F491529

General Info

Members Datasets Scaffolds Average Seq Length
1196 325 2392 88

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100914264|Ga0070687_1009142641
Length 81
Sequence MTMRTITTSTGAEITLDGDLLAIMETLYREVTAKRELQRSTHLIDQMSDEDRRKYLLESLFLNTVTYENDKLEAYMRKLTK

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
116 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
117 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
118 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
215 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
232 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
249 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
250 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
289 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 27.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100914264 3300005343 Unclassified 630
2 JGI24746J21847_1000952 3300001977 Bacteria 4536
3 JGI24746J21847_1041046 3300001977 Unclassified 644
4 JGI24750J21931_1005644 3300002070 Bacteria 1541
5 JGI24749J21850_1021680 3300002076 Bacteria 909
6 JGI24749J21850_1074278 3300002076 Unclassified 528
7 JGI24033J26618_1012516 3300002155 Bacteria 1022
8 JGI24034J26672_10105793 3300002239 Unclassified 534
9 JGI24742J22300_10011045 3300002244 Bacteria 1497
10 JGI24751J29686_10062998 3300002459 Unclassified 764
11 JGI26145J50221_1030466 3300003371 Unclassified 550
12 Ga0058859_11182138 3300004798 Bacteria 598
13 Ga0065714_10091502 3300005288 Bacteria 1908
14 Ga0065714_10146061 3300005288 Bacteria 1137
15 Ga0065704_10001963 3300005289 Bacteria 7047
16 Ga0065704_10106014 3300005289 Bacteria 2077
17 Ga0065704_10123446 3300005289 Bacteria 1733
18 Ga0065704_10394202 3300005289 Bacteria 759
19 Ga0065704_10750709 3300005289 Unclassified 542
20 Ga0065704_10783754 3300005289 Unclassified 514
21 Ga0065712_10006432 3300005290 Bacteria 7070
22 Ga0065712_10022428 3300005290 Bacteria 1313
23 Ga0065712_10072906 3300005290 Bacteria 4571
24 Ga0065712_10098251 3300005290 Bacteria 2125
25 Ga0065712_10125629 3300005290 Bacteria 1611
26 Ga0065712_10420257 3300005290 Bacteria 712
27 Ga0065715_10003916 3300005293 Bacteria 6019
28 Ga0065715_10097777 3300005293 Bacteria 3644
29 Ga0065715_10191708 3300005293 Unclassified 1411
30 Ga0065715_10240452 3300005293 Bacteria 1188
31 Ga0065715_10360078 3300005293 Bacteria 937
32 Ga0065715_11120585 3300005293 Bacteria 506
33 Ga0065707_10005876 3300005295 Bacteria 5306
34 Ga0065707_10007429 3300005295 Bacteria 3088
35 Ga0065707_10176388 3300005295 Bacteria 1448
36 Ga0065707_10490249 3300005295 Unclassified 766
37 Ga0065707_10641057 3300005295 Bacteria 668
38 Ga0065707_10773662 3300005295 Unclassified 573
39 Ga0065707_10809338 3300005295 Unclassified 596
40 Ga0065707_10905644 3300005295 Unclassified 554
41 Ga0065707_11001532 3300005295 Unclassified 539
42 Ga0070658_10292078 3300005327 Bacteria 1389
43 Ga0070676_10010053 3300005328 Bacteria 5124
44 Ga0070676_10064347 3300005328 Bacteria 2186
45 Ga0070676_10366078 3300005328 Bacteria 995
46 Ga0070676_10946566 3300005328 Unclassified 644
47 Ga0070683_100083153 3300005329 Bacteria 2999
48 Ga0070690_100004426 3300005330 Bacteria 7799
49 Ga0070690_100031293 3300005330 Unclassified 3314
50 Ga0070690_100121416 3300005330 Bacteria 1754
51 Ga0070690_100956875 3300005330 Unclassified 673
52 Ga0070690_101540208 3300005330 Bacteria 538
53 Ga0070670_100002370 3300005331 Bacteria 15530
54 Ga0070670_100021798 3300005331 Bacteria 5510
55 Ga0070670_100100140 3300005331 Bacteria 2494
56 Ga0070670_100128420 3300005331 Bacteria 2188
57 Ga0070670_100196456 3300005331 Bacteria 1752
58 Ga0070670_100215657 3300005331 Bacteria 1669
59 Ga0070670_100405359 3300005331 Bacteria 1204
60 Ga0070677_10000884 3300005333 Bacteria 9865
61 Ga0070677_10015592 3300005333 Bacteria 2692
62 Ga0070677_10023964 3300005333 Bacteria 2265
63 Ga0070677_10026613 3300005333 Unclassified 2171
64 Ga0070677_10055120 3300005333 Bacteria 1621
65 Ga0070677_10131353 3300005333 Bacteria 1143
66 Ga0070677_10374653 3300005333 Bacteria 744
67 Ga0070677_10451448 3300005333 Bacteria 688
68 Ga0070677_10899039 3300005333 Unclassified 512
69 Ga0068869_100023429 3300005334 Bacteria 4264
70 Ga0068869_100112130 3300005334 Bacteria 2076
71 Ga0068869_100180305 3300005334 Bacteria 1655
72 Ga0068869_100426708 3300005334 Unclassified 1095
73 Ga0068869_100984162 3300005334 Bacteria 734
74 Ga0068869_101018733 3300005334 Unclassified 722
75 Ga0070666_10007259 3300005335 Bacteria 6834
76 Ga0070666_10034704 3300005335 Bacteria 3342
77 Ga0070666_10092645 3300005335 Bacteria 2077
78 Ga0070666_10116797 3300005335 Bacteria 1848
79 Ga0070666_10122016 3300005335 Bacteria 1808
80 Ga0070666_10308826 3300005335 Bacteria 1127
81 Ga0070666_10839728 3300005335 Unclassified 678
82 Ga0070680_100038026 3300005336 Bacteria 3891
83 Ga0070680_100877621 3300005336 Bacteria 774
84 Ga0070682_101223126 3300005337 Bacteria 635
85 Ga0068868_100005344 3300005338 Bacteria 9017
86 Ga0068868_100347337 3300005338 Bacteria 1270
87 Ga0068868_100559707 3300005338 Bacteria 1009
88 Ga0068868_100811086 3300005338 Unclassified 845
89 Ga0068868_101825433 3300005338 Bacteria 575
90 Ga0070660_100258686 3300005339 Bacteria 1421
91 Ga0070660_100751079 3300005339 Bacteria 819
92 Ga0070689_100072777 3300005340 Bacteria 2686
93 Ga0070689_100163068 3300005340 Unclassified 1803
94 Ga0070689_100163346 3300005340 Bacteria 1801
95 Ga0070689_100383040 3300005340 Bacteria 1186
96 Ga0070689_100757329 3300005340 Bacteria 851
97 Ga0070689_100959753 3300005340 Bacteria 759
98 Ga0070689_101138528 3300005340 Bacteria 698
99 Ga0070689_101872924 3300005340 Unclassified 548
100 Ga0070691_10128853 3300005341 Bacteria 1280
101 Ga0070691_10327392 3300005341 Bacteria 845
102 Ga0070687_100008085 3300005343 Bacteria 4432
103 Ga0070687_100016455 3300005343 Unclassified 3374
104 Ga0070687_100028758 3300005343 Bacteria 2699
105 Ga0070687_100088193 3300005343 Bacteria 1710
106 Ga0070687_100187908 3300005343 Bacteria 1243
107 Ga0070661_100003293 3300005344 Bacteria 11147
108 Ga0070661_100065094 3300005344 Unclassified 2678
109 Ga0070661_100092077 3300005344 Bacteria 2246
110 Ga0070661_101600594 3300005344 Bacteria 551
111 Ga0070692_10082522 3300005345 Bacteria 1734
112 Ga0070668_100016902 3300005347 Bacteria 5457
113 Ga0070668_100020560 3300005347 Bacteria 4983
114 Ga0070668_100114614 3300005347 Bacteria 2148
115 Ga0070668_100518597 3300005347 Bacteria 1034
116 Ga0070668_100562270 3300005347 Bacteria 994
117 Ga0070668_101484023 3300005347 Unclassified 619
118 Ga0070669_100006473 3300005353 Bacteria 8431
119 Ga0070669_100012780 3300005353 Bacteria 5962
120 Ga0070669_100053301 3300005353 Bacteria 2960
121 Ga0070669_100078184 3300005353 Bacteria 2459
122 Ga0070669_100123882 3300005353 Bacteria 1976
123 Ga0070669_100234238 3300005353 Bacteria 1456
124 Ga0070669_100439357 3300005353 Bacteria 1074
125 Ga0070669_100573903 3300005353 Bacteria 943
126 Ga0070669_100688371 3300005353 Unclassified 862
127 Ga0070669_100790679 3300005353 Unclassified 806
128 Ga0070669_101360856 3300005353 Unclassified 615
129 Ga0070675_100001614 3300005354 Bacteria 16612
130 Ga0070675_100002608 3300005354 Bacteria 13528
131 Ga0070675_100018101 3300005354 Bacteria 5607
132 Ga0070675_100032679 3300005354 Bacteria 4212
133 Ga0070675_100063406 3300005354 Bacteria 3055
134 Ga0070675_100113663 3300005354 Bacteria 2293
135 Ga0070675_100240873 3300005354 Bacteria 1580
136 Ga0070675_100361229 3300005354 Bacteria 1289
137 Ga0070675_100492683 3300005354 Bacteria 1103
138 Ga0070675_100929383 3300005354 Bacteria 798
139 Ga0070675_101355439 3300005354 Bacteria 656
140 Ga0070675_101613160 3300005354 Unclassified 599
141 Ga0070671_100122909 3300005355 Bacteria 2185
142 Ga0070671_100184331 3300005355 Unclassified 1768
143 Ga0070671_100229478 3300005355 Bacteria 1575
