F491621
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1204 | 463 | 2408 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10053993|Ga0207648_100539932 |
| Length | 426 |
| Sequence | MAMVVVTMDVPAIAVAATENVLSAQLLTLLLGVRLRGFYDLVIGGPMKHGALVGILAGQLIAGLALADVNVGVTLSATGPAASLGIPEKNTIEMLPTTVAGQKVNWIILDDGSDTTKAVTNTKKLIAEDKVDVIVGSTVTPNSLAMIDVVADAETPMISMAASARIVDPTNPKTKWVFKTPQNDALMADAIAVHMKANGVKTMGYIGFNDAYGDGWLAEIKRSAQTAGIKVVAEEKYNRSDASVTGQVLKLVAANPDAILIGASGTPGATPQKELVGRNYKGKIYQTHGVANPDFLRVVGKDGNGTLLPIGPMLVYEQLPDSNPIKKVAAEYITQYEAKYGKGSRTTFGGHGYDAYLLLAKAIPEALKKAKPGTKEFRVALRDALETSNVVGAHGVFVMGPQEHNGLDNRARVMIRIDNGQWVLAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 252 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 382 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 383 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 384 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 385 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 386 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 387 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 388 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 389 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 390 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 391 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 392 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 393 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 394 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 395 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 396 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 397 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 398 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 399 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 400 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 401 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 402 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 403 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 404 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 405 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 406 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 407 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 408 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 409 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 410 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 411 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 412 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 413 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 414 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 415 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 416 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 417 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 418 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 419 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 420 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 421 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 422 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 423 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 424 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 425 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 426 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 427 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 428 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 429 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 430 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 431 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 432 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 433 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 434 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 435 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 436 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 437 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 438 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 439 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 440 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 441 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 442 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 443 | 2941479691 | |||
| 444 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 445 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 446 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 447 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 448 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 449 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 450 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 451 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 452 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 453 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 454 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 455 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 456 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 457 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 458 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 459 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 460 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 461 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 462 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 463 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.02 |
| Metatranscriptomes | 0.08 |
| Isolates | 6.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.56 |
| Nodule | 1.33 |
| Rhizoplane | 4.73 |
| Rhizosphere | 78.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207648_10053993 | 3300026089 | Bacteria | 3511 |
| 2 | JGI24746J21847_1011793 | 3300001977 | Bacteria | 1283 |
| 3 | JGI24740J21852_10005037 | 3300001979 | Bacteria | 5610 |
| 4 | JGI24739J22299_10006235 | 3300001989 | Bacteria | 4501 |
| 5 | JGI24739J22299_10011344 | 3300001989 | Bacteria | 3291 |
| 6 | JGI24739J22299_10030746 | 3300001989 | Bacteria | 1860 |
| 7 | JGI24737J22298_10006627 | 3300001990 | Bacteria | 3945 |
| 8 | JGI24737J22298_10009084 | 3300001990 | Bacteria | 3312 |
| 9 | JGI24737J22298_10010007 | 3300001990 | Bacteria | 3139 |
| 10 | JGI24735J21928_10000162 | 3300002067 | Bacteria | 23762 |
| 11 | JGI24735J21928_10000241 | 3300002067 | Bacteria | 19210 |
| 12 | JGI24735J21928_10003000 | 3300002067 | Bacteria | 5802 |
| 13 | JGI24735J21928_10005356 | 3300002067 | Bacteria | 4258 |
| 14 | JGI24738J21930_10005721 | 3300002075 | Bacteria | 2958 |
| 15 | JGI25156J39149_1000310 | 3300002705 | Bacteria | 32338 |
| 16 | JGI25156J39149_1000485 | 3300002705 | Bacteria | 23858 |
| 17 | JGI25156J39149_1000815 | 3300002705 | Bacteria | 15924 |
| 18 | rootL2_10004490 | 3300003322 | Bacteria | 3204 |
| 19 | rootL2_10011098 | 3300003322 | Bacteria | 8546 |
| 20 | rootH1_10085817 | 3300003323 | Bacteria | 2065 |
| 21 | JGI25160J50197_1000016 | 3300003354 | Bacteria | 247819 |
| 22 | Ga0006556J51387_1038757 | 3300003479 | Bacteria | 1205 |
| 23 | Ga0055533_1000331 | 3300003756 | Bacteria | 20806 |
| 24 | Ga0055533_1001876 | 3300003756 | Bacteria | 5234 |
| 25 | Ga0055532_1000022 | 3300003758 | Bacteria | 248737 |
| 26 | Ga0055532_1000999 | 3300003758 | Bacteria | 8886 |
| 27 | Ga0055532_1002396 | 3300003758 | Bacteria | 3934 |
| 28 | Ga0055532_1003782 | 3300003758 | Bacteria | 2460 |
| 29 | Ga0055527_1000016 | 3300003760 | Bacteria | 248736 |
| 30 | Ga0055527_1000645 | 3300003760 | Bacteria | 10581 |
| 31 | Ga0055535_1000017 | 3300003761 | Bacteria | 248735 |
| 32 | Ga0055535_1001611 | 3300003761 | Bacteria | 10581 |
| 33 | Ga0055535_1001620 | 3300003761 | Bacteria | 10545 |
| 34 | Ga0055542_1000030 | 3300003762 | Bacteria | 248717 |
| 35 | Ga0055542_1001587 | 3300003762 | Bacteria | 10545 |
| 36 | Ga0055542_1002572 | 3300003762 | Bacteria | 5776 |
| 37 | Ga0055529_1000033 | 3300003763 | Bacteria | 248734 |
| 38 | Ga0055529_1001023 | 3300003763 | Bacteria | 13397 |
| 39 | Ga0055528_1007441 | 3300003790 | Bacteria | 4841 |
| 40 | Ga0058692_1001054 | 3300003856 | Bacteria | 10776 |
| 41 | Ga0065165_1000875 | 3300005262 | Bacteria | 38986 |
| 42 | Ga0065715_10154227 | 3300005293 | Bacteria | 1695 |
| 43 | Ga0070658_10020490 | 3300005327 | Bacteria | 5300 |
| 44 | Ga0070658_10024613 | 3300005327 | Bacteria | 4828 |
| 45 | Ga0070658_10027656 | 3300005327 | Bacteria | 4550 |
| 46 | Ga0070658_10036786 | 3300005327 | Bacteria | 3946 |
| 47 | Ga0070658_10053362 | 3300005327 | Bacteria | 3281 |
| 48 | Ga0070658_10102762 | 3300005327 | Bacteria | 2363 |
| 49 | Ga0070676_10000586 | 3300005328 | Bacteria | 17625 |
| 50 | Ga0070676_10089032 | 3300005328 | Bacteria | 1887 |
| 51 | Ga0070676_10094565 | 3300005328 | Bacteria | 1836 |
| 52 | Ga0070683_100005154 | 3300005329 | Bacteria | 10869 |
| 53 | Ga0070683_100006341 | 3300005329 | Bacteria | 9919 |
| 54 | Ga0070683_100013442 | 3300005329 | Bacteria | 7139 |
| 55 | Ga0070683_100034936 | 3300005329 | Bacteria | 4595 |
| 56 | Ga0070690_100043230 | 3300005330 | Bacteria | 2856 |
| 57 | Ga0070690_100061114 | 3300005330 | Bacteria | 2426 |
| 58 | Ga0070670_100006292 | 3300005331 | Bacteria | 10052 |
| 59 | Ga0070670_100010440 | 3300005331 | Bacteria | 7926 |
| 60 | Ga0070670_100015920 | 3300005331 | Bacteria | 6454 |
| 61 | Ga0070670_100032122 | 3300005331 | Bacteria | 4521 |
| 62 | Ga0070670_100109217 | 3300005331 | Bacteria | 2383 |
| 63 | Ga0070670_100125476 | 3300005331 | Bacteria | 2215 |
| 64 | Ga0070677_10000147 | 3300005333 | Bacteria | 23782 |
| 65 | Ga0070677_10000950 | 3300005333 | Bacteria | 9386 |
| 66 | Ga0068869_100002581 | 3300005334 | Bacteria | 10938 |
| 67 | Ga0068869_100004238 | 3300005334 | Bacteria | 8897 |
| 68 | Ga0068869_100008639 | 3300005334 | Bacteria | 6579 |
| 69 | Ga0068869_100016878 | 3300005334 | Bacteria | 4934 |
| 70 | Ga0068869_100020996 | 3300005334 | Bacteria | 4488 |
| 71 | Ga0068869_100021186 | 3300005334 | Bacteria | 4468 |
| 72 | Ga0070666_10006093 | 3300005335 | Bacteria | 7411 |
| 73 | Ga0070666_10033752 | 3300005335 | Bacteria | 3389 |
| 74 | Ga0070666_10039705 | 3300005335 | Bacteria | 3138 |
| 75 | Ga0070666_10068898 | 3300005335 | Bacteria | 2405 |
| 76 | Ga0070680_100007735 | 3300005336 | Bacteria | 8191 |
| 77 | Ga0070680_100115258 | 3300005336 | Bacteria | 2239 |
| 78 | Ga0068868_100008523 | 3300005338 | Bacteria | 7341 |
| 79 | Ga0068868_100040309 | 3300005338 | Bacteria | 3635 |
| 80 | Ga0068868_100083558 | 3300005338 | Bacteria | 2564 |
| 81 | Ga0068868_100087613 | 3300005338 | Bacteria | 2504 |
| 82 | Ga0068868_100211047 | 3300005338 | Bacteria | 1622 |
| 83 | Ga0068868_100255748 | 3300005338 | Bacteria | 1475 |
| 84 | Ga0070660_100000108 | 3300005339 | Bacteria | 51014 |
| 85 | Ga0070660_100006646 | 3300005339 | Bacteria | 8022 |
| 86 | Ga0070660_100021779 | 3300005339 | Bacteria | 4730 |
| 87 | Ga0070660_100038176 | 3300005339 | Bacteria | 3644 |
| 88 | Ga0070660_100124106 | 3300005339 | Bacteria | 2062 |
| 89 | Ga0070689_100033559 | 3300005340 | Bacteria | 3911 |
| 90 | Ga0070689_100076224 | 3300005340 | Bacteria | 2627 |
| 91 | Ga0070687_100016228 | 3300005343 | Bacteria | 3390 |
| 92 | Ga0070687_100038716 | 3300005343 | Bacteria | 2392 |
| 93 | Ga0070661_100001352 | 3300005344 | Bacteria | 17151 |
| 94 | Ga0070661_100010105 | 3300005344 | Bacteria | 6556 |
| 95 | Ga0070661_100014151 | 3300005344 | Bacteria | 5619 |
| 96 | Ga0070661_100037763 | 3300005344 | Bacteria | 3514 |
| 97 | Ga0070661_100047409 | 3300005344 | Bacteria | 3144 |
| 98 | Ga0070661_100077110 | 3300005344 | Bacteria | 2456 |
| 99 | Ga0070661_100142053 | 3300005344 | Bacteria | 1810 |
| 100 | Ga0070692_10075234 | 3300005345 | Bacteria | 1808 |
| 101 | Ga0070668_100003337 | 3300005347 | Bacteria | 11837 |
| 102 | Ga0070668_100003380 | 3300005347 | Bacteria | 11769 |
| 103 | Ga0070668_100007343 | 3300005347 | Bacteria | 8172 |
| 104 | Ga0070668_100010138 | 3300005347 | Bacteria | 6986 |
| 105 | Ga0070668_100013434 | 3300005347 | Bacteria | 6112 |
| 106 | Ga0070668_100019925 | 3300005347 | Bacteria | 5055 |
| 107 | Ga0070668_100023352 | 3300005347 | Bacteria | 4677 |
| 108 | Ga0070668_100035467 | 3300005347 | Bacteria | 3803 |
| 109 | Ga0070668_100149220 | 3300005347 | Bacteria | 1889 |
| 110 | Ga0070669_100006798 | 3300005353 | Bacteria | 8229 |
| 111 | Ga0070669_100034853 | 3300005353 | Bacteria | 3644 |
| 112 | Ga0070669_100101833 | 3300005353 | Bacteria | 2168 |
| 113 | Ga0070669_100217881 | 3300005353 | Bacteria | 1508 |
| 114 | Ga0070675_100003409 | 3300005354 | Bacteria | 12038 |
| 115 | Ga0070675_100004470 | 3300005354 | Bacteria | 10666 |
| 116 | Ga0070675_100007104 | 3300005354 | Bacteria | 8623 |
| 117 | Ga0070675_100009671 | 3300005354 | Bacteria | 7507 |
| 118 | Ga0070675_100011427 | 3300005354 | Bacteria | 6949 |
| 119 | Ga0070675_100052154 | 3300005354 | Bacteria | 3362 |
| 120 | Ga0070675_100084438 | 3300005354 | Bacteria | 2652 |
| 121 | Ga0070675_100097990 | 3300005354 | Bacteria | 2466 |
| 122 | Ga0070671_100002148 | 3300005355 | Bacteria | 15230 |
| 123 | Ga0070671_100002235 | 3300005355 | Bacteria | 14943 |
| 124 | Ga0070671_100002777 | 3300005355 | Bacteria | 13599 |
| 125 | Ga0070671_100004290 | 3300005355 | Bacteria | 11282 |
| 126 | Ga0070671_100007470 | 3300005355 | Bacteria | 8737 |
| 127 | Ga0070671_100035756 | 3300005355 | Bacteria | 4115 |
| 128 | Ga0070671_100059174 | 3300005355 | Bacteria | 3188 |
| 129 | Ga0070671_100084613 | 3300005355 | Bacteria | 2652 |
| 130 | Ga0070671_100085183 | 3300005355 | Bacteria | 2644 |
| 131 | Ga0070671_100182876 | 3300005355 | Bacteria | 1775 |
| 132 | Ga0070674_100000109 | 3300005356 | Bacteria | 38448 |
| 133 | Ga0070674_100009365 | 3300005356 | Bacteria | 5865 |
| 134 | Ga0070674_100012642 | 3300005356 | Bacteria | 5189 |
| 135 | Ga0070674_100035000 | 3300005356 | Bacteria | 3360 |
| 136 | Ga0070674_100113592 | 3300005356 | Bacteria | 1993 |
| 137 | Ga0070673_100000814 | 3300005364 | Bacteria | 17469 |
| 138 | Ga0070673_100002188 | 3300005364 | Bacteria | 11805 |
| 139 | Ga0070673_100017811 | 3300005364 | Bacteria | 5061 |
| 140 | Ga0070673_100075921 | 3300005364 | Bacteria | 2712 |
| 141 | Ga0070673_100103956 | 3300005364 | Bacteria | 2344 |
| 142 | Ga0070688_100005571 | 3300005365 | Bacteria | 6645 |
| 143 | Ga0070688_100036468 | 3300005365 | Bacteria | 2991 |
| 144 | Ga0070659_100000070 | 3300005366 | Bacteria | 79815 |
| 145 | Ga0070659_100002205 | 3300005366 | Bacteria | 13848 |
| 146 | Ga0070659_100019281 | 3300005366 | Bacteria | 5165 |
| 147 | Ga0070659_100034631 | 3300005366 | Bacteria | 3928 |
| 148 | Ga0070667_100003743 | 3300005367 | Bacteria | 12915 |
| 149 | Ga0070667_100005378 | 3300005367 | Bacteria | 10695 |
| 150 | Ga0070667_100006224 | 3300005367 | Bacteria | 9932 |
| 151 | Ga0070667_100006231 | 3300005367 | Bacteria | 9925 |
| 152 | Ga0070667_100007026 | 3300005367 | Bacteria | 9358 |
| 153 | Ga0070667_100038936 | 3300005367 | Bacteria | 3986 |
| 154 | Ga0070667_100123366 | 3300005367 | Bacteria | 2255 |
