F491621

General Info

Members Datasets Scaffolds Average Seq Length
1204 463 2408 381

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10053993|Ga0207648_100539932
Length 426
Sequence MAMVVVTMDVPAIAVAATENVLSAQLLTLLLGVRLRGFYDLVIGGPMKHGALVGILAGQLIAGLALADVNVGVTLSATGPAASLGIPEKNTIEMLPTTVAGQKVNWIILDDGSDTTKAVTNTKKLIAEDKVDVIVGSTVTPNSLAMIDVVADAETPMISMAASARIVDPTNPKTKWVFKTPQNDALMADAIAVHMKANGVKTMGYIGFNDAYGDGWLAEIKRSAQTAGIKVVAEEKYNRSDASVTGQVLKLVAANPDAILIGASGTPGATPQKELVGRNYKGKIYQTHGVANPDFLRVVGKDGNGTLLPIGPMLVYEQLPDSNPIKKVAAEYITQYEAKYGKGSRTTFGGHGYDAYLLLAKAIPEALKKAKPGTKEFRVALRDALETSNVVGAHGVFVMGPQEHNGLDNRARVMIRIDNGQWVLAK

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
355 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
376 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
377 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
382 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
383 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
384 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
385 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
386 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
387 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
388 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
389 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
390 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
391 2519103095 Burkholderia sp. KJ006 Isolate Nodule
392 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
393 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
394 2547132512 Azospira oryzae 6a3 Isolate Unclassified
395 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
396 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
397 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
398 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
399 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
400 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
401 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
402 2643221621 Achromobacter sp. Root83 Isolate Unclassified
403 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
404 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
405 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
406 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
407 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
408 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
409 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
410 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
411 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
412 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
413 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
414 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
415 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
416 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
417 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
418 2818991450 Burkholderia sp. 604 Isolate Unclassified
419 2818991452 Burkholderia cepacia 561 Isolate Unclassified
420 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
421 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
422 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
423 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
424 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
425 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
426 2858950400 Achromobacter sp. K91 Isolate Unclassified
427 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
428 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
429 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
430 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
431 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
432 2904564687 Burkholderia sp. 571 Isolate Unclassified
433 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
434 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
435 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
436 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
437 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
438 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
439 2928163908 Burkholderia sp. 567 Isolate Unclassified
440 2928170801 Burkholderia sp. 572 Isolate Unclassified
441 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
442 2928536128 Burkholderia sola 565 Isolate Unclassified
443 2941479691
444 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
445 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
446 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
447 639633007 Azoarcus olearius BH72 Isolate Unclassified
448 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
449 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
450 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
451 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
452 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
453 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
454 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
455 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
456 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
457 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
458 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
459 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
460 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
461 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
462 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
463 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 0.08
Isolates 6.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 1.33
Rhizoplane 4.73
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 0.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10053993 3300026089 Bacteria 3511
2 JGI24746J21847_1011793 3300001977 Bacteria 1283
3 JGI24740J21852_10005037 3300001979 Bacteria 5610
4 JGI24739J22299_10006235 3300001989 Bacteria 4501
5 JGI24739J22299_10011344 3300001989 Bacteria 3291
6 JGI24739J22299_10030746 3300001989 Bacteria 1860
7 JGI24737J22298_10006627 3300001990 Bacteria 3945
8 JGI24737J22298_10009084 3300001990 Bacteria 3312
9 JGI24737J22298_10010007 3300001990 Bacteria 3139
10 JGI24735J21928_10000162 3300002067 Bacteria 23762
11 JGI24735J21928_10000241 3300002067 Bacteria 19210
12 JGI24735J21928_10003000 3300002067 Bacteria 5802
13 JGI24735J21928_10005356 3300002067 Bacteria 4258
14 JGI24738J21930_10005721 3300002075 Bacteria 2958
15 JGI25156J39149_1000310 3300002705 Bacteria 32338
16 JGI25156J39149_1000485 3300002705 Bacteria 23858
17 JGI25156J39149_1000815 3300002705 Bacteria 15924
18 rootL2_10004490 3300003322 Bacteria 3204
19 rootL2_10011098 3300003322 Bacteria 8546
20 rootH1_10085817 3300003323 Bacteria 2065
21 JGI25160J50197_1000016 3300003354 Bacteria 247819
22 Ga0006556J51387_1038757 3300003479 Bacteria 1205
23 Ga0055533_1000331 3300003756 Bacteria 20806
24 Ga0055533_1001876 3300003756 Bacteria 5234
25 Ga0055532_1000022 3300003758 Bacteria 248737
26 Ga0055532_1000999 3300003758 Bacteria 8886
27 Ga0055532_1002396 3300003758 Bacteria 3934
28 Ga0055532_1003782 3300003758 Bacteria 2460
29 Ga0055527_1000016 3300003760 Bacteria 248736
30 Ga0055527_1000645 3300003760 Bacteria 10581
31 Ga0055535_1000017 3300003761 Bacteria 248735
32 Ga0055535_1001611 3300003761 Bacteria 10581
33 Ga0055535_1001620 3300003761 Bacteria 10545
34 Ga0055542_1000030 3300003762 Bacteria 248717
35 Ga0055542_1001587 3300003762 Bacteria 10545
36 Ga0055542_1002572 3300003762 Bacteria 5776
37 Ga0055529_1000033 3300003763 Bacteria 248734
38 Ga0055529_1001023 3300003763 Bacteria 13397
39 Ga0055528_1007441 3300003790 Bacteria 4841
40 Ga0058692_1001054 3300003856 Bacteria 10776
41 Ga0065165_1000875 3300005262 Bacteria 38986
42 Ga0065715_10154227 3300005293 Bacteria 1695
43 Ga0070658_10020490 3300005327 Bacteria 5300
44 Ga0070658_10024613 3300005327 Bacteria 4828
45 Ga0070658_10027656 3300005327 Bacteria 4550
46 Ga0070658_10036786 3300005327 Bacteria 3946
47 Ga0070658_10053362 3300005327 Bacteria 3281
48 Ga0070658_10102762 3300005327 Bacteria 2363
49 Ga0070676_10000586 3300005328 Bacteria 17625
50 Ga0070676_10089032 3300005328 Bacteria 1887
51 Ga0070676_10094565 3300005328 Bacteria 1836
52 Ga0070683_100005154 3300005329 Bacteria 10869
53 Ga0070683_100006341 3300005329 Bacteria 9919
54 Ga0070683_100013442 3300005329 Bacteria 7139
55 Ga0070683_100034936 3300005329 Bacteria 4595
56 Ga0070690_100043230 3300005330 Bacteria 2856
57 Ga0070690_100061114 3300005330 Bacteria 2426
58 Ga0070670_100006292 3300005331 Bacteria 10052
59 Ga0070670_100010440 3300005331 Bacteria 7926
60 Ga0070670_100015920 3300005331 Bacteria 6454
61 Ga0070670_100032122 3300005331 Bacteria 4521
62 Ga0070670_100109217 3300005331 Bacteria 2383
63 Ga0070670_100125476 3300005331 Bacteria 2215
64 Ga0070677_10000147 3300005333 Bacteria 23782
65 Ga0070677_10000950 3300005333 Bacteria 9386
66 Ga0068869_100002581 3300005334 Bacteria 10938
67 Ga0068869_100004238 3300005334 Bacteria 8897
68 Ga0068869_100008639 3300005334 Bacteria 6579
69 Ga0068869_100016878 3300005334 Bacteria 4934
70 Ga0068869_100020996 3300005334 Bacteria 4488
71 Ga0068869_100021186 3300005334 Bacteria 4468
72 Ga0070666_10006093 3300005335 Bacteria 7411
73 Ga0070666_10033752 3300005335 Bacteria 3389
74 Ga0070666_10039705 3300005335 Bacteria 3138
75 Ga0070666_10068898 3300005335 Bacteria 2405
76 Ga0070680_100007735 3300005336 Bacteria 8191
77 Ga0070680_100115258 3300005336 Bacteria 2239
78 Ga0068868_100008523 3300005338 Bacteria 7341
79 Ga0068868_100040309 3300005338 Bacteria 3635
80 Ga0068868_100083558 3300005338 Bacteria 2564
81 Ga0068868_100087613 3300005338 Bacteria 2504
82 Ga0068868_100211047 3300005338 Bacteria 1622
83 Ga0068868_100255748 3300005338 Bacteria 1475
84 Ga0070660_100000108 3300005339 Bacteria 51014
85 Ga0070660_100006646 3300005339 Bacteria 8022
86 Ga0070660_100021779 3300005339 Bacteria 4730
87 Ga0070660_100038176 3300005339 Bacteria 3644
88 Ga0070660_100124106 3300005339 Bacteria 2062
89 Ga0070689_100033559 3300005340 Bacteria 3911
90 Ga0070689_100076224 3300005340 Bacteria 2627
91 Ga0070687_100016228 3300005343 Bacteria 3390
92 Ga0070687_100038716 3300005343 Bacteria 2392
93 Ga0070661_100001352 3300005344 Bacteria 17151
94 Ga0070661_100010105 3300005344 Bacteria 6556
95 Ga0070661_100014151 3300005344 Bacteria 5619
96 Ga0070661_100037763 3300005344 Bacteria 3514
97 Ga0070661_100047409 3300005344 Bacteria 3144
98 Ga0070661_100077110 3300005344 Bacteria 2456
99 Ga0070661_100142053 3300005344 Bacteria 1810
100 Ga0070692_10075234 3300005345 Bacteria 1808
101 Ga0070668_100003337 3300005347 Bacteria 11837
102 Ga0070668_100003380 3300005347 Bacteria 11769
103 Ga0070668_100007343 3300005347 Bacteria 8172
104 Ga0070668_100010138 3300005347 Bacteria 6986
105 Ga0070668_100013434 3300005347 Bacteria 6112
106 Ga0070668_100019925 3300005347 Bacteria 5055
107 Ga0070668_100023352 3300005347 Bacteria 4677
108 Ga0070668_100035467 3300005347 Bacteria 3803
109 Ga0070668_100149220 3300005347 Bacteria 1889
110 Ga0070669_100006798 3300005353 Bacteria 8229
111 Ga0070669_100034853 3300005353 Bacteria 3644
112 Ga0070669_100101833 3300005353 Bacteria 2168
113 Ga0070669_100217881 3300005353 Bacteria 1508
114 Ga0070675_100003409 3300005354 Bacteria 12038
115 Ga0070675_100004470 3300005354 Bacteria 10666
116 Ga0070675_100007104 3300005354 Bacteria 8623
117 Ga0070675_100009671 3300005354 Bacteria 7507
118 Ga0070675_100011427 3300005354 Bacteria 6949
119 Ga0070675_100052154 3300005354 Bacteria 3362
120 Ga0070675_100084438 3300005354 Bacteria 2652
121 Ga0070675_100097990 3300005354 Bacteria 2466
122 Ga0070671_100002148 3300005355 Bacteria 15230