144 Ga0070671_101024139 3300005355 Bacteria 724
145 Ga0070674_100000222 3300005356 Bacteria 27727
146 Ga0070674_100033451 3300005356 Bacteria 3422
147 Ga0070674_100155777 3300005356 Bacteria 1729
148 Ga0070674_100345239 3300005356 Bacteria 1200
149 Ga0070674_101137694 3300005356 Bacteria 691
150 Ga0070674_101605542 3300005356 Bacteria 586
151 Ga0070674_102172848 3300005356 Unclassified 507
152 Ga0070673_100020938 3300005364 Bacteria 4728
153 Ga0070673_100025136 3300005364 Bacteria 4378
154 Ga0070673_100115784 3300005364 Bacteria 2229
155 Ga0070673_100120386 3300005364 Unclassified 2189
156 Ga0070673_100123040 3300005364 Bacteria 2167
157 Ga0070673_100129990 3300005364 Bacteria 2111
158 Ga0070673_100153046 3300005364 Bacteria 1955
159 Ga0070673_100173104 3300005364 Unclassified 1844
160 Ga0070673_100232536 3300005364 Bacteria 1600
161 Ga0070673_100397622 3300005364 Unclassified 1231
162 Ga0070673_100443807 3300005364 Bacteria 1166
163 Ga0070673_100464947 3300005364 Bacteria 1140
164 Ga0070673_100469385 3300005364 Bacteria 1134
165 Ga0070673_100598427 3300005364 Bacteria 1005
166 Ga0070673_101039448 3300005364 Bacteria 764
167 Ga0070688_100013286 3300005365 Bacteria 4638
168 Ga0070688_100031127 3300005365 Unclassified 3208
169 Ga0070688_100102851 3300005365 Unclassified 1886
170 Ga0070688_100120357 3300005365 Bacteria 1757
171 Ga0070688_100186678 3300005365 Bacteria 1441
172 Ga0070688_100287848 3300005365 Bacteria 1183
173 Ga0070688_100457007 3300005365 Bacteria 956
174 Ga0070688_100936717 3300005365 Bacteria 685
175 Ga0070659_100114324 3300005366 Unclassified 2180
176 Ga0070659_100135095 3300005366 Bacteria 2005
177 Ga0070659_100668450 3300005366 Bacteria 896
178 Ga0070667_100178994 3300005367 Bacteria 1875
179 Ga0070667_100270530 3300005367 Bacteria 1523
180 Ga0070667_100272075 3300005367 Bacteria 1519
181 Ga0070667_101867223 3300005367 Unclassified 566
182 Ga0070703_10188412 3300005406 Unclassified 802
183 Ga0070713_100848750 3300005436 Bacteria 877
184 Ga0070701_10009628 3300005438 Bacteria 4239
185 Ga0070701_10082718 3300005438 Bacteria 1742
186 Ga0070701_10093840 3300005438 Bacteria 1650
187 Ga0070701_10138441 3300005438 Unclassified 1389
188 Ga0070701_10910973 3300005438 Bacteria 607
189 Ga0070705_100000353 3300005440 Bacteria 27139
190 Ga0070705_100008965 3300005440 Bacteria 4963
191 Ga0070705_100029016 3300005440 Unclassified 3037
192 Ga0070705_100079069 3300005440 Unclassified 2013
193 Ga0070705_100085170 3300005440 Unclassified 1953
194 Ga0070705_100434585 3300005440 Bacteria 981
195 Ga0070705_100499988 3300005440 Bacteria 923
196 Ga0070705_100728846 3300005440 Bacteria 782
197 Ga0070700_100013220 3300005441 Bacteria 4632
198 Ga0070700_100222638 3300005441 Bacteria 1338
199 Ga0070700_100520551 3300005441 Bacteria 919
200 Ga0070700_100564109 3300005441 Bacteria 886
201 Ga0070700_100684244 3300005441 Bacteria 813
202 Ga0070700_100699055 3300005441 Unclassified 806
203 Ga0070694_100001728 3300005444 Bacteria 12875
204 Ga0070694_100008513 3300005444 Bacteria 6276
205 Ga0070694_100010015 3300005444 Bacteria 5829
206 Ga0070694_100813735 3300005444 Unclassified 767
207 Ga0070694_100912234 3300005444 Bacteria 726
208 Ga0070694_101056990 3300005444 Bacteria 676
209 Ga0070694_101277919 3300005444 Bacteria 617
210 Ga0070694_101455482 3300005444 Bacteria 579
211 Ga0070708_100071937 3300005445 Bacteria 3115
212 Ga0070708_100135240 3300005445 Bacteria 2283
213 Ga0070708_100305645 3300005445 Bacteria 1498
214 Ga0070708_100675580 3300005445 Bacteria 973
215 Ga0070708_101019911 3300005445 Unclassified 776
216 Ga0070663_100014111 3300005455 Bacteria 5121
217 Ga0070663_100084753 3300005455 Bacteria 2337
218 Ga0070663_101524594 3300005455 Unclassified 595
219 Ga0070663_101759234 3300005455 Unclassified 555
220 Ga0070678_100041874 3300005456 Bacteria 3251
221 Ga0070678_100146621 3300005456 Bacteria 1895
222 Ga0070678_100448341 3300005456 Bacteria 1130
223 Ga0070678_100480279 3300005456 Unclassified 1093
224 Ga0070678_101647951 3300005456 Bacteria 603
225 Ga0070662_100006426 3300005457 Bacteria 7575
226 Ga0070662_100019273 3300005457 Unclassified 4630
227 Ga0070662_100059774 3300005457 Bacteria 2777
228 Ga0070662_100509327 3300005457 Unclassified 1005
229 Ga0070662_100710678 3300005457 Unclassified 851
230 Ga0070662_100848928 3300005457 Unclassified 778
231 Ga0070681_10002446 3300005458 Bacteria 17007
232 Ga0068867_100007382 3300005459 Bacteria 7776
233 Ga0068867_100019216 3300005459 Unclassified 4868
234 Ga0068867_100060463 3300005459 Bacteria 2810
235 Ga0068867_100129518 3300005459 Bacteria 1959
236 Ga0068867_100600396 3300005459 Unclassified 960
237 Ga0068867_101489442 3300005459 Unclassified 630
238 Ga0070685_10015733 3300005466 Bacteria 4021
239 Ga0070685_10027397 3300005466 Bacteria 3149
240 Ga0070685_10264721 3300005466 Bacteria 1145
241 Ga0070706_100169304 3300005467 Bacteria 2040
242 Ga0070706_100555807 3300005467 Bacteria 1067
243 Ga0070706_100794546 3300005467 Bacteria 876
244 Ga0070706_101381440 3300005467 Unclassified 645
245 Ga0070707_100874859 3300005468 Bacteria 863
246 Ga0070707_101422599 3300005468 Bacteria 660
247 Ga0070698_100005270 3300005471 Bacteria 14146
248 Ga0070698_100029738 3300005471 Bacteria 5669
249 Ga0070698_100100980 3300005471 Bacteria 2857
250 Ga0070698_100153539 3300005471 Bacteria 2248
251 Ga0070698_100279604 3300005471 Bacteria 1601
252 Ga0070698_100536546 3300005471 Bacteria 1109
253 Ga0070698_100719809 3300005471 Unclassified 941
254 Ga0070698_101015617 3300005471 Unclassified 777
255 Ga0070698_101848618 3300005471 Unclassified 557
256 Ga0070699_100003285 3300005518 Bacteria 14297
257 Ga0070699_100007386 3300005518 Bacteria 9569
258 Ga0070699_100022796 3300005518 Bacteria 5396
259 Ga0070679_100597545 3300005530 Unclassified 1047
260 Ga0070679_101008571 3300005530 Bacteria 777
261 Ga0070684_100099393 3300005535 Unclassified 2597
262 Ga0070684_100175655 3300005535 Bacteria 1947
263 Ga0070684_100470762 3300005535 Bacteria 1162
264 Ga0070684_100748943 3300005535 Bacteria 912
265 Ga0070684_102300879 3300005535 Bacteria 508
266 Ga0070697_100313326 3300005536 Bacteria 1350
267 Ga0070697_101028189 3300005536 Bacteria 733
268 Ga0068853_100448603 3300005539 Bacteria 1213
269 Ga0070672_100009505 3300005543 Bacteria 6707
270 Ga0070672_100043637 3300005543 Bacteria 3459
271 Ga0070672_100056073 3300005543 Bacteria 3088
272 Ga0070672_100104949 3300005543 Bacteria 2297
273 Ga0070672_100150200 3300005543 Bacteria 1927
274 Ga0070672_100274683 3300005543 Bacteria 1424
275 Ga0070672_100619546 3300005543 Bacteria 943
276 Ga0070672_100788673 3300005543 Unclassified 835
277 Ga0070672_100911719 3300005543 Bacteria 776
278 Ga0070672_100923746 3300005543 Bacteria 771
279 Ga0070672_101364412 3300005543 Unclassified 634
280 Ga0070672_101458649 3300005543 Bacteria 613
281 Ga0070672_101971580 3300005543 Bacteria 526
282 Ga0070686_100006474 3300005544 Bacteria 6512
283 Ga0070686_100273209 3300005544 Unclassified 1243
284 Ga0070686_100345857 3300005544 Unclassified 1116
285 Ga0070686_100416253 3300005544 Unclassified 1025
286 Ga0070686_100627161 3300005544 Unclassified 850
287 Ga0070686_101116921 3300005544 Bacteria 652
288 Ga0070686_101363773 3300005544 Unclassified 594
289 Ga0070695_100003268 3300005545 Bacteria 9468
290 Ga0070695_100020676 3300005545 Bacteria 4020
291 Ga0070695_100935128 3300005545 Bacteria 702
292 Ga0070695_101011094 3300005545 Unclassified 677
293 Ga0070695_101196999 3300005545 Unclassified 625
294 Ga0070696_100000751 3300005546 Bacteria 20742
295 Ga0070696_100013141 3300005546 Bacteria 5554
296 Ga0070696_100039033 3300005546 Bacteria 3279
297 Ga0070696_100172919 3300005546 Bacteria 1598
298 Ga0070696_101002298 3300005546 Bacteria 698
299 Ga0070693_100334479 3300005547 Unclassified 1032
300 Ga0070693_100501711 3300005547 Unclassified 861