| 155 | Ga0070701_10081098 | 3300005438 | Bacteria | 1756 |
| 156 | Ga0070701_10103958 | 3300005438 | Bacteria | 1577 |
| 157 | Ga0070705_100047209 | 3300005440 | Bacteria | 2488 |
| 158 | Ga0070700_100062483 | 3300005441 | Bacteria | 2353 |
| 159 | Ga0070708_100000726 | 3300005445 | Bacteria | 25018 |
| 160 | Ga0070708_100007372 | 3300005445 | Bacteria | 8801 |
| 161 | Ga0070708_100128680 | 3300005445 | Bacteria | 2342 |
| 162 | Ga0070708_100170455 | 3300005445 | Bacteria | 2032 |
| 163 | Ga0070708_100425618 | 3300005445 | Bacteria | 1252 |
| 164 | Ga0070663_100007612 | 3300005455 | Bacteria | 6606 |
| 165 | Ga0070663_100012949 | 3300005455 | Bacteria | 5296 |
| 166 | Ga0070663_100022630 | 3300005455 | Bacteria | 4205 |
| 167 | Ga0070663_100044048 | 3300005455 | Bacteria | 3144 |
| 168 | Ga0070663_100121218 | 3300005455 | Bacteria | 1975 |
| 169 | Ga0070663_100135370 | 3300005455 | Bacteria | 1875 |
| 170 | Ga0070678_100001654 | 3300005456 | Bacteria | 11955 |
| 171 | Ga0070678_100003347 | 3300005456 | Bacteria | 8926 |
| 172 | Ga0070678_100010414 | 3300005456 | Bacteria | 5679 |
| 173 | Ga0070678_100017525 | 3300005456 | Bacteria | 4615 |
| 174 | Ga0070678_100034995 | 3300005456 | Bacteria | 3502 |
| 175 | Ga0070678_100243727 | 3300005456 | Bacteria | 1504 |
| 176 | Ga0070662_100000827 | 3300005457 | Bacteria | 19059 |
| 177 | Ga0070662_100031859 | 3300005457 | Bacteria | 3703 |
| 178 | Ga0070662_100034579 | 3300005457 | Bacteria | 3564 |
| 179 | Ga0070681_10005152 | 3300005458 | Bacteria | 12610 |
| 180 | Ga0068867_100001260 | 3300005459 | Bacteria | 17478 |
| 181 | Ga0068867_100008463 | 3300005459 | Bacteria | 7258 |
| 182 | Ga0068867_100161548 | 3300005459 | Bacteria | 1767 |
| 183 | Ga0068867_100182335 | 3300005459 | Bacteria | 1670 |
| 184 | Ga0068867_100191458 | 3300005459 | Bacteria | 1632 |
| 185 | Ga0070685_10002746 | 3300005466 | Bacteria | 9020 |
| 186 | Ga0070685_10020281 | 3300005466 | Bacteria | 3597 |
| 187 | Ga0070685_10059431 | 3300005466 | Bacteria | 2232 |
| 188 | Ga0070685_10225154 | 3300005466 | Bacteria | 1231 |
| 189 | Ga0070706_100035270 | 3300005467 | Bacteria | 4620 |
| 190 | Ga0070707_100048762 | 3300005468 | Bacteria | 4058 |
| 191 | Ga0070707_100374483 | 3300005468 | Bacteria | 1383 |
| 192 | Ga0070698_100120262 | 3300005471 | Bacteria | 2587 |
| 193 | Ga0070699_100117152 | 3300005518 | Bacteria | 2341 |
| 194 | Ga0070699_100246753 | 3300005518 | Bacteria | 1595 |
| 195 | Ga0070684_100006125 | 3300005535 | Bacteria | 9269 |
| 196 | Ga0070684_100008902 | 3300005535 | Bacteria | 7878 |
| 197 | Ga0070684_100012948 | 3300005535 | Bacteria | 6707 |
| 198 | Ga0070684_100181480 | 3300005535 | Bacteria | 1914 |
| 199 | Ga0068853_100005992 | 3300005539 | Bacteria | 9612 |
| 200 | Ga0068853_100009311 | 3300005539 | Bacteria | 7920 |
| 201 | Ga0068853_100019086 | 3300005539 | Bacteria | 5680 |
| 202 | Ga0068853_100023650 | 3300005539 | Bacteria | 5146 |
| 203 | Ga0070672_100001074 | 3300005543 | Bacteria | 16639 |
| 204 | Ga0070672_100001704 | 3300005543 | Bacteria | 13708 |
| 205 | Ga0070672_100005096 | 3300005543 | Bacteria | 8667 |
| 206 | Ga0070672_100012555 | 3300005543 | Bacteria | 5954 |
| 207 | Ga0070672_100046284 | 3300005543 | Bacteria | 3370 |
| 208 | Ga0070672_100078445 | 3300005543 | Bacteria | 2642 |
| 209 | Ga0070672_100078605 | 3300005543 | Bacteria | 2640 |
| 210 | Ga0070672_100287365 | 3300005543 | Bacteria | 1392 |
| 211 | Ga0070686_100004725 | 3300005544 | Bacteria | 7509 |
| 212 | Ga0070693_100009342 | 3300005547 | Bacteria | 4874 |
| 213 | Ga0070693_100023224 | 3300005547 | Bacteria | 3312 |
| 214 | Ga0070665_100003313 | 3300005548 | Bacteria | 17249 |
| 215 | Ga0070665_100005444 | 3300005548 | Bacteria | 13130 |
| 216 | Ga0070665_100006892 | 3300005548 | Bacteria | 11550 |
| 217 | Ga0070665_100010582 | 3300005548 | Bacteria | 9339 |
| 218 | Ga0070665_100092825 | 3300005548 | Bacteria | 3023 |
| 219 | Ga0070665_100108872 | 3300005548 | Bacteria | 2773 |
| 220 | Ga0070665_100144829 | 3300005548 | Bacteria | 2379 |
| 221 | Ga0070665_100262285 | 3300005548 | Bacteria | 1729 |
| 222 | Ga0068855_100000618 | 3300005563 | Bacteria | 43673 |
| 223 | Ga0068855_100059864 | 3300005563 | Bacteria | 4455 |
| 224 | Ga0068855_100091228 | 3300005563 | Bacteria | 3515 |
| 225 | Ga0068855_100114630 | 3300005563 | Bacteria | 3090 |
| 226 | Ga0068855_100159283 | 3300005563 | Bacteria | 2563 |
| 227 | Ga0068855_100262211 | 3300005563 | Bacteria | 1925 |
| 228 | Ga0070664_100008432 | 3300005564 | Bacteria | 8334 |
| 229 | Ga0070664_100051283 | 3300005564 | Bacteria | 3493 |
| 230 | Ga0070664_100104242 | 3300005564 | Bacteria | 2469 |
| 231 | Ga0068857_100007291 | 3300005577 | Bacteria | 9524 |
| 232 | Ga0068857_100014197 | 3300005577 | Bacteria | 6936 |
| 233 | Ga0068857_100016044 | 3300005577 | Bacteria | 6562 |
| 234 | Ga0068857_100086979 | 3300005577 | Bacteria | 2795 |
| 235 | Ga0068854_100022298 | 3300005578 | Bacteria | 4310 |
| 236 | Ga0068854_100022735 | 3300005578 | Bacteria | 4277 |
| 237 | Ga0068854_100061024 | 3300005578 | Bacteria | 2730 |
| 238 | Ga0068856_100000093 | 3300005614 | Bacteria | 84752 |
| 239 | Ga0068856_100022002 | 3300005614 | Bacteria | 6199 |
| 240 | Ga0068856_100125110 | 3300005614 | Bacteria | 2574 |
| 241 | Ga0068852_100000265 | 3300005616 | Bacteria | 35028 |
| 242 | Ga0068852_100004707 | 3300005616 | Bacteria | 9679 |
| 243 | Ga0068852_100011098 | 3300005616 | Bacteria | 6765 |
| 244 | Ga0068852_100029990 | 3300005616 | Bacteria | 4473 |
| 245 | Ga0068852_100033803 | 3300005616 | Bacteria | 4250 |
| 246 | Ga0068852_100060839 | 3300005616 | Bacteria | 3280 |
| 247 | Ga0068852_100141132 | 3300005616 | Bacteria | 2229 |
| 248 | Ga0068852_100307005 | 3300005616 | Bacteria | 1537 |
| 249 | Ga0068859_100002465 | 3300005617 | Bacteria | 18831 |
| 250 | Ga0068859_100020875 | 3300005617 | Bacteria | 6573 |
| 251 | Ga0068859_100092457 | 3300005617 | Bacteria | 3076 |
| 252 | Ga0068859_100168399 | 3300005617 | Bacteria | 2271 |
| 253 | Ga0068859_100284431 | 3300005617 | Bacteria | 1746 |
| 254 | Ga0068864_100005694 | 3300005618 | Bacteria | 10215 |
| 255 | Ga0068864_100011928 | 3300005618 | Bacteria | 7177 |
| 256 | Ga0068864_100017340 | 3300005618 | Bacteria | 6002 |
| 257 | Ga0068864_100045429 | 3300005618 | Bacteria | 3768 |
| 258 | Ga0068864_100108060 | 3300005618 | Bacteria | 2475 |
| 259 | Ga0068864_100354794 | 3300005618 | Bacteria | 1384 |
| 260 | Ga0068864_100464758 | 3300005618 | Bacteria | 1212 |
| 261 | Ga0068866_10001528 | 3300005718 | Bacteria | 9838 |
| 262 | Ga0068866_10036134 | 3300005718 | Bacteria | 2418 |
| 263 | Ga0068861_100003054 | 3300005719 | Bacteria | 11054 |
| 264 | Ga0068861_100033420 | 3300005719 | Bacteria | 3794 |
| 265 | Ga0068861_100037238 | 3300005719 | Bacteria | 3616 |
| 266 | Ga0068861_100044788 | 3300005719 | Bacteria | 3328 |
| 267 | Ga0068861_100045459 | 3300005719 | Bacteria | 3306 |
| 268 | Ga0068861_100110879 | 3300005719 | Bacteria | 2198 |
| 269 | Ga0068851_10001117 | 3300005834 | Bacteria | 11611 |
| 270 | Ga0068851_10002821 | 3300005834 | Bacteria | 7659 |
| 271 | Ga0068851_10025333 | 3300005834 | Bacteria | 2909 |
| 272 | Ga0068851_10057935 | 3300005834 | Bacteria | 1979 |
| 273 | Ga0068870_10001406 | 3300005840 | Bacteria | 9708 |
| 274 | Ga0068870_10015874 | 3300005840 | Bacteria | 3585 |
| 275 | Ga0068870_10038307 | 3300005840 | Bacteria | 2475 |
| 276 | Ga0068863_100002185 | 3300005841 | Bacteria | 19403 |
| 277 | Ga0068863_100018376 | 3300005841 | Bacteria | 6691 |
| 278 | Ga0068863_100020623 | 3300005841 | Bacteria | 6299 |
| 279 | Ga0068863_100024582 | 3300005841 | Bacteria | 5744 |
| 280 | Ga0068863_100032838 | 3300005841 | Bacteria | 4945 |
| 281 | Ga0068863_100052723 | 3300005841 | Bacteria | 3854 |
| 282 | Ga0068863_100077160 | 3300005841 | Bacteria | 3153 |
| 283 | Ga0068863_100118397 | 3300005841 | Bacteria | 2524 |
| 284 | Ga0068863_100129344 | 3300005841 | Bacteria | 2410 |
| 285 | Ga0068863_100154888 | 3300005841 | Bacteria | 2194 |
| 286 | Ga0068858_100003435 | 3300005842 | Bacteria | 15741 |
| 287 | Ga0068858_100005392 | 3300005842 | Bacteria | 12533 |
| 288 | Ga0068858_100005719 | 3300005842 | Bacteria | 12151 |
| 289 | Ga0068858_100009830 | 3300005842 | Bacteria | 9100 |
| 290 | Ga0068858_100010459 | 3300005842 | Bacteria | 8789 |
| 291 | Ga0068858_100020675 | 3300005842 | Bacteria | 6148 |
| 292 | Ga0068858_100030219 | 3300005842 | Bacteria | 5032 |
| 293 | Ga0068858_100034811 | 3300005842 | Bacteria | 4671 |
| 294 | Ga0068858_100396618 | 3300005842 | Bacteria | 1325 |
| 295 | Ga0068860_100003281 | 3300005843 | Bacteria | 16651 |
| 296 | Ga0068860_100004709 | 3300005843 | Bacteria | 13920 |
| 297 | Ga0068860_100020794 | 3300005843 | Bacteria | 6358 |
| 298 | Ga0068860_100031689 | 3300005843 | Bacteria | 5082 |
| 299 | Ga0068860_100033805 | 3300005843 | Bacteria | 4906 |
| 300 | Ga0068860_100042479 | 3300005843 | Bacteria | 4341 |
| 301 | Ga0068860_100050709 | 3300005843 | Bacteria | 3950 |
| 302 | Ga0068860_100051372 | 3300005843 | Bacteria | 3922 |
| 303 | Ga0068862_100012971 | 3300005844 | Bacteria | 6893 |
| 304 | Ga0068862_100025853 | 3300005844 | Bacteria | 4931 |
| 305 | Ga0068862_100093050 | 3300005844 | Bacteria | 2628 |
| 306 | Ga0081455_10003268 | 3300005937 | Bacteria | 18754 |
| 307 | Ga0081455_10116880 | 3300005937 | Bacteria | 2109 |
| 308 | Ga0081539_10023827 | 3300005985 | Bacteria | 3994 |
| 309 | Ga0081539_10027215 | 3300005985 | Bacteria | 3627 |
| 310 | Ga0075363_100062191 | 3300006048 | Bacteria | 2013 |
| 311 | Ga0075364_10102625 | 3300006051 | Bacteria | 1904 |
| 312 | Ga0075362_10012524 | 3300006177 | Bacteria | 3371 |
| 313 | Ga0075367_10003415 | 3300006178 | Bacteria | 7568 |
| 314 | Ga0075367_10005138 | 3300006178 | Bacteria | 6461 |
| 315 | Ga0075367_10030966 | 3300006178 | Bacteria | 3071 |
| 316 | Ga0075367_10122576 | 3300006178 | Bacteria | 1602 |
| 317 | Ga0075369_10002321 | 3300006186 | Bacteria | 6766 |
| 318 | Ga0075366_10044090 | 3300006195 | Bacteria | 2643 |
| 319 | Ga0075366_10110854 | 3300006195 | Bacteria | 1650 |
| 320 | Ga0097621_100007585 | 3300006237 | Bacteria | 7775 |
| 321 | Ga0097621_100016593 | 3300006237 | Bacteria | 5571 |
| 322 | Ga0097621_100025122 | 3300006237 | Bacteria | 4659 |
| 323 | Ga0097621_100029264 | 3300006237 | Bacteria | 4349 |
| 324 | Ga0097621_100082912 | 3300006237 | Bacteria | 2671 |
| 325 | Ga0075370_10000157 | 3300006353 | Bacteria | 23226 |
| 326 | Ga0075370_10000617 | 3300006353 | Bacteria | 13729 |
| 327 | Ga0075370_10012187 | 3300006353 | Bacteria | 4537 |
| 328 | Ga0075370_10035953 | 3300006353 | Bacteria | 2781 |
| 329 | Ga0075370_10057366 | 3300006353 | Bacteria | 2213 |
| 330 | Ga0075370_10080188 | 3300006353 | Bacteria | 1875 |
| 331 | Ga0075370_10120898 | 3300006353 | Bacteria | 1524 |
| 332 | Ga0068871_100014110 | 3300006358 | Bacteria | 5943 |
| 333 | Ga0068871_100017513 | 3300006358 | Bacteria | 5424 |
| 334 | Ga0068871_100029987 | 3300006358 | Bacteria | 4279 |
| 335 | Ga0068871_100033032 | 3300006358 | Bacteria | 4093 |
| 336 | Ga0068871_100226680 | 3300006358 | Bacteria | 1621 |
| 337 | Ga0075428_100079945 | 3300006844 | Bacteria | 3568 |
| 338 | Ga0075433_10032958 | 3300006852 | Bacteria | 4439 |
| 339 | Ga0075433_10359690 | 3300006852 | Bacteria | 1286 |
| 340 | Ga0075434_100017497 | 3300006871 | Bacteria | 6908 |
| 341 | Ga0075434_100110940 | 3300006871 | Bacteria | 2753 |
| 342 | Ga0075434_100223125 | 3300006871 | Bacteria | 1904 |
| 343 | Ga0068865_100012656 | 3300006881 | Bacteria | 5317 |
| 344 | Ga0068865_100033942 | 3300006881 | Bacteria | 3419 |
| 345 | Ga0068865_100123612 | 3300006881 | Bacteria | 1928 |
| 346 | Ga0097620_100002465 | 3300006931 | Bacteria | 18831 |
| 347 | Ga0097620_100020876 | 3300006931 | Bacteria | 6573 |
| 348 | Ga0097620_100092456 | 3300006931 | Bacteria | 3076 |
| 349 | Ga0097620_100168400 | 3300006931 | Bacteria | 2271 |
| 350 | Ga0097620_100284444 | 3300006931 | Bacteria | 1746 |
| 351 | Ga0075435_100117035 | 3300007076 | Bacteria | 2221 |
| 352 | Ga0105251_10000671 | 3300009011 | Bacteria | 31552 |
| 353 | Ga0105251_10001447 | 3300009011 | Bacteria | 20403 |
| 354 | Ga0105251_10032505 | 3300009011 | Bacteria | 2599 |
| 355 | Ga0105240_10002436 | 3300009093 | Bacteria | 29913 |
| 356 | Ga0105240_10016538 | 3300009093 | Bacteria | 9985 |
| 357 | Ga0105240_10022166 | 3300009093 | Bacteria | 8427 |
| 358 | Ga0105240_10045943 | 3300009093 | Bacteria | 5537 |
| 359 | Ga0105240_10048690 | 3300009093 | Bacteria | 5355 |
| 360 | Ga0105240_10205295 | 3300009093 | Bacteria | 2307 |
| 361 | Ga0111539_10011146 | 3300009094 | Bacteria | 11307 |
| 362 | Ga0105245_10018737 | 3300009098 | Bacteria | 6055 |
| 363 | Ga0105245_10107659 | 3300009098 | Bacteria | 2588 |
| 364 | Ga0105245_10282422 | 3300009098 | Bacteria | 1623 |
| 365 | Ga0105247_10007966 | 3300009101 | Bacteria | 6473 |
| 366 | Ga0105247_10110227 | 3300009101 | Bacteria | 1771 |
| 367 | Ga0105241_10040157 | 3300009174 | Bacteria | 3532 |
| 368 | Ga0105242_10132477 | 3300009176 | Bacteria | 2153 |
| 369 | Ga0105248_10003137 | 3300009177 | Bacteria | 18293 |
| 370 | Ga0105248_10017241 | 3300009177 | Bacteria | 7958 |
| 371 | Ga0105248_10018724 | 3300009177 | Bacteria | 7656 |
| 372 | Ga0105237_10091876 | 3300009545 | Bacteria | 3025 |
| 373 | Ga0105237_10180232 | 3300009545 | Bacteria | 2113 |
| 374 | Ga0105237_10290995 | 3300009545 | Bacteria | 1636 |
| 375 | Ga0105238_10041126 | 3300009551 | Bacteria | 4682 |
| 376 | Ga0105249_10147133 | 3300009553 | Bacteria | 2264 |
| 377 | Ga0105249_10163717 | 3300009553 | Bacteria | 2152 |
| 378 | Ga0105249_10296402 | 3300009553 | Bacteria | 1620 |
| 379 | Ga0105239_10001161 | 3300010375 | Bacteria | 36164 |
| 380 | Ga0105239_10497661 | 3300010375 | Bacteria | 1385 |
| 381 | Ga0105239_10676282 | 3300010375 | Bacteria | 1180 |
| 382 | Ga0105246_10029890 | 3300011119 | Bacteria | 3593 |
| 383 | Ga0157373_10000777 | 3300013100 | Bacteria | 24608 |
| 384 | Ga0157373_10010136 | 3300013100 | Bacteria | 6945 |
| 385 | Ga0157373_10043636 | 3300013100 | Bacteria | 3203 |
| 386 | Ga0157371_10008425 | 3300013102 | Bacteria | 8212 |
| 387 | Ga0157370_10005771 | 3300013104 | Bacteria | 13830 |
| 388 | Ga0157370_10019561 | 3300013104 | Bacteria | 6786 |
| 389 | Ga0157369_10001395 | 3300013105 | Bacteria | 29676 |
| 390 | Ga0157369_10006755 | 3300013105 | Bacteria | 13242 |
| 391 | Ga0157369_10008403 | 3300013105 | Bacteria | 11839 |
| 392 | Ga0157369_10025742 | 3300013105 | Bacteria | 6527 |
| 393 | Ga0157369_10042581 | 3300013105 | Bacteria | 4952 |
| 394 | Ga0157369_10325518 | 3300013105 | Bacteria | 1597 |
| 395 | Ga0157374_10001040 | 3300013296 | Bacteria | 24063 |
| 396 | Ga0157374_10007000 | 3300013296 | Bacteria | 9599 |
| 397 | Ga0157374_10008031 | 3300013296 | Bacteria | 9020 |
| 398 | Ga0157374_10017774 | 3300013296 | Bacteria | 6265 |
| 399 | Ga0157374_10029253 | 3300013296 | Bacteria | 4986 |
| 400 | Ga0157374_10313103 | 3300013296 | Bacteria | 1554 |