123 Ga0070671_100002235 3300005355 Bacteria 14943
124 Ga0070671_100002777 3300005355 Bacteria 13599
125 Ga0070671_100004290 3300005355 Bacteria 11282
126 Ga0070671_100007470 3300005355 Bacteria 8737
127 Ga0070671_100035756 3300005355 Bacteria 4115
128 Ga0070671_100059174 3300005355 Bacteria 3188
129 Ga0070671_100084613 3300005355 Bacteria 2652
130 Ga0070671_100085183 3300005355 Bacteria 2644
131 Ga0070671_100182876 3300005355 Bacteria 1775
132 Ga0070674_100000109 3300005356 Bacteria 38448
133 Ga0070674_100009365 3300005356 Bacteria 5865
134 Ga0070674_100012642 3300005356 Bacteria 5189
135 Ga0070674_100035000 3300005356 Bacteria 3360
136 Ga0070674_100113592 3300005356 Bacteria 1993
137 Ga0070673_100000814 3300005364 Bacteria 17469
138 Ga0070673_100002188 3300005364 Bacteria 11805
139 Ga0070673_100017811 3300005364 Bacteria 5061
140 Ga0070673_100075921 3300005364 Bacteria 2712
141 Ga0070673_100103956 3300005364 Bacteria 2344
142 Ga0070688_100005571 3300005365 Bacteria 6645
143 Ga0070688_100036468 3300005365 Bacteria 2991
144 Ga0070659_100000070 3300005366 Bacteria 79815
145 Ga0070659_100002205 3300005366 Bacteria 13848
146 Ga0070659_100019281 3300005366 Bacteria 5165
147 Ga0070659_100034631 3300005366 Bacteria 3928
148 Ga0070667_100003743 3300005367 Bacteria 12915
149 Ga0070667_100005378 3300005367 Bacteria 10695
150 Ga0070667_100006224 3300005367 Bacteria 9932
151 Ga0070667_100006231 3300005367 Bacteria 9925
152 Ga0070667_100007026 3300005367 Bacteria 9358
153 Ga0070667_100038936 3300005367 Bacteria 3986
154 Ga0070667_100123366 3300005367 Bacteria 2255
155 Ga0070701_10081098 3300005438 Bacteria 1756
156 Ga0070701_10103958 3300005438 Bacteria 1577
157 Ga0070705_100047209 3300005440 Bacteria 2488
158 Ga0070700_100062483 3300005441 Bacteria 2353
159 Ga0070708_100000726 3300005445 Bacteria 25018
160 Ga0070708_100007372 3300005445 Bacteria 8801
161 Ga0070708_100128680 3300005445 Bacteria 2342
162 Ga0070708_100170455 3300005445 Bacteria 2032
163 Ga0070708_100425618 3300005445 Bacteria 1252
164 Ga0070663_100007612 3300005455 Bacteria 6606
165 Ga0070663_100012949 3300005455 Bacteria 5296
166 Ga0070663_100022630 3300005455 Bacteria 4205
167 Ga0070663_100044048 3300005455 Bacteria 3144
168 Ga0070663_100121218 3300005455 Bacteria 1975
169 Ga0070663_100135370 3300005455 Bacteria 1875
170 Ga0070678_100001654 3300005456 Bacteria 11955
171 Ga0070678_100003347 3300005456 Bacteria 8926
172 Ga0070678_100010414 3300005456 Bacteria 5679
173 Ga0070678_100017525 3300005456 Bacteria 4615
174 Ga0070678_100034995 3300005456 Bacteria 3502
175 Ga0070678_100243727 3300005456 Bacteria 1504
176 Ga0070662_100000827 3300005457 Bacteria 19059
177 Ga0070662_100031859 3300005457 Bacteria 3703
178 Ga0070662_100034579 3300005457 Bacteria 3564
179 Ga0070681_10005152 3300005458 Bacteria 12610
180 Ga0068867_100001260 3300005459 Bacteria 17478
181 Ga0068867_100008463 3300005459 Bacteria 7258
182 Ga0068867_100161548 3300005459 Bacteria 1767
183 Ga0068867_100182335 3300005459 Bacteria 1670
184 Ga0068867_100191458 3300005459 Bacteria 1632
185 Ga0070685_10002746 3300005466 Bacteria 9020
186 Ga0070685_10020281 3300005466 Bacteria 3597
187 Ga0070685_10059431 3300005466 Bacteria 2232
188 Ga0070685_10225154 3300005466 Bacteria 1231
189 Ga0070706_100035270 3300005467 Bacteria 4620
190 Ga0070707_100048762 3300005468 Bacteria 4058
191 Ga0070707_100374483 3300005468 Bacteria 1383
192 Ga0070698_100120262 3300005471 Bacteria 2587
193 Ga0070699_100117152 3300005518 Bacteria 2341
194 Ga0070699_100246753 3300005518 Bacteria 1595
195 Ga0070684_100006125 3300005535 Bacteria 9269
196 Ga0070684_100008902 3300005535 Bacteria 7878
197 Ga0070684_100012948 3300005535 Bacteria 6707
198 Ga0070684_100181480 3300005535 Bacteria 1914
199 Ga0068853_100005992 3300005539 Bacteria 9612
200 Ga0068853_100009311 3300005539 Bacteria 7920
201 Ga0068853_100019086 3300005539 Bacteria 5680
202 Ga0068853_100023650 3300005539 Bacteria 5146
203 Ga0070672_100001074 3300005543 Bacteria 16639
204 Ga0070672_100001704 3300005543 Bacteria 13708
205 Ga0070672_100005096 3300005543 Bacteria 8667
206 Ga0070672_100012555 3300005543 Bacteria 5954
207 Ga0070672_100046284 3300005543 Bacteria 3370
208 Ga0070672_100078445 3300005543 Bacteria 2642
209 Ga0070672_100078605 3300005543 Bacteria 2640
210 Ga0070672_100287365 3300005543 Bacteria 1392
211 Ga0070686_100004725 3300005544 Bacteria 7509
212 Ga0070693_100009342 3300005547 Bacteria 4874
213 Ga0070693_100023224 3300005547 Bacteria 3312
214 Ga0070665_100003313 3300005548 Bacteria 17249
215 Ga0070665_100005444 3300005548 Bacteria 13130
216 Ga0070665_100006892 3300005548 Bacteria 11550
217 Ga0070665_100010582 3300005548 Bacteria 9339
218 Ga0070665_100092825 3300005548 Bacteria 3023
219 Ga0070665_100108872 3300005548 Bacteria 2773
220 Ga0070665_100144829 3300005548 Bacteria 2379
221 Ga0070665_100262285 3300005548 Bacteria 1729
222 Ga0068855_100000618 3300005563 Bacteria 43673
223 Ga0068855_100059864 3300005563 Bacteria 4455
224 Ga0068855_100091228 3300005563 Bacteria 3515
225 Ga0068855_100114630 3300005563 Bacteria 3090
226 Ga0068855_100159283 3300005563 Bacteria 2563
227 Ga0068855_100262211 3300005563 Bacteria 1925
228 Ga0070664_100008432 3300005564 Bacteria 8334
229 Ga0070664_100051283 3300005564 Bacteria 3493
230 Ga0070664_100104242 3300005564 Bacteria 2469
231 Ga0068857_100007291 3300005577 Bacteria 9524
232 Ga0068857_100014197 3300005577 Bacteria 6936
233 Ga0068857_100016044 3300005577 Bacteria 6562
234 Ga0068857_100086979 3300005577 Bacteria 2795
235 Ga0068854_100022298 3300005578 Bacteria 4310
236 Ga0068854_100022735 3300005578 Bacteria 4277
237 Ga0068854_100061024 3300005578 Bacteria 2730
238 Ga0068856_100000093 3300005614 Bacteria 84752
239 Ga0068856_100022002 3300005614 Bacteria 6199
240 Ga0068856_100125110 3300005614 Bacteria 2574
241 Ga0068852_100000265 3300005616 Bacteria 35028
242 Ga0068852_100004707 3300005616 Bacteria 9679
243 Ga0068852_100011098 3300005616 Bacteria 6765
244 Ga0068852_100029990 3300005616 Bacteria 4473
245 Ga0068852_100033803 3300005616 Bacteria 4250
246 Ga0068852_100060839 3300005616 Bacteria 3280
247 Ga0068852_100141132 3300005616 Bacteria 2229
248 Ga0068852_100307005 3300005616 Bacteria 1537
249 Ga0068859_100002465 3300005617 Bacteria 18831
250 Ga0068859_100020875 3300005617 Bacteria 6573
251 Ga0068859_100092457 3300005617 Bacteria 3076
252 Ga0068859_100168399 3300005617 Bacteria 2271
253 Ga0068859_100284431 3300005617 Bacteria 1746
254 Ga0068864_100005694 3300005618 Bacteria 10215
255 Ga0068864_100011928 3300005618 Bacteria 7177
256 Ga0068864_100017340 3300005618 Bacteria 6002
257 Ga0068864_100045429 3300005618 Bacteria 3768
258 Ga0068864_100108060 3300005618 Bacteria 2475
259 Ga0068864_100354794 3300005618 Bacteria 1384
260 Ga0068864_100464758 3300005618 Bacteria 1212
261 Ga0068866_10001528 3300005718 Bacteria 9838
262 Ga0068866_10036134 3300005718 Bacteria 2418
263 Ga0068861_100003054 3300005719 Bacteria 11054
264 Ga0068861_100033420 3300005719 Bacteria 3794
265 Ga0068861_100037238 3300005719 Bacteria 3616
266 Ga0068861_100044788 3300005719 Bacteria 3328
267 Ga0068861_100045459 3300005719 Bacteria 3306
268 Ga0068861_100110879 3300005719 Bacteria 2198
269 Ga0068851_10001117 3300005834 Bacteria 11611
270 Ga0068851_10002821 3300005834 Bacteria 7659
271 Ga0068851_10025333 3300005834 Bacteria 2909
272 Ga0068851_10057935 3300005834 Bacteria 1979
273 Ga0068870_10001406 3300005840 Bacteria 9708
274 Ga0068870_10015874 3300005840 Bacteria 3585
275 Ga0068870_10038307 3300005840 Bacteria 2475
276 Ga0068863_100002185 3300005841 Bacteria 19403
277 Ga0068863_100018376 3300005841 Bacteria 6691
278 Ga0068863_100020623 3300005841 Bacteria 6299
279 Ga0068863_100024582 3300005841 Bacteria 5744
280 Ga0068863_100032838 3300005841 Bacteria 4945
281 Ga0068863_100052723 3300005841 Bacteria 3854
282 Ga0068863_100077160 3300005841 Bacteria 3153
283 Ga0068863_100118397 3300005841 Bacteria 2524
284 Ga0068863_100129344 3300005841 Bacteria 2410
285 Ga0068863_100154888 3300005841 Bacteria 2194
286 Ga0068858_100003435 3300005842 Bacteria 15741
287 Ga0068858_100005392 3300005842 Bacteria 12533
288 Ga0068858_100005719 3300005842 Bacteria 12151
289 Ga0068858_100009830 3300005842 Bacteria 9100
290 Ga0068858_100010459 3300005842 Bacteria 8789
291 Ga0068858_100020675 3300005842 Bacteria 6148
292 Ga0068858_100030219 3300005842 Bacteria 5032
293 Ga0068858_100034811 3300005842 Bacteria 4671
294 Ga0068858_100396618 3300005842 Bacteria 1325
295 Ga0068860_100003281 3300005843 Bacteria 16651
296 Ga0068860_100004709 3300005843 Bacteria 13920
297 Ga0068860_100020794 3300005843 Bacteria 6358
298 Ga0068860_100031689 3300005843 Bacteria 5082
299 Ga0068860_100033805 3300005843 Bacteria 4906
300 Ga0068860_100042479 3300005843 Bacteria 4341
301 Ga0068860_100050709 3300005843 Bacteria 3950
302 Ga0068860_100051372 3300005843 Bacteria 3922
303 Ga0068862_100012971 3300005844 Bacteria 6893
304 Ga0068862_100025853 3300005844 Bacteria 4931
305 Ga0068862_100093050 3300005844 Bacteria 2628
306 Ga0081455_10003268 3300005937 Bacteria 18754
307 Ga0081455_10116880 3300005937 Bacteria 2109
308 Ga0081539_10023827 3300005985 Bacteria 3994
309 Ga0081539_10027215 3300005985 Bacteria 3627
310 Ga0075363_100062191 3300006048 Bacteria 2013
311 Ga0075364_10102625 3300006051 Bacteria 1904
312 Ga0075362_10012524 3300006177 Bacteria 3371
313 Ga0075367_10003415 3300006178 Bacteria 7568
314 Ga0075367_10005138 3300006178 Bacteria 6461
315 Ga0075367_10030966 3300006178 Bacteria 3071
316 Ga0075367_10122576 3300006178 Bacteria 1602
317 Ga0075369_10002321 3300006186 Bacteria 6766
318 Ga0075366_10044090 3300006195 Bacteria 2643
319 Ga0075366_10110854 3300006195 Bacteria 1650
320 Ga0097621_100007585 3300006237 Bacteria 7775
321 Ga0097621_100016593 3300006237 Bacteria 5571
322 Ga0097621_100025122 3300006237 Bacteria 4659
323 Ga0097621_100029264 3300006237 Bacteria 4349
324 Ga0097621_100082912 3300006237 Bacteria 2671
325 Ga0075370_10000157 3300006353 Bacteria 23226
326 Ga0075370_10000617 3300006353 Bacteria 13729
327 Ga0075370_10012187 3300006353 Bacteria 4537
328 Ga0075370_10035953 3300006353 Bacteria 2781
329 Ga0075370_10057366 3300006353 Bacteria 2213
330 Ga0075370_10080188 3300006353 Bacteria 1875
331 Ga0075370_10120898 3300006353 Bacteria 1524
332 Ga0068871_100014110 3300006358 Bacteria 5943
333 Ga0068871_100017513 3300006358 Bacteria 5424
334 Ga0068871_100029987 3300006358 Bacteria 4279
335 Ga0068871_100033032 3300006358 Bacteria 4093
336 Ga0068871_100226680 3300006358 Bacteria 1621
337 Ga0075428_100079945 3300006844 Bacteria 3568
338 Ga0075433_10032958 3300006852 Bacteria 4439
339 Ga0075433_10359690 3300006852 Bacteria 1286
340 Ga0075434_100017497 3300006871 Bacteria 6908
341 Ga0075434_100110940 3300006871 Bacteria 2753
342 Ga0075434_100223125 3300006871 Bacteria 1904
343 Ga0068865_100012656 3300006881 Bacteria 5317
344 Ga0068865_100033942 3300006881 Bacteria 3419
345 Ga0068865_100123612 3300006881 Bacteria 1928
346 Ga0097620_100002465 3300006931 Bacteria 18831
347 Ga0097620_100020876 3300006931 Bacteria 6573
348 Ga0097620_100092456 3300006931 Bacteria 3076
349 Ga0097620_100168400 3300006931 Bacteria 2271
350 Ga0097620_100284444 3300006931 Bacteria 1746
351 Ga0075435_100117035 3300007076 Bacteria 2221
352 Ga0105251_10000671 3300009011 Bacteria 31552
353 Ga0105251_10001447 3300009011 Bacteria 20403
354 Ga0105251_10032505 3300009011 Bacteria 2599
355 Ga0105240_10002436 3300009093 Bacteria 29913
356 Ga0105240_10016538 3300009093 Bacteria 9985
357 Ga0105240_10022166 3300009093 Bacteria 8427
358 Ga0105240_10045943 3300009093 Bacteria 5537
359 Ga0105240_10048690 3300009093 Bacteria 5355
360 Ga0105240_10205295 3300009093 Bacteria 2307
361 Ga0111539_10011146 3300009094 Bacteria 11307