301 Ga0070665_100090893 3300005548 Bacteria 3059
302 Ga0070665_101608319 3300005548 Unclassified 658
303 Ga0070665_102232540 3300005548 Unclassified 551
304 Ga0070704_100002185 3300005549 Bacteria 10894
305 Ga0070704_100014281 3300005549 Bacteria 4957
306 Ga0070704_100047016 3300005549 Bacteria 3014
307 Ga0070704_100073926 3300005549 Bacteria 2484
308 Ga0070704_100115315 3300005549 Bacteria 2052
309 Ga0070704_100248857 3300005549 Bacteria 1458
310 Ga0070704_100793674 3300005549 Unclassified 845
311 Ga0070704_101448904 3300005549 Bacteria 631
312 Ga0070704_101775293 3300005549 Unclassified 571
313 Ga0070664_100018194 3300005564 Bacteria 5767
314 Ga0070664_100039531 3300005564 Bacteria 3975
315 Ga0070664_100053084 3300005564 Bacteria 3434
316 Ga0070664_100175999 3300005564 Bacteria 1900
317 Ga0070664_100222908 3300005564 Bacteria 1688
318 Ga0070664_100272927 3300005564 Bacteria 1524
319 Ga0070664_100504310 3300005564 Bacteria 1115
320 Ga0070664_100589293 3300005564 Unclassified 1031
321 Ga0070664_101082640 3300005564 Bacteria 755
322 Ga0068857_100138766 3300005577 Bacteria 2196
323 Ga0068857_100202629 3300005577 Bacteria 1809
324 Ga0068857_100711697 3300005577 Unclassified 955
325 Ga0068854_100040004 3300005578 Bacteria 3305
326 Ga0068854_100840812 3300005578 Unclassified 803
327 Ga0068854_100955854 3300005578 Bacteria 756
328 Ga0068854_101189487 3300005578 Bacteria 683
329 Ga0068856_101752580 3300005614 Unclassified 633
330 Ga0070702_100098240 3300005615 Bacteria 1791
331 Ga0070702_100348949 3300005615 Unclassified 1041
332 Ga0070702_100788075 3300005615 Unclassified 734
333 Ga0070702_100793281 3300005615 Bacteria 732
334 Ga0068852_100051784 3300005616 Bacteria 3526
335 Ga0068852_100623592 3300005616 Bacteria 1084
336 Ga0068852_100635292 3300005616 Bacteria 1074
337 Ga0068852_100744886 3300005616 Bacteria 992
338 Ga0068852_100761046 3300005616 Unclassified 981
339 Ga0068859_100039000 3300005617 Bacteria 4764
340 Ga0068859_100117279 3300005617 Unclassified 2727
341 Ga0068859_100189178 3300005617 Bacteria 2143
342 Ga0068859_100256673 3300005617 Bacteria 1839
343 Ga0068859_100319892 3300005617 Bacteria 1645
344 Ga0068859_100582281 3300005617 Unclassified 1213
345 Ga0068859_101225249 3300005617 Bacteria 827
346 Ga0068859_101239689 3300005617 Bacteria 822
347 Ga0068859_102270249 3300005617 Bacteria 598
348 Ga0068864_100047439 3300005618 Bacteria 3689
349 Ga0068864_100066467 3300005618 Bacteria 3130
350 Ga0068864_100102782 3300005618 Bacteria 2536
351 Ga0068864_100123147 3300005618 Bacteria 2321
352 Ga0068864_100305474 3300005618 Bacteria 1490
353 Ga0068864_100328649 3300005618 Bacteria 1438
354 Ga0068864_100356891 3300005618 Bacteria 1381
355 Ga0068864_100486019 3300005618 Bacteria 1186
356 Ga0068864_101143360 3300005618 Bacteria 776
357 Ga0068866_10006225 3300005718 Bacteria 4967
358 Ga0068866_10259654 3300005718 Bacteria 1067
359 Ga0068866_11153648 3300005718 Bacteria 557
360 Ga0068861_100012791 3300005719 Bacteria 5860
361 Ga0068861_100032640 3300005719 Bacteria 3834
362 Ga0068861_100085352 3300005719 Unclassified 2479
363 Ga0068861_100133379 3300005719 Bacteria 2018
364 Ga0068861_100912979 3300005719 Unclassified 832
365 Ga0068861_102238726 3300005719 Bacteria 548
366 Ga0068851_10008481 3300005834 Bacteria 4753
367 Ga0068851_10922979 3300005834 Unclassified 548
368 Ga0068870_10018525 3300005840 Bacteria 3364
369 Ga0068870_10028570 3300005840 Unclassified 2801
370 Ga0068870_10029356 3300005840 Unclassified 2769
371 Ga0068870_10114191 3300005840 Bacteria 1546
372 Ga0068870_10179614 3300005840 Bacteria 1269
373 Ga0068870_10267855 3300005840 Bacteria 1066
374 Ga0068870_10354043 3300005840 Unclassified 943
375 Ga0068870_10550614 3300005840 Bacteria 777
376 Ga0068870_10844517 3300005840 Bacteria 643
377 Ga0068870_10933317 3300005840 Bacteria 615
378 Ga0068870_11179445 3300005840 Bacteria 554
379 Ga0068863_100002899 3300005841 Bacteria 16989
380 Ga0068863_100025702 3300005841 Bacteria 5615
381 Ga0068863_100124010 3300005841 Unclassified 2465
382 Ga0068863_102384778 3300005841 Unclassified 539
383 Ga0068858_100007484 3300005842 Bacteria 10556
384 Ga0068858_100018524 3300005842 Bacteria 6518
385 Ga0068858_100267963 3300005842 Unclassified 1624
386 Ga0068858_100272659 3300005842 Bacteria 1610
387 Ga0068858_100344119 3300005842 Bacteria 1427
388 Ga0068858_101314986 3300005842 Unclassified 712
389 Ga0068860_100014383 3300005843 Bacteria 7755
390 Ga0068860_100185323 3300005843 Bacteria 2012
391 Ga0068860_100440099 3300005843 Bacteria 1295
392 Ga0068860_100580002 3300005843 Unclassified 1125
393 Ga0068862_100002073 3300005844 Bacteria 18094
394 Ga0068862_100111241 3300005844 Bacteria 2404
395 Ga0068862_100407820 3300005844 Bacteria 1273
396 Ga0068862_100704301 3300005844 Unclassified 979
397 Ga0068862_100803665 3300005844 Unclassified 918
398 Ga0068862_100922615 3300005844 Unclassified 860
399 Ga0068862_101201879 3300005844 Bacteria 757
400 Ga0068862_101530753 3300005844 Unclassified 673
401 Ga0068862_102271404 3300005844 Unclassified 554
402 Ga0068862_102377259 3300005844 Unclassified 542
403 Ga0068862_102664939 3300005844 Unclassified 512
404 Ga0081455_10858315 3300005937 Unclassified 567
405 Ga0081539_10372093 3300005985 Bacteria 597
406 Ga0070717_10631548 3300006028 Bacteria 972
407 Ga0075432_10094707 3300006058 Bacteria 1097
408 Ga0070712_100876359 3300006175 Unclassified 773
409 Ga0097621_100417979 3300006237 Unclassified 1203
410 Ga0097621_100800049 3300006237 Bacteria 873
411 Ga0097621_100910532 3300006237 Bacteria 819
412 Ga0097621_101009588 3300006237 Bacteria 778
413 Ga0097621_101221959 3300006237 Unclassified 708
414 Ga0097621_101883344 3300006237 Bacteria 571
415 Ga0068871_100195632 3300006358 Bacteria 1743
416 Ga0068871_100203037 3300006358 Unclassified 1712
417 Ga0068871_100233077 3300006358 Bacteria 1598
418 Ga0068871_100774957 3300006358 Bacteria 883
419 Ga0075428_100001205 3300006844 Bacteria 27639
420 Ga0075428_100011446 3300006844 Bacteria 9867
421 Ga0075428_100012226 3300006844 Bacteria 9545
422 Ga0075428_100042724 3300006844 Bacteria 4984
423 Ga0075428_100523099 3300006844 Bacteria 1269
424 Ga0075428_100668990 3300006844 Bacteria 1107
425 Ga0075430_100089047 3300006846 Bacteria 2582
426 Ga0075430_100188316 3300006846 Bacteria 1715
427 Ga0075430_100206542 3300006846 Bacteria 1630
428 Ga0075430_100208917 3300006846 Bacteria 1620
429 Ga0075430_100251135 3300006846 Unclassified 1465
430 Ga0075430_100460028 3300006846 Bacteria 1050
431 Ga0075430_100533554 3300006846 Bacteria 968
432 Ga0075430_100688712 3300006846 Unclassified 842
433 Ga0075431_100005109 3300006847 Bacteria 12909
434 Ga0075431_100010681 3300006847 Bacteria 9226
435 Ga0075431_100183629 3300006847 Bacteria 2146
436 Ga0075431_100747466 3300006847 Unclassified 953
437 Ga0075433_10001688 3300006852 Bacteria 16445
438 Ga0075433_10018246 3300006852 Bacteria 5828
439 Ga0075433_10050964 3300006852 Unclassified 3604
440 Ga0075433_10055219 3300006852 Bacteria 3467
441 Ga0075433_10061199 3300006852 Bacteria 3298
442 Ga0075434_100000943 3300006871 Bacteria 23394
443 Ga0075434_100002545 3300006871 Bacteria 16085
444 Ga0075434_100035306 3300006871 Bacteria 4942
445 Ga0075434_100064826 3300006871 Unclassified 3638
446 Ga0075434_100158188 3300006871 Bacteria 2285
447 Ga0075434_100228243 3300006871 Unclassified 1881
448 Ga0075434_100718790 3300006871 Unclassified 1016
449 Ga0075434_101490509 3300006871 Unclassified 686
450 Ga0075429_100025834 3300006880 Bacteria 5099
451 Ga0075429_100038522 3300006880 Bacteria 4162
452 Ga0075429_100051940 3300006880 Bacteria 3566
453 Ga0075429_100109495 3300006880 Bacteria 2415
454 Ga0075429_100117682 3300006880 Bacteria 2322
455 Ga0075429_100629963 3300006880 Unclassified 939
456 Ga0075429_100946140 3300006880 Bacteria 753
457 Ga0068865_100053704 3300006881 Unclassified 2796