| 401 | Ga0157378_10005031 | 3300013297 | Bacteria | 11605 |
| 402 | Ga0157378_10006031 | 3300013297 | Bacteria | 10616 |
| 403 | Ga0157378_10014439 | 3300013297 | Bacteria | 6915 |
| 404 | Ga0157378_10042441 | 3300013297 | Bacteria | 4037 |
| 405 | Ga0157378_10069600 | 3300013297 | Bacteria | 3157 |
| 406 | Ga0157378_10091530 | 3300013297 | Bacteria | 2765 |
| 407 | Ga0157378_10105755 | 3300013297 | Bacteria | 2574 |
| 408 | Ga0157378_10165826 | 3300013297 | Bacteria | 2069 |
| 409 | Ga0163162_10004087 | 3300013306 | Bacteria | 14005 |
| 410 | Ga0163162_10030122 | 3300013306 | Bacteria | 5376 |
| 411 | Ga0163162_10043717 | 3300013306 | Bacteria | 4486 |
| 412 | Ga0163162_10070653 | 3300013306 | Bacteria | 3543 |
| 413 | Ga0163162_10089123 | 3300013306 | Bacteria | 3165 |
| 414 | Ga0163162_10095019 | 3300013306 | Bacteria | 3067 |
| 415 | Ga0163162_10308831 | 3300013306 | Bacteria | 1714 |
| 416 | Ga0163162_10448565 | 3300013306 | Bacteria | 1422 |
| 417 | Ga0157372_10000852 | 3300013307 | Bacteria | 33078 |
| 418 | Ga0157372_10001735 | 3300013307 | Bacteria | 23652 |
| 419 | Ga0157372_10022569 | 3300013307 | Bacteria | 6811 |
| 420 | Ga0157372_10029653 | 3300013307 | Bacteria | 5976 |
| 421 | Ga0157375_10033547 | 3300013308 | Bacteria | 4878 |
| 422 | Ga0157375_10180955 | 3300013308 | Bacteria | 2259 |
| 423 | Ga0157375_10501181 | 3300013308 | Bacteria | 1378 |
| 424 | Ga0163163_10001673 | 3300014325 | Bacteria | 18702 |
| 425 | Ga0163163_10017149 | 3300014325 | Bacteria | 6747 |
| 426 | Ga0163163_10037547 | 3300014325 | Bacteria | 4713 |
| 427 | Ga0163163_10054748 | 3300014325 | Bacteria | 3942 |
| 428 | Ga0163163_10074747 | 3300014325 | Bacteria | 3381 |
| 429 | Ga0163163_10184228 | 3300014325 | Bacteria | 2135 |
| 430 | Ga0157380_10085914 | 3300014326 | Bacteria | 2584 |
| 431 | Ga0157380_10230269 | 3300014326 | Bacteria | 1664 |
| 432 | Ga0182008_10012750 | 3300014497 | Bacteria | 4432 |
| 433 | Ga0157377_10001479 | 3300014745 | Bacteria | 10164 |
| 434 | Ga0157377_10006198 | 3300014745 | Bacteria | 5687 |
| 435 | Ga0157379_10000219 | 3300014968 | Bacteria | 44603 |
| 436 | Ga0157379_10003465 | 3300014968 | Bacteria | 13354 |
| 437 | Ga0157379_10015827 | 3300014968 | Bacteria | 6627 |
| 438 | Ga0157379_10032158 | 3300014968 | Bacteria | 4676 |
| 439 | Ga0157379_10065986 | 3300014968 | Bacteria | 3235 |
| 440 | Ga0157379_10369171 | 3300014968 | Bacteria | 1316 |
| 441 | Ga0157376_10025185 | 3300014969 | Bacteria | 4683 |
| 442 | Ga0157376_10031030 | 3300014969 | Bacteria | 4274 |
| 443 | Ga0157376_10116895 | 3300014969 | Bacteria | 2357 |
| 444 | Ga0182007_10000465 | 3300015262 | Bacteria | 24511 |
| 445 | Ga0163161_10008715 | 3300017792 | Bacteria | 7015 |
| 446 | Ga0163161_10020759 | 3300017792 | Bacteria | 4611 |
| 447 | Ga0163161_10035616 | 3300017792 | Bacteria | 3563 |
| 448 | Ga0163161_10200499 | 3300017792 | Bacteria | 1538 |
| 449 | Ga0209566_100264 | 3300025225 | Bacteria | 49372 |
| 450 | Ga0209674_100017 | 3300025226 | Bacteria | 689087 |
| 451 | Ga0209674_100291 | 3300025226 | Bacteria | 35684 |
| 452 | Ga0209674_101162 | 3300025226 | Bacteria | 7615 |
| 453 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 454 | Ga0209672_100115 | 3300025228 | Bacteria | 89213 |
| 455 | Ga0209672_100136 | 3300025228 | Bacteria | 72753 |
| 456 | Ga0209147_100022 | 3300025229 | Bacteria | 443906 |
| 457 | Ga0209147_100164 | 3300025229 | Bacteria | 90422 |
| 458 | Ga0209147_100215 | 3300025229 | Bacteria | 60346 |
| 459 | Ga0209147_100360 | 3300025229 | Bacteria | 32565 |
| 460 | Ga0209563_101730 | 3300025230 | Bacteria | 5514 |
| 461 | Ga0207427_100419 | 3300025231 | Bacteria | 24329 |
| 462 | Ga0209258_100033 | 3300025242 | Bacteria | 443845 |
| 463 | Ga0209258_100261 | 3300025242 | Bacteria | 90726 |
| 464 | Ga0209258_100271 | 3300025242 | Bacteria | 89095 |
| 465 | Ga0209148_1000046 | 3300025254 | Bacteria | 443881 |
| 466 | Ga0209148_1000104 | 3300025254 | Bacteria | 214254 |
| 467 | Ga0209148_1000609 | 3300025254 | Bacteria | 32035 |
| 468 | Ga0209759_1000180 | 3300025256 | Bacteria | 103458 |
| 469 | Ga0209759_1000231 | 3300025256 | Bacteria | 83320 |
| 470 | Ga0209759_1000568 | 3300025256 | Bacteria | 37118 |
| 471 | Ga0209759_1007514 | 3300025256 | Bacteria | 3496 |
| 472 | Ga0209233_1000050 | 3300025261 | Bacteria | 450736 |
| 473 | Ga0209565_1003571 | 3300025263 | Bacteria | 4980 |
| 474 | Ga0209455_1000038 | 3300025272 | Bacteria | 443899 |
| 475 | Ga0209455_1000097 | 3300025272 | Bacteria | 214136 |
| 476 | Ga0209673_1000124 | 3300025273 | Bacteria | 169015 |
| 477 | Ga0209676_1003712 | 3300025292 | Bacteria | 9109 |
| 478 | Ga0209564_1001909 | 3300025295 | Bacteria | 18634 |
| 479 | Ga0209564_1010372 | 3300025295 | Bacteria | 4299 |
| 480 | Ga0209050_1006245 | 3300025298 | Bacteria | 7138 |
| 481 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 482 | Ga0207426_1001933 | 3300025302 | Bacteria | 14885 |
| 483 | Ga0207697_10000241 | 3300025315 | Bacteria | 29902 |
| 484 | Ga0207697_10000378 | 3300025315 | Bacteria | 24945 |
| 485 | Ga0207697_10047102 | 3300025315 | Bacteria | 1777 |
| 486 | Ga0207656_10003936 | 3300025321 | Bacteria | 5141 |
| 487 | Ga0207656_10007815 | 3300025321 | Bacteria | 3915 |
| 488 | Ga0207656_10083753 | 3300025321 | Bacteria | 1437 |
| 489 | Ga0207713_1000064 | 3300025735 | Bacteria | 200324 |
| 490 | Ga0207682_10000106 | 3300025893 | Bacteria | 38190 |
| 491 | Ga0207682_10001272 | 3300025893 | Bacteria | 11576 |
| 492 | Ga0207682_10001404 | 3300025893 | Bacteria | 11131 |
| 493 | Ga0207682_10001758 | 3300025893 | Bacteria | 9944 |
| 494 | Ga0207682_10026844 | 3300025893 | Bacteria | 2291 |
| 495 | Ga0207642_10082255 | 3300025899 | Bacteria | 1567 |
| 496 | Ga0207710_10055288 | 3300025900 | Bacteria | 1789 |
| 497 | Ga0207688_10000062 | 3300025901 | Bacteria | 38797 |
| 498 | Ga0207688_10002838 | 3300025901 | Bacteria | 9414 |
| 499 | Ga0207688_10112938 | 3300025901 | Bacteria | 1579 |
| 500 | Ga0207688_10132486 | 3300025901 | Bacteria | 1462 |
| 501 | Ga0207680_10003378 | 3300025903 | Bacteria | 7516 |
| 502 | Ga0207680_10006222 | 3300025903 | Bacteria | 5760 |
| 503 | Ga0207680_10025862 | 3300025903 | Bacteria | 3243 |
| 504 | Ga0207680_10030104 | 3300025903 | Bacteria | 3057 |
| 505 | Ga0207680_10031279 | 3300025903 | Bacteria | 3013 |
| 506 | Ga0207680_10095925 | 3300025903 | Bacteria | 1896 |
| 507 | Ga0207647_10000160 | 3300025904 | Bacteria | 53192 |
| 508 | Ga0207647_10001190 | 3300025904 | Bacteria | 20055 |
| 509 | Ga0207647_10005355 | 3300025904 | Bacteria | 9428 |
| 510 | Ga0207647_10006047 | 3300025904 | Bacteria | 8824 |
| 511 | Ga0207647_10030737 | 3300025904 | Bacteria | 3462 |
| 512 | Ga0207645_10000643 | 3300025907 | Bacteria | 29006 |
| 513 | Ga0207645_10000947 | 3300025907 | Bacteria | 24105 |
| 514 | Ga0207645_10001010 | 3300025907 | Bacteria | 23268 |
| 515 | Ga0207645_10003404 | 3300025907 | Bacteria | 12094 |
| 516 | Ga0207645_10006139 | 3300025907 | Bacteria | 8631 |
| 517 | Ga0207645_10007374 | 3300025907 | Bacteria | 7777 |
| 518 | Ga0207645_10008382 | 3300025907 | Bacteria | 7211 |
| 519 | Ga0207645_10024574 | 3300025907 | Bacteria | 3904 |
| 520 | Ga0207645_10080836 | 3300025907 | Bacteria | 2083 |
| 521 | Ga0207645_10151205 | 3300025907 | Bacteria | 1515 |
| 522 | Ga0207643_10000555 | 3300025908 | Bacteria | 23880 |
| 523 | Ga0207643_10000994 | 3300025908 | Bacteria | 16917 |
| 524 | Ga0207643_10004775 | 3300025908 | Bacteria | 7260 |
| 525 | Ga0207643_10030729 | 3300025908 | Bacteria | 2991 |
| 526 | Ga0207705_10052854 | 3300025909 | Bacteria | 2926 |
| 527 | Ga0207684_10002166 | 3300025910 | Bacteria | 20113 |
| 528 | Ga0207684_10024612 | 3300025910 | Bacteria | 5133 |
| 529 | Ga0207654_10040521 | 3300025911 | Bacteria | 2625 |
| 530 | Ga0207707_10019848 | 3300025912 | Bacteria | 5867 |
| 531 | Ga0207695_10006665 | 3300025913 | Bacteria | 14905 |
| 532 | Ga0207695_10036528 | 3300025913 | Bacteria | 5311 |
| 533 | Ga0207695_10412696 | 3300025913 | Bacteria | 1235 |
| 534 | Ga0207671_10052511 | 3300025914 | Bacteria | 3021 |
| 535 | Ga0207671_10071949 | 3300025914 | Bacteria | 2580 |
| 536 | Ga0207662_10010347 | 3300025918 | Bacteria | 5149 |
| 537 | Ga0207662_10017900 | 3300025918 | Bacteria | 4013 |
| 538 | Ga0207657_10001682 | 3300025919 | Bacteria | 23847 |
| 539 | Ga0207657_10013412 | 3300025919 | Bacteria | 8042 |
| 540 | Ga0207657_10030166 | 3300025919 | Bacteria | 4926 |
| 541 | Ga0207657_10054821 | 3300025919 | Bacteria | 3445 |
| 542 | Ga0207649_10012511 | 3300025920 | Bacteria | 4711 |
| 543 | Ga0207649_10014014 | 3300025920 | Bacteria | 4486 |
| 544 | Ga0207649_10027271 | 3300025920 | Bacteria | 3350 |
| 545 | Ga0207649_10029848 | 3300025920 | Bacteria | 3223 |
| 546 | Ga0207649_10069468 | 3300025920 | Bacteria | 2243 |
| 547 | Ga0207652_10034716 | 3300025921 | Bacteria | 4252 |
| 548 | Ga0207646_10009371 | 3300025922 | Bacteria | 9677 |
| 549 | Ga0207646_10270335 | 3300025922 | Bacteria | 1536 |
| 550 | Ga0207681_10019385 | 3300025923 | Bacteria | 4297 |
| 551 | Ga0207694_10019888 | 3300025924 | Bacteria | 5079 |
| 552 | Ga0207694_10209071 | 3300025924 | Bacteria | 1589 |
| 553 | Ga0207694_10226019 | 3300025924 | Bacteria | 1527 |
| 554 | Ga0207650_10002778 | 3300025925 | Bacteria | 12087 |
| 555 | Ga0207650_10004595 | 3300025925 | Bacteria | 9440 |
| 556 | Ga0207650_10004708 | 3300025925 | Bacteria | 9322 |
| 557 | Ga0207650_10016518 | 3300025925 | Bacteria | 5162 |
| 558 | Ga0207650_10057057 | 3300025925 | Bacteria | 2903 |
| 559 | Ga0207650_10107662 | 3300025925 | Bacteria | 2154 |
| 560 | Ga0207659_10001627 | 3300025926 | Bacteria | 13326 |
| 561 | Ga0207659_10016723 | 3300025926 | Bacteria | 4780 |
| 562 | Ga0207659_10036297 | 3300025926 | Bacteria | 3413 |
| 563 | Ga0207659_10036463 | 3300025926 | Bacteria | 3406 |
| 564 | Ga0207659_10040394 | 3300025926 | Bacteria | 3262 |
| 565 | Ga0207659_10170752 | 3300025926 | Bacteria | 1715 |
| 566 | Ga0207644_10002345 | 3300025931 | Bacteria | 12226 |
| 567 | Ga0207644_10005166 | 3300025931 | Bacteria | 8524 |
| 568 | Ga0207644_10006271 | 3300025931 | Bacteria | 7747 |
| 569 | Ga0207644_10006648 | 3300025931 | Bacteria | 7535 |
| 570 | Ga0207644_10015798 | 3300025931 | Bacteria | 5076 |
| 571 | Ga0207644_10023527 | 3300025931 | Bacteria | 4221 |
| 572 | Ga0207644_10025774 | 3300025931 | Bacteria | 4045 |
| 573 | Ga0207644_10034330 | 3300025931 | Bacteria | 3548 |
| 574 | Ga0207644_10057467 | 3300025931 | Bacteria | 2809 |
| 575 | Ga0207644_10129872 | 3300025931 | Bacteria | 1927 |
| 576 | Ga0207644_10245047 | 3300025931 | Bacteria | 1428 |
| 577 | Ga0207644_10266992 | 3300025931 | Bacteria | 1370 |
| 578 | Ga0207690_10000012 | 3300025932 | Bacteria | 269610 |
| 579 | Ga0207690_10047939 | 3300025932 | Bacteria | 2837 |
| 580 | Ga0207690_10065701 | 3300025932 | Bacteria | 2481 |
| 581 | Ga0207690_10078695 | 3300025932 | Bacteria | 2295 |
| 582 | Ga0207706_10000014 | 3300025933 | Bacteria | 177082 |
| 583 | Ga0207706_10001235 | 3300025933 | Bacteria | 25741 |
| 584 | Ga0207706_10005642 | 3300025933 | Bacteria | 11659 |
| 585 | Ga0207706_10061497 | 3300025933 | Bacteria | 3307 |
| 586 | Ga0207706_10143690 | 3300025933 | Bacteria | 2099 |
| 587 | Ga0207706_10151102 | 3300025933 | Bacteria | 2042 |
| 588 | Ga0207686_10037457 | 3300025934 | Bacteria | 2927 |
| 589 | Ga0207670_10064043 | 3300025936 | Bacteria | 2518 |
| 590 | Ga0207669_10006691 | 3300025937 | Bacteria | 5285 |
| 591 | Ga0207669_10008073 | 3300025937 | Bacteria | 4924 |
| 592 | Ga0207669_10008872 | 3300025937 | Bacteria | 4747 |
| 593 | Ga0207669_10125381 | 3300025937 | Bacteria | 1753 |
| 594 | Ga0207704_10008463 | 3300025938 | Bacteria | 4924 |
| 595 | Ga0207704_10057591 | 3300025938 | Bacteria | 2388 |
| 596 | Ga0207704_10068553 | 3300025938 | Bacteria | 2237 |
| 597 | Ga0207665_10065201 | 3300025939 | Bacteria | 2476 |
| 598 | Ga0207691_10000427 | 3300025940 | Bacteria | 41828 |
| 599 | Ga0207691_10000453 | 3300025940 | Bacteria | 40520 |
| 600 | Ga0207691_10004101 | 3300025940 | Bacteria | 14146 |
| 601 | Ga0207691_10004432 | 3300025940 | Bacteria | 13608 |
| 602 | Ga0207691_10004600 | 3300025940 | Bacteria | 13357 |
| 603 | Ga0207691_10022987 | 3300025940 | Bacteria | 5872 |
| 604 | Ga0207691_10024015 | 3300025940 | Bacteria | 5734 |
| 605 | Ga0207691_10036867 | 3300025940 | Bacteria | 4529 |
| 606 | Ga0207691_10050884 | 3300025940 | Bacteria | 3791 |
| 607 | Ga0207691_10057558 | 3300025940 | Bacteria | 3537 |
| 608 | Ga0207691_10130283 | 3300025940 | Bacteria | 2223 |
| 609 | Ga0207691_10206803 | 3300025940 | Bacteria | 1706 |
| 610 | Ga0207691_10288998 | 3300025940 | Bacteria | 1410 |
| 611 | Ga0207711_10005592 | 3300025941 | Bacteria | 10626 |
| 612 | Ga0207711_10033577 | 3300025941 | Bacteria | 4343 |
| 613 | Ga0207711_10044709 | 3300025941 | Bacteria | 3782 |
| 614 | Ga0207689_10001490 | 3300025942 | Bacteria | 22366 |
| 615 | Ga0207689_10001602 | 3300025942 | Bacteria | 21425 |
| 616 | Ga0207689_10002003 | 3300025942 | Bacteria | 19229 |
| 617 | Ga0207689_10006947 | 3300025942 | Bacteria | 9952 |
| 618 | Ga0207689_10009876 | 3300025942 | Bacteria | 8226 |
| 619 | Ga0207689_10016553 | 3300025942 | Bacteria | 6240 |
| 620 | Ga0207689_10053561 | 3300025942 | Bacteria | 3324 |
| 621 | Ga0207689_10075975 | 3300025942 | Bacteria | 2762 |
| 622 | Ga0207689_10083823 | 3300025942 | Bacteria | 2621 |
| 623 | Ga0207661_10040145 | 3300025944 | Bacteria | 3677 |
| 624 | Ga0207679_10015901 | 3300025945 | Bacteria | 4987 |
| 625 | Ga0207679_10037248 | 3300025945 | Bacteria | 3456 |
| 626 | Ga0207679_10123011 | 3300025945 | Bacteria | 2069 |
| 627 | Ga0207679_10270107 | 3300025945 | Bacteria | 1454 |
| 628 | Ga0207667_10004701 | 3300025949 | Bacteria | 16704 |
| 629 | Ga0207667_10006720 | 3300025949 | Bacteria | 13895 |
| 630 | Ga0207667_10078813 | 3300025949 | Bacteria | 3414 |
| 631 | Ga0207667_10190424 | 3300025949 | Bacteria | 2105 |
| 632 | Ga0207651_10014505 | 3300025960 | Bacteria | 4554 |
| 633 | Ga0207651_10024084 | 3300025960 | Bacteria | 3758 |
| 634 | Ga0207651_10108695 | 3300025960 | Bacteria | 2076 |
| 635 | Ga0207712_10022690 | 3300025961 | Bacteria | 4136 |
| 636 | Ga0207712_10056810 | 3300025961 | Bacteria | 2758 |
| 637 | Ga0207668_10003043 | 3300025972 | Bacteria | 9830 |
| 638 | Ga0207668_10009335 | 3300025972 | Bacteria | 5873 |
| 639 | Ga0207668_10013796 | 3300025972 | Bacteria | 4987 |
| 640 | Ga0207668_10018430 | 3300025972 | Bacteria | 4393 |
| 641 | Ga0207668_10041736 | 3300025972 | Bacteria | 3103 |
| 642 | Ga0207668_10048637 | 3300025972 | Bacteria | 2911 |
| 643 | Ga0207668_10102863 | 3300025972 | Bacteria | 2126 |
| 644 | Ga0207668_10208791 | 3300025972 | Bacteria | 1560 |
| 645 | Ga0207640_10022876 | 3300025981 | Bacteria | 3748 |
| 646 | Ga0207640_10034512 | 3300025981 | Bacteria | 3158 |
| 647 | Ga0207640_10051886 | 3300025981 | Bacteria | 2669 |
| 648 | Ga0207640_10074161 | 3300025981 | Bacteria | 2302 |
| 649 | Ga0207640_10079323 | 3300025981 | Bacteria | 2237 |