362 Ga0105245_10018737 3300009098 Bacteria 6055
363 Ga0105245_10107659 3300009098 Bacteria 2588
364 Ga0105245_10282422 3300009098 Bacteria 1623
365 Ga0105247_10007966 3300009101 Bacteria 6473
366 Ga0105247_10110227 3300009101 Bacteria 1771
367 Ga0105241_10040157 3300009174 Bacteria 3532
368 Ga0105242_10132477 3300009176 Bacteria 2153
369 Ga0105248_10003137 3300009177 Bacteria 18293
370 Ga0105248_10017241 3300009177 Bacteria 7958
371 Ga0105248_10018724 3300009177 Bacteria 7656
372 Ga0105237_10091876 3300009545 Bacteria 3025
373 Ga0105237_10180232 3300009545 Bacteria 2113
374 Ga0105237_10290995 3300009545 Bacteria 1636
375 Ga0105238_10041126 3300009551 Bacteria 4682
376 Ga0105249_10147133 3300009553 Bacteria 2264
377 Ga0105249_10163717 3300009553 Bacteria 2152
378 Ga0105249_10296402 3300009553 Bacteria 1620
379 Ga0105239_10001161 3300010375 Bacteria 36164
380 Ga0105239_10497661 3300010375 Bacteria 1385
381 Ga0105239_10676282 3300010375 Bacteria 1180
382 Ga0105246_10029890 3300011119 Bacteria 3593
383 Ga0157373_10000777 3300013100 Bacteria 24608
384 Ga0157373_10010136 3300013100 Bacteria 6945
385 Ga0157373_10043636 3300013100 Bacteria 3203
386 Ga0157371_10008425 3300013102 Bacteria 8212
387 Ga0157370_10005771 3300013104 Bacteria 13830
388 Ga0157370_10019561 3300013104 Bacteria 6786
389 Ga0157369_10001395 3300013105 Bacteria 29676
390 Ga0157369_10006755 3300013105 Bacteria 13242
391 Ga0157369_10008403 3300013105 Bacteria 11839
392 Ga0157369_10025742 3300013105 Bacteria 6527
393 Ga0157369_10042581 3300013105 Bacteria 4952
394 Ga0157369_10325518 3300013105 Bacteria 1597
395 Ga0157374_10001040 3300013296 Bacteria 24063
396 Ga0157374_10007000 3300013296 Bacteria 9599
397 Ga0157374_10008031 3300013296 Bacteria 9020
398 Ga0157374_10017774 3300013296 Bacteria 6265
399 Ga0157374_10029253 3300013296 Bacteria 4986
400 Ga0157374_10313103 3300013296 Bacteria 1554
401 Ga0157378_10005031 3300013297 Bacteria 11605
402 Ga0157378_10006031 3300013297 Bacteria 10616
403 Ga0157378_10014439 3300013297 Bacteria 6915
404 Ga0157378_10042441 3300013297 Bacteria 4037
405 Ga0157378_10069600 3300013297 Bacteria 3157
406 Ga0157378_10091530 3300013297 Bacteria 2765
407 Ga0157378_10105755 3300013297 Bacteria 2574
408 Ga0157378_10165826 3300013297 Bacteria 2069
409 Ga0163162_10004087 3300013306 Bacteria 14005
410 Ga0163162_10030122 3300013306 Bacteria 5376
411 Ga0163162_10043717 3300013306 Bacteria 4486
412 Ga0163162_10070653 3300013306 Bacteria 3543
413 Ga0163162_10089123 3300013306 Bacteria 3165
414 Ga0163162_10095019 3300013306 Bacteria 3067
415 Ga0163162_10308831 3300013306 Bacteria 1714
416 Ga0163162_10448565 3300013306 Bacteria 1422
417 Ga0157372_10000852 3300013307 Bacteria 33078
418 Ga0157372_10001735 3300013307 Bacteria 23652
419 Ga0157372_10022569 3300013307 Bacteria 6811
420 Ga0157372_10029653 3300013307 Bacteria 5976
421 Ga0157375_10033547 3300013308 Bacteria 4878
422 Ga0157375_10180955 3300013308 Bacteria 2259
423 Ga0157375_10501181 3300013308 Bacteria 1378
424 Ga0163163_10001673 3300014325 Bacteria 18702
425 Ga0163163_10017149 3300014325 Bacteria 6747
426 Ga0163163_10037547 3300014325 Bacteria 4713
427 Ga0163163_10054748 3300014325 Bacteria 3942
428 Ga0163163_10074747 3300014325 Bacteria 3381
429 Ga0163163_10184228 3300014325 Bacteria 2135
430 Ga0157380_10085914 3300014326 Bacteria 2584
431 Ga0157380_10230269 3300014326 Bacteria 1664
432 Ga0182008_10012750 3300014497 Bacteria 4432
433 Ga0157377_10001479 3300014745 Bacteria 10164
434 Ga0157377_10006198 3300014745 Bacteria 5687
435 Ga0157379_10000219 3300014968 Bacteria 44603
436 Ga0157379_10003465 3300014968 Bacteria 13354
437 Ga0157379_10015827 3300014968 Bacteria 6627
438 Ga0157379_10032158 3300014968 Bacteria 4676
439 Ga0157379_10065986 3300014968 Bacteria 3235
440 Ga0157379_10369171 3300014968 Bacteria 1316
441 Ga0157376_10025185 3300014969 Bacteria 4683
442 Ga0157376_10031030 3300014969 Bacteria 4274
443 Ga0157376_10116895 3300014969 Bacteria 2357
444 Ga0182007_10000465 3300015262 Bacteria 24511
445 Ga0163161_10008715 3300017792 Bacteria 7015
446 Ga0163161_10020759 3300017792 Bacteria 4611
447 Ga0163161_10035616 3300017792 Bacteria 3563
448 Ga0163161_10200499 3300017792 Bacteria 1538
449 Ga0209566_100264 3300025225 Bacteria 49372
450 Ga0209674_100017 3300025226 Bacteria 689087
451 Ga0209674_100291 3300025226 Bacteria 35684
452 Ga0209674_101162 3300025226 Bacteria 7615
453 Ga0209672_100001 3300025228 Bacteria 2828210
454 Ga0209672_100115 3300025228 Bacteria 89213
455 Ga0209672_100136 3300025228 Bacteria 72753
456 Ga0209147_100022 3300025229 Bacteria 443906
457 Ga0209147_100164 3300025229 Bacteria 90422
458 Ga0209147_100215 3300025229 Bacteria 60346
459 Ga0209147_100360 3300025229 Bacteria 32565
460 Ga0209563_101730 3300025230 Bacteria 5514
461 Ga0207427_100419 3300025231 Bacteria 24329
462 Ga0209258_100033 3300025242 Bacteria 443845
463 Ga0209258_100261 3300025242 Bacteria 90726
464 Ga0209258_100271 3300025242 Bacteria 89095
465 Ga0209148_1000046 3300025254 Bacteria 443881
466 Ga0209148_1000104 3300025254 Bacteria 214254
467 Ga0209148_1000609 3300025254 Bacteria 32035
468 Ga0209759_1000180 3300025256 Bacteria 103458
469 Ga0209759_1000231 3300025256 Bacteria 83320
470 Ga0209759_1000568 3300025256 Bacteria 37118
471 Ga0209759_1007514 3300025256 Bacteria 3496
472 Ga0209233_1000050 3300025261 Bacteria 450736
473 Ga0209565_1003571 3300025263 Bacteria 4980
474 Ga0209455_1000038 3300025272 Bacteria 443899
475 Ga0209455_1000097 3300025272 Bacteria 214136
476 Ga0209673_1000124 3300025273 Bacteria 169015
477 Ga0209676_1003712 3300025292 Bacteria 9109
478 Ga0209564_1001909 3300025295 Bacteria 18634
479 Ga0209564_1010372 3300025295 Bacteria 4299
480 Ga0209050_1006245 3300025298 Bacteria 7138
481 Ga0207426_1000007 3300025302 Bacteria 971011
482 Ga0207426_1001933 3300025302 Bacteria 14885
483 Ga0207697_10000241 3300025315 Bacteria 29902
484 Ga0207697_10000378 3300025315 Bacteria 24945
485 Ga0207697_10047102 3300025315 Bacteria 1777
486 Ga0207656_10003936 3300025321 Bacteria 5141
487 Ga0207656_10007815 3300025321 Bacteria 3915
488 Ga0207656_10083753 3300025321 Bacteria 1437
489 Ga0207713_1000064 3300025735 Bacteria 200324
490 Ga0207682_10000106 3300025893 Bacteria 38190
491 Ga0207682_10001272 3300025893 Bacteria 11576
492 Ga0207682_10001404 3300025893 Bacteria 11131
493 Ga0207682_10001758 3300025893 Bacteria 9944
494 Ga0207682_10026844 3300025893 Bacteria 2291
495 Ga0207642_10082255 3300025899 Bacteria 1567
496 Ga0207710_10055288 3300025900 Bacteria 1789
497 Ga0207688_10000062 3300025901 Bacteria 38797
498 Ga0207688_10002838 3300025901 Bacteria 9414
499 Ga0207688_10112938 3300025901 Bacteria 1579
500 Ga0207688_10132486 3300025901 Bacteria 1462
501 Ga0207680_10003378 3300025903 Bacteria 7516
502 Ga0207680_10006222 3300025903 Bacteria 5760
503 Ga0207680_10025862 3300025903 Bacteria 3243
504 Ga0207680_10030104 3300025903 Bacteria 3057
505 Ga0207680_10031279 3300025903 Bacteria 3013
506 Ga0207680_10095925 3300025903 Bacteria 1896
507 Ga0207647_10000160 3300025904 Bacteria 53192
508 Ga0207647_10001190 3300025904 Bacteria 20055
509 Ga0207647_10005355 3300025904 Bacteria 9428
510 Ga0207647_10006047 3300025904 Bacteria 8824
511 Ga0207647_10030737 3300025904 Bacteria 3462
512 Ga0207645_10000643 3300025907 Bacteria 29006
513 Ga0207645_10000947 3300025907 Bacteria 24105
514 Ga0207645_10001010 3300025907 Bacteria 23268
515 Ga0207645_10003404 3300025907 Bacteria 12094
516 Ga0207645_10006139 3300025907 Bacteria 8631
517 Ga0207645_10007374 3300025907 Bacteria 7777
518 Ga0207645_10008382 3300025907 Bacteria 7211
519 Ga0207645_10024574 3300025907 Bacteria 3904
520 Ga0207645_10080836 3300025907 Bacteria 2083
521 Ga0207645_10151205 3300025907 Bacteria 1515
522 Ga0207643_10000555 3300025908 Bacteria 23880
523 Ga0207643_10000994 3300025908 Bacteria 16917
524 Ga0207643_10004775 3300025908 Bacteria 7260
525 Ga0207643_10030729 3300025908 Bacteria 2991
526 Ga0207705_10052854 3300025909 Bacteria 2926
527 Ga0207684_10002166 3300025910 Bacteria 20113
528 Ga0207684_10024612 3300025910 Bacteria 5133
529 Ga0207654_10040521 3300025911 Bacteria 2625
530 Ga0207707_10019848 3300025912 Bacteria 5867
531 Ga0207695_10006665 3300025913 Bacteria 14905
532 Ga0207695_10036528 3300025913 Bacteria 5311
533 Ga0207695_10412696 3300025913 Bacteria 1235
534 Ga0207671_10052511 3300025914 Bacteria 3021
535 Ga0207671_10071949 3300025914 Bacteria 2580
536 Ga0207662_10010347 3300025918 Bacteria 5149
537 Ga0207662_10017900 3300025918 Bacteria 4013
538 Ga0207657_10001682 3300025919 Bacteria 23847
539 Ga0207657_10013412 3300025919 Bacteria 8042
540 Ga0207657_10030166 3300025919 Bacteria 4926
541 Ga0207657_10054821 3300025919 Bacteria 3445
542 Ga0207649_10012511 3300025920 Bacteria 4711
543 Ga0207649_10014014 3300025920 Bacteria 4486
544 Ga0207649_10027271 3300025920 Bacteria 3350
545 Ga0207649_10029848 3300025920 Bacteria 3223
546 Ga0207649_10069468 3300025920 Bacteria 2243
547 Ga0207652_10034716 3300025921 Bacteria 4252
548 Ga0207646_10009371 3300025922 Bacteria 9677
549 Ga0207646_10270335 3300025922 Bacteria 1536
550 Ga0207681_10019385 3300025923 Bacteria 4297
551 Ga0207694_10019888 3300025924 Bacteria 5079
552 Ga0207694_10209071 3300025924 Bacteria 1589
553 Ga0207694_10226019 3300025924 Bacteria 1527
554 Ga0207650_10002778 3300025925 Bacteria 12087
555 Ga0207650_10004595 3300025925 Bacteria 9440
556 Ga0207650_10004708 3300025925 Bacteria 9322
557 Ga0207650_10016518 3300025925 Bacteria 5162
558 Ga0207650_10057057 3300025925 Bacteria 2903
559 Ga0207650_10107662 3300025925 Bacteria 2154
560 Ga0207659_10001627 3300025926 Bacteria 13326
561 Ga0207659_10016723 3300025926 Bacteria 4780
562 Ga0207659_10036297 3300025926 Bacteria 3413
563 Ga0207659_10036463 3300025926 Bacteria 3406
564 Ga0207659_10040394 3300025926 Bacteria 3262
565 Ga0207659_10170752 3300025926 Bacteria 1715
566 Ga0207644_10002345 3300025931 Bacteria 12226
567 Ga0207644_10005166 3300025931 Bacteria 8524
568 Ga0207644_10006271 3300025931 Bacteria 7747
569 Ga0207644_10006648 3300025931 Bacteria 7535
570 Ga0207644_10015798 3300025931 Bacteria 5076
571 Ga0207644_10023527 3300025931 Bacteria 4221
572 Ga0207644_10025774 3300025931 Bacteria 4045
573 Ga0207644_10034330 3300025931 Bacteria 3548
574 Ga0207644_10057467 3300025931 Bacteria 2809
575 Ga0207644_10129872 3300025931 Bacteria 1927
576 Ga0207644_10245047 3300025931 Bacteria 1428
577 Ga0207644_10266992 3300025931 Bacteria 1370
578 Ga0207690_10000012 3300025932 Bacteria 269610
579 Ga0207690_10047939 3300025932 Bacteria 2837
580 Ga0207690_10065701 3300025932 Bacteria 2481
581 Ga0207690_10078695 3300025932 Bacteria 2295
582 Ga0207706_10000014 3300025933 Bacteria 177082
583 Ga0207706_10001235 3300025933 Bacteria 25741
584 Ga0207706_10005642 3300025933 Bacteria 11659
585 Ga0207706_10061497 3300025933 Bacteria 3307
586 Ga0207706_10143690 3300025933 Bacteria 2099
587 Ga0207706_10151102 3300025933 Bacteria 2042
588 Ga0207686_10037457 3300025934 Bacteria 2927
589 Ga0207670_10064043 3300025936 Bacteria 2518
590 Ga0207669_10006691 3300025937 Bacteria 5285
591 Ga0207669_10008073 3300025937 Bacteria 4924
592 Ga0207669_10008872 3300025937 Bacteria 4747
593 Ga0207669_10125381 3300025937 Bacteria 1753
594 Ga0207704_10008463 3300025938 Bacteria 4924
595 Ga0207704_10057591 3300025938 Bacteria 2388
596 Ga0207704_10068553 3300025938 Bacteria 2237
597 Ga0207665_10065201 3300025939 Bacteria 2476
598 Ga0207691_10000427 3300025940 Bacteria 41828
599 Ga0207691_10000453 3300025940 Bacteria 40520
600 Ga0207691_10004101 3300025940 Bacteria 14146
601 Ga0207691_10004432 3300025940 Bacteria 13608
602 Ga0207691_10004600 3300025940 Bacteria 13357
603 Ga0207691_10022987 3300025940 Bacteria 5872