458 Ga0068865_100199111 3300006881 Bacteria 1554
459 Ga0068865_100295905 3300006881 Bacteria 1294
460 Ga0068865_100533146 3300006881 Unclassified 983
461 Ga0068865_100561968 3300006881 Bacteria 959
462 Ga0075436_100023031 3300006914 Bacteria 4278
463 Ga0097620_100039000 3300006931 Bacteria 4764
464 Ga0097620_100117285 3300006931 Unclassified 2727
465 Ga0097620_100189167 3300006931 Bacteria 2143
466 Ga0097620_100256662 3300006931 Bacteria 1839
467 Ga0097620_100319883 3300006931 Bacteria 1645
468 Ga0097620_100582328 3300006931 Unclassified 1213
469 Ga0097620_101225226 3300006931 Bacteria 827
470 Ga0097620_101239600 3300006931 Bacteria 822
471 Ga0097620_102270193 3300006931 Bacteria 598
472 Ga0075435_100002880 3300007076 Bacteria 11534
473 Ga0075435_100010137 3300007076 Bacteria 6882
474 Ga0075435_100010913 3300007076 Bacteria 6657
475 Ga0075435_100178693 3300007076 Bacteria 1793
476 Ga0075435_100479813 3300007076 Bacteria 1074
477 Ga0075435_101534962 3300007076 Unclassified 584
478 Ga0105251_10314861 3300009011 Unclassified 711
479 Ga0111539_10000542 3300009094 Bacteria 48084
480 Ga0111539_10002846 3300009094 Bacteria 23005
481 Ga0111539_10022938 3300009094 Bacteria 7663
482 Ga0111539_10138512 3300009094 Bacteria 2850
483 Ga0111539_10197442 3300009094 Bacteria 2347
484 Ga0111539_10197900 3300009094 Bacteria 2344
485 Ga0111539_10216760 3300009094 Bacteria 2229
486 Ga0111539_10323210 3300009094 Bacteria 1795
487 Ga0111539_10544753 3300009094 Bacteria 1352
488 Ga0111539_10886226 3300009094 Bacteria 1038
489 Ga0111539_11007936 3300009094 Bacteria 968
490 Ga0111539_12453436 3300009094 Bacteria 605
491 Ga0111539_12989662 3300009094 Bacteria 546
492 Ga0105245_10338554 3300009098 Bacteria 1487
493 Ga0105245_11157318 3300009098 Bacteria 821
494 Ga0105245_11176052 3300009098 Bacteria 814
495 Ga0105245_11276792 3300009098 Bacteria 783
496 Ga0105245_11529375 3300009098 Unclassified 718
497 Ga0105247_10086466 3300009101 Bacteria 1984
498 Ga0105247_11264744 3300009101 Unclassified 591
499 Ga0114129_10001659 3300009147 Bacteria 30298
500 Ga0114129_10003888 3300009147 Bacteria 21072
501 Ga0114129_10016436 3300009147 Bacteria 10531
502 Ga0114129_10086038 3300009147 Bacteria 4360
503 Ga0114129_10116266 3300009147 Bacteria 3686
504 Ga0114129_10223067 3300009147 Bacteria 2542
505 Ga0114129_10394086 3300009147 Bacteria 1826
506 Ga0114129_10800058 3300009147 Unclassified 1203
507 Ga0114129_11166255 3300009147 Unclassified 961
508 Ga0114129_11284148 3300009147 Unclassified 908
509 Ga0114129_11958811 3300009147 Bacteria 709
510 Ga0114129_11982710 3300009147 Archaea 704
511 Ga0114129_12111479 3300009147 Unclassified 679
512 Ga0105243_10027038 3300009148 Bacteria 4394
513 Ga0105243_10093757 3300009148 Bacteria 2478
514 Ga0105243_10158402 3300009148 Bacteria 1950
515 Ga0105243_10168660 3300009148 Bacteria 1894
516 Ga0105243_10969829 3300009148 Bacteria 850
517 Ga0105243_10983644 3300009148 Bacteria 845
518 Ga0105243_11028703 3300009148 Bacteria 828
519 Ga0105243_13131978 3300009148 Unclassified 501
520 Ga0105241_10909626 3300009174 Unclassified 818
521 Ga0105241_11919499 3300009174 Unclassified 581
522 Ga0105242_10011817 3300009176 Bacteria 6720
523 Ga0105242_10065331 3300009176 Bacteria 3001
524 Ga0105242_10185772 3300009176 Bacteria 1837
525 Ga0105242_11463668 3300009176 Unclassified 712
526 Ga0105242_11907954 3300009176 Unclassified 635
527 Ga0105248_10051872 3300009177 Bacteria 4603
528 Ga0105248_10113273 3300009177 Bacteria 3059
529 Ga0105248_10280214 3300009177 Bacteria 1877
530 Ga0105248_10396219 3300009177 Bacteria 1555
531 Ga0105248_10583212 3300009177 Bacteria 1262
532 Ga0105248_11543960 3300009177 Unclassified 752
533 Ga0105238_10058346 3300009551 Unclassified 3869
534 Ga0105238_11788035 3300009551 Unclassified 646
535 Ga0105249_10000672 3300009553 Bacteria 31059
536 Ga0105249_10001821 3300009553 Bacteria 18542
537 Ga0105249_10252825 3300009553 Bacteria 1748
538 Ga0105249_10377841 3300009553 Bacteria 1442
539 Ga0105249_11121917 3300009553 Unclassified 857
540 Ga0105249_11285126 3300009553 Unclassified 803
541 Ga0105249_11570110 3300009553 Unclassified 730
542 Ga0105249_12210631 3300009553 Bacteria 623
543 Ga0105249_12414026 3300009553 Unclassified 598
544 Ga0105249_12623344 3300009553 Bacteria 576
545 Ga0105249_12673871 3300009553 Unclassified 571
546 Ga0105239_11372302 3300010375 Bacteria 816
547 Ga0105246_10364554 3300011119 Bacteria 1188
548 Ga0105246_10651790 3300011119 Unclassified 917
549 Ga0157337_1014616 3300012483 Bacteria 660
550 Ga0157335_1030830 3300012492 Bacteria 562
551 Ga0157345_1054407 3300012498 Unclassified 517
552 Ga0157324_1001288 3300012506 Bacteria 1359
553 Ga0157371_10413871 3300013102 Bacteria 988
554 Ga0157371_10624768 3300013102 Bacteria 802
555 Ga0157371_11182638 3300013102 Unclassified 589
556 Ga0157370_10073957 3300013104 Bacteria 3215
557 Ga0157374_10157407 3300013296 Bacteria 2212
558 Ga0157374_10185254 3300013296 Unclassified 2035
559 Ga0157374_11254284 3300013296 Bacteria 763
560 Ga0157374_12050102 3300013296 Bacteria 599
561 Ga0157378_10137274 3300013297 Bacteria 2268
562 Ga0157378_10491431 3300013297 Bacteria 1224
563 Ga0157378_10513867 3300013297 Bacteria 1198
564 Ga0157378_11000408 3300013297 Bacteria 870
565 Ga0157378_11160127 3300013297 Unclassified 811
566 Ga0157378_12007646 3300013297 Unclassified 628
567 Ga0157378_12952901 3300013297 Unclassified 527
568 Ga0163162_10007803 3300013306 Bacteria 10433
569 Ga0163162_10087199 3300013306 Unclassified 3199
570 Ga0163162_10574529 3300013306 Unclassified 1254
571 Ga0163162_10859515 3300013306 Unclassified 1022
572 Ga0163162_11154024 3300013306 Bacteria 878
573 Ga0163162_12681753 3300013306 Bacteria 573
574 Ga0157372_11020583 3300013307 Bacteria 958
575 Ga0157372_11924360 3300013307 Unclassified 680
576 Ga0157375_10011615 3300013308 Bacteria 7781
577 Ga0157375_10015562 3300013308 Bacteria 6813
578 Ga0157375_10246137 3300013308 Bacteria 1948
579 Ga0157375_10311956 3300013308 Bacteria 1737
580 Ga0157375_10320781 3300013308 Bacteria 1714
581 Ga0157375_10422420 3300013308 Bacteria 1499
582 Ga0157375_10447625 3300013308 Bacteria 1457
583 Ga0157375_10774905 3300013308 Unclassified 1109
584 Ga0157375_10942782 3300013308 Unclassified 1005
585 Ga0157375_11492868 3300013308 Bacteria 798
586 Ga0157375_11784441 3300013308 Unclassified 729
587 Ga0163163_10034093 3300014325 Bacteria 4928
588 Ga0163163_10098812 3300014325 Bacteria 2940
589 Ga0163163_10303044 3300014325 Unclassified 1650
590 Ga0163163_10320181 3300014325 Bacteria 1604
591 Ga0163163_10569774 3300014325 Bacteria 1195
592 Ga0163163_12278427 3300014325 Unclassified 600
593 Ga0157380_10004513 3300014326 Bacteria 9655
594 Ga0157380_10040095 3300014326 Unclassified 3645
595 Ga0157380_10042139 3300014326 Bacteria 3567
596 Ga0157380_10145336 3300014326 Bacteria 2043
597 Ga0157380_10216223 3300014326 Bacteria 1712
598 Ga0157380_10236903 3300014326 Bacteria 1643
599 Ga0157380_10301823 3300014326 Bacteria 1475
600 Ga0157380_10458235 3300014326 Bacteria 1227
601 Ga0157380_11016065 3300014326 Bacteria 863
602 Ga0157380_11228405 3300014326 Bacteria 794
603 Ga0157380_12010684 3300014326 Unclassified 640
604 Ga0157377_10027043 3300014745 Bacteria 3076
605 Ga0157377_10042179 3300014745 Bacteria 2534
606 Ga0157377_10081058 3300014745 Bacteria 1898
607 Ga0157377_10096840 3300014745 Bacteria 1751
608 Ga0157377_10171699 3300014745 Bacteria 1357
609 Ga0157377_11189132 3300014745 Unclassified 590
610 Ga0157379_10013361 3300014968 Bacteria 7190
611 Ga0157379_11966972 3300014968 Bacteria 577
612 Ga0157376_10083020 3300014969 Bacteria 2755
613 Ga0157376_10095058 3300014969 Bacteria 2591
614 Ga0157376_10362594 3300014969 Bacteria 1390
615 Ga0157376_12183167 3300014969 Unclassified 592
616 Ga0182005_1156778 3300015265 Bacteria 665