| 650 | Ga0207640_10081190 | 3300025981 | Bacteria | 2216 |
| 651 | Ga0207658_10021436 | 3300025986 | Bacteria | 4486 |
| 652 | Ga0207658_10038978 | 3300025986 | Bacteria | 3426 |
| 653 | Ga0207658_10067663 | 3300025986 | Bacteria | 2691 |
| 654 | Ga0207658_10071097 | 3300025986 | Bacteria | 2634 |
| 655 | Ga0207658_10075476 | 3300025986 | Bacteria | 2565 |
| 656 | Ga0207658_10098441 | 3300025986 | Bacteria | 2285 |
| 657 | Ga0207658_10106611 | 3300025986 | Bacteria | 2206 |
| 658 | Ga0207658_10194170 | 3300025986 | Bacteria | 1690 |
| 659 | Ga0207658_10259461 | 3300025986 | Bacteria | 1480 |
| 660 | Ga0207658_10355677 | 3300025986 | Bacteria | 1276 |
| 661 | Ga0207677_10018111 | 3300026023 | Bacteria | 4220 |
| 662 | Ga0207677_10036704 | 3300026023 | Bacteria | 3197 |
| 663 | Ga0207677_10087343 | 3300026023 | Bacteria | 2257 |
| 664 | Ga0207677_10094735 | 3300026023 | Bacteria | 2180 |
| 665 | Ga0207677_10123124 | 3300026023 | Bacteria | 1955 |
| 666 | Ga0207677_10270318 | 3300026023 | Bacteria | 1390 |
| 667 | Ga0207703_10001278 | 3300026035 | Bacteria | 23343 |
| 668 | Ga0207703_10003727 | 3300026035 | Bacteria | 12682 |
| 669 | Ga0207703_10005904 | 3300026035 | Bacteria | 9813 |
| 670 | Ga0207703_10019294 | 3300026035 | Bacteria | 5326 |
| 671 | Ga0207703_10077042 | 3300026035 | Bacteria | 2767 |
| 672 | Ga0207703_10162644 | 3300026035 | Bacteria | 1956 |
| 673 | Ga0207703_10172017 | 3300026035 | Bacteria | 1906 |
| 674 | Ga0207639_10017538 | 3300026041 | Bacteria | 5077 |
| 675 | Ga0207639_10059228 | 3300026041 | Bacteria | 2949 |
| 676 | Ga0207639_10061158 | 3300026041 | Bacteria | 2907 |
| 677 | Ga0207639_10100845 | 3300026041 | Bacteria | 2333 |
| 678 | Ga0207639_10147748 | 3300026041 | Bacteria | 1965 |
| 679 | Ga0207639_10191095 | 3300026041 | Bacteria | 1749 |
| 680 | Ga0207678_10000076 | 3300026067 | Bacteria | 78938 |
| 681 | Ga0207678_10002409 | 3300026067 | Bacteria | 16996 |
| 682 | Ga0207678_10014291 | 3300026067 | Bacteria | 6980 |
| 683 | Ga0207678_10014424 | 3300026067 | Bacteria | 6948 |
| 684 | Ga0207678_10018320 | 3300026067 | Bacteria | 6150 |
| 685 | Ga0207678_10019124 | 3300026067 | Bacteria | 6013 |
| 686 | Ga0207678_10048083 | 3300026067 | Bacteria | 3688 |
| 687 | Ga0207678_10063147 | 3300026067 | Bacteria | 3182 |
| 688 | Ga0207678_10144250 | 3300026067 | Bacteria | 2032 |
| 689 | Ga0207708_10000721 | 3300026075 | Bacteria | 24881 |
| 690 | Ga0207708_10089789 | 3300026075 | Bacteria | 2368 |
| 691 | Ga0207708_10178950 | 3300026075 | Bacteria | 1683 |
| 692 | Ga0207702_10002780 | 3300026078 | Bacteria | 16396 |
| 693 | Ga0207702_10055110 | 3300026078 | Bacteria | 3371 |
| 694 | Ga0207702_10105027 | 3300026078 | Bacteria | 2501 |
| 695 | Ga0207702_10291767 | 3300026078 | Bacteria | 1545 |
| 696 | Ga0207641_10009563 | 3300026088 | Bacteria | 7985 |
| 697 | Ga0207641_10010972 | 3300026088 | Bacteria | 7426 |
| 698 | Ga0207641_10017532 | 3300026088 | Bacteria | 5861 |
| 699 | Ga0207641_10021295 | 3300026088 | Bacteria | 5330 |
| 700 | Ga0207641_10046720 | 3300026088 | Bacteria | 3650 |
| 701 | Ga0207641_10101091 | 3300026088 | Bacteria | 2540 |
| 702 | Ga0207641_10178279 | 3300026088 | Bacteria | 1944 |
| 703 | Ga0207641_10246708 | 3300026088 | Bacteria | 1666 |
| 704 | Ga0207641_10283388 | 3300026088 | Bacteria | 1559 |
| 705 | Ga0207648_10000622 | 3300026089 | Bacteria | 39723 |
| 706 | Ga0207648_10001351 | 3300026089 | Bacteria | 27125 |
| 707 | Ga0207648_10003119 | 3300026089 | Bacteria | 17501 |
| 708 | Ga0207648_10008451 | 3300026089 | Bacteria | 9968 |
| 709 | Ga0207648_10016411 | 3300026089 | Bacteria | 6767 |
| 710 | Ga0207648_10059208 | 3300026089 | Bacteria | 3340 |
| 711 | Ga0207676_10007978 | 3300026095 | Bacteria | 7526 |
| 712 | Ga0207676_10019486 | 3300026095 | Bacteria | 4951 |
| 713 | Ga0207676_10024327 | 3300026095 | Bacteria | 4480 |
| 714 | Ga0207676_10100702 | 3300026095 | Bacteria | 2394 |
| 715 | Ga0207676_10451433 | 3300026095 | Bacteria | 1212 |
| 716 | Ga0207674_10002529 | 3300026116 | Bacteria | 23045 |
| 717 | Ga0207674_10004238 | 3300026116 | Bacteria | 17310 |
| 718 | Ga0207674_10007009 | 3300026116 | Bacteria | 13173 |
| 719 | Ga0207674_10024335 | 3300026116 | Bacteria | 6473 |
| 720 | Ga0207674_10052152 | 3300026116 | Bacteria | 4172 |
| 721 | Ga0207674_10101207 | 3300026116 | Bacteria | 2862 |
| 722 | Ga0207675_100000493 | 3300026118 | Bacteria | 38318 |
| 723 | Ga0207675_100001240 | 3300026118 | Bacteria | 25485 |
| 724 | Ga0207675_100007517 | 3300026118 | Bacteria | 10295 |
| 725 | Ga0207675_100029496 | 3300026118 | Bacteria | 5112 |
| 726 | Ga0207675_100090772 | 3300026118 | Bacteria | 2872 |
| 727 | Ga0207675_100187450 | 3300026118 | Bacteria | 1983 |
| 728 | Ga0207683_10000008 | 3300026121 | Bacteria | 164709 |
| 729 | Ga0207683_10000133 | 3300026121 | Bacteria | 61157 |
| 730 | Ga0207683_10000255 | 3300026121 | Bacteria | 47453 |
| 731 | Ga0207683_10000504 | 3300026121 | Bacteria | 36089 |
| 732 | Ga0207683_10003640 | 3300026121 | Bacteria | 13410 |
| 733 | Ga0207683_10008887 | 3300026121 | Bacteria | 8564 |
| 734 | Ga0207683_10012625 | 3300026121 | Bacteria | 7206 |
| 735 | Ga0207683_10039146 | 3300026121 | Bacteria | 4135 |
| 736 | Ga0207683_10159100 | 3300026121 | Bacteria | 2041 |
| 737 | Ga0207698_10024032 | 3300026142 | Bacteria | 4269 |
| 738 | Ga0207698_10026089 | 3300026142 | Bacteria | 4129 |
| 739 | Ga0207698_10044355 | 3300026142 | Bacteria | 3340 |
| 740 | Ga0207698_10132097 | 3300026142 | Bacteria | 2135 |
| 741 | Ga0207698_10137566 | 3300026142 | Bacteria | 2098 |
| 742 | Ga0207698_10200548 | 3300026142 | Bacteria | 1786 |
| 743 | Ga0209371_1000185 | 3300027312 | Bacteria | 90613 |
| 744 | Ga0209371_1021121 | 3300027312 | Bacteria | 1585 |
| 745 | Ga0209971_1005327 | 3300027682 | Bacteria | 3059 |
| 746 | Ga0209998_10002067 | 3300027717 | Bacteria | 4691 |
| 747 | Ga0209813_10008703 | 3300027866 | Bacteria | 2573 |
| 748 | Ga0209974_10011520 | 3300027876 | Bacteria | 2968 |
| 749 | Ga0207428_10176037 | 3300027907 | Bacteria | 1618 |
| 750 | Ga0268266_10006244 | 3300028379 | Bacteria | 10942 |
| 751 | Ga0268266_10111725 | 3300028379 | Bacteria | 2421 |
| 752 | Ga0268266_10136948 | 3300028379 | Bacteria | 2194 |
| 753 | Ga0268266_10288654 | 3300028379 | Bacteria | 1527 |
| 754 | Ga0268265_10147329 | 3300028380 | Bacteria | 1980 |
| 755 | Ga0268265_10154199 | 3300028380 | Bacteria | 1941 |
| 756 | Ga0268264_10002240 | 3300028381 | Bacteria | 17151 |
| 757 | Ga0268264_10018760 | 3300028381 | Bacteria | 5656 |
| 758 | Ga0268264_10027217 | 3300028381 | Bacteria | 4669 |
| 759 | Ga0268264_10103779 | 3300028381 | Bacteria | 2476 |
| 760 | Ga0307515_10095930 | 3300028794 | Bacteria | 3643 |
| 761 | Ga0268256_1000847 | 3300030500 | Bacteria | 21660 |
| 762 | Ga0268256_1023750 | 3300030500 | Bacteria | 1585 |
| 763 | Ga0265332_10000026 | 3300031238 | Bacteria | 193153 |
| 764 | Ga0265332_10041535 | 3300031238 | Bacteria | 1989 |
| 765 | Ga0265325_10000686 | 3300031241 | Bacteria | 24667 |
| 766 | Ga0265316_10036183 | 3300031344 | Bacteria | 3993 |
| 767 | Ga0307513_10026627 | 3300031456 | Bacteria | 6662 |
| 768 | Ga0307408_100000227 | 3300031548 | Bacteria | 59538 |
| 769 | Ga0307408_100008544 | 3300031548 | Bacteria | 6762 |
| 770 | Ga0307408_100011033 | 3300031548 | Bacteria | 5962 |
| 771 | Ga0307516_10025491 | 3300031730 | Bacteria | 6021 |
| 772 | Ga0307405_10008674 | 3300031731 | Bacteria | 5166 |
| 773 | Ga0307405_10050431 | 3300031731 | Bacteria | 2577 |
| 774 | Ga0307413_10004560 | 3300031824 | Bacteria | 6047 |
| 775 | Ga0307413_10160565 | 3300031824 | Bacteria | 1578 |
| 776 | Ga0307410_10010598 | 3300031852 | Bacteria | 5230 |
| 777 | Ga0307410_10018790 | 3300031852 | Bacteria | 4186 |
| 778 | Ga0307406_10005672 | 3300031901 | Bacteria | 6826 |
| 779 | Ga0307406_10012655 | 3300031901 | Bacteria | 4811 |
| 780 | Ga0307407_10008227 | 3300031903 | Bacteria | 4775 |
| 781 | Ga0307407_10017947 | 3300031903 | Bacteria | 3565 |
| 782 | Ga0307412_10000011 | 3300031911 | Bacteria | 405842 |
| 783 | Ga0307412_10000819 | 3300031911 | Bacteria | 17915 |
| 784 | Ga0307412_10001311 | 3300031911 | Bacteria | 13955 |
| 785 | Ga0307412_10007528 | 3300031911 | Bacteria | 6183 |
| 786 | Ga0307412_10015894 | 3300031911 | Bacteria | 4471 |
| 787 | Ga0307412_10038366 | 3300031911 | Bacteria | 3084 |
| 788 | Ga0307409_100011472 | 3300031995 | Bacteria | 5591 |
| 789 | Ga0307416_100014656 | 3300032002 | Bacteria | 5384 |
| 790 | Ga0307416_100018099 | 3300032002 | Bacteria | 4953 |
| 791 | Ga0307416_100025378 | 3300032002 | Bacteria | 4344 |
| 792 | Ga0307411_10000342 | 3300032005 | Bacteria | 15724 |
| 793 | Ga0307415_100012133 | 3300032126 | Bacteria | 4971 |
| 794 | Ga0373955_0020600 | 3300035172 | Bacteria | 3318 |
| 795 | Ga0373955_0102507 | 3300035172 | Bacteria | 1645 |
| 796 | Ga0373942_0038342 | 3300035207 | Bacteria | 1299 |
| 797 | Ga0373924_0050746 | 3300035410 | Bacteria | 1719 |
| 798 | Ga0373931_0070127 | 3300035691 | Bacteria | 1911 |
| 799 | Ga0373927_0084473 | 3300035695 | Bacteria | 2059 |
| 800 | Ga0373947_0053707 | 3300035725 | Bacteria | 2430 |
| 801 | Ga0373937_0093668 | 3300036401 | Bacteria | 2785 |
| 802 | Ga0373937_0228789 | 3300036401 | Bacteria | 1751 |
| 803 | Ga0373925_0008350 | 3300037068 | Bacteria | 7540 |
| 804 | Ga0373925_0146143 | 3300037068 | Bacteria | 1854 |
| 805 | Ga0395900_0049220 | 3300037418 | Bacteria | 4342 |
| 806 | Ga0395900_0068346 | 3300037418 | Bacteria | 3651 |
| 807 | Ga0395900_0124396 | 3300037418 | Bacteria | 2645 |
| 808 | Ga0395898_0001927 | 3300037466 | Bacteria | 26381 |
| 809 | Ga0395898_0089622 | 3300037466 | Bacteria | 2960 |
| 810 | Ga0395905_0000079 | 3300037471 | Bacteria | 160663 |
| 811 | Ga0395905_0021231 | 3300037471 | Bacteria | 6144 |
| 812 | Ga0436364_0213269 | 3300037853 | Bacteria | 6665 |
| 813 | Ga0395901_0002134 | 3300038443 | Bacteria | 20258 |
| 814 | Ga0395901_0010899 | 3300038443 | Bacteria | 9214 |
| 815 | Ga0395901_0022287 | 3300038443 | Bacteria | 6490 |
| 816 | Ga0395901_0041093 | 3300038443 | Bacteria | 4792 |
| 817 | Ga0395901_0047593 | 3300038443 | Bacteria | 4453 |
| 818 | Ga0436365_0414012 | 3300039437 | Bacteria | 1817 |
| 819 | Ga0436361_0524475 | 3300039447 | Bacteria | 2871 |
| 820 | Ga0436363_0071338 | 3300039450 | Bacteria | 2823 |
| 821 | Ga0451791_1678248 | 3300041451 | Bacteria | 1459 |
| 822 | Ga0439448_0000556 | 3300042005 | Bacteria | 8738 |
| 823 | Ga0439455_0013825 | 3300042012 | Bacteria | 1835 |
| 824 | Ga0451577_0073212 | 3300042876 | Unclassified | 3057 |
| 825 | Ga0466973_0003647 | 3300044659 | Bacteria | 12557 |
| 826 | Ga0466965_0001188 | 3300044683 | Bacteria | 10273 |
| 827 | Ga0466966_0000753 | 3300044684 | Bacteria | 20547 |
| 828 | Ga0466966_0014807 | 3300044684 | Bacteria | 5160 |
| 829 | Ga0466966_0016639 | 3300044684 | Bacteria | 4858 |
| 830 | Ga0466961_0008782 | 3300044693 | Bacteria | 6445 |
| 831 | Ga0466961_0013890 | 3300044693 | Bacteria | 5159 |
| 832 | Ga0466961_0054525 | 3300044693 | Bacteria | 2549 |
| 833 | Ga0466961_0060424 | 3300044693 | Bacteria | 2410 |
| 834 | Ga0466963_0030764 | 3300044694 | Bacteria | 3465 |
| 835 | Ga0453684_0000659 | 3300044712 | Bacteria | 123941 |
| 836 | Ga0453684_0013238 | 3300044712 | Bacteria | 13438 |
| 837 | Ga0453684_0016855 | 3300044712 | Bacteria | 11373 |
| 838 | Ga0453684_0032124 | 3300044712 | Bacteria | 7356 |
| 839 | Ga0466971_0035732 | 3300044719 | Bacteria | 2228 |
| 840 | Ga0466971_0039807 | 3300044719 | Bacteria | 2110 |
| 841 | Ga0466957_0079131 | 3300044842 | Bacteria | 2045 |
| 842 | Ga0451576_0000917 | 3300045051 | Bacteria | 55869 |
| 843 | Ga0466958_0007770 | 3300045836 | Bacteria | 5917 |
| 844 | Ga0466958_0011823 | 3300045836 | Bacteria | 4927 |
| 845 | Ga0466958_0066601 | 3300045836 | Bacteria | 2200 |
| 846 | Ga0495592_0023344 | 3300046454 | Bacteria | 4703 |
| 847 | Ga0495603_0008549 | 3300046455 | Bacteria | 6187 |
| 848 | Ga0495603_0022435 | 3300046455 | Bacteria | 3821 |
| 849 | Ga0495590_0005178 | 3300046457 | Bacteria | 5188 |
| 850 | Ga0495590_0005410 | 3300046457 | Bacteria | 5070 |
| 851 | Ga0495590_0027735 | 3300046457 | Bacteria | 1986 |
| 852 | Ga0495590_0037926 | 3300046457 | Bacteria | 1680 |
| 853 | Ga0495591_003395 | 3300046458 | Bacteria | 8254 |
| 854 | Ga0495591_005964 | 3300046458 | Bacteria | 5504 |
| 855 | Ga0495629_0001148 | 3300046459 | Bacteria | 20917 |
| 856 | Ga0495629_0007503 | 3300046459 | Bacteria | 8041 |
| 857 | Ga0495629_0014432 | 3300046459 | Bacteria | 5683 |
| 858 | Ga0495629_0025391 | 3300046459 | Bacteria | 4212 |
| 859 | Ga0495629_0045030 | 3300046459 | Bacteria | 3096 |
| 860 | Ga0495638_0003608 | 3300046460 | Bacteria | 12099 |
| 861 | Ga0495638_0043787 | 3300046460 | Bacteria | 2822 |
| 862 | Ga0495651_0016179 | 3300046462 | Bacteria | 5777 |
| 863 | Ga0495653_0049709 | 3300046463 | Bacteria | 3228 |
| 864 | Ga0495653_0177358 | 3300046463 | Bacteria | 1465 |
| 865 | Ga0495650_0007327 | 3300046471 | Bacteria | 6651 |
| 866 | Ga0495650_0034514 | 3300046471 | Bacteria | 2238 |
| 867 | Ga0495650_0056407 | 3300046471 | Bacteria | 1594 |
| 868 | Ga0495580_0017512 | 3300046472 | Bacteria | 5356 |
| 869 | Ga0495580_0027508 | 3300046472 | Bacteria | 4137 |
| 870 | Ga0495580_0027552 | 3300046472 | Bacteria | 4133 |
| 871 | Ga0495580_0111005 | 3300046472 | Bacteria | 1904 |
| 872 | Ga0495582_0005503 | 3300046473 | Bacteria | 7054 |
| 873 | Ga0495582_0014589 | 3300046473 | Bacteria | 4317 |
| 874 | Ga0495605_0008591 | 3300046474 | Bacteria | 5770 |
| 875 | Ga0495605_0051566 | 3300046474 | Bacteria | 2003 |
| 876 | Ga0495662_0033519 | 3300046476 | Bacteria | 2481 |
| 877 | Ga0495596_0006198 | 3300046500 | Bacteria | 5538 |
| 878 | Ga0495607_0000009 | 3300046501 | Bacteria | 216674 |
| 879 | Ga0495607_0019953 | 3300046501 | Bacteria | 4246 |
| 880 | Ga0495583_0035066 | 3300046506 | Bacteria | 2398 |
| 881 | Ga0495606_0017079 | 3300046507 | Bacteria | 5503 |
| 882 | Ga0495606_0029191 | 3300046507 | Bacteria | 3877 |
| 883 | Ga0495606_0042270 | 3300046507 | Bacteria | 3049 |
| 884 | Ga0495608_0015231 | 3300046511 | Bacteria | 5335 |
| 885 | Ga0495610_0002064 | 3300046512 | Bacteria | 17146 |
| 886 | Ga0495616_0007729 | 3300046513 | Bacteria | 6424 |
| 887 | Ga0495618_0003307 | 3300046514 | Bacteria | 10082 |
| 888 | Ga0495618_0016177 | 3300046514 | Bacteria | 4559 |
| 889 | Ga0495628_0019963 | 3300046516 | Bacteria | 5535 |
| 890 | Ga0495628_0046029 | 3300046516 | Bacteria | 3466 |
| 891 | Ga0495628_0055588 | 3300046516 | Bacteria | 3117 |
| 892 | Ga0495628_0084035 | 3300046516 | Bacteria | 2470 |
| 893 | Ga0495630_0052730 | 3300046517 | Bacteria | 3045 |
| 894 | Ga0495630_0084542 | 3300046517 | Bacteria | 2395 |
| 895 | Ga0495637_0011099 | 3300046520 | Bacteria | 4337 |
| 896 | Ga0495643_0011706 | 3300046522 | Bacteria | 5326 |
| 897 | Ga0495644_0026808 | 3300046523 | Bacteria | 2185 |
| 898 | Ga0495666_0007034 | 3300046526 | Bacteria | 5653 |
| 899 | Ga0495666_0007567 | 3300046526 | Bacteria | 5434 |