604 Ga0207691_10024015 3300025940 Bacteria 5734
605 Ga0207691_10036867 3300025940 Bacteria 4529
606 Ga0207691_10050884 3300025940 Bacteria 3791
607 Ga0207691_10057558 3300025940 Bacteria 3537
608 Ga0207691_10130283 3300025940 Bacteria 2223
609 Ga0207691_10206803 3300025940 Bacteria 1706
610 Ga0207691_10288998 3300025940 Bacteria 1410
611 Ga0207711_10005592 3300025941 Bacteria 10626
612 Ga0207711_10033577 3300025941 Bacteria 4343
613 Ga0207711_10044709 3300025941 Bacteria 3782
614 Ga0207689_10001490 3300025942 Bacteria 22366
615 Ga0207689_10001602 3300025942 Bacteria 21425
616 Ga0207689_10002003 3300025942 Bacteria 19229
617 Ga0207689_10006947 3300025942 Bacteria 9952
618 Ga0207689_10009876 3300025942 Bacteria 8226
619 Ga0207689_10016553 3300025942 Bacteria 6240
620 Ga0207689_10053561 3300025942 Bacteria 3324
621 Ga0207689_10075975 3300025942 Bacteria 2762
622 Ga0207689_10083823 3300025942 Bacteria 2621
623 Ga0207661_10040145 3300025944 Bacteria 3677
624 Ga0207679_10015901 3300025945 Bacteria 4987
625 Ga0207679_10037248 3300025945 Bacteria 3456
626 Ga0207679_10123011 3300025945 Bacteria 2069
627 Ga0207679_10270107 3300025945 Bacteria 1454
628 Ga0207667_10004701 3300025949 Bacteria 16704
629 Ga0207667_10006720 3300025949 Bacteria 13895
630 Ga0207667_10078813 3300025949 Bacteria 3414
631 Ga0207667_10190424 3300025949 Bacteria 2105
632 Ga0207651_10014505 3300025960 Bacteria 4554
633 Ga0207651_10024084 3300025960 Bacteria 3758
634 Ga0207651_10108695 3300025960 Bacteria 2076
635 Ga0207712_10022690 3300025961 Bacteria 4136
636 Ga0207712_10056810 3300025961 Bacteria 2758
637 Ga0207668_10003043 3300025972 Bacteria 9830
638 Ga0207668_10009335 3300025972 Bacteria 5873
639 Ga0207668_10013796 3300025972 Bacteria 4987
640 Ga0207668_10018430 3300025972 Bacteria 4393
641 Ga0207668_10041736 3300025972 Bacteria 3103
642 Ga0207668_10048637 3300025972 Bacteria 2911
643 Ga0207668_10102863 3300025972 Bacteria 2126
644 Ga0207668_10208791 3300025972 Bacteria 1560
645 Ga0207640_10022876 3300025981 Bacteria 3748
646 Ga0207640_10034512 3300025981 Bacteria 3158
647 Ga0207640_10051886 3300025981 Bacteria 2669
648 Ga0207640_10074161 3300025981 Bacteria 2302
649 Ga0207640_10079323 3300025981 Bacteria 2237
650 Ga0207640_10081190 3300025981 Bacteria 2216
651 Ga0207658_10021436 3300025986 Bacteria 4486
652 Ga0207658_10038978 3300025986 Bacteria 3426
653 Ga0207658_10067663 3300025986 Bacteria 2691
654 Ga0207658_10071097 3300025986 Bacteria 2634
655 Ga0207658_10075476 3300025986 Bacteria 2565
656 Ga0207658_10098441 3300025986 Bacteria 2285
657 Ga0207658_10106611 3300025986 Bacteria 2206
658 Ga0207658_10194170 3300025986 Bacteria 1690
659 Ga0207658_10259461 3300025986 Bacteria 1480
660 Ga0207658_10355677 3300025986 Bacteria 1276
661 Ga0207677_10018111 3300026023 Bacteria 4220
662 Ga0207677_10036704 3300026023 Bacteria 3197
663 Ga0207677_10087343 3300026023 Bacteria 2257
664 Ga0207677_10094735 3300026023 Bacteria 2180
665 Ga0207677_10123124 3300026023 Bacteria 1955
666 Ga0207677_10270318 3300026023 Bacteria 1390
667 Ga0207703_10001278 3300026035 Bacteria 23343
668 Ga0207703_10003727 3300026035 Bacteria 12682
669 Ga0207703_10005904 3300026035 Bacteria 9813
670 Ga0207703_10019294 3300026035 Bacteria 5326
671 Ga0207703_10077042 3300026035 Bacteria 2767
672 Ga0207703_10162644 3300026035 Bacteria 1956
673 Ga0207703_10172017 3300026035 Bacteria 1906
674 Ga0207639_10017538 3300026041 Bacteria 5077
675 Ga0207639_10059228 3300026041 Bacteria 2949
676 Ga0207639_10061158 3300026041 Bacteria 2907
677 Ga0207639_10100845 3300026041 Bacteria 2333
678 Ga0207639_10147748 3300026041 Bacteria 1965
679 Ga0207639_10191095 3300026041 Bacteria 1749
680 Ga0207678_10000076 3300026067 Bacteria 78938
681 Ga0207678_10002409 3300026067 Bacteria 16996
682 Ga0207678_10014291 3300026067 Bacteria 6980
683 Ga0207678_10014424 3300026067 Bacteria 6948
684 Ga0207678_10018320 3300026067 Bacteria 6150
685 Ga0207678_10019124 3300026067 Bacteria 6013
686 Ga0207678_10048083 3300026067 Bacteria 3688
687 Ga0207678_10063147 3300026067 Bacteria 3182
688 Ga0207678_10144250 3300026067 Bacteria 2032
689 Ga0207708_10000721 3300026075 Bacteria 24881
690 Ga0207708_10089789 3300026075 Bacteria 2368
691 Ga0207708_10178950 3300026075 Bacteria 1683
692 Ga0207702_10002780 3300026078 Bacteria 16396
693 Ga0207702_10055110 3300026078 Bacteria 3371
694 Ga0207702_10105027 3300026078 Bacteria 2501
695 Ga0207702_10291767 3300026078 Bacteria 1545
696 Ga0207641_10009563 3300026088 Bacteria 7985
697 Ga0207641_10010972 3300026088 Bacteria 7426
698 Ga0207641_10017532 3300026088 Bacteria 5861
699 Ga0207641_10021295 3300026088 Bacteria 5330
700 Ga0207641_10046720 3300026088 Bacteria 3650
701 Ga0207641_10101091 3300026088 Bacteria 2540
702 Ga0207641_10178279 3300026088 Bacteria 1944
703 Ga0207641_10246708 3300026088 Bacteria 1666
704 Ga0207641_10283388 3300026088 Bacteria 1559
705 Ga0207648_10000622 3300026089 Bacteria 39723
706 Ga0207648_10001351 3300026089 Bacteria 27125
707 Ga0207648_10003119 3300026089 Bacteria 17501
708 Ga0207648_10008451 3300026089 Bacteria 9968
709 Ga0207648_10016411 3300026089 Bacteria 6767
710 Ga0207648_10059208 3300026089 Bacteria 3340
711 Ga0207676_10007978 3300026095 Bacteria 7526
712 Ga0207676_10019486 3300026095 Bacteria 4951
713 Ga0207676_10024327 3300026095 Bacteria 4480
714 Ga0207676_10100702 3300026095 Bacteria 2394
715 Ga0207676_10451433 3300026095 Bacteria 1212
716 Ga0207674_10002529 3300026116 Bacteria 23045
717 Ga0207674_10004238 3300026116 Bacteria 17310
718 Ga0207674_10007009 3300026116 Bacteria 13173
719 Ga0207674_10024335 3300026116 Bacteria 6473
720 Ga0207674_10052152 3300026116 Bacteria 4172
721 Ga0207674_10101207 3300026116 Bacteria 2862
722 Ga0207675_100000493 3300026118 Bacteria 38318
723 Ga0207675_100001240 3300026118 Bacteria 25485
724 Ga0207675_100007517 3300026118 Bacteria 10295
725 Ga0207675_100029496 3300026118 Bacteria 5112
726 Ga0207675_100090772 3300026118 Bacteria 2872
727 Ga0207675_100187450 3300026118 Bacteria 1983
728 Ga0207683_10000008 3300026121 Bacteria 164709
729 Ga0207683_10000133 3300026121 Bacteria 61157
730 Ga0207683_10000255 3300026121 Bacteria 47453
731 Ga0207683_10000504 3300026121 Bacteria 36089
732 Ga0207683_10003640 3300026121 Bacteria 13410
733 Ga0207683_10008887 3300026121 Bacteria 8564
734 Ga0207683_10012625 3300026121 Bacteria 7206
735 Ga0207683_10039146 3300026121 Bacteria 4135
736 Ga0207683_10159100 3300026121 Bacteria 2041
737 Ga0207698_10024032 3300026142 Bacteria 4269
738 Ga0207698_10026089 3300026142 Bacteria 4129
739 Ga0207698_10044355 3300026142 Bacteria 3340
740 Ga0207698_10132097 3300026142 Bacteria 2135
741 Ga0207698_10137566 3300026142 Bacteria 2098
742 Ga0207698_10200548 3300026142 Bacteria 1786
743 Ga0209371_1000185 3300027312 Bacteria 90613
744 Ga0209371_1021121 3300027312 Bacteria 1585
745 Ga0209971_1005327 3300027682 Bacteria 3059
746 Ga0209998_10002067 3300027717 Bacteria 4691
747 Ga0209813_10008703 3300027866 Bacteria 2573
748 Ga0209974_10011520 3300027876 Bacteria 2968
749 Ga0207428_10176037 3300027907 Bacteria 1618
750 Ga0268266_10006244 3300028379 Bacteria 10942
751 Ga0268266_10111725 3300028379 Bacteria 2421
752 Ga0268266_10136948 3300028379 Bacteria 2194
753 Ga0268266_10288654 3300028379 Bacteria 1527
754 Ga0268265_10147329 3300028380 Bacteria 1980
755 Ga0268265_10154199 3300028380 Bacteria 1941
756 Ga0268264_10002240 3300028381 Bacteria 17151
757 Ga0268264_10018760 3300028381 Bacteria 5656
758 Ga0268264_10027217 3300028381 Bacteria 4669
759 Ga0268264_10103779 3300028381 Bacteria 2476
760 Ga0307515_10095930 3300028794 Bacteria 3643
761 Ga0268256_1000847 3300030500 Bacteria 21660
762 Ga0268256_1023750 3300030500 Bacteria 1585
763 Ga0265332_10000026 3300031238 Bacteria 193153
764 Ga0265332_10041535 3300031238 Bacteria 1989
765 Ga0265325_10000686 3300031241 Bacteria 24667
766 Ga0265316_10036183 3300031344 Bacteria 3993
767 Ga0307513_10026627 3300031456 Bacteria 6662
768 Ga0307408_100000227 3300031548 Bacteria 59538
769 Ga0307408_100008544 3300031548 Bacteria 6762
770 Ga0307408_100011033 3300031548 Bacteria 5962
771 Ga0307516_10025491 3300031730 Bacteria 6021
772 Ga0307405_10008674 3300031731 Bacteria 5166
773 Ga0307405_10050431 3300031731 Bacteria 2577
774 Ga0307413_10004560 3300031824 Bacteria 6047
775 Ga0307413_10160565 3300031824 Bacteria 1578
776 Ga0307410_10010598 3300031852 Bacteria 5230
777 Ga0307410_10018790 3300031852 Bacteria 4186
778 Ga0307406_10005672 3300031901 Bacteria 6826
779 Ga0307406_10012655 3300031901 Bacteria 4811
780 Ga0307407_10008227 3300031903 Bacteria 4775
781 Ga0307407_10017947 3300031903 Bacteria 3565
782 Ga0307412_10000011 3300031911 Bacteria 405842
783 Ga0307412_10000819 3300031911 Bacteria 17915
784 Ga0307412_10001311 3300031911 Bacteria 13955
785 Ga0307412_10007528 3300031911 Bacteria 6183
786 Ga0307412_10015894 3300031911 Bacteria 4471
787 Ga0307412_10038366 3300031911 Bacteria 3084
788 Ga0307409_100011472 3300031995 Bacteria 5591
789 Ga0307416_100014656 3300032002 Bacteria 5384
790 Ga0307416_100018099 3300032002 Bacteria 4953
791 Ga0307416_100025378 3300032002 Bacteria 4344
792 Ga0307411_10000342 3300032005 Bacteria 15724
793 Ga0307415_100012133 3300032126 Bacteria 4971
794 Ga0373955_0020600 3300035172 Bacteria 3318
795 Ga0373955_0102507 3300035172 Bacteria 1645
796 Ga0373942_0038342 3300035207 Bacteria 1299
797 Ga0373924_0050746 3300035410 Bacteria 1719
798 Ga0373931_0070127 3300035691 Bacteria 1911
799 Ga0373927_0084473 3300035695 Bacteria 2059
800 Ga0373947_0053707 3300035725 Bacteria 2430
801 Ga0373937_0093668 3300036401 Bacteria 2785
802 Ga0373937_0228789 3300036401 Bacteria 1751
803 Ga0373925_0008350 3300037068 Bacteria 7540
804 Ga0373925_0146143 3300037068 Bacteria 1854
805 Ga0395900_0049220 3300037418 Bacteria 4342
806 Ga0395900_0068346 3300037418 Bacteria 3651
807 Ga0395900_0124396 3300037418 Bacteria 2645
808 Ga0395898_0001927 3300037466 Bacteria 26381
809 Ga0395898_0089622 3300037466 Bacteria 2960
810 Ga0395905_0000079 3300037471 Bacteria 160663
811 Ga0395905_0021231 3300037471 Bacteria 6144
812 Ga0436364_0213269 3300037853 Bacteria 6665
813 Ga0395901_0002134 3300038443 Bacteria 20258
814 Ga0395901_0010899 3300038443 Bacteria 9214
815 Ga0395901_0022287 3300038443 Bacteria 6490
816 Ga0395901_0041093 3300038443 Bacteria 4792
817 Ga0395901_0047593 3300038443 Bacteria 4453
818 Ga0436365_0414012 3300039437 Bacteria 1817
819 Ga0436361_0524475 3300039447 Bacteria 2871
820 Ga0436363_0071338 3300039450 Bacteria 2823
821 Ga0451791_1678248 3300041451 Bacteria 1459
822 Ga0439448_0000556 3300042005 Bacteria 8738
823 Ga0439455_0013825 3300042012 Bacteria 1835
824 Ga0451577_0073212 3300042876 Unclassified 3057
825 Ga0466973_0003647 3300044659 Bacteria 12557
826 Ga0466965_0001188 3300044683 Bacteria 10273
827 Ga0466966_0000753 3300044684 Bacteria 20547
828 Ga0466966_0014807 3300044684 Bacteria 5160
829 Ga0466966_0016639 3300044684 Bacteria 4858
830 Ga0466961_0008782 3300044693 Bacteria 6445
831 Ga0466961_0013890 3300044693 Bacteria 5159
832 Ga0466961_0054525 3300044693 Bacteria 2549
833 Ga0466961_0060424 3300044693 Bacteria 2410
834 Ga0466963_0030764 3300044694 Bacteria 3465
835 Ga0453684_0000659 3300044712 Bacteria 123941
836 Ga0453684_0013238 3300044712 Bacteria 13438
837 Ga0453684_0016855 3300044712 Bacteria 11373
838 Ga0453684_0032124 3300044712 Bacteria 7356
839 Ga0466971_0035732 3300044719 Bacteria 2228
840 Ga0466971_0039807 3300044719 Bacteria 2110
841 Ga0466957_0079131 3300044842 Bacteria 2045
842 Ga0451576_0000917 3300045051 Bacteria 55869
843 Ga0466958_0007770 3300045836 Bacteria 5917
844 Ga0466958_0011823 3300045836 Bacteria 4927
845 Ga0466958_0066601 3300045836 Bacteria 2200
846 Ga0495592_0023344 3300046454 Bacteria 4703