617 Ga0163161_10114895 3300017792 Bacteria 2017
618 Ga0163161_10159995 3300017792 Bacteria 1717
619 Ga0163161_10303867 3300017792 Unclassified 1257
620 Ga0163161_10784279 3300017792 Bacteria 800
621 Ga0163161_11119694 3300017792 Unclassified 677
622 Ga0163161_11176652 3300017792 Unclassified 662
623 Ga0207666_1006342 3300025271 Bacteria 1532
624 Ga0207673_1001644 3300025290 Bacteria 2469
625 Ga0207697_10000027 3300025315 Bacteria 51720
626 Ga0207697_10046882 3300025315 Bacteria 1781
627 Ga0207697_10274833 3300025315 Bacteria 746
628 Ga0207697_10306687 3300025315 Unclassified 704
629 Ga0207656_10017536 3300025321 Bacteria 2807
630 Ga0207653_10213155 3300025885 Unclassified 731
631 Ga0207653_10428451 3300025885 Unclassified 519
632 Ga0207653_10442355 3300025885 Bacteria 510
633 Ga0207682_10003092 3300025893 Bacteria 7294
634 Ga0207682_10004644 3300025893 Bacteria 5708
635 Ga0207682_10014485 3300025893 Unclassified 3073
636 Ga0207682_10016389 3300025893 Bacteria 2890
637 Ga0207682_10082721 3300025893 Bacteria 1379
638 Ga0207682_10204672 3300025893 Bacteria 909
639 Ga0207682_10250462 3300025893 Bacteria 824
640 Ga0207682_10319816 3300025893 Bacteria 729
641 Ga0207682_10548639 3300025893 Unclassified 546
642 Ga0207642_10312102 3300025899 Bacteria 915
643 Ga0207710_10389828 3300025900 Bacteria 714
644 Ga0207688_10000041 3300025901 Bacteria 44495
645 Ga0207688_10019397 3300025901 Bacteria 3705
646 Ga0207688_10134788 3300025901 Unclassified 1449
647 Ga0207688_10237014 3300025901 Unclassified 1103
648 Ga0207688_10578706 3300025901 Bacteria 707
649 Ga0207688_10665973 3300025901 Unclassified 657
650 Ga0207680_10020405 3300025903 Bacteria 3566
651 Ga0207680_10057104 3300025903 Bacteria 2360
652 Ga0207680_10111674 3300025903 Bacteria 1774
653 Ga0207680_10358492 3300025903 Bacteria 1025
654 Ga0207680_10565025 3300025903 Bacteria 812
655 Ga0207680_10858227 3300025903 Bacteria 651
656 Ga0207680_11367048 3300025903 Unclassified 503
657 Ga0207647_10363802 3300025904 Unclassified 818
658 Ga0207645_10000227 3300025907 Bacteria 46640
659 Ga0207645_10008759 3300025907 Bacteria 7038
660 Ga0207645_10018641 3300025907 Bacteria 4560
661 Ga0207645_10057170 3300025907 Bacteria 2490
662 Ga0207645_10205039 3300025907 Bacteria 1298
663 Ga0207645_11153404 3300025907 Unclassified 521
664 Ga0207643_10005161 3300025908 Bacteria 6986
665 Ga0207643_10023237 3300025908 Bacteria 3418
666 Ga0207643_10159631 3300025908 Bacteria 1356
667 Ga0207643_10161325 3300025908 Unclassified 1349
668 Ga0207643_10411311 3300025908 Bacteria 856
669 Ga0207643_10427906 3300025908 Bacteria 840
670 Ga0207643_10664826 3300025908 Bacteria 672
671 Ga0207643_10734289 3300025908 Unclassified 639
672 Ga0207684_10095825 3300025910 Bacteria 2532
673 Ga0207684_10220997 3300025910 Bacteria 1635
674 Ga0207684_10669911 3300025910 Bacteria 883
675 Ga0207684_10917149 3300025910 Bacteria 736
676 Ga0207684_10920302 3300025910 Unclassified 734
677 Ga0207707_10030021 3300025912 Bacteria 4753
678 Ga0207660_10166418 3300025917 Unclassified 1704
679 Ga0207660_10384042 3300025917 Bacteria 1129
680 Ga0207660_11418199 3300025917 Unclassified 562
681 Ga0207662_10024630 3300025918 Bacteria 3463
682 Ga0207662_10030980 3300025918 Bacteria 3107
683 Ga0207662_10068357 3300025918 Bacteria 2145
684 Ga0207662_10156944 3300025918 Bacteria 1451
685 Ga0207662_10501961 3300025918 Bacteria 835
686 Ga0207662_11183984 3300025918 Bacteria 543
687 Ga0207657_10448169 3300025919 Bacteria 1013
688 Ga0207657_11336236 3300025919 Bacteria 540
689 Ga0207649_10018539 3300025920 Bacteria 3961
690 Ga0207649_10091573 3300025920 Bacteria 1992
691 Ga0207649_10481471 3300025920 Unclassified 941
692 Ga0207649_11144210 3300025920 Unclassified 614
693 Ga0207652_10542291 3300025921 Bacteria 1046
694 Ga0207652_10946649 3300025921 Unclassified 759
695 Ga0207646_10166324 3300025922 Bacteria 1991
696 Ga0207646_10390394 3300025922 Bacteria 1257
697 Ga0207646_10714768 3300025922 Bacteria 895
698 Ga0207646_10858789 3300025922 Unclassified 806
699 Ga0207646_10965596 3300025922 Unclassified 754
700 Ga0207646_11893978 3300025922 Unclassified 508
701 Ga0207681_10003610 3300025923 Bacteria 9630
702 Ga0207681_10023535 3300025923 Unclassified 3941
703 Ga0207681_10060021 3300025923 Bacteria 2609
704 Ga0207681_10185862 3300025923 Bacteria 1586
705 Ga0207681_10461898 3300025923 Bacteria 1034
706 Ga0207681_10528749 3300025923 Bacteria 968
707 Ga0207681_10534268 3300025923 Bacteria 963
708 Ga0207681_11514895 3300025923 Unclassified 562
709 Ga0207694_10019305 3300025924 Bacteria 5153
710 Ga0207694_11196723 3300025924 Unclassified 643
711 Ga0207650_10023366 3300025925 Bacteria 4382
712 Ga0207650_10060265 3300025925 Bacteria 2832
713 Ga0207650_10084559 3300025925 Bacteria 2412
714 Ga0207650_10216404 3300025925 Bacteria 1540
715 Ga0207650_10536255 3300025925 Unclassified 980
716 Ga0207650_10592425 3300025925 Unclassified 932
717 Ga0207650_11074573 3300025925 Bacteria 685
718 Ga0207659_10004790 3300025926 Bacteria 8206
719 Ga0207659_10007594 3300025926 Bacteria 6682
720 Ga0207659_10010993 3300025926 Bacteria 5702
721 Ga0207659_10033197 3300025926 Unclassified 3550
722 Ga0207659_10043481 3300025926 Bacteria 3155
723 Ga0207659_10067577 3300025926 Unclassified 2596
724 Ga0207659_10147189 3300025926 Bacteria 1835
725 Ga0207659_10409452 3300025926 Bacteria 1136
726 Ga0207659_10461407 3300025926 Unclassified 1071
727 Ga0207659_10807302 3300025926 Bacteria 806
728 Ga0207659_10868420 3300025926 Unclassified 775
729 Ga0207687_10067308 3300025927 Bacteria 2548
730 Ga0207687_11590172 3300025927 Unclassified 561
731 Ga0207687_11638564 3300025927 Unclassified 552
732 Ga0207700_10005256 3300025928 Bacteria 7717
733 Ga0207644_10091929 3300025931 Bacteria 2263
734 Ga0207644_10163201 3300025931 Unclassified 1733
735 Ga0207644_10630925 3300025931 Bacteria 891
736 Ga0207644_11838933 3300025931 Unclassified 506
737 Ga0207644_11875034 3300025931 Bacteria 501
738 Ga0207690_10055770 3300025932 Bacteria 2663
739 Ga0207690_10177085 3300025932 Bacteria 1603
740 Ga0207690_10610160 3300025932 Bacteria 891
741 Ga0207706_10005190 3300025933 Bacteria 12159
742 Ga0207706_10038984 3300025933 Bacteria 4214
743 Ga0207706_10044964 3300025933 Unclassified 3912
744 Ga0207706_10357466 3300025933 Bacteria 1269
745 Ga0207706_10499097 3300025933 Unclassified 1050
746 Ga0207706_10789932 3300025933 Unclassified 807
747 Ga0207706_11695047 3300025933 Unclassified 509
748 Ga0207686_10004901 3300025934 Bacteria 7198
749 Ga0207686_10251325 3300025934 Bacteria 1292
750 Ga0207686_10284028 3300025934 Bacteria 1223
751 Ga0207686_11221683 3300025934 Unclassified 616
752 Ga0207709_10049606 3300025935 Bacteria 2563
753 Ga0207709_10217781 3300025935 Bacteria 1375
754 Ga0207670_10012814 3300025936 Unclassified 4920
755 Ga0207670_10139766 3300025936 Bacteria 1785
756 Ga0207670_10155653 3300025936 Unclassified 1701
757 Ga0207670_10159309 3300025936 Bacteria 1683
758 Ga0207670_10218970 3300025936 Bacteria 1456
759 Ga0207670_10256920 3300025936 Bacteria 1352
760 Ga0207670_10292785 3300025936 Bacteria 1272
761 Ga0207670_10395934 3300025936 Bacteria 1103
762 Ga0207670_10576504 3300025936 Unclassified 922
763 Ga0207670_11540448 3300025936 Unclassified 565
764 Ga0207669_10000418 3300025937 Bacteria 18585
765 Ga0207669_10010943 3300025937 Bacteria 4391
766 Ga0207669_10370696 3300025937 Bacteria 1112
767 Ga0207669_10594225 3300025937 Bacteria 899
768 Ga0207669_10801385 3300025937 Unclassified 781
769 Ga0207669_11649151 3300025937 Unclassified 547
770 Ga0207704_10047486 3300025938 Bacteria 2566
771 Ga0207704_10085927 3300025938 Unclassified 2050
772 Ga0207704_10092318 3300025938 Bacteria 1992
773 Ga0207704_10648741 3300025938 Unclassified 869
774 Ga0207704_10742056 3300025938 Bacteria 816
775 Ga0207704_11892334 3300025938 Unclassified 513
776 Ga0207691_10000239 3300025940 Bacteria 53779