| 900 | Ga0495642_0041987 | 3300046528 | Bacteria | 1862 |
| 901 | Ga0495652_0007296 | 3300046529 | Bacteria | 10200 |
| 902 | Ga0495652_0045841 | 3300046529 | Bacteria | 3756 |
| 903 | Ga0495665_0009073 | 3300046531 | Bacteria | 5394 |
| 904 | Ga0495665_0009210 | 3300046531 | Bacteria | 5349 |
| 905 | Ga0495640_0017143 | 3300046533 | Bacteria | 5405 |
| 906 | Ga0495587_0013269 | 3300046536 | Bacteria | 5180 |
| 907 | Ga0495621_0005808 | 3300046539 | Bacteria | 3568 |
| 908 | Ga0495597_0008664 | 3300046542 | Bacteria | 5084 |
| 909 | Ga0495597_0057003 | 3300046542 | Bacteria | 1710 |
| 910 | Ga0495597_0062288 | 3300046542 | Bacteria | 1623 |
| 911 | Ga0495645_0004772 | 3300046543 | Bacteria | 9263 |
| 912 | Ga0495645_0115988 | 3300046543 | Bacteria | 1891 |
| 913 | Ga0495622_0005858 | 3300046557 | Bacteria | 5705 |
| 914 | Ga0495622_0011359 | 3300046557 | Bacteria | 4114 |
| 915 | Ga0495668_0140163 | 3300046616 | Bacteria | 1323 |
| 916 | Ga0495634_0015178 | 3300046642 | Bacteria | 5538 |
| 917 | Ga0495634_0041591 | 3300046642 | Bacteria | 3120 |
| 918 | Ga0495611_0020582 | 3300046648 | Bacteria | 2841 |
| 919 | Ga0495635_0005295 | 3300046663 | Bacteria | 8976 |
| 920 | Ga0495635_0123230 | 3300046663 | Bacteria | 1768 |
| 921 | Ga0495661_0002821 | 3300046665 | Bacteria | 13158 |
| 922 | Ga0495661_0011330 | 3300046665 | Bacteria | 6051 |
| 923 | Ga0495661_0023525 | 3300046665 | Bacteria | 3999 |
| 924 | Ga0495599_0029487 | 3300046678 | Bacteria | 3440 |
| 925 | Ga0495623_0000579 | 3300046679 | Bacteria | 24412 |
| 926 | Ga0495623_0022842 | 3300046679 | Bacteria | 4038 |
| 927 | Ga0495623_0030764 | 3300046679 | Bacteria | 3454 |
| 928 | Ga0495646_0053046 | 3300046680 | Bacteria | 2446 |
| 929 | Ga0495658_0014701 | 3300046683 | Bacteria | 4002 |
| 930 | Ga0495658_0140661 | 3300046683 | Bacteria | 1476 |
| 931 | Ga0495613_0015540 | 3300046689 | Bacteria | 5661 |
| 932 | Ga0495624_0007224 | 3300046690 | Bacteria | 7808 |
| 933 | Ga0495624_0128791 | 3300046690 | Bacteria | 1552 |
| 934 | Ga0495649_0005474 | 3300046694 | Bacteria | 8066 |
| 935 | Ga0495649_0007873 | 3300046694 | Bacteria | 6446 |
| 936 | Ga0495649_0008109 | 3300046694 | Bacteria | 6338 |
| 937 | Ga0495649_0032271 | 3300046694 | Bacteria | 2885 |
| 938 | Ga0495589_0015924 | 3300046794 | Bacteria | 3865 |
| 939 | Ga0495589_0017912 | 3300046794 | Bacteria | 3633 |
| 940 | Ga0495600_0001590 | 3300046809 | Bacteria | 12616 |
| 941 | Ga0495600_0011974 | 3300046809 | Bacteria | 5416 |
| 942 | Ga0495581_0001489 | 3300047315 | Bacteria | 13039 |
| 943 | Ga0495581_0003869 | 3300047315 | Bacteria | 8611 |
| 944 | Ga0495604_0018528 | 3300047317 | Bacteria | 5577 |
| 945 | Ga0495604_0021070 | 3300047317 | Bacteria | 5201 |
| 946 | Ga0495674_0006044 | 3300047319 | Bacteria | 11626 |
| 947 | Ga0495674_0023512 | 3300047319 | Bacteria | 5678 |
| 948 | Ga0495674_0032916 | 3300047319 | Bacteria | 4699 |
| 949 | Ga0495674_0042812 | 3300047319 | Bacteria | 4036 |
| 950 | Ga0495674_0124537 | 3300047319 | Bacteria | 2176 |
| 951 | Ga0495676_0120811 | 3300047321 | Bacteria | 1906 |
| 952 | Ga0495680_0002302 | 3300047322 | Bacteria | 19622 |
| 953 | Ga0495680_0222080 | 3300047322 | Bacteria | 1348 |
| 954 | Ga0495683_0003339 | 3300047323 | Bacteria | 9378 |
| 955 | Ga0495683_0004598 | 3300047323 | Bacteria | 7792 |
| 956 | Ga0495683_0018207 | 3300047323 | Bacteria | 3633 |
| 957 | Ga0495683_0065114 | 3300047323 | Bacteria | 1798 |
| 958 | Ga0495683_0123875 | 3300047323 | Bacteria | 1224 |
| 959 | Ga0495687_000053 | 3300047443 | Bacteria | 195897 |
| 960 | Ga0495687_001004 | 3300047443 | Bacteria | 28188 |
| 961 | Ga0495687_009162 | 3300047443 | Bacteria | 5569 |
| 962 | Ga0495687_012920 | 3300047443 | Bacteria | 4386 |
| 963 | Ga0495687_023722 | 3300047443 | Bacteria | 2927 |
| 964 | Ga0495675_0001937 | 3300047444 | Bacteria | 12337 |
| 965 | Ga0495675_0022841 | 3300047444 | Bacteria | 3988 |
| 966 | Ga0495675_0067509 | 3300047444 | Bacteria | 2259 |
| 967 | Ga0495679_000156 | 3300047446 | Bacteria | 61428 |
| 968 | Ga0495679_011687 | 3300047446 | Bacteria | 3373 |
| 969 | Ga0495679_023716 | 3300047446 | Bacteria | 2077 |
| 970 | Ga0495673_0037562 | 3300047469 | Bacteria | 2210 |
| 971 | Ga0495684_0108710 | 3300047471 | Bacteria | 2094 |
| 972 | Ga0495686_0000519 | 3300047472 | Bacteria | 55675 |
| 973 | Ga0495686_0047356 | 3300047472 | Bacteria | 2715 |
| 974 | Ga0495593_0001073 | 3300047673 | Bacteria | 15971 |
| 975 | Ga0495593_0040922 | 3300047673 | Bacteria | 2493 |
| 976 | Ga0495593_0065877 | 3300047673 | Bacteria | 1888 |
| 977 | Ga0495602_0040914 | 3300048088 | Bacteria | 4239 |
| 978 | Ga0495602_0079957 | 3300048088 | Bacteria | 2755 |
| 979 | Ga0495614_0000394 | 3300048089 | Bacteria | 17743 |
| 980 | Ga0495614_0006231 | 3300048089 | Bacteria | 5361 |
| 981 | Ga0495626_0025837 | 3300048091 | Bacteria | 2868 |
| 982 | Ga0495626_0096504 | 3300048091 | Bacteria | 1294 |
| 983 | Ga0496100_0103449 | 3300048903 | Bacteria | 1966 |
| 984 | Ga0496100_0130027 | 3300048903 | Bacteria | 1772 |
| 985 | Ga0496100_0159831 | 3300048903 | Bacteria | 1614 |
| 986 | Ga0496101_0020522 | 3300048904 | Bacteria | 4525 |
| 987 | Ga0496101_0034664 | 3300048904 | Bacteria | 3566 |
| 988 | Ga0496101_0048173 | 3300048904 | Bacteria | 3062 |
| 989 | Ga0496102_0010175 | 3300048905 | Bacteria | 8088 |
| 990 | Ga0496102_0017335 | 3300048905 | Bacteria | 6308 |
| 991 | Ga0496102_0025230 | 3300048905 | Bacteria | 5289 |
| 992 | Ga0496102_0031026 | 3300048905 | Bacteria | 4789 |
| 993 | Ga0496102_0052864 | 3300048905 | Bacteria | 3702 |
| 994 | Ga0496102_0061722 | 3300048905 | Bacteria | 3431 |
| 995 | Ga0496102_0117818 | 3300048905 | Bacteria | 2478 |
| 996 | Ga0496102_0121758 | 3300048905 | Bacteria | 2437 |
| 997 | Ga0496102_0141068 | 3300048905 | Bacteria | 2259 |
| 998 | Ga0496102_0327359 | 3300048905 | Bacteria | 1443 |
| 999 | Ga0496103_0014601 | 3300048906 | Bacteria | 4666 |
| 1000 | Ga0496103_0151420 | 3300048906 | Bacteria | 1486 |
| 1001 | Ga0496103_0164294 | 3300048906 | Bacteria | 1424 |
| 1002 | Ga0496104_0010736 | 3300048907 | Bacteria | 8191 |
| 1003 | Ga0496104_0049904 | 3300048907 | Bacteria | 3947 |
| 1004 | Ga0496104_0078895 | 3300048907 | Bacteria | 3137 |
| 1005 | Ga0496105_0004400 | 3300048908 | Bacteria | 10605 |
| 1006 | Ga0496105_0024174 | 3300048908 | Bacteria | 4935 |
| 1007 | Ga0496105_0260987 | 3300048908 | Bacteria | 1401 |
| 1008 | Ga0496106_0002288 | 3300048909 | Bacteria | 14290 |
| 1009 | Ga0496106_0193296 | 3300048909 | Bacteria | 1618 |
| 1010 | Ga0496107_0068311 | 3300048910 | Bacteria | 2579 |
| 1011 | Ga0496107_0078947 | 3300048910 | Bacteria | 2399 |
| 1012 | Ga0496107_0197081 | 3300048910 | Bacteria | 1497 |
| 1013 | Ga0496108_0014298 | 3300048911 | Bacteria | 6477 |
| 1014 | Ga0496108_0035500 | 3300048911 | Bacteria | 4145 |
| 1015 | Ga0496108_0066034 | 3300048911 | Bacteria | 3050 |
| 1016 | Ga0496109_0036151 | 3300048912 | Bacteria | 4457 |
| 1017 | Ga0496109_0048566 | 3300048912 | Bacteria | 3861 |
| 1018 | Ga0496109_0228278 | 3300048912 | Bacteria | 1751 |
| 1019 | Ga0496109_0447564 | 3300048912 | Bacteria | 1220 |
| 1020 | Ga0496110_0020925 | 3300048913 | Bacteria | 5527 |
| 1021 | Ga0496110_0134053 | 3300048913 | Bacteria | 2238 |
| 1022 | Ga0496110_0165336 | 3300048913 | Bacteria | 2006 |
| 1023 | Ga0496111_0296604 | 3300048914 | Bacteria | 1198 |
| 1024 | Ga0496112_0002051 | 3300048915 | Bacteria | 15970 |
| 1025 | Ga0496112_0033732 | 3300048915 | Bacteria | 4977 |
| 1026 | Ga0496112_0122979 | 3300048915 | Bacteria | 2565 |
| 1027 | Ga0496113_0028510 | 3300048916 | Bacteria | 4016 |
| 1028 | Ga0496113_0056135 | 3300048916 | Bacteria | 2955 |
| 1029 | Ga0496114_0001851 | 3300048917 | Bacteria | 16017 |
| 1030 | Ga0496114_0056745 | 3300048917 | Bacteria | 3268 |
| 1031 | Ga0496114_0306124 | 3300048917 | Bacteria | 1403 |
| 1032 | Ga0496115_0099610 | 3300048918 | Bacteria | 2381 |
| 1033 | Ga0496116_0010706 | 3300048919 | Bacteria | 7657 |
| 1034 | Ga0496116_0015926 | 3300048919 | Bacteria | 5912 |
| 1035 | Ga0496116_0019593 | 3300048919 | Bacteria | 5175 |
| 1036 | Ga0496117_0005096 | 3300048920 | Bacteria | 14050 |
| 1037 | Ga0496117_0008616 | 3300048920 | Bacteria | 9661 |
| 1038 | Ga0496117_0025161 | 3300048920 | Bacteria | 4686 |
| 1039 | Ga0496117_0032547 | 3300048920 | Bacteria | 3960 |
| 1040 | Ga0496117_0042762 | 3300048920 | Bacteria | 3303 |
| 1041 | Ga0496117_0046755 | 3300048920 | Bacteria | 3110 |
| 1042 | Ga0496118_0001664 | 3300048921 | Bacteria | 32633 |
| 1043 | Ga0496118_0002738 | 3300048921 | Bacteria | 23192 |
| 1044 | Ga0496118_0009250 | 3300048921 | Bacteria | 10001 |
| 1045 | Ga0496118_0011642 | 3300048921 | Bacteria | 8555 |
| 1046 | Ga0496118_0020035 | 3300048921 | Bacteria | 5952 |
| 1047 | Ga0496118_0025697 | 3300048921 | Bacteria | 5040 |
| 1048 | Ga0496118_0075633 | 3300048921 | Bacteria | 2400 |
| 1049 | Ga0496118_0103979 | 3300048921 | Bacteria | 1908 |
| 1050 | Ga0496119_0007583 | 3300048922 | Bacteria | 9734 |
| 1051 | Ga0496119_0018374 | 3300048922 | Bacteria | 5205 |
| 1052 | Ga0496119_0019501 | 3300048922 | Bacteria | 4992 |
| 1053 | Ga0496119_0051972 | 3300048922 | Bacteria | 2514 |
| 1054 | Ga0496119_0068323 | 3300048922 | Bacteria | 2093 |
| 1055 | Ga0496120_0007282 | 3300048923 | Bacteria | 8265 |
| 1056 | Ga0496120_0038111 | 3300048923 | Bacteria | 2846 |
| 1057 | Ga0496121_0000164 | 3300048924 | Bacteria | 145421 |
| 1058 | Ga0496121_0004956 | 3300048924 | Bacteria | 17465 |
| 1059 | Ga0496121_0025108 | 3300048924 | Bacteria | 5671 |
| 1060 | Ga0496121_0026445 | 3300048924 | Bacteria | 5468 |
| 1061 | Ga0496121_0066813 | 3300048924 | Bacteria | 2917 |
| 1062 | Ga0496121_0108325 | 3300048924 | Bacteria | 2125 |
| 1063 | Ga0496122_0000865 | 3300048925 | Bacteria | 57024 |
| 1064 | Ga0496122_0001706 | 3300048925 | Bacteria | 34056 |
| 1065 | Ga0496122_0042110 | 3300048925 | Bacteria | 3597 |
| 1066 | Ga0496122_0047209 | 3300048925 | Bacteria | 3326 |
| 1067 | Ga0496122_0086012 | 3300048925 | Bacteria | 2166 |
| 1068 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 1069 | Ga0496123_0001919 | 3300048926 | Bacteria | 27137 |
| 1070 | Ga0496123_0031845 | 3300048926 | Bacteria | 3828 |
| 1071 | Ga0496124_0035716 | 3300048927 | Bacteria | 4346 |
| 1072 | Ga0496124_0039370 | 3300048927 | Bacteria | 4098 |
| 1073 | Ga0496124_0098439 | 3300048927 | Bacteria | 2373 |
| 1074 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1075 | Ga0496125_0000241 | 3300048928 | Bacteria | 112044 |
| 1076 | Ga0496125_0016616 | 3300048928 | Bacteria | 7058 |
| 1077 | Ga0496125_0047447 | 3300048928 | Bacteria | 3591 |
| 1078 | Ga0496125_0085613 | 3300048928 | Bacteria | 2387 |
| 1079 | Ga0496126_0000118 | 3300048929 | Bacteria | 184719 |
| 1080 | Ga0496126_0004623 | 3300048929 | Bacteria | 16310 |
| 1081 | Ga0496126_0052121 | 3300048929 | Bacteria | 3721 |
| 1082 | Ga0496126_0091523 | 3300048929 | Bacteria | 2674 |
| 1083 | Ga0496126_0127914 | 3300048929 | Bacteria | 2197 |
| 1084 | Ga0496126_0274708 | 3300048929 | Bacteria | 1397 |
| 1085 | Ga0495678_020912 | 3300049459 | Bacteria | 2888 |
| 1086 | Ga0495682_0069519 | 3300049460 | Bacteria | 1267 |
| 1087 | Ga0501033_0083225 | 3300049570 | Bacteria | 2346 |
| 1088 | Ga0501034_0176816 | 3300049571 | Bacteria | 2100 |
| 1089 | Ga0501043_0191811 | 3300049579 | Bacteria | 1589 |
| 1090 | Ga0501067_0067477 | 3300049583 | Bacteria | 1980 |
| 1091 | Ga0501069_0113096 | 3300049585 | Bacteria | 1547 |
| 1092 | Ga0501070_0007055 | 3300049586 | Bacteria | 9559 |
| 1093 | Ga0501072_0027713 | 3300049588 | Bacteria | 4419 |
| 1094 | Ga0501074_0052928 | 3300049590 | Bacteria | 2930 |
| 1095 | Ga0501080_0037277 | 3300049742 | Bacteria | 4540 |
| 1096 | Ga0501083_0030372 | 3300049744 | Bacteria | 3713 |
| 1097 | Ga0501044_0002376 | 3300049823 | Bacteria | 21434 |
| 1098 | nmdc:mga03683_56980_c1 | 3300050489 | Bacteria | 1644 |
| 1099 | nmdc:mga0k408_24569_c1 | 3300050493 | Bacteria | 3408 |
| 1100 | nmdc:mga0k408_6630_c1 | 3300050493 | Bacteria | 6173 |
| 1101 | nmdc:mga06z11_7546_c1 | 3300050494 | Bacteria | 4483 |
| 1102 | nmdc:mga07m45_32734_c1 | 3300050496 | Bacteria | 2883 |
| 1103 | nmdc:mga07m45_3489_c1 | 3300050496 | Bacteria | 7581 |
| 1104 | nmdc:mga07m45_39477_c1 | 3300050496 | Bacteria | 2638 |
| 1105 | nmdc:mga07m45_919_c1 | 3300050496 | Bacteria | 12885 |
| 1106 | nmdc:mga07m45_96793_c1 | 3300050496 | Bacteria | 1694 |
| 1107 | nmdc:mga08y16_186143_c1 | 3300050511 | Bacteria | 2155 |
| 1108 | nmdc:mga08y16_62834_c1 | 3300050511 | Bacteria | 3878 |
| 1109 | nmdc:mga0n895_164178_c1 | 3300050512 | Bacteria | 2252 |
| 1110 | nmdc:mga0n895_24727_c1 | 3300050512 | Bacteria | 5663 |
| 1111 | nmdc:mga0n895_24867_c1 | 3300050512 | Bacteria | 5650 |
| 1112 | nmdc:mga0n895_279629_c2 | 3300050512 | Bacteria | 1208 |
| 1113 | nmdc:mga0rr50_119776_c1 | 3300050513 | Bacteria | 2093 |
| 1114 | nmdc:mga0a205_31268_c1 | 3300050515 | Bacteria | 5100 |
| 1115 | nmdc:mga0sz30_56067_c1 | 3300050516 | Bacteria | 1678 |
| 1116 | Ga0495601_0102974 | 3300053077 | Bacteria | 1845 |
| 1117 | Ga0500658_0002972 | 3300053134 | Bacteria | 6514 |
| 1118 | Ga0500568_0011536 | 3300053139 | Bacteria | 4092 |
| 1119 | Ga0501084_0072201 | 3300054114 | Bacteria | 2890 |
| 1120 | Ga0466962_0000108 | 3300061719 | Bacteria | 33805 |
| 1121 | Ga0466962_0002594 | 3300061719 | Bacteria | 8584 |
| 1122 | 2501074651 | 2501025501 | Bacteria | 7768574 |
| 1123 | 2501410112 | 2501025504 | Bacteria | 8008976 |
| 1124 | 2509128041 | 2508501125 | Bacteria | 7208311 |
| 1125 | 2511095434 | 2510917014 | Bacteria | 8296963 |
| 1126 | 2511105092 | 2510917015 | Bacteria | 7950052 |
| 1127 | 2513556029 | 2513237082 | Bacteria | 8640282 |
| 1128 | 2513561341 | 2513237083 | Bacteria | 8410967 |
| 1129 | 2513959543 | 2513237151 | Bacteria | 6309801 |
| 1130 | 2514046879 | 2513237166 | Bacteria | 10373764 |
| 1131 | 2515688313 | 2515154123 | Bacteria | 6387382 |
| 1132 | 2519457301 | 2519103095 | Bacteria | 6629912 |
| 1133 | 2526061142 | 2524614857 | Bacteria | 4146328 |
| 1134 | 2527078482 | 2526164713 | Bacteria | 6780608 |
| 1135 | 2548846463 | 2547132512 | Bacteria | 3416496 |
| 1136 | 2563055488 | 2562617112 | Bacteria | 10918404 |
| 1137 | 2574433462 | 2574179768 | Bacteria | 4907129 |
| 1138 | 2585292157 | 2582581311 | Bacteria | 6763856 |
| 1139 | 2599738759 | 2599185239 | Bacteria | 8686614 |
| 1140 | 2599747630 | 2599185240 | Bacteria | 7968121 |
| 1141 | 2599903165 | 2599185292 | Bacteria | 6290804 |
| 1142 | 2600209514 | 2599185355 | Bacteria | 7968906 |
| 1143 | 2644121416 | 2643221621 | Bacteria | 6212786 |
| 1144 | 2644302459 | 2643221654 | Bacteria | 5273570 |
| 1145 | 2676745573 | 2675903129 | Bacteria | 7964495 |
| 1146 | 2713478867 | 2711768613 | Bacteria | 11048459 |
| 1147 | 2738823073 | 2738541296 | Bacteria | 7285013 |
| 1148 | 2738835280 | 2738541298 | Bacteria | 7286732 |
| 1149 | 2738876759 | 2738541306 | Bacteria | 7284992 |
| 1150 | 2739188778 | 2738543002 | Bacteria | 7284546 |