847 Ga0495603_0008549 3300046455 Bacteria 6187
848 Ga0495603_0022435 3300046455 Bacteria 3821
849 Ga0495590_0005178 3300046457 Bacteria 5188
850 Ga0495590_0005410 3300046457 Bacteria 5070
851 Ga0495590_0027735 3300046457 Bacteria 1986
852 Ga0495590_0037926 3300046457 Bacteria 1680
853 Ga0495591_003395 3300046458 Bacteria 8254
854 Ga0495591_005964 3300046458 Bacteria 5504
855 Ga0495629_0001148 3300046459 Bacteria 20917
856 Ga0495629_0007503 3300046459 Bacteria 8041
857 Ga0495629_0014432 3300046459 Bacteria 5683
858 Ga0495629_0025391 3300046459 Bacteria 4212
859 Ga0495629_0045030 3300046459 Bacteria 3096
860 Ga0495638_0003608 3300046460 Bacteria 12099
861 Ga0495638_0043787 3300046460 Bacteria 2822
862 Ga0495651_0016179 3300046462 Bacteria 5777
863 Ga0495653_0049709 3300046463 Bacteria 3228
864 Ga0495653_0177358 3300046463 Bacteria 1465
865 Ga0495650_0007327 3300046471 Bacteria 6651
866 Ga0495650_0034514 3300046471 Bacteria 2238
867 Ga0495650_0056407 3300046471 Bacteria 1594
868 Ga0495580_0017512 3300046472 Bacteria 5356
869 Ga0495580_0027508 3300046472 Bacteria 4137
870 Ga0495580_0027552 3300046472 Bacteria 4133
871 Ga0495580_0111005 3300046472 Bacteria 1904
872 Ga0495582_0005503 3300046473 Bacteria 7054
873 Ga0495582_0014589 3300046473 Bacteria 4317
874 Ga0495605_0008591 3300046474 Bacteria 5770
875 Ga0495605_0051566 3300046474 Bacteria 2003
876 Ga0495662_0033519 3300046476 Bacteria 2481
877 Ga0495596_0006198 3300046500 Bacteria 5538
878 Ga0495607_0000009 3300046501 Bacteria 216674
879 Ga0495607_0019953 3300046501 Bacteria 4246
880 Ga0495583_0035066 3300046506 Bacteria 2398
881 Ga0495606_0017079 3300046507 Bacteria 5503
882 Ga0495606_0029191 3300046507 Bacteria 3877
883 Ga0495606_0042270 3300046507 Bacteria 3049
884 Ga0495608_0015231 3300046511 Bacteria 5335
885 Ga0495610_0002064 3300046512 Bacteria 17146
886 Ga0495616_0007729 3300046513 Bacteria 6424
887 Ga0495618_0003307 3300046514 Bacteria 10082
888 Ga0495618_0016177 3300046514 Bacteria 4559
889 Ga0495628_0019963 3300046516 Bacteria 5535
890 Ga0495628_0046029 3300046516 Bacteria 3466
891 Ga0495628_0055588 3300046516 Bacteria 3117
892 Ga0495628_0084035 3300046516 Bacteria 2470
893 Ga0495630_0052730 3300046517 Bacteria 3045
894 Ga0495630_0084542 3300046517 Bacteria 2395
895 Ga0495637_0011099 3300046520 Bacteria 4337
896 Ga0495643_0011706 3300046522 Bacteria 5326
897 Ga0495644_0026808 3300046523 Bacteria 2185
898 Ga0495666_0007034 3300046526 Bacteria 5653
899 Ga0495666_0007567 3300046526 Bacteria 5434
900 Ga0495642_0041987 3300046528 Bacteria 1862
901 Ga0495652_0007296 3300046529 Bacteria 10200
902 Ga0495652_0045841 3300046529 Bacteria 3756
903 Ga0495665_0009073 3300046531 Bacteria 5394
904 Ga0495665_0009210 3300046531 Bacteria 5349
905 Ga0495640_0017143 3300046533 Bacteria 5405
906 Ga0495587_0013269 3300046536 Bacteria 5180
907 Ga0495621_0005808 3300046539 Bacteria 3568
908 Ga0495597_0008664 3300046542 Bacteria 5084
909 Ga0495597_0057003 3300046542 Bacteria 1710
910 Ga0495597_0062288 3300046542 Bacteria 1623
911 Ga0495645_0004772 3300046543 Bacteria 9263
912 Ga0495645_0115988 3300046543 Bacteria 1891
913 Ga0495622_0005858 3300046557 Bacteria 5705
914 Ga0495622_0011359 3300046557 Bacteria 4114
915 Ga0495668_0140163 3300046616 Bacteria 1323
916 Ga0495634_0015178 3300046642 Bacteria 5538
917 Ga0495634_0041591 3300046642 Bacteria 3120
918 Ga0495611_0020582 3300046648 Bacteria 2841
919 Ga0495635_0005295 3300046663 Bacteria 8976
920 Ga0495635_0123230 3300046663 Bacteria 1768
921 Ga0495661_0002821 3300046665 Bacteria 13158
922 Ga0495661_0011330 3300046665 Bacteria 6051
923 Ga0495661_0023525 3300046665 Bacteria 3999
924 Ga0495599_0029487 3300046678 Bacteria 3440
925 Ga0495623_0000579 3300046679 Bacteria 24412
926 Ga0495623_0022842 3300046679 Bacteria 4038
927 Ga0495623_0030764 3300046679 Bacteria 3454
928 Ga0495646_0053046 3300046680 Bacteria 2446
929 Ga0495658_0014701 3300046683 Bacteria 4002
930 Ga0495658_0140661 3300046683 Bacteria 1476
931 Ga0495613_0015540 3300046689 Bacteria 5661
932 Ga0495624_0007224 3300046690 Bacteria 7808
933 Ga0495624_0128791 3300046690 Bacteria 1552
934 Ga0495649_0005474 3300046694 Bacteria 8066
935 Ga0495649_0007873 3300046694 Bacteria 6446
936 Ga0495649_0008109 3300046694 Bacteria 6338
937 Ga0495649_0032271 3300046694 Bacteria 2885
938 Ga0495589_0015924 3300046794 Bacteria 3865
939 Ga0495589_0017912 3300046794 Bacteria 3633
940 Ga0495600_0001590 3300046809 Bacteria 12616
941 Ga0495600_0011974 3300046809 Bacteria 5416
942 Ga0495581_0001489 3300047315 Bacteria 13039
943 Ga0495581_0003869 3300047315 Bacteria 8611
944 Ga0495604_0018528 3300047317 Bacteria 5577
945 Ga0495604_0021070 3300047317 Bacteria 5201
946 Ga0495674_0006044 3300047319 Bacteria 11626
947 Ga0495674_0023512 3300047319 Bacteria 5678
948 Ga0495674_0032916 3300047319 Bacteria 4699
949 Ga0495674_0042812 3300047319 Bacteria 4036
950 Ga0495674_0124537 3300047319 Bacteria 2176
951 Ga0495676_0120811 3300047321 Bacteria 1906
952 Ga0495680_0002302 3300047322 Bacteria 19622
953 Ga0495680_0222080 3300047322 Bacteria 1348
954 Ga0495683_0003339 3300047323 Bacteria 9378
955 Ga0495683_0004598 3300047323 Bacteria 7792
956 Ga0495683_0018207 3300047323 Bacteria 3633
957 Ga0495683_0065114 3300047323 Bacteria 1798
958 Ga0495683_0123875 3300047323 Bacteria 1224
959 Ga0495687_000053 3300047443 Bacteria 195897
960 Ga0495687_001004 3300047443 Bacteria 28188
961 Ga0495687_009162 3300047443 Bacteria 5569
962 Ga0495687_012920 3300047443 Bacteria 4386
963 Ga0495687_023722 3300047443 Bacteria 2927
964 Ga0495675_0001937 3300047444 Bacteria 12337
965 Ga0495675_0022841 3300047444 Bacteria 3988
966 Ga0495675_0067509 3300047444 Bacteria 2259
967 Ga0495679_000156 3300047446 Bacteria 61428
968 Ga0495679_011687 3300047446 Bacteria 3373
969 Ga0495679_023716 3300047446 Bacteria 2077
970 Ga0495673_0037562 3300047469 Bacteria 2210
971 Ga0495684_0108710 3300047471 Bacteria 2094
972 Ga0495686_0000519 3300047472 Bacteria 55675
973 Ga0495686_0047356 3300047472 Bacteria 2715
974 Ga0495593_0001073 3300047673 Bacteria 15971
975 Ga0495593_0040922 3300047673 Bacteria 2493
976 Ga0495593_0065877 3300047673 Bacteria 1888
977 Ga0495602_0040914 3300048088 Bacteria 4239
978 Ga0495602_0079957 3300048088 Bacteria 2755
979 Ga0495614_0000394 3300048089 Bacteria 17743
980 Ga0495614_0006231 3300048089 Bacteria 5361
981 Ga0495626_0025837 3300048091 Bacteria 2868
982 Ga0495626_0096504 3300048091 Bacteria 1294
983 Ga0496100_0103449 3300048903 Bacteria 1966
984 Ga0496100_0130027 3300048903 Bacteria 1772
985 Ga0496100_0159831 3300048903 Bacteria 1614
986 Ga0496101_0020522 3300048904 Bacteria 4525
987 Ga0496101_0034664 3300048904 Bacteria 3566
988 Ga0496101_0048173 3300048904 Bacteria 3062
989 Ga0496102_0010175 3300048905 Bacteria 8088
990 Ga0496102_0017335 3300048905 Bacteria 6308
991 Ga0496102_0025230 3300048905 Bacteria 5289
992 Ga0496102_0031026 3300048905 Bacteria 4789
993 Ga0496102_0052864 3300048905 Bacteria 3702
994 Ga0496102_0061722 3300048905 Bacteria 3431
995 Ga0496102_0117818 3300048905 Bacteria 2478
996 Ga0496102_0121758 3300048905 Bacteria 2437
997 Ga0496102_0141068 3300048905 Bacteria 2259
998 Ga0496102_0327359 3300048905 Bacteria 1443
999 Ga0496103_0014601 3300048906 Bacteria 4666
1000 Ga0496103_0151420 3300048906 Bacteria 1486
1001 Ga0496103_0164294 3300048906 Bacteria 1424
1002 Ga0496104_0010736 3300048907 Bacteria 8191
1003 Ga0496104_0049904 3300048907 Bacteria 3947
1004 Ga0496104_0078895 3300048907 Bacteria 3137
1005 Ga0496105_0004400 3300048908 Bacteria 10605
1006 Ga0496105_0024174 3300048908 Bacteria 4935
1007 Ga0496105_0260987 3300048908 Bacteria 1401
1008 Ga0496106_0002288 3300048909 Bacteria 14290
1009 Ga0496106_0193296 3300048909 Bacteria 1618
1010 Ga0496107_0068311 3300048910 Bacteria 2579
1011 Ga0496107_0078947 3300048910 Bacteria 2399
1012 Ga0496107_0197081 3300048910 Bacteria 1497
1013 Ga0496108_0014298 3300048911 Bacteria 6477
1014 Ga0496108_0035500 3300048911 Bacteria 4145
1015 Ga0496108_0066034 3300048911 Bacteria 3050
1016 Ga0496109_0036151 3300048912 Bacteria 4457
1017 Ga0496109_0048566 3300048912 Bacteria 3861
1018 Ga0496109_0228278 3300048912 Bacteria 1751
1019 Ga0496109_0447564 3300048912 Bacteria 1220
1020 Ga0496110_0020925 3300048913 Bacteria 5527
1021 Ga0496110_0134053 3300048913 Bacteria 2238
1022 Ga0496110_0165336 3300048913 Bacteria 2006
1023 Ga0496111_0296604 3300048914 Bacteria 1198
1024 Ga0496112_0002051 3300048915 Bacteria 15970
1025 Ga0496112_0033732 3300048915 Bacteria 4977
1026 Ga0496112_0122979 3300048915 Bacteria 2565
1027 Ga0496113_0028510 3300048916 Bacteria 4016
1028 Ga0496113_0056135 3300048916 Bacteria 2955
1029 Ga0496114_0001851 3300048917 Bacteria 16017
1030 Ga0496114_0056745 3300048917 Bacteria 3268
1031 Ga0496114_0306124 3300048917 Bacteria 1403
1032 Ga0496115_0099610 3300048918 Bacteria 2381
1033 Ga0496116_0010706 3300048919 Bacteria 7657
1034 Ga0496116_0015926 3300048919 Bacteria 5912
1035 Ga0496116_0019593 3300048919 Bacteria 5175
1036 Ga0496117_0005096 3300048920 Bacteria 14050
1037 Ga0496117_0008616 3300048920 Bacteria 9661
1038 Ga0496117_0025161 3300048920 Bacteria 4686
1039 Ga0496117_0032547 3300048920 Bacteria 3960
1040 Ga0496117_0042762 3300048920 Bacteria 3303
1041 Ga0496117_0046755 3300048920 Bacteria 3110
1042 Ga0496118_0001664 3300048921 Bacteria 32633
1043 Ga0496118_0002738 3300048921 Bacteria 23192
1044 Ga0496118_0009250 3300048921 Bacteria 10001
1045 Ga0496118_0011642 3300048921 Bacteria 8555
1046 Ga0496118_0020035 3300048921 Bacteria 5952
1047 Ga0496118_0025697 3300048921 Bacteria 5040
1048 Ga0496118_0075633 3300048921 Bacteria 2400
1049 Ga0496118_0103979 3300048921 Bacteria 1908
1050 Ga0496119_0007583 3300048922 Bacteria 9734
1051 Ga0496119_0018374 3300048922 Bacteria 5205
1052 Ga0496119_0019501 3300048922 Bacteria 4992
1053 Ga0496119_0051972 3300048922 Bacteria 2514
1054 Ga0496119_0068323 3300048922 Bacteria 2093
1055 Ga0496120_0007282 3300048923 Bacteria 8265
1056 Ga0496120_0038111 3300048923 Bacteria 2846
1057 Ga0496121_0000164 3300048924 Bacteria 145421
1058 Ga0496121_0004956 3300048924 Bacteria 17465
1059 Ga0496121_0025108 3300048924 Bacteria 5671
1060 Ga0496121_0026445 3300048924 Bacteria 5468
1061 Ga0496121_0066813 3300048924 Bacteria 2917
1062 Ga0496121_0108325 3300048924 Bacteria 2125
1063 Ga0496122_0000865 3300048925 Bacteria 57024
1064 Ga0496122_0001706 3300048925 Bacteria 34056
1065 Ga0496122_0042110 3300048925 Bacteria 3597
1066 Ga0496122_0047209 3300048925 Bacteria 3326
1067 Ga0496122_0086012 3300048925 Bacteria 2166
1068 Ga0496123_0000203 3300048926 Bacteria 121361
1069 Ga0496123_0001919 3300048926 Bacteria 27137
1070 Ga0496123_0031845 3300048926 Bacteria 3828
1071 Ga0496124_0035716 3300048927 Bacteria 4346
1072 Ga0496124_0039370 3300048927 Bacteria 4098
1073 Ga0496124_0098439 3300048927 Bacteria 2373
1074 Ga0496125_0000011 3300048928 Bacteria 655895
1075 Ga0496125_0000241 3300048928 Bacteria 112044
1076 Ga0496125_0016616 3300048928 Bacteria 7058
1077 Ga0496125_0047447 3300048928 Bacteria 3591
1078 Ga0496125_0085613 3300048928 Bacteria 2387
1079 Ga0496126_0000118 3300048929 Bacteria 184719
1080 Ga0496126_0004623 3300048929 Bacteria 16310
1081 Ga0496126_0052121 3300048929 Bacteria 3721
1082 Ga0496126_0091523 3300048929 Bacteria 2674
1083 Ga0496126_0127914 3300048929 Bacteria 2197
1084 Ga0496126_0274708 3300048929 Bacteria 1397
1085 Ga0495678_020912 3300049459 Bacteria 2888
1086 Ga0495682_0069519 3300049460 Bacteria 1267
1087 Ga0501033_0083225 3300049570 Bacteria 2346
1088 Ga0501034_0176816 3300049571 Bacteria 2100
1089 Ga0501043_0191811 3300049579 Bacteria 1589
1090 Ga0501067_0067477 3300049583 Bacteria 1980
1091 Ga0501069_0113096 3300049585 Bacteria 1547
1092 Ga0501070_0007055 3300049586 Bacteria 9559