777 Ga0207691_10036456 3300025940 Bacteria 4557
778 Ga0207691_10043175 3300025940 Bacteria 4155
779 Ga0207691_10051379 3300025940 Bacteria 3769
780 Ga0207691_10158261 3300025940 Bacteria 1988
781 Ga0207691_10160903 3300025940 Bacteria 1970
782 Ga0207691_10180509 3300025940 Bacteria 1845
783 Ga0207691_10243277 3300025940 Unclassified 1555
784 Ga0207691_10519534 3300025940 Bacteria 1010
785 Ga0207691_10654628 3300025940 Unclassified 887
786 Ga0207691_11019759 3300025940 Bacteria 690
787 Ga0207691_11091549 3300025940 Unclassified 664
788 Ga0207691_11349630 3300025940 Unclassified 587
789 Ga0207711_10021329 3300025941 Bacteria 5412
790 Ga0207711_10200733 3300025941 Bacteria 1820
791 Ga0207711_10349380 3300025941 Bacteria 1369
792 Ga0207711_10494309 3300025941 Bacteria 1140
793 Ga0207711_10721437 3300025941 Bacteria 930
794 Ga0207689_10002100 3300025942 Bacteria 18776
795 Ga0207689_10003638 3300025942 Bacteria 14080
796 Ga0207689_10084114 3300025942 Bacteria 2615
797 Ga0207689_10123559 3300025942 Bacteria 2129
798 Ga0207689_10394788 3300025942 Unclassified 1153
799 Ga0207689_10413666 3300025942 Bacteria 1125
800 Ga0207689_10997739 3300025942 Unclassified 706
801 Ga0207661_11325057 3300025944 Unclassified 661
802 Ga0207661_11609543 3300025944 Unclassified 594
803 Ga0207679_10026957 3300025945 Bacteria 3968
804 Ga0207679_10237538 3300025945 Bacteria 1542
805 Ga0207679_10273180 3300025945 Bacteria 1446
806 Ga0207679_10338864 3300025945 Bacteria 1307
807 Ga0207679_10499982 3300025945 Bacteria 1085
808 Ga0207679_10571183 3300025945 Bacteria 1016
809 Ga0207679_11169589 3300025945 Unclassified 706
810 Ga0207679_11562215 3300025945 Unclassified 605
811 Ga0207679_11676924 3300025945 Bacteria 582
812 Ga0207651_10001713 3300025960 Bacteria 10127
813 Ga0207651_10063358 3300025960 Bacteria 2581
814 Ga0207651_10065560 3300025960 Unclassified 2547
815 Ga0207651_10070442 3300025960 Bacteria 2474
816 Ga0207651_10074908 3300025960 Bacteria 2412
817 Ga0207651_10174603 3300025960 Bacteria 1698
818 Ga0207651_10248280 3300025960 Bacteria 1454
819 Ga0207651_10274330 3300025960 Bacteria 1390
820 Ga0207651_10484530 3300025960 Bacteria 1067
821 Ga0207651_10566454 3300025960 Bacteria 989
822 Ga0207651_11096068 3300025960 Unclassified 713
823 Ga0207712_10020206 3300025961 Bacteria 4360
824 Ga0207712_10025216 3300025961 Bacteria 3949
825 Ga0207712_10978144 3300025961 Unclassified 750
826 Ga0207712_11440235 3300025961 Unclassified 617
827 Ga0207668_10018526 3300025972 Bacteria 4385
828 Ga0207668_10099010 3300025972 Bacteria 2162
829 Ga0207668_10234454 3300025972 Bacteria 1481
830 Ga0207640_10029510 3300025981 Bacteria 3368
831 Ga0207640_10988983 3300025981 Bacteria 739
832 Ga0207640_11374874 3300025981 Bacteria 632
833 Ga0207658_10211044 3300025986 Bacteria 1627
834 Ga0207658_10219518 3300025986 Bacteria 1599
835 Ga0207658_10432497 3300025986 Bacteria 1162
836 Ga0207658_10907413 3300025986 Bacteria 802
837 Ga0207677_10055612 3300026023 Bacteria 2707
838 Ga0207677_10144604 3300026023 Bacteria 1826
839 Ga0207677_10457017 3300026023 Unclassified 1095
840 Ga0207677_10637943 3300026023 Unclassified 939
841 Ga0207677_11218498 3300026023 Bacteria 689
842 Ga0207677_11369574 3300026023 Unclassified 651
843 Ga0207677_11567873 3300026023 Unclassified 609
844 Ga0207703_10009365 3300026035 Bacteria 7697
845 Ga0207703_10041677 3300026035 Bacteria 3680
846 Ga0207703_10155756 3300026035 Bacteria 1996
847 Ga0207703_10239799 3300026035 Unclassified 1630
848 Ga0207703_10561128 3300026035 Bacteria 1077
849 Ga0207703_11059363 3300026035 Unclassified 778
850 Ga0207639_10518173 3300026041 Bacteria 1091
851 Ga0207678_10019741 3300026067 Bacteria 5929
852 Ga0207678_10201267 3300026067 Unclassified 1703
853 Ga0207678_10783794 3300026067 Bacteria 841
854 Ga0207678_11400286 3300026067 Unclassified 618
855 Ga0207678_11911452 3300026067 Unclassified 518
856 Ga0207708_10008322 3300026075 Bacteria 7681
857 Ga0207708_10017268 3300026075 Bacteria 5432
858 Ga0207708_10041033 3300026075 Bacteria 3529
859 Ga0207708_10147588 3300026075 Unclassified 1849
860 Ga0207708_10262877 3300026075 Bacteria 1393
861 Ga0207708_10366948 3300026075 Bacteria 1184
862 Ga0207708_10393440 3300026075 Unclassified 1145
863 Ga0207708_10411795 3300026075 Bacteria 1120
864 Ga0207708_10453195 3300026075 Bacteria 1069
865 Ga0207708_10570254 3300026075 Bacteria 956
866 Ga0207708_10639095 3300026075 Unclassified 905
867 Ga0207708_10908528 3300026075 Unclassified 762
868 Ga0207702_11798716 3300026078 Bacteria 605
869 Ga0207641_10053541 3300026088 Unclassified 3421
870 Ga0207641_10114845 3300026088 Bacteria 2393
871 Ga0207641_10388821 3300026088 Bacteria 1337
872 Ga0207641_10437850 3300026088 Bacteria 1261
873 Ga0207641_10911062 3300026088 Unclassified 873
874 Ga0207648_10000945 3300026089 Bacteria 32836
875 Ga0207648_10005096 3300026089 Bacteria 13314
876 Ga0207648_10009645 3300026089 Bacteria 9232
877 Ga0207648_10044557 3300026089 Bacteria 3892
878 Ga0207648_10178752 3300026089 Unclassified 1877
879 Ga0207648_10317199 3300026089 Bacteria 1400
880 Ga0207648_10538608 3300026089 Bacteria 1071
881 Ga0207648_10649501 3300026089 Unclassified 975
882 Ga0207648_10797965 3300026089 Bacteria 879
883 Ga0207648_10897152 3300026089 Bacteria 828
884 Ga0207648_11152260 3300026089 Unclassified 728
885 Ga0207676_10048220 3300026095 Bacteria 3306
886 Ga0207676_10071875 3300026095 Bacteria 2779
887 Ga0207676_10092775 3300026095 Bacteria 2484
888 Ga0207676_10157753 3300026095 Bacteria 1962
889 Ga0207676_10224131 3300026095 Bacteria 1676
890 Ga0207676_10324654 3300026095 Bacteria 1414
891 Ga0207676_10336341 3300026095 Unclassified 1391
892 Ga0207676_10438962 3300026095 Bacteria 1228
893 Ga0207676_10540002 3300026095 Unclassified 1112
894 Ga0207674_10107420 3300026116 Bacteria 2768
895 Ga0207674_10108580 3300026116 Bacteria 2751
896 Ga0207674_10114338 3300026116 Bacteria 2671
897 Ga0207674_10131336 3300026116 Bacteria 2467
898 Ga0207674_10166513 3300026116 Bacteria 2158
899 Ga0207674_11393225 3300026116 Unclassified 670
900 Ga0207674_11653184 3300026116 Unclassified 609
901 Ga0207675_100005724 3300026118 Bacteria 11891
902 Ga0207675_100015280 3300026118 Bacteria 7163
903 Ga0207675_100022564 3300026118 Bacteria 5860
904 Ga0207675_100198146 3300026118 Bacteria 1928
905 Ga0207675_100429742 3300026118 Bacteria 1305
906 Ga0207675_101457217 3300026118 Bacteria 705
907 Ga0207683_10002140 3300026121 Bacteria 17343
908 Ga0207683_10024888 3300026121 Bacteria 5159
909 Ga0207683_10256952 3300026121 Bacteria 1595
910 Ga0207683_10563352 3300026121 Bacteria 1054
911 Ga0207683_10999847 3300026121 Bacteria 776
912 Ga0207683_11457127 3300026121 Unclassified 633
913 Ga0207683_11917920 3300026121 Unclassified 541
914 Ga0207698_10122886 3300026142 Bacteria 2201
915 Ga0207698_10266732 3300026142 Bacteria 1576
916 Ga0207698_10401482 3300026142 Bacteria 1310
917 Ga0207698_10565191 3300026142 Bacteria 1117
918 Ga0207698_10792787 3300026142 Bacteria 949
919 Ga0207698_10916983 3300026142 Bacteria 884
920 Ga0207698_10945499 3300026142 Unclassified 871
921 Ga0207698_12015381 3300026142 Unclassified 591
922 Ga0209973_1018226 3300027252 Unclassified 909
923 Ga0209967_1061133 3300027364 Bacteria 584
924 Ga0209968_1006266 3300027526 Bacteria 1791
925 Ga0209999_1031658 3300027543 Bacteria 982
926 Ga0210002_1026697 3300027617 Unclassified 948
927 Ga0209966_1066059 3300027695 Bacteria 787
928 Ga0209974_10057113 3300027876 Bacteria 1318
929 Ga0209974_10066894 3300027876 Bacteria 1221
930 Ga0209974_10143736 3300027876 Bacteria 857
931 Ga0209974_10471803 3300027876 Bacteria 500
932 Ga0207428_10000712 3300027907 Bacteria 38459
933 Ga0207428_10003385 3300027907 Bacteria 15501
934 Ga0207428_10003621 3300027907 Bacteria 14905
935 Ga0207428_10014253 3300027907 Bacteria 6916