| 1151 | 2739223430 | 2738543008 | Bacteria | 7282815 |
| 1152 | 2740065054 | 2739367875 | Bacteria | 4157290 |
| 1153 | 2746086764 | 2744054900 | Bacteria | 8399525 |
| 1154 | 2746094163 | 2744054901 | Bacteria | 8397047 |
| 1155 | 2753568591 | 2751185846 | Bacteria | 7242164 |
| 1156 | 2817259502 | 2816332253 | Bacteria | 6764532 |
| 1157 | 2817277171 | 2816332256 | Bacteria | 6891714 |
| 1158 | 2817454085 | 2816332286 | Bacteria | 6853759 |
| 1159 | 2819622610 | 2818991450 | Bacteria | 6962147 |
| 1160 | 2819634712 | 2818991452 | Bacteria | 8442785 |
| 1161 | 2842329101 | 2842324504 | Bacteria | 9364110 |
| 1162 | 2842353480 | 2842348783 | Bacteria | 9002918 |
| 1163 | 2842459004 | 2842454564 | Bacteria | 8730687 |
| 1164 | 2856290418 | 2856287931 | Bacteria | 7223934 |
| 1165 | 2857359953 | 2857357740 | Bacteria | 9937880 |
| 1166 | 2857578030 | 2857576091 | Bacteria | 5465855 |
| 1167 | 2858952954 | 2858950400 | Bacteria | 6783797 |
| 1168 | 2863425400 | 2863421361 | Bacteria | 7300805 |
| 1169 | 2870069639 | 2870068957 | Bacteria | 8925310 |
| 1170 | 2895516129 | 2895511927 | Bacteria | 6802080 |
| 1171 | 2900636816 | 2900634093 | Bacteria | 10263517 |
| 1172 | 2904488144 | 2904483920 | Bacteria | 7545285 |
| 1173 | 2904570146 | 2904564687 | Bacteria | 7609577 |
| 1174 | 2904577322 | 2904571731 | Bacteria | 7608790 |
| 1175 | 2919531095 | 2919527303 | Bacteria | 7718827 |
| 1176 | 2921647159 | 2921643360 | Bacteria | 11448031 |
| 1177 | 2928112667 | 2928108538 | Bacteria | 7360024 |
| 1178 | 2928139640 | 2928135762 | Bacteria | 7259641 |
| 1179 | 2928163721 | 2928157003 | Bacteria | 7522202 |
| 1180 | 2928170528 | 2928163908 | Bacteria | 7561269 |
| 1181 | 2928175849 | 2928170801 | Bacteria | 8785406 |
| 1182 | 2928508477 | 2928503688 | Bacteria | 7268108 |
| 1183 | 2928541489 | 2928536128 | Bacteria | 7657547 |
| 1184 | 2941480431 | |||
| 1185 | 2945934838 | 2945934425 | Bacteria | 7444609 |
| 1186 | 2981995760 | 2981990288 | Bacteria | 7590678 |
| 1187 | 2990704585 | 2990703756 | Bacteria | 7715990 |
| 1188 | 639787655 | 639633007 | Bacteria | 4376040 |
| 1189 | 642425144 | 641736151 | Bacteria | 7477263 |
| 1190 | 642416023 | 641736154 | Bacteria | 7689995 |
| 1191 | 642594847 | 642555112 | Bacteria | 8676562 |
| 1192 | 642623496 | 642555113 | Bacteria | 8214658 |
| 1193 | 8003958757 | 8003955200 | Bacteria | 8601927 |
| 1194 | 8018848092 | 8018845410 | Bacteria | 8933938 |
| 1195 | 8020810292 | 8020807995 | Bacteria | 6801506 |
| 1196 | 8020939186 | 8020938398 | Bacteria | 7472757 |
| 1197 | 8020948523 | 8020945358 | Bacteria | 8467355 |
| 1198 | 8020956244 | 8020953355 | Bacteria | 7439080 |
| 1199 | 8021127045 | 8021120328 | Bacteria | 8782274 |
| 1200 | 8039101474 | 8039098773 | Bacteria | 6602928 |
| 1201 | 8040169598 | 8040167225 | Bacteria | 6542727 |
| 1202 | 8040174631 | 8040173305 | Bacteria | 6827067 |
| 1203 | 8055270776 | 8055266321 | Bacteria | 7999742 |
| 1204 | 8055305578 | 8055301274 | Bacteria | 8587385 |
| 1205 | Ga0207648_10053993 | |||
| 1206 | JGI24746J21847_1011793 | |||
| 1207 | JGI24740J21852_10005037 | |||
| 1208 | JGI24739J22299_10006235 | |||
| 1209 | JGI24739J22299_10011344 | |||
| 1210 | JGI24739J22299_10030746 | |||
| 1211 | JGI24737J22298_10006627 | |||
| 1212 | JGI24737J22298_10009084 | |||
| 1213 | JGI24737J22298_10010007 | |||
| 1214 | JGI24735J21928_10000162 | |||
| 1215 | JGI24735J21928_10000241 | |||
| 1216 | JGI24735J21928_10003000 | |||
| 1217 | JGI24735J21928_10005356 | |||
| 1218 | JGI24738J21930_10005721 | |||
| 1219 | JGI25156J39149_1000310 | |||
| 1220 | JGI25156J39149_1000485 | |||
| 1221 | JGI25156J39149_1000815 | |||
| 1222 | rootL2_10004490 | |||
| 1223 | rootL2_10011098 | |||
| 1224 | rootH1_10085817 | |||
| 1225 | JGI25160J50197_1000016 | |||
| 1226 | Ga0006556J51387_1038757 | |||
| 1227 | Ga0055533_1000331 | |||
| 1228 | Ga0055533_1001876 | |||
| 1229 | Ga0055532_1000022 | |||
| 1230 | Ga0055532_1000999 | |||
| 1231 | Ga0055532_1002396 | |||
| 1232 | Ga0055532_1003782 | |||
| 1233 | Ga0055527_1000016 | |||
| 1234 | Ga0055527_1000645 | |||
| 1235 | Ga0055535_1000017 | |||
| 1236 | Ga0055535_1001611 | |||
| 1237 | Ga0055535_1001620 | |||
| 1238 | Ga0055542_1000030 | |||
| 1239 | Ga0055542_1001587 | |||
| 1240 | Ga0055542_1002572 | |||
| 1241 | Ga0055529_1000033 | |||
| 1242 | Ga0055529_1001023 | |||
| 1243 | Ga0055528_1007441 | |||
| 1244 | Ga0058692_1001054 | |||
| 1245 | Ga0065165_1000875 | |||
| 1246 | Ga0065715_10154227 | |||
| 1247 | Ga0070658_10020490 | |||
| 1248 | Ga0070658_10024613 | |||
| 1249 | Ga0070658_10027656 | |||
| 1250 | Ga0070658_10036786 | |||
| 1251 | Ga0070658_10053362 | |||
| 1252 | Ga0070658_10102762 | |||
| 1253 | Ga0070676_10000586 | |||
| 1254 | Ga0070676_10089032 | |||
| 1255 | Ga0070676_10094565 | |||
| 1256 | Ga0070683_100005154 | |||
| 1257 | Ga0070683_100006341 | |||
| 1258 | Ga0070683_100013442 | |||
| 1259 | Ga0070683_100034936 | |||
| 1260 | Ga0070690_100043230 | |||
| 1261 | Ga0070690_100061114 | |||
| 1262 | Ga0070670_100006292 | |||
| 1263 | Ga0070670_100010440 | |||
| 1264 | Ga0070670_100015920 | |||
| 1265 | Ga0070670_100032122 | |||
| 1266 | Ga0070670_100109217 | |||
| 1267 | Ga0070670_100125476 | |||
| 1268 | Ga0070677_10000147 | |||
| 1269 | Ga0070677_10000950 | |||
| 1270 | Ga0068869_100002581 | |||
| 1271 | Ga0068869_100004238 | |||
| 1272 | Ga0068869_100008639 | |||
| 1273 | Ga0068869_100016878 | |||
| 1274 | Ga0068869_100020996 | |||
| 1275 | Ga0068869_100021186 | |||
| 1276 | Ga0070666_10006093 | |||
| 1277 | Ga0070666_10033752 | |||
| 1278 | Ga0070666_10039705 | |||
| 1279 | Ga0070666_10068898 | |||
| 1280 | Ga0070680_100007735 | |||
| 1281 | Ga0070680_100115258 | |||
| 1282 | Ga0068868_100008523 | |||
| 1283 | Ga0068868_100040309 | |||
| 1284 | Ga0068868_100083558 | |||
| 1285 | Ga0068868_100087613 | |||
| 1286 | Ga0068868_100211047 | |||
| 1287 | Ga0068868_100255748 | |||
| 1288 | Ga0070660_100000108 | |||
| 1289 | Ga0070660_100006646 | |||
| 1290 | Ga0070660_100021779 | |||
| 1291 | Ga0070660_100038176 | |||
| 1292 | Ga0070660_100124106 | |||
| 1293 | Ga0070689_100033559 | |||
| 1294 | Ga0070689_100076224 | |||
| 1295 | Ga0070687_100016228 | |||
| 1296 | Ga0070687_100038716 | |||
| 1297 | Ga0070661_100001352 | |||
| 1298 | Ga0070661_100010105 | |||
| 1299 | Ga0070661_100014151 | |||
| 1300 | Ga0070661_100037763 | |||
| 1301 | Ga0070661_100047409 | |||
| 1302 | Ga0070661_100077110 | |||
| 1303 | Ga0070661_100142053 | |||
| 1304 | Ga0070692_10075234 | |||
| 1305 | Ga0070668_100003337 | |||
| 1306 | Ga0070668_100003380 | |||
| 1307 | Ga0070668_100007343 | |||
| 1308 | Ga0070668_100010138 | |||
| 1309 | Ga0070668_100013434 | |||
| 1310 | Ga0070668_100019925 | |||
| 1311 | Ga0070668_100023352 | |||
| 1312 | Ga0070668_100035467 | |||
| 1313 | Ga0070668_100149220 | |||
| 1314 | Ga0070669_100006798 | |||
| 1315 | Ga0070669_100034853 | |||
| 1316 | Ga0070669_100101833 | |||
| 1317 | Ga0070669_100217881 | |||
| 1318 | Ga0070675_100003409 | |||
| 1319 | Ga0070675_100004470 | |||
| 1320 | Ga0070675_100007104 | |||
| 1321 | Ga0070675_100009671 | |||
| 1322 | Ga0070675_100011427 | |||
| 1323 | Ga0070675_100052154 | |||
| 1324 | Ga0070675_100084438 | |||
| 1325 | Ga0070675_100097990 | |||
| 1326 | Ga0070671_100002148 | |||
| 1327 | Ga0070671_100002235 | |||
| 1328 | Ga0070671_100002777 | |||
| 1329 | Ga0070671_100004290 | |||
| 1330 | Ga0070671_100007470 | |||
| 1331 | Ga0070671_100035756 | |||
| 1332 | Ga0070671_100059174 | |||
| 1333 | Ga0070671_100084613 | |||
| 1334 | Ga0070671_100085183 | |||
| 1335 | Ga0070671_100182876 | |||
| 1336 | Ga0070674_100000109 | |||
| 1337 | Ga0070674_100009365 | |||
| 1338 | Ga0070674_100012642 | |||
| 1339 | Ga0070674_100035000 | |||
| 1340 | Ga0070674_100113592 | |||
| 1341 | Ga0070673_100000814 | |||
| 1342 | Ga0070673_100002188 | |||
| 1343 | Ga0070673_100017811 | |||
| 1344 | Ga0070673_100075921 | |||
| 1345 | Ga0070673_100103956 | |||
| 1346 | Ga0070688_100005571 | |||
| 1347 | Ga0070688_100036468 | |||
| 1348 | Ga0070659_100000070 | |||
| 1349 | Ga0070659_100002205 | |||
| 1350 | Ga0070659_100019281 | |||
| 1351 | Ga0070659_100034631 | |||
| 1352 | Ga0070667_100003743 | |||
| 1353 | Ga0070667_100005378 | |||
| 1354 | Ga0070667_100006224 | |||
| 1355 | Ga0070667_100006231 | |||
| 1356 | Ga0070667_100007026 | |||
| 1357 | Ga0070667_100038936 | |||
| 1358 | Ga0070667_100123366 | |||
| 1359 | Ga0070701_10081098 | |||
| 1360 | Ga0070701_10103958 | |||
| 1361 | Ga0070705_100047209 | |||
| 1362 | Ga0070700_100062483 | |||
| 1363 | Ga0070708_100000726 | |||
| 1364 | Ga0070708_100007372 | |||
| 1365 | Ga0070708_100128680 | |||
| 1366 | Ga0070708_100170455 | |||
| 1367 | Ga0070708_100425618 | |||
| 1368 | Ga0070663_100007612 | |||
| 1369 | Ga0070663_100012949 | |||
| 1370 | Ga0070663_100022630 | |||
| 1371 | Ga0070663_100044048 | |||
| 1372 | Ga0070663_100121218 | |||
| 1373 | Ga0070663_100135370 | |||
| 1374 | Ga0070678_100001654 | |||
| 1375 | Ga0070678_100003347 | |||
| 1376 | Ga0070678_100010414 | |||
| 1377 | Ga0070678_100017525 | |||
| 1378 | Ga0070678_100034995 | |||
| 1379 | Ga0070678_100243727 | |||
| 1380 | Ga0070662_100000827 | |||
| 1381 | Ga0070662_100031859 | |||
| 1382 | Ga0070662_100034579 | |||
| 1383 | Ga0070681_10005152 | |||
| 1384 | Ga0068867_100001260 | |||
| 1385 | Ga0068867_100008463 | |||
| 1386 | Ga0068867_100161548 | |||
| 1387 | Ga0068867_100182335 | |||
| 1388 | Ga0068867_100191458 | |||
| 1389 | Ga0070685_10002746 | |||
| 1390 | Ga0070685_10020281 | |||
| 1391 | Ga0070685_10059431 | |||
| 1392 | Ga0070685_10225154 | |||
| 1393 | Ga0070706_100035270 | |||
| 1394 | Ga0070707_100048762 | |||
| 1395 | Ga0070707_100374483 | |||
| 1396 | Ga0070698_100120262 | |||
| 1397 | Ga0070699_100117152 | |||
| 1398 | Ga0070699_100246753 | |||
| 1399 | Ga0070684_100006125 | |||
| 1400 | Ga0070684_100008902 | |||
| 1401 | Ga0070684_100012948 | |||
| 1402 | Ga0070684_100181480 | |||
| 1403 | Ga0068853_100005992 | |||
| 1404 | Ga0068853_100009311 | |||
| 1405 | Ga0068853_100019086 | |||
| 1406 | Ga0068853_100023650 | |||
| 1407 | Ga0070672_100001074 | |||
| 1408 | Ga0070672_100001704 | |||
| 1409 | Ga0070672_100005096 | |||
| 1410 | Ga0070672_100012555 | |||
| 1411 | Ga0070672_100046284 | |||
| 1412 | Ga0070672_100078445 | |||
| 1413 | Ga0070672_100078605 | |||
| 1414 | Ga0070672_100287365 | |||
| 1415 | Ga0070686_100004725 | |||
| 1416 | Ga0070693_100009342 | |||
| 1417 | Ga0070693_100023224 | |||
| 1418 | Ga0070665_100003313 | |||
| 1419 | Ga0070665_100005444 | |||
| 1420 | Ga0070665_100006892 | |||
| 1421 | Ga0070665_100010582 | |||
| 1422 | Ga0070665_100092825 | |||
| 1423 | Ga0070665_100108872 | |||
| 1424 | Ga0070665_100144829 | |||
| 1425 | Ga0070665_100262285 | |||
| 1426 | Ga0068855_100000618 | |||
| 1427 | Ga0068855_100059864 | |||
| 1428 | Ga0068855_100091228 | |||
| 1429 | Ga0068855_100114630 | |||
| 1430 | Ga0068855_100159283 | |||
| 1431 | Ga0068855_100262211 | |||
| 1432 | Ga0070664_100008432 | |||
| 1433 | Ga0070664_100051283 | |||
| 1434 | Ga0070664_100104242 | |||
| 1435 | Ga0068857_100007291 | |||
| 1436 | Ga0068857_100014197 | |||
| 1437 | Ga0068857_100016044 | |||
| 1438 | Ga0068857_100086979 | |||
| 1439 | Ga0068854_100022298 | |||
| 1440 | Ga0068854_100022735 | |||
| 1441 | Ga0068854_100061024 | |||
| 1442 | Ga0068856_100000093 | |||
| 1443 | Ga0068856_100022002 | |||
| 1444 | Ga0068856_100125110 | |||
| 1445 | Ga0068852_100000265 | |||
| 1446 | Ga0068852_100004707 | |||
| 1447 | Ga0068852_100011098 | |||
| 1448 | Ga0068852_100029990 | |||
| 1449 | Ga0068852_100033803 | |||
| 1450 | Ga0068852_100060839 | |||
| 1451 | Ga0068852_100141132 | |||
| 1452 | Ga0068852_100307005 | |||
| 1453 | Ga0068859_100002465 | |||
| 1454 | Ga0068859_100020875 | |||
| 1455 | Ga0068859_100092457 | |||
| 1456 | Ga0068859_100168399 | |||
| 1457 | Ga0068859_100284431 | |||
| 1458 | Ga0068864_100005694 | |||
| 1459 | Ga0068864_100011928 | |||
| 1460 | Ga0068864_100017340 | |||
| 1461 | Ga0068864_100045429 | |||
| 1462 | Ga0068864_100108060 | |||
| 1463 | Ga0068864_100354794 | |||
| 1464 | Ga0068864_100464758 | |||
| 1465 | Ga0068866_10001528 | |||
| 1466 | Ga0068866_10036134 | |||
| 1467 | Ga0068861_100003054 | |||
| 1468 | Ga0068861_100033420 | |||
| 1469 | Ga0068861_100037238 | |||
| 1470 | Ga0068861_100044788 | |||
| 1471 | Ga0068861_100045459 | |||
| 1472 | Ga0068861_100110879 | |||
| 1473 | Ga0068851_10001117 | |||
| 1474 | Ga0068851_10002821 | |||
| 1475 | Ga0068851_10025333 | |||
| 1476 | Ga0068851_10057935 | |||
| 1477 | Ga0068870_10001406 | |||
| 1478 | Ga0068870_10015874 | |||
| 1479 | Ga0068870_10038307 | |||
| 1480 | Ga0068863_100002185 | |||
| 1481 | Ga0068863_100018376 | |||
| 1482 | Ga0068863_100020623 | |||
| 1483 | Ga0068863_100024582 | |||
| 1484 | Ga0068863_100032838 | |||
| 1485 | Ga0068863_100052723 | |||
| 1486 | Ga0068863_100077160 | |||
| 1487 | Ga0068863_100118397 | |||
| 1488 | Ga0068863_100129344 | |||
| 1489 | Ga0068863_100154888 | |||
| 1490 | Ga0068858_100003435 | |||
| 1491 | Ga0068858_100005392 | |||
| 1492 | Ga0068858_100005719 | |||
| 1493 | Ga0068858_100009830 | |||
| 1494 | Ga0068858_100010459 | |||
| 1495 | Ga0068858_100020675 | |||
| 1496 | Ga0068858_100030219 | |||
| 1497 | Ga0068858_100034811 | |||
| 1498 | Ga0068858_100396618 | |||
| 1499 | Ga0068860_100003281 | |||
| 1500 | Ga0068860_100004709 | |||
| 1501 | Ga0068860_100020794 | |||
| 1502 | Ga0068860_100031689 | |||
| 1503 | Ga0068860_100033805 | |||
| 1504 | Ga0068860_100042479 | |||
| 1505 | Ga0068860_100050709 | |||
| 1506 | Ga0068860_100051372 | |||
| 1507 | Ga0068862_100012971 | |||
| 1508 | Ga0068862_100025853 | |||
| 1509 | Ga0068862_100093050 | |||
| 1510 | Ga0081455_10003268 | |||
| 1511 | Ga0081455_10116880 | |||
| 1512 | Ga0081539_10023827 | |||
| 1513 | Ga0081539_10027215 | |||
| 1514 | Ga0075363_100062191 | |||
| 1515 | Ga0075364_10102625 | |||
| 1516 | Ga0075362_10012524 | |||
| 1517 | Ga0075367_10003415 | |||
| 1518 | Ga0075367_10005138 | |||
| 1519 | Ga0075367_10030966 | |||
| 1520 | Ga0075367_10122576 | |||
| 1521 | Ga0075369_10002321 | |||
| 1522 | Ga0075366_10044090 | |||
| 1523 | Ga0075366_10110854 | |||
| 1524 | Ga0097621_100007585 | |||
| 1525 | Ga0097621_100016593 | |||
| 1526 | Ga0097621_100025122 | |||
| 1527 | Ga0097621_100029264 | |||
| 1528 | Ga0097621_100082912 | |||
| 1529 | Ga0075370_10000157 | |||
| 1530 | Ga0075370_10000617 | |||
| 1531 | Ga0075370_10012187 | |||
| 1532 | Ga0075370_10035953 | |||
| 1533 | Ga0075370_10057366 | |||
| 1534 | Ga0075370_10080188 | |||
| 1535 | Ga0075370_10120898 | |||
| 1536 | Ga0068871_100014110 | |||
| 1537 | Ga0068871_100017513 | |||
| 1538 | Ga0068871_100029987 | |||
| 1539 | Ga0068871_100033032 | |||
| 1540 | Ga0068871_100226680 | |||
| 1541 | Ga0075428_100079945 | |||
| 1542 | Ga0075433_10032958 | |||
| 1543 | Ga0075433_10359690 | |||
| 1544 | Ga0075434_100017497 | |||
| 1545 | Ga0075434_100110940 | |||
| 1546 | Ga0075434_100223125 | |||
| 1547 | Ga0068865_100012656 | |||
| 1548 | Ga0068865_100033942 | |||