1093 Ga0501072_0027713 3300049588 Bacteria 4419
1094 Ga0501074_0052928 3300049590 Bacteria 2930
1095 Ga0501080_0037277 3300049742 Bacteria 4540
1096 Ga0501083_0030372 3300049744 Bacteria 3713
1097 Ga0501044_0002376 3300049823 Bacteria 21434
1098 nmdc:mga03683_56980_c1 3300050489 Bacteria 1644
1099 nmdc:mga0k408_24569_c1 3300050493 Bacteria 3408
1100 nmdc:mga0k408_6630_c1 3300050493 Bacteria 6173
1101 nmdc:mga06z11_7546_c1 3300050494 Bacteria 4483
1102 nmdc:mga07m45_32734_c1 3300050496 Bacteria 2883
1103 nmdc:mga07m45_3489_c1 3300050496 Bacteria 7581
1104 nmdc:mga07m45_39477_c1 3300050496 Bacteria 2638
1105 nmdc:mga07m45_919_c1 3300050496 Bacteria 12885
1106 nmdc:mga07m45_96793_c1 3300050496 Bacteria 1694
1107 nmdc:mga08y16_186143_c1 3300050511 Bacteria 2155
1108 nmdc:mga08y16_62834_c1 3300050511 Bacteria 3878
1109 nmdc:mga0n895_164178_c1 3300050512 Bacteria 2252
1110 nmdc:mga0n895_24727_c1 3300050512 Bacteria 5663
1111 nmdc:mga0n895_24867_c1 3300050512 Bacteria 5650
1112 nmdc:mga0n895_279629_c2 3300050512 Bacteria 1208
1113 nmdc:mga0rr50_119776_c1 3300050513 Bacteria 2093
1114 nmdc:mga0a205_31268_c1 3300050515 Bacteria 5100
1115 nmdc:mga0sz30_56067_c1 3300050516 Bacteria 1678
1116 Ga0495601_0102974 3300053077 Bacteria 1845
1117 Ga0500658_0002972 3300053134 Bacteria 6514
1118 Ga0500568_0011536 3300053139 Bacteria 4092
1119 Ga0501084_0072201 3300054114 Bacteria 2890
1120 Ga0466962_0000108 3300061719 Bacteria 33805
1121 Ga0466962_0002594 3300061719 Bacteria 8584
1122 2501074651 2501025501 Bacteria 7768574
1123 2501410112 2501025504 Bacteria 8008976
1124 2509128041 2508501125 Bacteria 7208311
1125 2511095434 2510917014 Bacteria 8296963
1126 2511105092 2510917015 Bacteria 7950052
1127 2513556029 2513237082 Bacteria 8640282
1128 2513561341 2513237083 Bacteria 8410967
1129 2513959543 2513237151 Bacteria 6309801
1130 2514046879 2513237166 Bacteria 10373764
1131 2515688313 2515154123 Bacteria 6387382
1132 2519457301 2519103095 Bacteria 6629912
1133 2526061142 2524614857 Bacteria 4146328
1134 2527078482 2526164713 Bacteria 6780608
1135 2548846463 2547132512 Bacteria 3416496
1136 2563055488 2562617112 Bacteria 10918404
1137 2574433462 2574179768 Bacteria 4907129
1138 2585292157 2582581311 Bacteria 6763856
1139 2599738759 2599185239 Bacteria 8686614
1140 2599747630 2599185240 Bacteria 7968121
1141 2599903165 2599185292 Bacteria 6290804
1142 2600209514 2599185355 Bacteria 7968906
1143 2644121416 2643221621 Bacteria 6212786
1144 2644302459 2643221654 Bacteria 5273570
1145 2676745573 2675903129 Bacteria 7964495
1146 2713478867 2711768613 Bacteria 11048459
1147 2738823073 2738541296 Bacteria 7285013
1148 2738835280 2738541298 Bacteria 7286732
1149 2738876759 2738541306 Bacteria 7284992
1150 2739188778 2738543002 Bacteria 7284546
1151 2739223430 2738543008 Bacteria 7282815
1152 2740065054 2739367875 Bacteria 4157290
1153 2746086764 2744054900 Bacteria 8399525
1154 2746094163 2744054901 Bacteria 8397047
1155 2753568591 2751185846 Bacteria 7242164
1156 2817259502 2816332253 Bacteria 6764532
1157 2817277171 2816332256 Bacteria 6891714
1158 2817454085 2816332286 Bacteria 6853759
1159 2819622610 2818991450 Bacteria 6962147
1160 2819634712 2818991452 Bacteria 8442785
1161 2842329101 2842324504 Bacteria 9364110
1162 2842353480 2842348783 Bacteria 9002918
1163 2842459004 2842454564 Bacteria 8730687
1164 2856290418 2856287931 Bacteria 7223934
1165 2857359953 2857357740 Bacteria 9937880
1166 2857578030 2857576091 Bacteria 5465855
1167 2858952954 2858950400 Bacteria 6783797
1168 2863425400 2863421361 Bacteria 7300805
1169 2870069639 2870068957 Bacteria 8925310
1170 2895516129 2895511927 Bacteria 6802080
1171 2900636816 2900634093 Bacteria 10263517
1172 2904488144 2904483920 Bacteria 7545285
1173 2904570146 2904564687 Bacteria 7609577
1174 2904577322 2904571731 Bacteria 7608790
1175 2919531095 2919527303 Bacteria 7718827
1176 2921647159 2921643360 Bacteria 11448031
1177 2928112667 2928108538 Bacteria 7360024
1178 2928139640 2928135762 Bacteria 7259641
1179 2928163721 2928157003 Bacteria 7522202
1180 2928170528 2928163908 Bacteria 7561269
1181 2928175849 2928170801 Bacteria 8785406
1182 2928508477 2928503688 Bacteria 7268108
1183 2928541489 2928536128 Bacteria 7657547
1184 2941480431
1185 2945934838 2945934425 Bacteria 7444609
1186 2981995760 2981990288 Bacteria 7590678
1187 2990704585 2990703756 Bacteria 7715990
1188 639787655 639633007 Bacteria 4376040
1189 642425144 641736151 Bacteria 7477263
1190 642416023 641736154 Bacteria 7689995
1191 642594847 642555112 Bacteria 8676562
1192 642623496 642555113 Bacteria 8214658
1193 8003958757 8003955200 Bacteria 8601927
1194 8018848092 8018845410 Bacteria 8933938
1195 8020810292 8020807995 Bacteria 6801506
1196 8020939186 8020938398 Bacteria 7472757
1197 8020948523 8020945358 Bacteria 8467355
1198 8020956244 8020953355 Bacteria 7439080
1199 8021127045 8021120328 Bacteria 8782274
1200 8039101474 8039098773 Bacteria 6602928
1201 8040169598 8040167225 Bacteria 6542727
1202 8040174631 8040173305 Bacteria 6827067
1203 8055270776 8055266321 Bacteria 7999742
1204 8055305578 8055301274 Bacteria 8587385
1205 Ga0207648_10053993
1206 JGI24746J21847_1011793
1207 JGI24740J21852_10005037
1208 JGI24739J22299_10006235
1209 JGI24739J22299_10011344
1210 JGI24739J22299_10030746
1211 JGI24737J22298_10006627
1212 JGI24737J22298_10009084
1213 JGI24737J22298_10010007
1214 JGI24735J21928_10000162
1215 JGI24735J21928_10000241
1216 JGI24735J21928_10003000
1217 JGI24735J21928_10005356
1218 JGI24738J21930_10005721
1219 JGI25156J39149_1000310
1220 JGI25156J39149_1000485
1221 JGI25156J39149_1000815
1222 rootL2_10004490
1223 rootL2_10011098
1224 rootH1_10085817
1225 JGI25160J50197_1000016
1226 Ga0006556J51387_1038757
1227 Ga0055533_1000331
1228 Ga0055533_1001876
1229 Ga0055532_1000022
1230 Ga0055532_1000999
1231 Ga0055532_1002396
1232 Ga0055532_1003782
1233 Ga0055527_1000016
1234 Ga0055527_1000645
1235 Ga0055535_1000017
1236 Ga0055535_1001611
1237 Ga0055535_1001620
1238 Ga0055542_1000030
1239 Ga0055542_1001587
1240 Ga0055542_1002572
1241 Ga0055529_1000033
1242 Ga0055529_1001023
1243 Ga0055528_1007441
1244 Ga0058692_1001054
1245 Ga0065165_1000875
1246 Ga0065715_10154227
1247 Ga0070658_10020490
1248 Ga0070658_10024613
1249 Ga0070658_10027656
1250 Ga0070658_10036786
1251 Ga0070658_10053362
1252 Ga0070658_10102762
1253 Ga0070676_10000586
1254 Ga0070676_10089032
1255 Ga0070676_10094565
1256 Ga0070683_100005154
1257 Ga0070683_100006341
1258 Ga0070683_100013442
1259 Ga0070683_100034936
1260 Ga0070690_100043230
1261 Ga0070690_100061114
1262 Ga0070670_100006292
1263 Ga0070670_100010440
1264 Ga0070670_100015920
1265 Ga0070670_100032122
1266 Ga0070670_100109217
1267 Ga0070670_100125476
1268 Ga0070677_10000147
1269 Ga0070677_10000950
1270 Ga0068869_100002581
1271 Ga0068869_100004238
1272 Ga0068869_100008639
1273 Ga0068869_100016878
1274 Ga0068869_100020996
1275 Ga0068869_100021186
1276 Ga0070666_10006093
1277 Ga0070666_10033752
1278 Ga0070666_10039705
1279 Ga0070666_10068898
1280 Ga0070680_100007735
1281 Ga0070680_100115258
1282 Ga0068868_100008523
1283 Ga0068868_100040309
1284 Ga0068868_100083558
1285 Ga0068868_100087613
1286 Ga0068868_100211047
1287 Ga0068868_100255748
1288 Ga0070660_100000108
1289 Ga0070660_100006646
1290 Ga0070660_100021779
1291 Ga0070660_100038176
1292 Ga0070660_100124106
1293 Ga0070689_100033559
1294 Ga0070689_100076224
1295 Ga0070687_100016228
1296 Ga0070687_100038716
1297 Ga0070661_100001352
1298 Ga0070661_100010105
1299 Ga0070661_100014151
1300 Ga0070661_100037763
1301 Ga0070661_100047409
1302 Ga0070661_100077110
1303 Ga0070661_100142053
1304 Ga0070692_10075234
1305 Ga0070668_100003337
1306 Ga0070668_100003380
1307 Ga0070668_100007343
1308 Ga0070668_100010138
1309 Ga0070668_100013434
1310 Ga0070668_100019925
1311 Ga0070668_100023352
1312 Ga0070668_100035467
1313 Ga0070668_100149220
1314 Ga0070669_100006798
1315 Ga0070669_100034853
1316 Ga0070669_100101833
1317 Ga0070669_100217881
1318 Ga0070675_100003409
1319 Ga0070675_100004470
1320 Ga0070675_100007104
1321 Ga0070675_100009671
1322 Ga0070675_100011427
1323 Ga0070675_100052154
1324 Ga0070675_100084438
1325 Ga0070675_100097990
1326 Ga0070671_100002148
1327 Ga0070671_100002235
1328 Ga0070671_100002777
1329 Ga0070671_100004290
1330 Ga0070671_100007470
1331 Ga0070671_100035756
1332 Ga0070671_100059174
1333 Ga0070671_100084613
1334 Ga0070671_100085183
1335 Ga0070671_100182876
1336 Ga0070674_100000109
1337 Ga0070674_100009365
1338 Ga0070674_100012642
1339 Ga0070674_100035000
1340 Ga0070674_100113592
1341 Ga0070673_100000814
1342 Ga0070673_100002188
1343 Ga0070673_100017811
1344 Ga0070673_100075921
1345 Ga0070673_100103956
1346 Ga0070688_100005571
1347 Ga0070688_100036468
1348 Ga0070659_100000070
1349 Ga0070659_100002205
1350 Ga0070659_100019281
1351 Ga0070659_100034631
1352 Ga0070667_100003743
1353 Ga0070667_100005378
1354 Ga0070667_100006224
1355 Ga0070667_100006231
1356 Ga0070667_100007026
1357 Ga0070667_100038936
1358 Ga0070667_100123366
1359 Ga0070701_10081098
1360 Ga0070701_10103958
1361 Ga0070705_100047209
1362 Ga0070700_100062483
1363 Ga0070708_100000726
1364 Ga0070708_100007372
1365 Ga0070708_100128680
1366 Ga0070708_100170455
1367 Ga0070708_100425618
1368 Ga0070663_100007612
1369 Ga0070663_100012949
1370 Ga0070663_100022630
1371 Ga0070663_100044048
1372 Ga0070663_100121218
1373 Ga0070663_100135370
1374 Ga0070678_100001654
1375 Ga0070678_100003347
1376 Ga0070678_100010414
1377 Ga0070678_100017525
1378 Ga0070678_100034995
1379 Ga0070678_100243727
1380 Ga0070662_100000827
1381 Ga0070662_100031859
1382 Ga0070662_100034579
1383 Ga0070681_10005152
1384 Ga0068867_100001260
1385 Ga0068867_100008463
1386 Ga0068867_100161548
1387 Ga0068867_100182335
1388 Ga0068867_100191458
1389 Ga0070685_10002746
1390 Ga0070685_10020281
1391 Ga0070685_10059431
1392 Ga0070685_10225154
1393 Ga0070706_100035270
1394 Ga0070707_100048762
1395 Ga0070707_100374483
1396 Ga0070698_100120262
1397 Ga0070699_100117152
1398 Ga0070699_100246753
1399 Ga0070684_100006125
1400 Ga0070684_100008902
1401 Ga0070684_100012948
1402 Ga0070684_100181480
1403 Ga0068853_100005992
1404 Ga0068853_100009311
1405 Ga0068853_100019086
1406 Ga0068853_100023650
1407 Ga0070672_100001074
1408 Ga0070672_100001704
1409 Ga0070672_100005096
1410 Ga0070672_100012555
1411 Ga0070672_100046284
1412 Ga0070672_100078445
1413 Ga0070672_100078605
1414 Ga0070672_100287365
1415 Ga0070686_100004725
1416 Ga0070693_100009342
1417 Ga0070693_100023224
1418 Ga0070665_100003313
1419 Ga0070665_100005444
1420 Ga0070665_100006892
1421 Ga0070665_100010582
1422 Ga0070665_100092825
1423 Ga0070665_100108872
1424 Ga0070665_100144829
1425 Ga0070665_100262285
1426 Ga0068855_100000618
1427 Ga0068855_100059864
1428 Ga0068855_100091228
1429 Ga0068855_100114630
1430 Ga0068855_100159283
1431 Ga0068855_100262211
1432 Ga0070664_100008432
1433 Ga0070664_100051283
1434 Ga0070664_100104242
1435 Ga0068857_100007291
1436 Ga0068857_100014197
1437 Ga0068857_100016044
1438 Ga0068857_100086979
1439 Ga0068854_100022298
1440 Ga0068854_100022735
1441 Ga0068854_100061024
1442 Ga0068856_100000093
1443 Ga0068856_100022002
1444 Ga0068856_100125110
1445 Ga0068852_100000265
1446 Ga0068852_100004707
1447 Ga0068852_100011098
1448 Ga0068852_100029990
1449 Ga0068852_100033803
1450 Ga0068852_100060839
1451 Ga0068852_100141132
1452 Ga0068852_100307005
1453 Ga0068859_100002465
1454 Ga0068859_100020875
1455 Ga0068859_100092457
1456 Ga0068859_100168399
1457 Ga0068859_100284431
1458 Ga0068864_100005694
1459 Ga0068864_100011928
1460 Ga0068864_100017340
1461 Ga0068864_100045429
1462 Ga0068864_100108060
1463 Ga0068864_100354794
1464 Ga0068864_100464758
1465 Ga0068866_10001528
1466 Ga0068866_10036134