936 Ga0207428_10020924 3300027907 Bacteria 5546
937 Ga0207428_10364693 3300027907 Bacteria 1061
938 Ga0207428_10436585 3300027907 Bacteria 955
939 Ga0207428_10590962 3300027907 Unclassified 800
940 Ga0268266_10145381 3300028379 Bacteria 2131
941 Ga0268266_10302778 3300028379 Bacteria 1492
942 Ga0268266_11154731 3300028379 Unclassified 749
943 Ga0268265_10001193 3300028380 Bacteria 22642
944 Ga0268265_10005363 3300028380 Bacteria 8777
945 Ga0268265_10118951 3300028380 Bacteria 2173
946 Ga0268265_10421163 3300028380 Unclassified 1240
947 Ga0268265_10557341 3300028380 Bacteria 1089
948 Ga0268265_10623573 3300028380 Bacteria 1033
949 Ga0268265_11445481 3300028380 Bacteria 690
950 Ga0268265_11794311 3300028380 Unclassified 620
951 Ga0268265_12093360 3300028380 Unclassified 573
952 Ga0268265_12384938 3300028380 Unclassified 535
953 Ga0268264_10004339 3300028381 Bacteria 12109
954 Ga0268264_10090200 3300028381 Unclassified 2641
955 Ga0268264_10221263 3300028381 Bacteria 1743
956 Ga0268264_10591113 3300028381 Bacteria 1093
957 Ga0307408_100330602 3300031548 Unclassified 1287
958 Ga0307405_10103932 3300031731 Bacteria 1911
959 Ga0307405_10279159 3300031731 Bacteria 1256
960 Ga0307413_10082909 3300031824 Bacteria 2061
961 Ga0307413_11148022 3300031824 Bacteria 673
962 Ga0307410_10033548 3300031852 Bacteria 3315
963 Ga0307410_10127209 3300031852 Bacteria 1867
964 Ga0307407_10311119 3300031903 Bacteria 1102
965 Ga0307407_10437374 3300031903 Bacteria 946
966 Ga0307412_10072599 3300031911 Bacteria 2352
967 Ga0307412_10248597 3300031911 Bacteria 1380
968 Ga0307412_10527573 3300031911 Bacteria 988
969 Ga0307412_11031866 3300031911 Unclassified 728
970 Ga0307409_100026651 3300031995 Bacteria 4080
971 Ga0307409_100960908 3300031995 Unclassified 871
972 Ga0307409_101721773 3300031995 Bacteria 656
973 Ga0307409_101981816 3300031995 Unclassified 612
974 Ga0307416_100153108 3300032002 Bacteria 2118
975 Ga0307416_100160503 3300032002 Bacteria 2077
976 Ga0307416_100937144 3300032002 Unclassified 967
977 Ga0307416_103292215 3300032002 Unclassified 541
978 Ga0307416_103509715 3300032002 Bacteria 525
979 Ga0307414_10229349 3300032004 Bacteria 1530
980 Ga0307414_11928435 3300032004 Unclassified 551
981 Ga0307411_10033406 3300032005 Bacteria 3191
982 Ga0307411_10332286 3300032005 Bacteria 1232
983 Ga0307415_100044852 3300032126 Bacteria 2959
984 Ga0373930_0056077 3300034816 Bacteria 870
985 Ga0373948_0166737 3300034817 Bacteria 558
986 Ga0373938_0086091 3300034957 Bacteria 771
987 Ga0373940_0119441 3300035088 Bacteria 816
988 Ga0373949_0016508 3300035090 Bacteria 1656
989 Ga0373951_0024736 3300035091 Bacteria 1392
990 Ga0373941_0035619 3300035115 Unclassified 1509
991 Ga0373943_0625757 3300035170 Bacteria 635
992 Ga0373955_0174056 3300035172 Bacteria 1275
993 Ga0373961_0064328 3300035241 Unclassified 1121
994 Ga0373961_0442464 3300035241 Bacteria 505
995 Ga0373962_0010858 3300035242 Bacteria 2277
996 Ga0316574_0790300 3300035398 Unclassified 578
997 Ga0373924_0272494 3300035410 Bacteria 750
998 Ga0373935_0117923 3300035692 Bacteria 1770
999 Ga0373933_0233675 3300035724 Bacteria 1181
1000 Ga0373947_0186396 3300035725 Bacteria 1353
1001 Ga0373937_0026134 3300036401 Bacteria 5275
1002 Ga0373925_1221150 3300037068 Bacteria 618
1003 Ga0373925_1520537 3300037068 Bacteria 548
1004 Ga0439453_0067396 3300041408 Bacteria 751
1005 Ga0451798_0980588 3300041458 Bacteria 947
1006 Ga0451800_1250676 3300041459 Bacteria 1048
1007 Ga0451807_0661252 3300041486 Unclassified 1363
1008 Ga0451807_1408989 3300041486 Bacteria 757
1009 Ga0451839_0937225 3300041496 Bacteria 571
1010 Ga0451847_0750152 3300041503 Bacteria 557
1011 Ga0451853_1414792 3300041512 Bacteria 1280
1012 Ga0439448_0267573 3300042005 Bacteria 605
1013 Ga0439450_005909 3300042008 Bacteria 2177
1014 Ga0450890_040919 3300042127 Bacteria 686
1015 Ga0439446_0227123 3300042156 Unclassified 638
1016 Ga0450908_089933 3300042184 Unclassified 556
1017 Ga0439435_0011938 3300042436 Bacteria 2092
1018 Ga0439444_0157052 3300042437 Bacteria 553
1019 Ga0439459_0195251 3300042438 Unclassified 550
1020 Ga0439464_0034234 3300042439 Unclassified 1432
1021 Ga0439464_0140599 3300042439 Bacteria 751
1022 Ga0439460_0022758 3300042461 Bacteria 1722
1023 Ga0450916_010876 3300042530 Bacteria 1143
1024 Ga0450918_068287 3300042531 Bacteria 665
1025 Ga0450893_0135755 3300042532 Unclassified 522
1026 Ga0451577_0851872 3300042876 Bacteria 822
1027 Ga0453683_0528129 3300044673 Bacteria 767
1028 Ga0451576_0012634 3300045051 Bacteria 9481
1029 Ga0451576_0058861 3300045051 Bacteria 4012
1030 Ga0451576_0156556 3300045051 Bacteria 2377
1031 Ga0451576_0265115 3300045051 Bacteria 1796
1032 Ga0451576_0273634 3300045051 Bacteria 1765
1033 Ga0451576_0620486 3300045051 Unclassified 1136
1034 Ga0451576_1129359 3300045051 Bacteria 820
1035 Ga0495627_229461 3300046453 Unclassified 509
1036 Ga0495580_0068165 3300046472 Unclassified 2488
1037 Ga0495582_0102419 3300046473 Bacteria 1604
1038 Ga0495639_0089871 3300046475 Bacteria 1440
1039 Ga0495584_0029611 3300046491 Unclassified 2776
1040 Ga0495584_0560794 3300046491 Unclassified 582
1041 Ga0495637_0360257 3300046520 Unclassified 509
1042 Ga0495643_0002815 3300046522 Bacteria 13276
1043 Ga0495644_0010822 3300046523 Bacteria 3515
1044 Ga0495663_0184678 3300046525 Bacteria 723
1045 Ga0495642_0401020 3300046528 Bacteria 605
1046 Ga0495665_0218846 3300046531 Bacteria 985
1047 Ga0495598_0007773 3300046537 Bacteria 2473
1048 Ga0495598_0024579 3300046537 Bacteria 1635
1049 Ga0495598_0036341 3300046537 Bacteria 1415
1050 Ga0495598_0058652 3300046537 Bacteria 1181
1051 Ga0495598_0150546 3300046537 Unclassified 812
1052 Ga0495598_0182740 3300046537 Bacteria 749
1053 Ga0495609_0012011 3300046538 Bacteria 4112
1054 Ga0495609_0042546 3300046538 Bacteria 2040
1055 Ga0495621_0014062 3300046539 Unclassified 2527
1056 Ga0495621_0029785 3300046539 Bacteria 1863
1057 Ga0495621_0038883 3300046539 Bacteria 1662
1058 Ga0495621_0148753 3300046539 Bacteria 920
1059 Ga0495645_0165975 3300046543 Bacteria 1523
1060 Ga0495633_0042236 3300046558 Bacteria 2167
1061 Ga0495656_0013094 3300046615 Bacteria 3077
1062 Ga0495656_0125245 3300046615 Bacteria 1217
1063 Ga0495656_0174465 3300046615 Bacteria 1053
1064 Ga0495668_0202500 3300046616 Unclassified 1087
1065 Ga0495668_0403784 3300046616 Unclassified 751
1066 Ga0495659_0004263 3300046664 Bacteria 4508
1067 Ga0495659_0024829 3300046664 Bacteria 2047
1068 Ga0495659_0035778 3300046664 Bacteria 1751
1069 Ga0495659_0090683 3300046664 Bacteria 1173
1070 Ga0495588_0185482 3300046674 Bacteria 1099
1071 Ga0495658_0246093 3300046683 Bacteria 1124
1072 Ga0495658_0629864 3300046683 Bacteria 687
1073 Ga0495669_0072519 3300046684 Bacteria 1571
1074 Ga0495669_0132747 3300046684 Bacteria 1172
1075 Ga0495670_0011708 3300046691 Bacteria 4318
1076 Ga0495670_0263306 3300046691 Bacteria 920
1077 Ga0495670_0267303 3300046691 Unclassified 913
1078 Ga0495670_0753188 3300046691 Unclassified 531
1079 Ga0495636_0069851 3300047318 Bacteria 1497
1080 Ga0495636_0089111 3300047318 Bacteria 1338
1081 Ga0495636_0297248 3300047318 Unclassified 755
1082 Ga0495681_0371517 3300047470 Unclassified 540
1083 Ga0495684_0505847 3300047471 Bacteria 830
1084 Ga0495593_0613228 3300047673 Unclassified 546
1085 Ga0496102_0261172 3300048905 Bacteria 1633
1086 Ga0496103_1058891 3300048906 Unclassified 503
1087 Ga0496109_0445681 3300048912 Unclassified 1223
1088 Ga0496110_0503166 3300048913 Unclassified 1103
1089 Ga0496112_0294441 3300048915 Bacteria 1569
1090 Ga0496113_0048818 3300048916 Bacteria 3150
1091 Ga0496113_1065649 3300048916 Bacteria 635
1092 Ga0496114_0404169 3300048917 Unclassified 1209
1093 Ga0496114_1658518 3300048917 Unclassified 527
1094 Ga0501290_093934 3300049513 Unclassified 526
1095 Ga0501299_155563 3300049522 Bacteria 580
1096 Ga0501031_0778307 3300049568 Unclassified 614