| 1549 | Ga0068865_100123612 | |||
| 1550 | Ga0097620_100002465 | |||
| 1551 | Ga0097620_100020876 | |||
| 1552 | Ga0097620_100092456 | |||
| 1553 | Ga0097620_100168400 | |||
| 1554 | Ga0097620_100284444 | |||
| 1555 | Ga0075435_100117035 | |||
| 1556 | Ga0105251_10000671 | |||
| 1557 | Ga0105251_10001447 | |||
| 1558 | Ga0105251_10032505 | |||
| 1559 | Ga0105240_10002436 | |||
| 1560 | Ga0105240_10016538 | |||
| 1561 | Ga0105240_10022166 | |||
| 1562 | Ga0105240_10045943 | |||
| 1563 | Ga0105240_10048690 | |||
| 1564 | Ga0105240_10205295 | |||
| 1565 | Ga0111539_10011146 | |||
| 1566 | Ga0105245_10018737 | |||
| 1567 | Ga0105245_10107659 | |||
| 1568 | Ga0105245_10282422 | |||
| 1569 | Ga0105247_10007966 | |||
| 1570 | Ga0105247_10110227 | |||
| 1571 | Ga0105241_10040157 | |||
| 1572 | Ga0105242_10132477 | |||
| 1573 | Ga0105248_10003137 | |||
| 1574 | Ga0105248_10017241 | |||
| 1575 | Ga0105248_10018724 | |||
| 1576 | Ga0105237_10091876 | |||
| 1577 | Ga0105237_10180232 | |||
| 1578 | Ga0105237_10290995 | |||
| 1579 | Ga0105238_10041126 | |||
| 1580 | Ga0105249_10147133 | |||
| 1581 | Ga0105249_10163717 | |||
| 1582 | Ga0105249_10296402 | |||
| 1583 | Ga0105239_10001161 | |||
| 1584 | Ga0105239_10497661 | |||
| 1585 | Ga0105239_10676282 | |||
| 1586 | Ga0105246_10029890 | |||
| 1587 | Ga0157373_10000777 | |||
| 1588 | Ga0157373_10010136 | |||
| 1589 | Ga0157373_10043636 | |||
| 1590 | Ga0157371_10008425 | |||
| 1591 | Ga0157370_10005771 | |||
| 1592 | Ga0157370_10019561 | |||
| 1593 | Ga0157369_10001395 | |||
| 1594 | Ga0157369_10006755 | |||
| 1595 | Ga0157369_10008403 | |||
| 1596 | Ga0157369_10025742 | |||
| 1597 | Ga0157369_10042581 | |||
| 1598 | Ga0157369_10325518 | |||
| 1599 | Ga0157374_10001040 | |||
| 1600 | Ga0157374_10007000 | |||
| 1601 | Ga0157374_10008031 | |||
| 1602 | Ga0157374_10017774 | |||
| 1603 | Ga0157374_10029253 | |||
| 1604 | Ga0157374_10313103 | |||
| 1605 | Ga0157378_10005031 | |||
| 1606 | Ga0157378_10006031 | |||
| 1607 | Ga0157378_10014439 | |||
| 1608 | Ga0157378_10042441 | |||
| 1609 | Ga0157378_10069600 | |||
| 1610 | Ga0157378_10091530 | |||
| 1611 | Ga0157378_10105755 | |||
| 1612 | Ga0157378_10165826 | |||
| 1613 | Ga0163162_10004087 | |||
| 1614 | Ga0163162_10030122 | |||
| 1615 | Ga0163162_10043717 | |||
| 1616 | Ga0163162_10070653 | |||
| 1617 | Ga0163162_10089123 | |||
| 1618 | Ga0163162_10095019 | |||
| 1619 | Ga0163162_10308831 | |||
| 1620 | Ga0163162_10448565 | |||
| 1621 | Ga0157372_10000852 | |||
| 1622 | Ga0157372_10001735 | |||
| 1623 | Ga0157372_10022569 | |||
| 1624 | Ga0157372_10029653 | |||
| 1625 | Ga0157375_10033547 | |||
| 1626 | Ga0157375_10180955 | |||
| 1627 | Ga0157375_10501181 | |||
| 1628 | Ga0163163_10001673 | |||
| 1629 | Ga0163163_10017149 | |||
| 1630 | Ga0163163_10037547 | |||
| 1631 | Ga0163163_10054748 | |||
| 1632 | Ga0163163_10074747 | |||
| 1633 | Ga0163163_10184228 | |||
| 1634 | Ga0157380_10085914 | |||
| 1635 | Ga0157380_10230269 | |||
| 1636 | Ga0182008_10012750 | |||
| 1637 | Ga0157377_10001479 | |||
| 1638 | Ga0157377_10006198 | |||
| 1639 | Ga0157379_10000219 | |||
| 1640 | Ga0157379_10003465 | |||
| 1641 | Ga0157379_10015827 | |||
| 1642 | Ga0157379_10032158 | |||
| 1643 | Ga0157379_10065986 | |||
| 1644 | Ga0157379_10369171 | |||
| 1645 | Ga0157376_10025185 | |||
| 1646 | Ga0157376_10031030 | |||
| 1647 | Ga0157376_10116895 | |||
| 1648 | Ga0182007_10000465 | |||
| 1649 | Ga0163161_10008715 | |||
| 1650 | Ga0163161_10020759 | |||
| 1651 | Ga0163161_10035616 | |||
| 1652 | Ga0163161_10200499 | |||
| 1653 | Ga0209566_100264 | |||
| 1654 | Ga0209674_100017 | |||
| 1655 | Ga0209674_100291 | |||
| 1656 | Ga0209674_101162 | |||
| 1657 | Ga0209672_100001 | |||
| 1658 | Ga0209672_100115 | |||
| 1659 | Ga0209672_100136 | |||
| 1660 | Ga0209147_100022 | |||
| 1661 | Ga0209147_100164 | |||
| 1662 | Ga0209147_100215 | |||
| 1663 | Ga0209147_100360 | |||
| 1664 | Ga0209563_101730 | |||
| 1665 | Ga0207427_100419 | |||
| 1666 | Ga0209258_100033 | |||
| 1667 | Ga0209258_100261 | |||
| 1668 | Ga0209258_100271 | |||
| 1669 | Ga0209148_1000046 | |||
| 1670 | Ga0209148_1000104 | |||
| 1671 | Ga0209148_1000609 | |||
| 1672 | Ga0209759_1000180 | |||
| 1673 | Ga0209759_1000231 | |||
| 1674 | Ga0209759_1000568 | |||
| 1675 | Ga0209759_1007514 | |||
| 1676 | Ga0209233_1000050 | |||
| 1677 | Ga0209565_1003571 | |||
| 1678 | Ga0209455_1000038 | |||
| 1679 | Ga0209455_1000097 | |||
| 1680 | Ga0209673_1000124 | |||
| 1681 | Ga0209676_1003712 | |||
| 1682 | Ga0209564_1001909 | |||
| 1683 | Ga0209564_1010372 | |||
| 1684 | Ga0209050_1006245 | |||
| 1685 | Ga0207426_1000007 | |||
| 1686 | Ga0207426_1001933 | |||
| 1687 | Ga0207697_10000241 | |||
| 1688 | Ga0207697_10000378 | |||
| 1689 | Ga0207697_10047102 | |||
| 1690 | Ga0207656_10003936 | |||
| 1691 | Ga0207656_10007815 | |||
| 1692 | Ga0207656_10083753 | |||
| 1693 | Ga0207713_1000064 | |||
| 1694 | Ga0207682_10000106 | |||
| 1695 | Ga0207682_10001272 | |||
| 1696 | Ga0207682_10001404 | |||
| 1697 | Ga0207682_10001758 | |||
| 1698 | Ga0207682_10026844 | |||
| 1699 | Ga0207642_10082255 | |||
| 1700 | Ga0207710_10055288 | |||
| 1701 | Ga0207688_10000062 | |||
| 1702 | Ga0207688_10002838 | |||
| 1703 | Ga0207688_10112938 | |||
| 1704 | Ga0207688_10132486 | |||
| 1705 | Ga0207680_10003378 | |||
| 1706 | Ga0207680_10006222 | |||
| 1707 | Ga0207680_10025862 | |||
| 1708 | Ga0207680_10030104 | |||
| 1709 | Ga0207680_10031279 | |||
| 1710 | Ga0207680_10095925 | |||
| 1711 | Ga0207647_10000160 | |||
| 1712 | Ga0207647_10001190 | |||
| 1713 | Ga0207647_10005355 | |||
| 1714 | Ga0207647_10006047 | |||
| 1715 | Ga0207647_10030737 | |||
| 1716 | Ga0207645_10000643 | |||
| 1717 | Ga0207645_10000947 | |||
| 1718 | Ga0207645_10001010 | |||
| 1719 | Ga0207645_10003404 | |||
| 1720 | Ga0207645_10006139 | |||
| 1721 | Ga0207645_10007374 | |||
| 1722 | Ga0207645_10008382 | |||
| 1723 | Ga0207645_10024574 | |||
| 1724 | Ga0207645_10080836 | |||
| 1725 | Ga0207645_10151205 | |||
| 1726 | Ga0207643_10000555 | |||
| 1727 | Ga0207643_10000994 | |||
| 1728 | Ga0207643_10004775 | |||
| 1729 | Ga0207643_10030729 | |||
| 1730 | Ga0207705_10052854 | |||
| 1731 | Ga0207684_10002166 | |||
| 1732 | Ga0207684_10024612 | |||
| 1733 | Ga0207654_10040521 | |||
| 1734 | Ga0207707_10019848 | |||
| 1735 | Ga0207695_10006665 | |||
| 1736 | Ga0207695_10036528 | |||
| 1737 | Ga0207695_10412696 | |||
| 1738 | Ga0207671_10052511 | |||
| 1739 | Ga0207671_10071949 | |||
| 1740 | Ga0207662_10010347 | |||
| 1741 | Ga0207662_10017900 | |||
| 1742 | Ga0207657_10001682 | |||
| 1743 | Ga0207657_10013412 | |||
| 1744 | Ga0207657_10030166 | |||
| 1745 | Ga0207657_10054821 | |||
| 1746 | Ga0207649_10012511 | |||
| 1747 | Ga0207649_10014014 | |||
| 1748 | Ga0207649_10027271 | |||
| 1749 | Ga0207649_10029848 | |||
| 1750 | Ga0207649_10069468 | |||
| 1751 | Ga0207652_10034716 | |||
| 1752 | Ga0207646_10009371 | |||
| 1753 | Ga0207646_10270335 | |||
| 1754 | Ga0207681_10019385 | |||
| 1755 | Ga0207694_10019888 | |||
| 1756 | Ga0207694_10209071 | |||
| 1757 | Ga0207694_10226019 | |||
| 1758 | Ga0207650_10002778 | |||
| 1759 | Ga0207650_10004595 | |||
| 1760 | Ga0207650_10004708 | |||
| 1761 | Ga0207650_10016518 | |||
| 1762 | Ga0207650_10057057 | |||
| 1763 | Ga0207650_10107662 | |||
| 1764 | Ga0207659_10001627 | |||
| 1765 | Ga0207659_10016723 | |||
| 1766 | Ga0207659_10036297 | |||
| 1767 | Ga0207659_10036463 | |||
| 1768 | Ga0207659_10040394 | |||
| 1769 | Ga0207659_10170752 | |||
| 1770 | Ga0207644_10002345 | |||
| 1771 | Ga0207644_10005166 | |||
| 1772 | Ga0207644_10006271 | |||
| 1773 | Ga0207644_10006648 | |||
| 1774 | Ga0207644_10015798 | |||
| 1775 | Ga0207644_10023527 | |||
| 1776 | Ga0207644_10025774 | |||
| 1777 | Ga0207644_10034330 | |||
| 1778 | Ga0207644_10057467 | |||
| 1779 | Ga0207644_10129872 | |||
| 1780 | Ga0207644_10245047 | |||
| 1781 | Ga0207644_10266992 | |||
| 1782 | Ga0207690_10000012 | |||
| 1783 | Ga0207690_10047939 | |||
| 1784 | Ga0207690_10065701 | |||
| 1785 | Ga0207690_10078695 | |||
| 1786 | Ga0207706_10000014 | |||
| 1787 | Ga0207706_10001235 | |||
| 1788 | Ga0207706_10005642 | |||
| 1789 | Ga0207706_10061497 | |||
| 1790 | Ga0207706_10143690 | |||
| 1791 | Ga0207706_10151102 | |||
| 1792 | Ga0207686_10037457 | |||
| 1793 | Ga0207670_10064043 | |||
| 1794 | Ga0207669_10006691 | |||
| 1795 | Ga0207669_10008073 | |||
| 1796 | Ga0207669_10008872 | |||
| 1797 | Ga0207669_10125381 | |||
| 1798 | Ga0207704_10008463 | |||
| 1799 | Ga0207704_10057591 | |||
| 1800 | Ga0207704_10068553 | |||
| 1801 | Ga0207665_10065201 | |||
| 1802 | Ga0207691_10000427 | |||
| 1803 | Ga0207691_10000453 | |||
| 1804 | Ga0207691_10004101 | |||
| 1805 | Ga0207691_10004432 | |||
| 1806 | Ga0207691_10004600 | |||
| 1807 | Ga0207691_10022987 | |||
| 1808 | Ga0207691_10024015 | |||
| 1809 | Ga0207691_10036867 | |||
| 1810 | Ga0207691_10050884 | |||
| 1811 | Ga0207691_10057558 | |||
| 1812 | Ga0207691_10130283 | |||
| 1813 | Ga0207691_10206803 | |||
| 1814 | Ga0207691_10288998 | |||
| 1815 | Ga0207711_10005592 | |||
| 1816 | Ga0207711_10033577 | |||
| 1817 | Ga0207711_10044709 | |||
| 1818 | Ga0207689_10001490 | |||
| 1819 | Ga0207689_10001602 | |||
| 1820 | Ga0207689_10002003 | |||
| 1821 | Ga0207689_10006947 | |||
| 1822 | Ga0207689_10009876 | |||
| 1823 | Ga0207689_10016553 | |||
| 1824 | Ga0207689_10053561 | |||
| 1825 | Ga0207689_10075975 | |||
| 1826 | Ga0207689_10083823 | |||
| 1827 | Ga0207661_10040145 | |||
| 1828 | Ga0207679_10015901 | |||
| 1829 | Ga0207679_10037248 | |||
| 1830 | Ga0207679_10123011 | |||
| 1831 | Ga0207679_10270107 | |||
| 1832 | Ga0207667_10004701 | |||
| 1833 | Ga0207667_10006720 | |||
| 1834 | Ga0207667_10078813 | |||
| 1835 | Ga0207667_10190424 | |||
| 1836 | Ga0207651_10014505 | |||
| 1837 | Ga0207651_10024084 | |||
| 1838 | Ga0207651_10108695 | |||
| 1839 | Ga0207712_10022690 | |||
| 1840 | Ga0207712_10056810 | |||
| 1841 | Ga0207668_10003043 | |||
| 1842 | Ga0207668_10009335 | |||
| 1843 | Ga0207668_10013796 | |||
| 1844 | Ga0207668_10018430 | |||
| 1845 | Ga0207668_10041736 | |||
| 1846 | Ga0207668_10048637 | |||
| 1847 | Ga0207668_10102863 | |||
| 1848 | Ga0207668_10208791 | |||
| 1849 | Ga0207640_10022876 | |||
| 1850 | Ga0207640_10034512 | |||
| 1851 | Ga0207640_10051886 | |||
| 1852 | Ga0207640_10074161 | |||
| 1853 | Ga0207640_10079323 | |||
| 1854 | Ga0207640_10081190 | |||
| 1855 | Ga0207658_10021436 | |||
| 1856 | Ga0207658_10038978 | |||
| 1857 | Ga0207658_10067663 | |||
| 1858 | Ga0207658_10071097 | |||
| 1859 | Ga0207658_10075476 | |||
| 1860 | Ga0207658_10098441 | |||
| 1861 | Ga0207658_10106611 | |||
| 1862 | Ga0207658_10194170 | |||
| 1863 | Ga0207658_10259461 | |||
| 1864 | Ga0207658_10355677 | |||
| 1865 | Ga0207677_10018111 | |||
| 1866 | Ga0207677_10036704 | |||
| 1867 | Ga0207677_10087343 | |||
| 1868 | Ga0207677_10094735 | |||
| 1869 | Ga0207677_10123124 | |||
| 1870 | Ga0207677_10270318 | |||
| 1871 | Ga0207703_10001278 | |||
| 1872 | Ga0207703_10003727 | |||
| 1873 | Ga0207703_10005904 | |||
| 1874 | Ga0207703_10019294 | |||
| 1875 | Ga0207703_10077042 | |||
| 1876 | Ga0207703_10162644 | |||
| 1877 | Ga0207703_10172017 | |||
| 1878 | Ga0207639_10017538 | |||
| 1879 | Ga0207639_10059228 | |||
| 1880 | Ga0207639_10061158 | |||
| 1881 | Ga0207639_10100845 | |||
| 1882 | Ga0207639_10147748 | |||
| 1883 | Ga0207639_10191095 | |||
| 1884 | Ga0207678_10000076 | |||
| 1885 | Ga0207678_10002409 | |||
| 1886 | Ga0207678_10014291 | |||
| 1887 | Ga0207678_10014424 | |||
| 1888 | Ga0207678_10018320 | |||
| 1889 | Ga0207678_10019124 | |||
| 1890 | Ga0207678_10048083 | |||
| 1891 | Ga0207678_10063147 | |||
| 1892 | Ga0207678_10144250 | |||
| 1893 | Ga0207708_10000721 | |||
| 1894 | Ga0207708_10089789 | |||
| 1895 | Ga0207708_10178950 | |||
| 1896 | Ga0207702_10002780 | |||
| 1897 | Ga0207702_10055110 | |||
| 1898 | Ga0207702_10105027 | |||
| 1899 | Ga0207702_10291767 | |||
| 1900 | Ga0207641_10009563 | |||
| 1901 | Ga0207641_10010972 | |||
| 1902 | Ga0207641_10017532 | |||
| 1903 | Ga0207641_10021295 | |||
| 1904 | Ga0207641_10046720 | |||
| 1905 | Ga0207641_10101091 | |||
| 1906 | Ga0207641_10178279 | |||
| 1907 | Ga0207641_10246708 | |||
| 1908 | Ga0207641_10283388 | |||
| 1909 | Ga0207648_10000622 | |||
| 1910 | Ga0207648_10001351 | |||
| 1911 | Ga0207648_10003119 | |||
| 1912 | Ga0207648_10008451 | |||
| 1913 | Ga0207648_10016411 | |||
| 1914 | Ga0207648_10059208 | |||
| 1915 | Ga0207676_10007978 | |||
| 1916 | Ga0207676_10019486 | |||
| 1917 | Ga0207676_10024327 | |||
| 1918 | Ga0207676_10100702 | |||
| 1919 | Ga0207676_10451433 | |||
| 1920 | Ga0207674_10002529 | |||
| 1921 | Ga0207674_10004238 | |||
| 1922 | Ga0207674_10007009 | |||
| 1923 | Ga0207674_10024335 | |||
| 1924 | Ga0207674_10052152 | |||
| 1925 | Ga0207674_10101207 | |||
| 1926 | Ga0207675_100000493 | |||
| 1927 | Ga0207675_100001240 | |||
| 1928 | Ga0207675_100007517 | |||
| 1929 | Ga0207675_100029496 | |||
| 1930 | Ga0207675_100090772 | |||
| 1931 | Ga0207675_100187450 | |||
| 1932 | Ga0207683_10000008 | |||
| 1933 | Ga0207683_10000133 | |||
| 1934 | Ga0207683_10000255 | |||
| 1935 | Ga0207683_10000504 | |||
| 1936 | Ga0207683_10003640 | |||
| 1937 | Ga0207683_10008887 | |||
| 1938 | Ga0207683_10012625 | |||
| 1939 | Ga0207683_10039146 | |||
| 1940 | Ga0207683_10159100 | |||
| 1941 | Ga0207698_10024032 | |||
| 1942 | Ga0207698_10026089 | |||
| 1943 | Ga0207698_10044355 | |||
| 1944 | Ga0207698_10132097 | |||
| 1945 | Ga0207698_10137566 | |||
| 1946 | Ga0207698_10200548 | |||
| 1947 | Ga0209371_1000185 | |||
| 1948 | Ga0209371_1021121 | |||
| 1949 | Ga0209971_1005327 | |||
| 1950 | Ga0209998_10002067 | |||
| 1951 | Ga0209813_10008703 | |||
| 1952 | Ga0209974_10011520 | |||
| 1953 | Ga0207428_10176037 | |||
| 1954 | Ga0268266_10006244 | |||
| 1955 | Ga0268266_10111725 | |||
| 1956 | Ga0268266_10136948 | |||
| 1957 | Ga0268266_10288654 | |||
| 1958 | Ga0268265_10147329 | |||
| 1959 | Ga0268265_10154199 | |||
| 1960 | Ga0268264_10002240 | |||
| 1961 | Ga0268264_10018760 | |||
| 1962 | Ga0268264_10027217 | |||
| 1963 | Ga0268264_10103779 | |||
| 1964 | Ga0307515_10095930 | |||
| 1965 | Ga0268256_1000847 | |||
| 1966 | Ga0268256_1023750 | |||
| 1967 | Ga0265332_10000026 | |||
| 1968 | Ga0265332_10041535 | |||
| 1969 | Ga0265325_10000686 | |||
| 1970 | Ga0265316_10036183 | |||
| 1971 | Ga0307513_10026627 | |||
| 1972 | Ga0307408_100000227 | |||
| 1973 | Ga0307408_100008544 | |||
| 1974 | Ga0307408_100011033 | |||
| 1975 | Ga0307516_10025491 | |||
| 1976 | Ga0307405_10008674 | |||
| 1977 | Ga0307405_10050431 | |||
| 1978 | Ga0307413_10004560 | |||
| 1979 | Ga0307413_10160565 | |||
| 1980 | Ga0307410_10010598 | |||
| 1981 | Ga0307410_10018790 | |||
| 1982 | Ga0307406_10005672 | |||
| 1983 | Ga0307406_10012655 | |||
| 1984 | Ga0307407_10008227 | |||
| 1985 | Ga0307407_10017947 | |||
| 1986 | Ga0307412_10000011 | |||
| 1987 | Ga0307412_10000819 | |||
| 1988 | Ga0307412_10001311 | |||
| 1989 | Ga0307412_10007528 | |||