1467 Ga0068861_100003054
1468 Ga0068861_100033420
1469 Ga0068861_100037238
1470 Ga0068861_100044788
1471 Ga0068861_100045459
1472 Ga0068861_100110879
1473 Ga0068851_10001117
1474 Ga0068851_10002821
1475 Ga0068851_10025333
1476 Ga0068851_10057935
1477 Ga0068870_10001406
1478 Ga0068870_10015874
1479 Ga0068870_10038307
1480 Ga0068863_100002185
1481 Ga0068863_100018376
1482 Ga0068863_100020623
1483 Ga0068863_100024582
1484 Ga0068863_100032838
1485 Ga0068863_100052723
1486 Ga0068863_100077160
1487 Ga0068863_100118397
1488 Ga0068863_100129344
1489 Ga0068863_100154888
1490 Ga0068858_100003435
1491 Ga0068858_100005392
1492 Ga0068858_100005719
1493 Ga0068858_100009830
1494 Ga0068858_100010459
1495 Ga0068858_100020675
1496 Ga0068858_100030219
1497 Ga0068858_100034811
1498 Ga0068858_100396618
1499 Ga0068860_100003281
1500 Ga0068860_100004709
1501 Ga0068860_100020794
1502 Ga0068860_100031689
1503 Ga0068860_100033805
1504 Ga0068860_100042479
1505 Ga0068860_100050709
1506 Ga0068860_100051372
1507 Ga0068862_100012971
1508 Ga0068862_100025853
1509 Ga0068862_100093050
1510 Ga0081455_10003268
1511 Ga0081455_10116880
1512 Ga0081539_10023827
1513 Ga0081539_10027215
1514 Ga0075363_100062191
1515 Ga0075364_10102625
1516 Ga0075362_10012524
1517 Ga0075367_10003415
1518 Ga0075367_10005138
1519 Ga0075367_10030966
1520 Ga0075367_10122576
1521 Ga0075369_10002321
1522 Ga0075366_10044090
1523 Ga0075366_10110854
1524 Ga0097621_100007585
1525 Ga0097621_100016593
1526 Ga0097621_100025122
1527 Ga0097621_100029264
1528 Ga0097621_100082912
1529 Ga0075370_10000157
1530 Ga0075370_10000617
1531 Ga0075370_10012187
1532 Ga0075370_10035953
1533 Ga0075370_10057366
1534 Ga0075370_10080188
1535 Ga0075370_10120898
1536 Ga0068871_100014110
1537 Ga0068871_100017513
1538 Ga0068871_100029987
1539 Ga0068871_100033032
1540 Ga0068871_100226680
1541 Ga0075428_100079945
1542 Ga0075433_10032958
1543 Ga0075433_10359690
1544 Ga0075434_100017497
1545 Ga0075434_100110940
1546 Ga0075434_100223125
1547 Ga0068865_100012656
1548 Ga0068865_100033942
1549 Ga0068865_100123612
1550 Ga0097620_100002465
1551 Ga0097620_100020876
1552 Ga0097620_100092456
1553 Ga0097620_100168400
1554 Ga0097620_100284444
1555 Ga0075435_100117035
1556 Ga0105251_10000671
1557 Ga0105251_10001447
1558 Ga0105251_10032505
1559 Ga0105240_10002436
1560 Ga0105240_10016538
1561 Ga0105240_10022166
1562 Ga0105240_10045943
1563 Ga0105240_10048690
1564 Ga0105240_10205295
1565 Ga0111539_10011146
1566 Ga0105245_10018737
1567 Ga0105245_10107659
1568 Ga0105245_10282422
1569 Ga0105247_10007966
1570 Ga0105247_10110227
1571 Ga0105241_10040157
1572 Ga0105242_10132477
1573 Ga0105248_10003137
1574 Ga0105248_10017241
1575 Ga0105248_10018724
1576 Ga0105237_10091876
1577 Ga0105237_10180232
1578 Ga0105237_10290995
1579 Ga0105238_10041126
1580 Ga0105249_10147133
1581 Ga0105249_10163717
1582 Ga0105249_10296402
1583 Ga0105239_10001161
1584 Ga0105239_10497661
1585 Ga0105239_10676282
1586 Ga0105246_10029890
1587 Ga0157373_10000777
1588 Ga0157373_10010136
1589 Ga0157373_10043636
1590 Ga0157371_10008425
1591 Ga0157370_10005771
1592 Ga0157370_10019561
1593 Ga0157369_10001395
1594 Ga0157369_10006755
1595 Ga0157369_10008403
1596 Ga0157369_10025742
1597 Ga0157369_10042581
1598 Ga0157369_10325518
1599 Ga0157374_10001040
1600 Ga0157374_10007000
1601 Ga0157374_10008031
1602 Ga0157374_10017774
1603 Ga0157374_10029253
1604 Ga0157374_10313103
1605 Ga0157378_10005031
1606 Ga0157378_10006031
1607 Ga0157378_10014439
1608 Ga0157378_10042441
1609 Ga0157378_10069600
1610 Ga0157378_10091530
1611 Ga0157378_10105755
1612 Ga0157378_10165826
1613 Ga0163162_10004087
1614 Ga0163162_10030122
1615 Ga0163162_10043717
1616 Ga0163162_10070653
1617 Ga0163162_10089123
1618 Ga0163162_10095019
1619 Ga0163162_10308831
1620 Ga0163162_10448565
1621 Ga0157372_10000852
1622 Ga0157372_10001735
1623 Ga0157372_10022569
1624 Ga0157372_10029653
1625 Ga0157375_10033547
1626 Ga0157375_10180955
1627 Ga0157375_10501181
1628 Ga0163163_10001673
1629 Ga0163163_10017149
1630 Ga0163163_10037547
1631 Ga0163163_10054748
1632 Ga0163163_10074747
1633 Ga0163163_10184228
1634 Ga0157380_10085914
1635 Ga0157380_10230269
1636 Ga0182008_10012750
1637 Ga0157377_10001479
1638 Ga0157377_10006198
1639 Ga0157379_10000219
1640 Ga0157379_10003465
1641 Ga0157379_10015827
1642 Ga0157379_10032158
1643 Ga0157379_10065986
1644 Ga0157379_10369171
1645 Ga0157376_10025185
1646 Ga0157376_10031030
1647 Ga0157376_10116895
1648 Ga0182007_10000465
1649 Ga0163161_10008715
1650 Ga0163161_10020759
1651 Ga0163161_10035616
1652 Ga0163161_10200499
1653 Ga0209566_100264
1654 Ga0209674_100017
1655 Ga0209674_100291
1656 Ga0209674_101162
1657 Ga0209672_100001
1658 Ga0209672_100115
1659 Ga0209672_100136
1660 Ga0209147_100022
1661 Ga0209147_100164
1662 Ga0209147_100215
1663 Ga0209147_100360
1664 Ga0209563_101730
1665 Ga0207427_100419
1666 Ga0209258_100033
1667 Ga0209258_100261
1668 Ga0209258_100271
1669 Ga0209148_1000046
1670 Ga0209148_1000104
1671 Ga0209148_1000609
1672 Ga0209759_1000180
1673 Ga0209759_1000231
1674 Ga0209759_1000568
1675 Ga0209759_1007514
1676 Ga0209233_1000050
1677 Ga0209565_1003571
1678 Ga0209455_1000038
1679 Ga0209455_1000097
1680 Ga0209673_1000124
1681 Ga0209676_1003712
1682 Ga0209564_1001909
1683 Ga0209564_1010372
1684 Ga0209050_1006245
1685 Ga0207426_1000007
1686 Ga0207426_1001933
1687 Ga0207697_10000241
1688 Ga0207697_10000378
1689 Ga0207697_10047102
1690 Ga0207656_10003936
1691 Ga0207656_10007815
1692 Ga0207656_10083753
1693 Ga0207713_1000064
1694 Ga0207682_10000106
1695 Ga0207682_10001272
1696 Ga0207682_10001404
1697 Ga0207682_10001758
1698 Ga0207682_10026844
1699 Ga0207642_10082255
1700 Ga0207710_10055288
1701 Ga0207688_10000062
1702 Ga0207688_10002838
1703 Ga0207688_10112938
1704 Ga0207688_10132486
1705 Ga0207680_10003378
1706 Ga0207680_10006222
1707 Ga0207680_10025862
1708 Ga0207680_10030104
1709 Ga0207680_10031279
1710 Ga0207680_10095925
1711 Ga0207647_10000160
1712 Ga0207647_10001190
1713 Ga0207647_10005355
1714 Ga0207647_10006047
1715 Ga0207647_10030737
1716 Ga0207645_10000643
1717 Ga0207645_10000947
1718 Ga0207645_10001010
1719 Ga0207645_10003404
1720 Ga0207645_10006139
1721 Ga0207645_10007374
1722 Ga0207645_10008382
1723 Ga0207645_10024574
1724 Ga0207645_10080836
1725 Ga0207645_10151205
1726 Ga0207643_10000555
1727 Ga0207643_10000994
1728 Ga0207643_10004775
1729 Ga0207643_10030729
1730 Ga0207705_10052854
1731 Ga0207684_10002166
1732 Ga0207684_10024612
1733 Ga0207654_10040521
1734 Ga0207707_10019848
1735 Ga0207695_10006665
1736 Ga0207695_10036528
1737 Ga0207695_10412696
1738 Ga0207671_10052511
1739 Ga0207671_10071949
1740 Ga0207662_10010347
1741 Ga0207662_10017900
1742 Ga0207657_10001682
1743 Ga0207657_10013412
1744 Ga0207657_10030166
1745 Ga0207657_10054821
1746 Ga0207649_10012511
1747 Ga0207649_10014014
1748 Ga0207649_10027271
1749 Ga0207649_10029848
1750 Ga0207649_10069468
1751 Ga0207652_10034716
1752 Ga0207646_10009371
1753 Ga0207646_10270335
1754 Ga0207681_10019385
1755 Ga0207694_10019888
1756 Ga0207694_10209071
1757 Ga0207694_10226019
1758 Ga0207650_10002778
1759 Ga0207650_10004595
1760 Ga0207650_10004708
1761 Ga0207650_10016518
1762 Ga0207650_10057057
1763 Ga0207650_10107662
1764 Ga0207659_10001627
1765 Ga0207659_10016723
1766 Ga0207659_10036297
1767 Ga0207659_10036463
1768 Ga0207659_10040394
1769 Ga0207659_10170752
1770 Ga0207644_10002345
1771 Ga0207644_10005166
1772 Ga0207644_10006271
1773 Ga0207644_10006648
1774 Ga0207644_10015798
1775 Ga0207644_10023527
1776 Ga0207644_10025774
1777 Ga0207644_10034330
1778 Ga0207644_10057467
1779 Ga0207644_10129872
1780 Ga0207644_10245047
1781 Ga0207644_10266992
1782 Ga0207690_10000012
1783 Ga0207690_10047939
1784 Ga0207690_10065701
1785 Ga0207690_10078695
1786 Ga0207706_10000014
1787 Ga0207706_10001235
1788 Ga0207706_10005642
1789 Ga0207706_10061497
1790 Ga0207706_10143690
1791 Ga0207706_10151102
1792 Ga0207686_10037457
1793 Ga0207670_10064043
1794 Ga0207669_10006691
1795 Ga0207669_10008073
1796 Ga0207669_10008872
1797 Ga0207669_10125381
1798 Ga0207704_10008463
1799 Ga0207704_10057591
1800 Ga0207704_10068553
1801 Ga0207665_10065201
1802 Ga0207691_10000427
1803 Ga0207691_10000453
1804 Ga0207691_10004101
1805 Ga0207691_10004432
1806 Ga0207691_10004600
1807 Ga0207691_10022987
1808 Ga0207691_10024015
1809 Ga0207691_10036867
1810 Ga0207691_10050884
1811 Ga0207691_10057558
1812 Ga0207691_10130283
1813 Ga0207691_10206803
1814 Ga0207691_10288998
1815 Ga0207711_10005592
1816 Ga0207711_10033577
1817 Ga0207711_10044709
1818 Ga0207689_10001490
1819 Ga0207689_10001602
1820 Ga0207689_10002003
1821 Ga0207689_10006947
1822 Ga0207689_10009876
1823 Ga0207689_10016553
1824 Ga0207689_10053561
1825 Ga0207689_10075975
1826 Ga0207689_10083823
1827 Ga0207661_10040145
1828 Ga0207679_10015901
1829 Ga0207679_10037248
1830 Ga0207679_10123011
1831 Ga0207679_10270107
1832 Ga0207667_10004701
1833 Ga0207667_10006720
1834 Ga0207667_10078813
1835 Ga0207667_10190424
1836 Ga0207651_10014505
1837 Ga0207651_10024084
1838 Ga0207651_10108695
1839 Ga0207712_10022690
1840 Ga0207712_10056810
1841 Ga0207668_10003043
1842 Ga0207668_10009335
1843 Ga0207668_10013796
1844 Ga0207668_10018430
1845 Ga0207668_10041736
1846 Ga0207668_10048637
1847 Ga0207668_10102863
1848 Ga0207668_10208791
1849 Ga0207640_10022876
1850 Ga0207640_10034512
1851 Ga0207640_10051886
1852 Ga0207640_10074161
1853 Ga0207640_10079323
1854 Ga0207640_10081190
1855 Ga0207658_10021436
1856 Ga0207658_10038978
1857 Ga0207658_10067663
1858 Ga0207658_10071097
1859 Ga0207658_10075476
1860 Ga0207658_10098441
1861 Ga0207658_10106611
1862 Ga0207658_10194170
1863 Ga0207658_10259461
1864 Ga0207658_10355677
1865 Ga0207677_10018111
1866 Ga0207677_10036704
1867 Ga0207677_10087343
1868 Ga0207677_10094735
1869 Ga0207677_10123124
1870 Ga0207677_10270318
1871 Ga0207703_10001278
1872 Ga0207703_10003727
1873 Ga0207703_10005904
1874 Ga0207703_10019294
1875 Ga0207703_10077042
1876 Ga0207703_10162644
1877 Ga0207703_10172017
1878 Ga0207639_10017538
1879 Ga0207639_10059228
1880 Ga0207639_10061158
1881 Ga0207639_10100845
1882 Ga0207639_10147748
1883 Ga0207639_10191095
1884 Ga0207678_10000076
1885 Ga0207678_10002409
1886 Ga0207678_10014291
1887 Ga0207678_10014424
1888 Ga0207678_10018320
1889 Ga0207678_10019124
1890 Ga0207678_10048083
1891 Ga0207678_10063147
1892 Ga0207678_10144250
1893 Ga0207708_10000721
1894 Ga0207708_10089789
1895 Ga0207708_10178950
1896 Ga0207702_10002780
1897 Ga0207702_10055110
1898 Ga0207702_10105027
1899 Ga0207702_10291767
1900 Ga0207641_10009563
1901 Ga0207641_10010972
1902 Ga0207641_10017532
1903 Ga0207641_10021295
1904 Ga0207641_10046720
1905 Ga0207641_10101091
1906 Ga0207641_10178279
1907 Ga0207641_10246708
1908 Ga0207641_10283388
1909 Ga0207648_10000622
1910 Ga0207648_10001351
1911 Ga0207648_10003119
1912 Ga0207648_10008451
1913 Ga0207648_10016411
1914 Ga0207648_10059208
1915 Ga0207676_10007978
1916 Ga0207676_10019486
1917 Ga0207676_10024327
1918 Ga0207676_10100702
1919 Ga0207676_10451433
1920 Ga0207674_10002529
1921 Ga0207674_10004238
1922 Ga0207674_10007009
1923 Ga0207674_10024335
1924 Ga0207674_10052152
1925 Ga0207674_10101207
1926 Ga0207675_100000493
1927 Ga0207675_100001240
1928 Ga0207675_100007517
1929 Ga0207675_100029496
1930 Ga0207675_100090772
1931 Ga0207675_100187450
1932 Ga0207683_10000008
1933 Ga0207683_10000133
1934 Ga0207683_10000255
1935 Ga0207683_10000504
1936 Ga0207683_10003640
1937 Ga0207683_10008887
1938 Ga0207683_10012625
1939 Ga0207683_10039146
1940 Ga0207683_10159100
1941 Ga0207698_10024032
1942 Ga0207698_10026089
1943 Ga0207698_10044355
1944 Ga0207698_10132097
1945 Ga0207698_10137566
1946 Ga0207698_10200548
1947 Ga0209371_1000185
1948 Ga0209371_1021121
1949 Ga0209971_1005327
1950 Ga0209998_10002067
1951 Ga0209813_10008703
1952 Ga0209974_10011520