| 1990 | Ga0307412_10015894 | |||
| 1991 | Ga0307412_10038366 | |||
| 1992 | Ga0307409_100011472 | |||
| 1993 | Ga0307416_100014656 | |||
| 1994 | Ga0307416_100018099 | |||
| 1995 | Ga0307416_100025378 | |||
| 1996 | Ga0307411_10000342 | |||
| 1997 | Ga0307415_100012133 | |||
| 1998 | Ga0373955_0020600 | |||
| 1999 | Ga0373955_0102507 | |||
| 2000 | Ga0373942_0038342 | |||
| 2001 | Ga0373924_0050746 | |||
| 2002 | Ga0373931_0070127 | |||
| 2003 | Ga0373927_0084473 | |||
| 2004 | Ga0373947_0053707 | |||
| 2005 | Ga0373937_0093668 | |||
| 2006 | Ga0373937_0228789 | |||
| 2007 | Ga0373925_0008350 | |||
| 2008 | Ga0373925_0146143 | |||
| 2009 | Ga0395900_0049220 | |||
| 2010 | Ga0395900_0068346 | |||
| 2011 | Ga0395900_0124396 | |||
| 2012 | Ga0395898_0001927 | |||
| 2013 | Ga0395898_0089622 | |||
| 2014 | Ga0395905_0000079 | |||
| 2015 | Ga0395905_0021231 | |||
| 2016 | Ga0436364_0213269 | |||
| 2017 | Ga0395901_0002134 | |||
| 2018 | Ga0395901_0010899 | |||
| 2019 | Ga0395901_0022287 | |||
| 2020 | Ga0395901_0041093 | |||
| 2021 | Ga0395901_0047593 | |||
| 2022 | Ga0436365_0414012 | |||
| 2023 | Ga0436361_0524475 | |||
| 2024 | Ga0436363_0071338 | |||
| 2025 | Ga0451791_1678248 | |||
| 2026 | Ga0439448_0000556 | |||
| 2027 | Ga0439455_0013825 | |||
| 2028 | Ga0451577_0073212 | |||
| 2029 | Ga0466973_0003647 | |||
| 2030 | Ga0466965_0001188 | |||
| 2031 | Ga0466966_0000753 | |||
| 2032 | Ga0466966_0014807 | |||
| 2033 | Ga0466966_0016639 | |||
| 2034 | Ga0466961_0008782 | |||
| 2035 | Ga0466961_0013890 | |||
| 2036 | Ga0466961_0054525 | |||
| 2037 | Ga0466961_0060424 | |||
| 2038 | Ga0466963_0030764 | |||
| 2039 | Ga0453684_0000659 | |||
| 2040 | Ga0453684_0013238 | |||
| 2041 | Ga0453684_0016855 | |||
| 2042 | Ga0453684_0032124 | |||
| 2043 | Ga0466971_0035732 | |||
| 2044 | Ga0466971_0039807 | |||
| 2045 | Ga0466957_0079131 | |||
| 2046 | Ga0451576_0000917 | |||
| 2047 | Ga0466958_0007770 | |||
| 2048 | Ga0466958_0011823 | |||
| 2049 | Ga0466958_0066601 | |||
| 2050 | Ga0495592_0023344 | |||
| 2051 | Ga0495603_0008549 | |||
| 2052 | Ga0495603_0022435 | |||
| 2053 | Ga0495590_0005178 | |||
| 2054 | Ga0495590_0005410 | |||
| 2055 | Ga0495590_0027735 | |||
| 2056 | Ga0495590_0037926 | |||
| 2057 | Ga0495591_003395 | |||
| 2058 | Ga0495591_005964 | |||
| 2059 | Ga0495629_0001148 | |||
| 2060 | Ga0495629_0007503 | |||
| 2061 | Ga0495629_0014432 | |||
| 2062 | Ga0495629_0025391 | |||
| 2063 | Ga0495629_0045030 | |||
| 2064 | Ga0495638_0003608 | |||
| 2065 | Ga0495638_0043787 | |||
| 2066 | Ga0495651_0016179 | |||
| 2067 | Ga0495653_0049709 | |||
| 2068 | Ga0495653_0177358 | |||
| 2069 | Ga0495650_0007327 | |||
| 2070 | Ga0495650_0034514 | |||
| 2071 | Ga0495650_0056407 | |||
| 2072 | Ga0495580_0017512 | |||
| 2073 | Ga0495580_0027508 | |||
| 2074 | Ga0495580_0027552 | |||
| 2075 | Ga0495580_0111005 | |||
| 2076 | Ga0495582_0005503 | |||
| 2077 | Ga0495582_0014589 | |||
| 2078 | Ga0495605_0008591 | |||
| 2079 | Ga0495605_0051566 | |||
| 2080 | Ga0495662_0033519 | |||
| 2081 | Ga0495596_0006198 | |||
| 2082 | Ga0495607_0000009 | |||
| 2083 | Ga0495607_0019953 | |||
| 2084 | Ga0495583_0035066 | |||
| 2085 | Ga0495606_0017079 | |||
| 2086 | Ga0495606_0029191 | |||
| 2087 | Ga0495606_0042270 | |||
| 2088 | Ga0495608_0015231 | |||
| 2089 | Ga0495610_0002064 | |||
| 2090 | Ga0495616_0007729 | |||
| 2091 | Ga0495618_0003307 | |||
| 2092 | Ga0495618_0016177 | |||
| 2093 | Ga0495628_0019963 | |||
| 2094 | Ga0495628_0046029 | |||
| 2095 | Ga0495628_0055588 | |||
| 2096 | Ga0495628_0084035 | |||
| 2097 | Ga0495630_0052730 | |||
| 2098 | Ga0495630_0084542 | |||
| 2099 | Ga0495637_0011099 | |||
| 2100 | Ga0495643_0011706 | |||
| 2101 | Ga0495644_0026808 | |||
| 2102 | Ga0495666_0007034 | |||
| 2103 | Ga0495666_0007567 | |||
| 2104 | Ga0495642_0041987 | |||
| 2105 | Ga0495652_0007296 | |||
| 2106 | Ga0495652_0045841 | |||
| 2107 | Ga0495665_0009073 | |||
| 2108 | Ga0495665_0009210 | |||
| 2109 | Ga0495640_0017143 | |||
| 2110 | Ga0495587_0013269 | |||
| 2111 | Ga0495621_0005808 | |||
| 2112 | Ga0495597_0008664 | |||
| 2113 | Ga0495597_0057003 | |||
| 2114 | Ga0495597_0062288 | |||
| 2115 | Ga0495645_0004772 | |||
| 2116 | Ga0495645_0115988 | |||
| 2117 | Ga0495622_0005858 | |||
| 2118 | Ga0495622_0011359 | |||
| 2119 | Ga0495668_0140163 | |||
| 2120 | Ga0495634_0015178 | |||
| 2121 | Ga0495634_0041591 | |||
| 2122 | Ga0495611_0020582 | |||
| 2123 | Ga0495635_0005295 | |||
| 2124 | Ga0495635_0123230 | |||
| 2125 | Ga0495661_0002821 | |||
| 2126 | Ga0495661_0011330 | |||
| 2127 | Ga0495661_0023525 | |||
| 2128 | Ga0495599_0029487 | |||
| 2129 | Ga0495623_0000579 | |||
| 2130 | Ga0495623_0022842 | |||
| 2131 | Ga0495623_0030764 | |||
| 2132 | Ga0495646_0053046 | |||
| 2133 | Ga0495658_0014701 | |||
| 2134 | Ga0495658_0140661 | |||
| 2135 | Ga0495613_0015540 | |||
| 2136 | Ga0495624_0007224 | |||
| 2137 | Ga0495624_0128791 | |||
| 2138 | Ga0495649_0005474 | |||
| 2139 | Ga0495649_0007873 | |||
| 2140 | Ga0495649_0008109 | |||
| 2141 | Ga0495649_0032271 | |||
| 2142 | Ga0495589_0015924 | |||
| 2143 | Ga0495589_0017912 | |||
| 2144 | Ga0495600_0001590 | |||
| 2145 | Ga0495600_0011974 | |||
| 2146 | Ga0495581_0001489 | |||
| 2147 | Ga0495581_0003869 | |||
| 2148 | Ga0495604_0018528 | |||
| 2149 | Ga0495604_0021070 | |||
| 2150 | Ga0495674_0006044 | |||
| 2151 | Ga0495674_0023512 | |||
| 2152 | Ga0495674_0032916 | |||
| 2153 | Ga0495674_0042812 | |||
| 2154 | Ga0495674_0124537 | |||
| 2155 | Ga0495676_0120811 | |||
| 2156 | Ga0495680_0002302 | |||
| 2157 | Ga0495680_0222080 | |||
| 2158 | Ga0495683_0003339 | |||
| 2159 | Ga0495683_0004598 | |||
| 2160 | Ga0495683_0018207 | |||
| 2161 | Ga0495683_0065114 | |||
| 2162 | Ga0495683_0123875 | |||
| 2163 | Ga0495687_000053 | |||
| 2164 | Ga0495687_001004 | |||
| 2165 | Ga0495687_009162 | |||
| 2166 | Ga0495687_012920 | |||
| 2167 | Ga0495687_023722 | |||
| 2168 | Ga0495675_0001937 | |||
| 2169 | Ga0495675_0022841 | |||
| 2170 | Ga0495675_0067509 | |||
| 2171 | Ga0495679_000156 | |||
| 2172 | Ga0495679_011687 | |||
| 2173 | Ga0495679_023716 | |||
| 2174 | Ga0495673_0037562 | |||
| 2175 | Ga0495684_0108710 | |||
| 2176 | Ga0495686_0000519 | |||
| 2177 | Ga0495686_0047356 | |||
| 2178 | Ga0495593_0001073 | |||
| 2179 | Ga0495593_0040922 | |||
| 2180 | Ga0495593_0065877 | |||
| 2181 | Ga0495602_0040914 | |||
| 2182 | Ga0495602_0079957 | |||
| 2183 | Ga0495614_0000394 | |||
| 2184 | Ga0495614_0006231 | |||
| 2185 | Ga0495626_0025837 | |||
| 2186 | Ga0495626_0096504 | |||
| 2187 | Ga0496100_0103449 | |||
| 2188 | Ga0496100_0130027 | |||
| 2189 | Ga0496100_0159831 | |||
| 2190 | Ga0496101_0020522 | |||
| 2191 | Ga0496101_0034664 | |||
| 2192 | Ga0496101_0048173 | |||
| 2193 | Ga0496102_0010175 | |||
| 2194 | Ga0496102_0017335 | |||
| 2195 | Ga0496102_0025230 | |||
| 2196 | Ga0496102_0031026 | |||
| 2197 | Ga0496102_0052864 | |||
| 2198 | Ga0496102_0061722 | |||
| 2199 | Ga0496102_0117818 | |||
| 2200 | Ga0496102_0121758 | |||
| 2201 | Ga0496102_0141068 | |||
| 2202 | Ga0496102_0327359 | |||
| 2203 | Ga0496103_0014601 | |||
| 2204 | Ga0496103_0151420 | |||
| 2205 | Ga0496103_0164294 | |||
| 2206 | Ga0496104_0010736 | |||
| 2207 | Ga0496104_0049904 | |||
| 2208 | Ga0496104_0078895 | |||
| 2209 | Ga0496105_0004400 | |||
| 2210 | Ga0496105_0024174 | |||
| 2211 | Ga0496105_0260987 | |||
| 2212 | Ga0496106_0002288 | |||
| 2213 | Ga0496106_0193296 | |||
| 2214 | Ga0496107_0068311 | |||
| 2215 | Ga0496107_0078947 | |||
| 2216 | Ga0496107_0197081 | |||
| 2217 | Ga0496108_0014298 | |||
| 2218 | Ga0496108_0035500 | |||
| 2219 | Ga0496108_0066034 | |||
| 2220 | Ga0496109_0036151 | |||
| 2221 | Ga0496109_0048566 | |||
| 2222 | Ga0496109_0228278 | |||
| 2223 | Ga0496109_0447564 | |||
| 2224 | Ga0496110_0020925 | |||
| 2225 | Ga0496110_0134053 | |||
| 2226 | Ga0496110_0165336 | |||
| 2227 | Ga0496111_0296604 | |||
| 2228 | Ga0496112_0002051 | |||
| 2229 | Ga0496112_0033732 | |||
| 2230 | Ga0496112_0122979 | |||
| 2231 | Ga0496113_0028510 | |||
| 2232 | Ga0496113_0056135 | |||
| 2233 | Ga0496114_0001851 | |||
| 2234 | Ga0496114_0056745 | |||
| 2235 | Ga0496114_0306124 | |||
| 2236 | Ga0496115_0099610 | |||
| 2237 | Ga0496116_0010706 | |||
| 2238 | Ga0496116_0015926 | |||
| 2239 | Ga0496116_0019593 | |||
| 2240 | Ga0496117_0005096 | |||
| 2241 | Ga0496117_0008616 | |||
| 2242 | Ga0496117_0025161 | |||
| 2243 | Ga0496117_0032547 | |||
| 2244 | Ga0496117_0042762 | |||
| 2245 | Ga0496117_0046755 | |||
| 2246 | Ga0496118_0001664 | |||
| 2247 | Ga0496118_0002738 | |||
| 2248 | Ga0496118_0009250 | |||
| 2249 | Ga0496118_0011642 | |||
| 2250 | Ga0496118_0020035 | |||
| 2251 | Ga0496118_0025697 | |||
| 2252 | Ga0496118_0075633 | |||
| 2253 | Ga0496118_0103979 | |||
| 2254 | Ga0496119_0007583 | |||
| 2255 | Ga0496119_0018374 | |||
| 2256 | Ga0496119_0019501 | |||
| 2257 | Ga0496119_0051972 | |||
| 2258 | Ga0496119_0068323 | |||
| 2259 | Ga0496120_0007282 | |||
| 2260 | Ga0496120_0038111 | |||
| 2261 | Ga0496121_0000164 | |||
| 2262 | Ga0496121_0004956 | |||
| 2263 | Ga0496121_0025108 | |||
| 2264 | Ga0496121_0026445 | |||
| 2265 | Ga0496121_0066813 | |||
| 2266 | Ga0496121_0108325 | |||
| 2267 | Ga0496122_0000865 | |||
| 2268 | Ga0496122_0001706 | |||
| 2269 | Ga0496122_0042110 | |||
| 2270 | Ga0496122_0047209 | |||
| 2271 | Ga0496122_0086012 | |||
| 2272 | Ga0496123_0000203 | |||
| 2273 | Ga0496123_0001919 | |||
| 2274 | Ga0496123_0031845 | |||
| 2275 | Ga0496124_0035716 | |||
| 2276 | Ga0496124_0039370 | |||
| 2277 | Ga0496124_0098439 | |||
| 2278 | Ga0496125_0000011 | |||
| 2279 | Ga0496125_0000241 | |||
| 2280 | Ga0496125_0016616 | |||
| 2281 | Ga0496125_0047447 | |||
| 2282 | Ga0496125_0085613 | |||
| 2283 | Ga0496126_0000118 | |||
| 2284 | Ga0496126_0004623 | |||
| 2285 | Ga0496126_0052121 | |||
| 2286 | Ga0496126_0091523 | |||
| 2287 | Ga0496126_0127914 | |||
| 2288 | Ga0496126_0274708 | |||
| 2289 | Ga0495678_020912 | |||
| 2290 | Ga0495682_0069519 | |||
| 2291 | Ga0501033_0083225 | |||
| 2292 | Ga0501034_0176816 | |||
| 2293 | Ga0501043_0191811 | |||
| 2294 | Ga0501067_0067477 | |||
| 2295 | Ga0501069_0113096 | |||
| 2296 | Ga0501070_0007055 | |||
| 2297 | Ga0501072_0027713 | |||
| 2298 | Ga0501074_0052928 | |||
| 2299 | Ga0501080_0037277 | |||
| 2300 | Ga0501083_0030372 | |||
| 2301 | Ga0501044_0002376 | |||
| 2302 | nmdc:mga03683_56980_c1 | |||
| 2303 | nmdc:mga0k408_24569_c1 | |||
| 2304 | nmdc:mga0k408_6630_c1 | |||
| 2305 | nmdc:mga06z11_7546_c1 | |||
| 2306 | nmdc:mga07m45_32734_c1 | |||
| 2307 | nmdc:mga07m45_3489_c1 | |||
| 2308 | nmdc:mga07m45_39477_c1 | |||
| 2309 | nmdc:mga07m45_919_c1 | |||
| 2310 | nmdc:mga07m45_96793_c1 | |||
| 2311 | nmdc:mga08y16_186143_c1 | |||
| 2312 | nmdc:mga08y16_62834_c1 | |||
| 2313 | nmdc:mga0n895_164178_c1 | |||
| 2314 | nmdc:mga0n895_24727_c1 | |||
| 2315 | nmdc:mga0n895_24867_c1 | |||
| 2316 | nmdc:mga0n895_279629_c2 | |||
| 2317 | nmdc:mga0rr50_119776_c1 | |||
| 2318 | nmdc:mga0a205_31268_c1 | |||
| 2319 | nmdc:mga0sz30_56067_c1 | |||
| 2320 | Ga0495601_0102974 | |||
| 2321 | Ga0500658_0002972 | |||
| 2322 | Ga0500568_0011536 | |||
| 2323 | Ga0501084_0072201 | |||
| 2324 | Ga0466962_0000108 | |||
| 2325 | Ga0466962_0002594 | |||
| 2326 | 2501074651 | |||
| 2327 | 2501410112 | |||
| 2328 | 2509128041 | |||
| 2329 | 2511095434 | |||
| 2330 | 2511105092 | |||
| 2331 | 2513556029 | |||
| 2332 | 2513561341 | |||
| 2333 | 2513959543 | |||
| 2334 | 2514046879 | |||
| 2335 | 2515688313 | |||
| 2336 | 2519457301 | |||
| 2337 | 2526061142 | |||
| 2338 | 2527078482 | |||
| 2339 | 2548846463 | |||
| 2340 | 2563055488 | |||
| 2341 | 2574433462 | |||
| 2342 | 2585292157 | |||
| 2343 | 2599738759 | |||
| 2344 | 2599747630 | |||
| 2345 | 2599903165 | |||
| 2346 | 2600209514 | |||
| 2347 | 2644121416 | |||
| 2348 | 2644302459 | |||
| 2349 | 2676745573 | |||
| 2350 | 2713478867 | |||
| 2351 | 2738823073 | |||
| 2352 | 2738835280 | |||
| 2353 | 2738876759 | |||
| 2354 | 2739188778 | |||
| 2355 | 2739223430 | |||
| 2356 | 2740065054 | |||
| 2357 | 2746086764 | |||
| 2358 | 2746094163 | |||
| 2359 | 2753568591 | |||
| 2360 | 2817259502 | |||
| 2361 | 2817277171 | |||
| 2362 | 2817454085 | |||
| 2363 | 2819622610 | |||
| 2364 | 2819634712 | |||
| 2365 | 2842329101 | |||
| 2366 | 2842353480 | |||
| 2367 | 2842459004 | |||
| 2368 | 2856290418 | |||
| 2369 | 2857359953 | |||
| 2370 | 2857578030 | |||
| 2371 | 2858952954 | |||
| 2372 | 2863425400 | |||
| 2373 | 2870069639 | |||
| 2374 | 2895516129 | |||
| 2375 | 2900636816 | |||
| 2376 | 2904488144 | |||
| 2377 | 2904570146 | |||
| 2378 | 2904577322 | |||
| 2379 | 2919531095 | |||
| 2380 | 2921647159 | |||
| 2381 | 2928112667 | |||
| 2382 | 2928139640 | |||
| 2383 | 2928163721 | |||
| 2384 | 2928170528 | |||
| 2385 | 2928175849 | |||
| 2386 | 2928508477 | |||
| 2387 | 2928541489 | |||
| 2388 | 2941480431 | |||
| 2389 | 2945934838 | |||
| 2390 | 2981995760 | |||
| 2391 | 2990704585 | |||
| 2392 | 639787655 | |||
| 2393 | 642425144 | |||
| 2394 | 642416023 | |||
| 2395 | 642594847 | |||
| 2396 | 642623496 | |||
| 2397 | 8003958757 | |||
| 2398 | 8018848092 | |||
| 2399 | 8020810292 | |||
| 2400 | 8020939186 | |||
| 2401 | 8020948523 | |||
| 2402 | 8020956244 | |||
| 2403 | 8021127045 | |||
| 2404 | 8039101474 | |||
| 2405 | 8040169598 | |||
| 2406 | 8040174631 | |||
| 2407 | 8055270776 | |||
| 2408 | 8055305578 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ukj-assembly1.cif.gz_A | crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 | 0.9773 | 23 | 382 |
| 4f8j-assembly1.cif.gz_A | the structure of an aromatic compound transport protein from rhodopseudomonas palustris in complex with p-coumarate | 0.9763 | 23 | 382 |
| 3sg0-assembly1.cif.gz_A | the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 | 0.9724 | 24 | 381 |
| 3ukj-assembly1.cif.gz_A | crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 | 0.9719 | 23 | 382 |
| 3uk0-assembly1.cif.gz_A | rpd_1889 protein, an extracellular ligand-binding receptor from rhodopseudomonas palustris. | 0.9705 | 23 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jb2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9728 | 143 | 264 | 3.40.50.2300 |
| 3sg0A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9724 | 142 | 273 | 3.40.50.2300 |
| 4nqrA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9479 | 142 | 264 | 3.40.50.2300 |
| 4fb4A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9422 | 23 | 364 | 3.40.50.2300 |
| 4dqdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.933 | 22 | 364 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352S038-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9867 | 61 | 323 |
|
| AF-A0A536YZ31-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9854 | 30 | 220 |
|
| AF-A0A011R3T8-F1-model_v4 | Receptor family ligand binding region | 0.9691 | 81 | 226 |
|
| AF-A0A352S038-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9649 | 61 | 323 |
|
| AF-A0A7C1G6Q7-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9628 | 154 | 382 |
|