1953 Ga0207428_10176037
1954 Ga0268266_10006244
1955 Ga0268266_10111725
1956 Ga0268266_10136948
1957 Ga0268266_10288654
1958 Ga0268265_10147329
1959 Ga0268265_10154199
1960 Ga0268264_10002240
1961 Ga0268264_10018760
1962 Ga0268264_10027217
1963 Ga0268264_10103779
1964 Ga0307515_10095930
1965 Ga0268256_1000847
1966 Ga0268256_1023750
1967 Ga0265332_10000026
1968 Ga0265332_10041535
1969 Ga0265325_10000686
1970 Ga0265316_10036183
1971 Ga0307513_10026627
1972 Ga0307408_100000227
1973 Ga0307408_100008544
1974 Ga0307408_100011033
1975 Ga0307516_10025491
1976 Ga0307405_10008674
1977 Ga0307405_10050431
1978 Ga0307413_10004560
1979 Ga0307413_10160565
1980 Ga0307410_10010598
1981 Ga0307410_10018790
1982 Ga0307406_10005672
1983 Ga0307406_10012655
1984 Ga0307407_10008227
1985 Ga0307407_10017947
1986 Ga0307412_10000011
1987 Ga0307412_10000819
1988 Ga0307412_10001311
1989 Ga0307412_10007528
1990 Ga0307412_10015894
1991 Ga0307412_10038366
1992 Ga0307409_100011472
1993 Ga0307416_100014656
1994 Ga0307416_100018099
1995 Ga0307416_100025378
1996 Ga0307411_10000342
1997 Ga0307415_100012133
1998 Ga0373955_0020600
1999 Ga0373955_0102507
2000 Ga0373942_0038342
2001 Ga0373924_0050746
2002 Ga0373931_0070127
2003 Ga0373927_0084473
2004 Ga0373947_0053707
2005 Ga0373937_0093668
2006 Ga0373937_0228789
2007 Ga0373925_0008350
2008 Ga0373925_0146143
2009 Ga0395900_0049220
2010 Ga0395900_0068346
2011 Ga0395900_0124396
2012 Ga0395898_0001927
2013 Ga0395898_0089622
2014 Ga0395905_0000079
2015 Ga0395905_0021231
2016 Ga0436364_0213269
2017 Ga0395901_0002134
2018 Ga0395901_0010899
2019 Ga0395901_0022287
2020 Ga0395901_0041093
2021 Ga0395901_0047593
2022 Ga0436365_0414012
2023 Ga0436361_0524475
2024 Ga0436363_0071338
2025 Ga0451791_1678248
2026 Ga0439448_0000556
2027 Ga0439455_0013825
2028 Ga0451577_0073212
2029 Ga0466973_0003647
2030 Ga0466965_0001188
2031 Ga0466966_0000753
2032 Ga0466966_0014807
2033 Ga0466966_0016639
2034 Ga0466961_0008782
2035 Ga0466961_0013890
2036 Ga0466961_0054525
2037 Ga0466961_0060424
2038 Ga0466963_0030764
2039 Ga0453684_0000659
2040 Ga0453684_0013238
2041 Ga0453684_0016855
2042 Ga0453684_0032124
2043 Ga0466971_0035732
2044 Ga0466971_0039807
2045 Ga0466957_0079131
2046 Ga0451576_0000917
2047 Ga0466958_0007770
2048 Ga0466958_0011823
2049 Ga0466958_0066601
2050 Ga0495592_0023344
2051 Ga0495603_0008549
2052 Ga0495603_0022435
2053 Ga0495590_0005178
2054 Ga0495590_0005410
2055 Ga0495590_0027735
2056 Ga0495590_0037926
2057 Ga0495591_003395
2058 Ga0495591_005964
2059 Ga0495629_0001148
2060 Ga0495629_0007503
2061 Ga0495629_0014432
2062 Ga0495629_0025391
2063 Ga0495629_0045030
2064 Ga0495638_0003608
2065 Ga0495638_0043787
2066 Ga0495651_0016179
2067 Ga0495653_0049709
2068 Ga0495653_0177358
2069 Ga0495650_0007327
2070 Ga0495650_0034514
2071 Ga0495650_0056407
2072 Ga0495580_0017512
2073 Ga0495580_0027508
2074 Ga0495580_0027552
2075 Ga0495580_0111005
2076 Ga0495582_0005503
2077 Ga0495582_0014589
2078 Ga0495605_0008591
2079 Ga0495605_0051566
2080 Ga0495662_0033519
2081 Ga0495596_0006198
2082 Ga0495607_0000009
2083 Ga0495607_0019953
2084 Ga0495583_0035066
2085 Ga0495606_0017079
2086 Ga0495606_0029191
2087 Ga0495606_0042270
2088 Ga0495608_0015231
2089 Ga0495610_0002064
2090 Ga0495616_0007729
2091 Ga0495618_0003307
2092 Ga0495618_0016177
2093 Ga0495628_0019963
2094 Ga0495628_0046029
2095 Ga0495628_0055588
2096 Ga0495628_0084035
2097 Ga0495630_0052730
2098 Ga0495630_0084542
2099 Ga0495637_0011099
2100 Ga0495643_0011706
2101 Ga0495644_0026808
2102 Ga0495666_0007034
2103 Ga0495666_0007567
2104 Ga0495642_0041987
2105 Ga0495652_0007296
2106 Ga0495652_0045841
2107 Ga0495665_0009073
2108 Ga0495665_0009210
2109 Ga0495640_0017143
2110 Ga0495587_0013269
2111 Ga0495621_0005808
2112 Ga0495597_0008664
2113 Ga0495597_0057003
2114 Ga0495597_0062288
2115 Ga0495645_0004772
2116 Ga0495645_0115988
2117 Ga0495622_0005858
2118 Ga0495622_0011359
2119 Ga0495668_0140163
2120 Ga0495634_0015178
2121 Ga0495634_0041591
2122 Ga0495611_0020582
2123 Ga0495635_0005295
2124 Ga0495635_0123230
2125 Ga0495661_0002821
2126 Ga0495661_0011330
2127 Ga0495661_0023525
2128 Ga0495599_0029487
2129 Ga0495623_0000579
2130 Ga0495623_0022842
2131 Ga0495623_0030764
2132 Ga0495646_0053046
2133 Ga0495658_0014701
2134 Ga0495658_0140661
2135 Ga0495613_0015540
2136 Ga0495624_0007224
2137 Ga0495624_0128791
2138 Ga0495649_0005474
2139 Ga0495649_0007873
2140 Ga0495649_0008109
2141 Ga0495649_0032271
2142 Ga0495589_0015924
2143 Ga0495589_0017912
2144 Ga0495600_0001590
2145 Ga0495600_0011974
2146 Ga0495581_0001489
2147 Ga0495581_0003869
2148 Ga0495604_0018528
2149 Ga0495604_0021070
2150 Ga0495674_0006044
2151 Ga0495674_0023512
2152 Ga0495674_0032916
2153 Ga0495674_0042812
2154 Ga0495674_0124537
2155 Ga0495676_0120811
2156 Ga0495680_0002302
2157 Ga0495680_0222080
2158 Ga0495683_0003339
2159 Ga0495683_0004598
2160 Ga0495683_0018207
2161 Ga0495683_0065114
2162 Ga0495683_0123875
2163 Ga0495687_000053
2164 Ga0495687_001004
2165 Ga0495687_009162
2166 Ga0495687_012920
2167 Ga0495687_023722
2168 Ga0495675_0001937
2169 Ga0495675_0022841
2170 Ga0495675_0067509
2171 Ga0495679_000156
2172 Ga0495679_011687
2173 Ga0495679_023716
2174 Ga0495673_0037562
2175 Ga0495684_0108710
2176 Ga0495686_0000519
2177 Ga0495686_0047356
2178 Ga0495593_0001073
2179 Ga0495593_0040922
2180 Ga0495593_0065877
2181 Ga0495602_0040914
2182 Ga0495602_0079957
2183 Ga0495614_0000394
2184 Ga0495614_0006231
2185 Ga0495626_0025837
2186 Ga0495626_0096504
2187 Ga0496100_0103449
2188 Ga0496100_0130027
2189 Ga0496100_0159831
2190 Ga0496101_0020522
2191 Ga0496101_0034664
2192 Ga0496101_0048173
2193 Ga0496102_0010175
2194 Ga0496102_0017335
2195 Ga0496102_0025230
2196 Ga0496102_0031026
2197 Ga0496102_0052864
2198 Ga0496102_0061722
2199 Ga0496102_0117818
2200 Ga0496102_0121758
2201 Ga0496102_0141068
2202 Ga0496102_0327359
2203 Ga0496103_0014601
2204 Ga0496103_0151420
2205 Ga0496103_0164294
2206 Ga0496104_0010736
2207 Ga0496104_0049904
2208 Ga0496104_0078895
2209 Ga0496105_0004400
2210 Ga0496105_0024174
2211 Ga0496105_0260987
2212 Ga0496106_0002288
2213 Ga0496106_0193296
2214 Ga0496107_0068311
2215 Ga0496107_0078947
2216 Ga0496107_0197081
2217 Ga0496108_0014298
2218 Ga0496108_0035500
2219 Ga0496108_0066034
2220 Ga0496109_0036151
2221 Ga0496109_0048566
2222 Ga0496109_0228278
2223 Ga0496109_0447564
2224 Ga0496110_0020925
2225 Ga0496110_0134053
2226 Ga0496110_0165336
2227 Ga0496111_0296604
2228 Ga0496112_0002051
2229 Ga0496112_0033732
2230 Ga0496112_0122979
2231 Ga0496113_0028510
2232 Ga0496113_0056135
2233 Ga0496114_0001851
2234 Ga0496114_0056745
2235 Ga0496114_0306124
2236 Ga0496115_0099610
2237 Ga0496116_0010706
2238 Ga0496116_0015926
2239 Ga0496116_0019593
2240 Ga0496117_0005096
2241 Ga0496117_0008616
2242 Ga0496117_0025161
2243 Ga0496117_0032547
2244 Ga0496117_0042762
2245 Ga0496117_0046755
2246 Ga0496118_0001664
2247 Ga0496118_0002738
2248 Ga0496118_0009250
2249 Ga0496118_0011642
2250 Ga0496118_0020035
2251 Ga0496118_0025697
2252 Ga0496118_0075633
2253 Ga0496118_0103979
2254 Ga0496119_0007583
2255 Ga0496119_0018374
2256 Ga0496119_0019501
2257 Ga0496119_0051972
2258 Ga0496119_0068323
2259 Ga0496120_0007282
2260 Ga0496120_0038111
2261 Ga0496121_0000164
2262 Ga0496121_0004956
2263 Ga0496121_0025108
2264 Ga0496121_0026445
2265 Ga0496121_0066813
2266 Ga0496121_0108325
2267 Ga0496122_0000865
2268 Ga0496122_0001706
2269 Ga0496122_0042110
2270 Ga0496122_0047209
2271 Ga0496122_0086012
2272 Ga0496123_0000203
2273 Ga0496123_0001919
2274 Ga0496123_0031845
2275 Ga0496124_0035716
2276 Ga0496124_0039370
2277 Ga0496124_0098439
2278 Ga0496125_0000011
2279 Ga0496125_0000241
2280 Ga0496125_0016616
2281 Ga0496125_0047447
2282 Ga0496125_0085613
2283 Ga0496126_0000118
2284 Ga0496126_0004623
2285 Ga0496126_0052121
2286 Ga0496126_0091523
2287 Ga0496126_0127914
2288 Ga0496126_0274708
2289 Ga0495678_020912
2290 Ga0495682_0069519
2291 Ga0501033_0083225
2292 Ga0501034_0176816
2293 Ga0501043_0191811
2294 Ga0501067_0067477
2295 Ga0501069_0113096
2296 Ga0501070_0007055
2297 Ga0501072_0027713
2298 Ga0501074_0052928
2299 Ga0501080_0037277
2300 Ga0501083_0030372
2301 Ga0501044_0002376
2302 nmdc:mga03683_56980_c1
2303 nmdc:mga0k408_24569_c1
2304 nmdc:mga0k408_6630_c1
2305 nmdc:mga06z11_7546_c1
2306 nmdc:mga07m45_32734_c1
2307 nmdc:mga07m45_3489_c1
2308 nmdc:mga07m45_39477_c1
2309 nmdc:mga07m45_919_c1
2310 nmdc:mga07m45_96793_c1
2311 nmdc:mga08y16_186143_c1
2312 nmdc:mga08y16_62834_c1
2313 nmdc:mga0n895_164178_c1
2314 nmdc:mga0n895_24727_c1
2315 nmdc:mga0n895_24867_c1
2316 nmdc:mga0n895_279629_c2
2317 nmdc:mga0rr50_119776_c1
2318 nmdc:mga0a205_31268_c1
2319 nmdc:mga0sz30_56067_c1
2320 Ga0495601_0102974
2321 Ga0500658_0002972
2322 Ga0500568_0011536
2323 Ga0501084_0072201
2324 Ga0466962_0000108
2325 Ga0466962_0002594
2326 2501074651
2327 2501410112
2328 2509128041
2329 2511095434
2330 2511105092
2331 2513556029
2332 2513561341
2333 2513959543
2334 2514046879
2335 2515688313
2336 2519457301
2337 2526061142
2338 2527078482
2339 2548846463
2340 2563055488
2341 2574433462
2342 2585292157
2343 2599738759
2344 2599747630
2345 2599903165
2346 2600209514
2347 2644121416
2348 2644302459
2349 2676745573
2350 2713478867
2351 2738823073
2352 2738835280
2353 2738876759
2354 2739188778
2355 2739223430
2356 2740065054
2357 2746086764
2358 2746094163
2359 2753568591
2360 2817259502
2361 2817277171
2362 2817454085
2363 2819622610
2364 2819634712
2365 2842329101
2366 2842353480
2367 2842459004
2368 2856290418
2369 2857359953
2370 2857578030
2371 2858952954
2372 2863425400
2373 2870069639
2374 2895516129
2375 2900636816
2376 2904488144
2377 2904570146
2378 2904577322
2379 2919531095
2380 2921647159
2381 2928112667
2382 2928139640
2383 2928163721
2384 2928170528
2385 2928175849
2386 2928508477
2387 2928541489
2388 2941480431
2389 2945934838
2390 2981995760
2391 2990704585
2392 639787655
2393 642425144
2394 642416023
2395 642594847
2396 642623496
2397 8003958757
2398 8018848092
2399 8020810292
2400 8020939186
2401 8020948523
2402 8020956244
2403 8021127045
2404 8039101474
2405 8040169598
2406 8040174631
2407 8055270776
2408 8055305578

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01094

ANF_receptor

Receptor family ligand binding region

88

276

0.91

PF13458

Peripla_BP_6

Periplasmic binding protein

68

421

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ukj-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.9773 23 382
4f8j-assembly1.cif.gz_A the structure of an aromatic compound transport protein from rhodopseudomonas palustris in complex with p-coumarate 0.9763 23 382
3sg0-assembly1.cif.gz_A the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.9724 24 381
3ukj-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.9719 23 382
3uk0-assembly1.cif.gz_A rpd_1889 protein, an extracellular ligand-binding receptor from rhodopseudomonas palustris. 0.9705 23 382
ID Description Score Start End Superfamily
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9728 143 264 3.40.50.2300
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9724 142 273 3.40.50.2300
4nqrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9479 142 264 3.40.50.2300
4fb4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9422 23 364 3.40.50.2300
4dqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.933 22 364 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A352S038-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9867 61 323
AF-A0A536YZ31-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9854 30 220
AF-A0A011R3T8-F1-model_v4 Receptor family ligand binding region 0.9691 81 226
AF-A0A352S038-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9649 61 323
AF-A0A7C1G6Q7-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9628 154 382

Map