1097 Ga0501038_1293720 3300049574 Unclassified 527
1098 Ga0501039_0504810 3300049575 Unclassified 950
1099 Ga0501040_0038103 3300049576 Bacteria 3268
1100 Ga0501041_0015406 3300049577 Bacteria 4539
1101 Ga0501041_0602498 3300049577 Bacteria 701
1102 Ga0501042_0006294 3300049578 Bacteria 7701
1103 Ga0501042_0097820 3300049578 Unclassified 2110
1104 Ga0501046_0203832 3300049580 Bacteria 1471
1105 Ga0501048_0227370 3300049582 Unclassified 1324
1106 Ga0501048_0946233 3300049582 Unclassified 620
1107 Ga0501048_1225511 3300049582 Unclassified 540
1108 Ga0501067_0218144 3300049583 Bacteria 1062
1109 Ga0501069_0080171 3300049585 Bacteria 1838
1110 Ga0501070_0655922 3300049586 Bacteria 833
1111 Ga0501074_0035716 3300049590 Bacteria 3601
1112 Ga0501075_0404982 3300049591 Bacteria 1040
1113 Ga0501076_0241434 3300049592 Bacteria 1478
1114 Ga0501076_0658127 3300049592 Unclassified 864
1115 Ga0501077_0530309 3300049593 Unclassified 755
1116 Ga0501216_162944 3300049660 Bacteria 536
1117 Ga0501079_0505695 3300049741 Unclassified 950
1118 Ga0501079_0552345 3300049741 Bacteria 906
1119 Ga0501080_0779302 3300049742 Bacteria 840
1120 Ga0501081_0000708 3300049743 Bacteria 19308
1121 Ga0501045_0032841 3300049824 Bacteria 3762
1122 nmdc:mga05p37_106692_c1 3300050507 Bacteria 3446
1123 nmdc:mga05p37_1771377_c1 3300050507 Unclassified 598
1124 nmdc:mga05p37_199120_c1 3300050507 Bacteria 2427
1125 nmdc:mga05p37_223620_c1 3300050507 Bacteria 2271
1126 nmdc:mga05p37_2706_c1 3300050507 Bacteria 20600
1127 nmdc:mga05p37_485684_c1 3300050507 Bacteria 1421
1128 nmdc:mga05p37_59257_c1 3300050507 Bacteria 4715
1129 nmdc:mga05p37_68798_c1 3300050507 Bacteria 4354
1130 nmdc:mga05p37_93129_c1 3300050507 Bacteria 3713
1131 nmdc:mga05p37_974318_c1 3300050507 Bacteria 904
1132 nmdc:mga09592_23365_c1 3300050508 Bacteria 5107
1133 nmdc:mga09592_4784_c1 3300050508 Bacteria 10966
1134 nmdc:mga09592_8217_c1 3300050508 Bacteria 8486
1135 nmdc:mga09592_871963_c1 3300050508 Bacteria 758
1136 nmdc:mga09592_9092_c1 3300050508 Bacteria 8077
1137 nmdc:mga0qj67_104681_c2 3300050509 Bacteria 1580
1138 nmdc:mga0qj67_14732_c1 3300050509 Bacteria 5910
1139 nmdc:mga0qj67_1512_c1 3300050509 Bacteria 16310
1140 nmdc:mga0qj67_178948_c1 3300050509 Bacteria 1722
1141 nmdc:mga0qj67_196722_c1 3300050509 Bacteria 1638
1142 nmdc:mga0qj67_299002_c1 3300050509 Bacteria 1304
1143 nmdc:mga0qj67_595996_c1 3300050509 Bacteria 884
1144 nmdc:mga06r32_104941_c1 3300050510 Bacteria 2776
1145 nmdc:mga06r32_1296648_c1 3300050510 Unclassified 672
1146 nmdc:mga06r32_13471_c1 3300050510 Bacteria 7409
1147 nmdc:mga06r32_194944_c1 3300050510 Bacteria 2013
1148 nmdc:mga06r32_3881_c1 3300050510 Bacteria 13387
1149 nmdc:mga08y16_123029_c1 3300050511 Bacteria 2699
1150 nmdc:mga08y16_12708_c1 3300050511 Bacteria 8859
1151 nmdc:mga08y16_1443171_c1 3300050511 Bacteria 650
1152 nmdc:mga08y16_225793_c1 3300050511 Bacteria 1938
1153 nmdc:mga08y16_23899_c1 3300050511 Bacteria 6455
1154 nmdc:mga08y16_262941_c1 3300050511 Bacteria 1782
1155 nmdc:mga08y16_38458_c1 3300050511 Bacteria 5024
1156 nmdc:mga08y16_387053_c1 3300050511 Bacteria 1433
1157 nmdc:mga08y16_48960_c1 3300050511 Bacteria 4423
1158 nmdc:mga08y16_611_c1 3300050511 Bacteria 33310
1159 nmdc:mga08y16_628285_c1 3300050511 Bacteria 1080
1160 nmdc:mga08y16_960088_c1 3300050511 Bacteria 837
1161 nmdc:mga0n895_11471_c1 3300050512 Bacteria 7909
1162 nmdc:mga0n895_136748_c1 3300050512 Unclassified 2477
1163 nmdc:mga0n895_1825256_c1 3300050512 Unclassified 568
1164 nmdc:mga0n895_267989_c1 3300050512 Bacteria 1733
1165 nmdc:mga0n895_409293_c1 3300050512 Unclassified 1372
1166 nmdc:mga0n895_5739_c1 3300050512 Bacteria 10416
1167 nmdc:mga0n895_839248_c1 3300050512 Unclassified 907
1168 nmdc:mga0n895_87579_c1 3300050512 Bacteria 3112
1169 nmdc:mga0n895_916967_c1 3300050512 Unclassified 861
1170 nmdc:mga0n895_955191_c1 3300050512 Bacteria 840
1171 nmdc:mga0rr50_13165_c1 3300050513 Bacteria 5375
1172 nmdc:mga0rr50_136685_c1 3300050513 Unclassified 1968
1173 nmdc:mga0rr50_1904079_c1 3300050513 Bacteria 500
1174 nmdc:mga0rr50_290916_c1 3300050513 Bacteria 1365
1175 nmdc:mga0rr50_3113_c1 3300050513 Bacteria 9478
1176 nmdc:mga0rr50_33925_c1 3300050513 Bacteria 3650
1177 nmdc:mga0rr50_980115_c1 3300050513 Bacteria 720
1178 nmdc:mga08x19_4710_c1 3300050514 Bacteria 8087
1179 nmdc:mga0a205_102428_c1 3300050515 Bacteria 2761
1180 nmdc:mga0a205_1204613_c1 3300050515 Unclassified 605
1181 nmdc:mga0a205_265250_c1 3300050515 Unclassified 1595
1182 nmdc:mga0a205_2970_c1 3300050515 Bacteria 15044
1183 nmdc:mga0a205_44696_c1 3300050515 Bacteria 4271
1184 nmdc:mga0a205_46915_c1 3300050515 Unclassified 2984
1185 nmdc:mga0a205_53372_c1 3300050515 Bacteria 3902
1186 nmdc:mga0a205_60215_c1 3300050515 Unclassified 3667
1187 nmdc:mga0a205_962431_c1 3300050515 Bacteria 700
1188 nmdc:mga0a205_986_c1 3300050515 Bacteria 23556
1189 Ga0501084_0284771 3300054114 Bacteria 1396
1190 Ga0501084_0450578 3300054114 Bacteria 1088
1191 Ga0590071_070774 3300059421 Bacteria 859
1192 Ga0590074_054982 3300059423 Bacteria 733
1193 Ga0590075_144421 3300059424 Bacteria 626
1194 Ga0590077_024636 3300059426 Bacteria 1293
1195 Ga0501082_1621217 3300060353 Unclassified 565
1196 Ga0530510_1233745 3300061734 Unclassified 573
1197 Ga0070687_100914264
1198 JGI24746J21847_1000952
1199 JGI24746J21847_1041046
1200 JGI24750J21931_1005644
1201 JGI24749J21850_1021680
1202 JGI24749J21850_1074278
1203 JGI24033J26618_1012516
1204 JGI24034J26672_10105793
1205 JGI24742J22300_10011045
1206 JGI24751J29686_10062998
1207 JGI26145J50221_1030466
1208 Ga0058859_11182138
1209 Ga0065714_10091502
1210 Ga0065714_10146061
1211 Ga0065704_10001963
1212 Ga0065704_10106014
1213 Ga0065704_10123446
1214 Ga0065704_10394202
1215 Ga0065704_10750709
1216 Ga0065704_10783754
1217 Ga0065712_10006432
1218 Ga0065712_10022428
1219 Ga0065712_10072906
1220 Ga0065712_10098251
1221 Ga0065712_10125629
1222 Ga0065712_10420257
1223 Ga0065715_10003916
1224 Ga0065715_10097777
1225 Ga0065715_10191708
1226 Ga0065715_10240452
1227 Ga0065715_10360078
1228 Ga0065715_11120585
1229 Ga0065707_10005876
1230 Ga0065707_10007429
1231 Ga0065707_10176388
1232 Ga0065707_10490249
1233 Ga0065707_10641057
1234 Ga0065707_10773662
1235 Ga0065707_10809338
1236 Ga0065707_10905644
1237 Ga0065707_11001532
1238 Ga0070658_10292078
1239 Ga0070676_10010053
1240 Ga0070676_10064347
1241 Ga0070676_10366078
1242 Ga0070676_10946566
1243 Ga0070683_100083153
1244 Ga0070690_100004426
1245 Ga0070690_100031293
1246 Ga0070690_100121416
1247 Ga0070690_100956875
1248 Ga0070690_101540208
1249 Ga0070670_100002370
1250 Ga0070670_100021798
1251 Ga0070670_100100140
1252 Ga0070670_100128420
1253 Ga0070670_100196456
1254 Ga0070670_100215657
1255 Ga0070670_100405359
1256 Ga0070677_10000884
1257 Ga0070677_10015592
1258 Ga0070677_10023964
1259 Ga0070677_10026613
1260 Ga0070677_10055120
1261 Ga0070677_10131353
1262 Ga0070677_10374653
1263 Ga0070677_10451448
1264 Ga0070677_10899039
1265 Ga0068869_100023429
1266 Ga0068869_100112130
1267 Ga0068869_100180305
1268 Ga0068869_100426708
1269 Ga0068869_100984162
1270 Ga0068869_101018733
1271 Ga0070666_10007259
1272 Ga0070666_10034704
1273 Ga0070666_10092645
1274 Ga0070666_10116797
1275 Ga0070666_10122016
1276 Ga0070666_10308826
1277 Ga0070666_10839728
1278 Ga0070680_100038026
1279 Ga0070680_100877621
1280 Ga0070682_101223126
1281 Ga0068868_100005344
1282 Ga0068868_100347337
1283 Ga0068868_100559707
1284 Ga0068868_100811086
1285 Ga0068868_101825433
1286 Ga0070660_100258686
1287 Ga0070660_100751079
1288 Ga0070689_100072777
1289 Ga0070689_100163068
1290 Ga0070689_100163346
1291 Ga0070689_100383040
1292 Ga0070689_100757329
1293 Ga0070689_100959753
1294 Ga0070689_101138528
1295 Ga0070689_101872924
1296 Ga0070691_10128853
1297 Ga0070691_10327392
1298 Ga0070687_100008085
1299 Ga0070687_100016455
1300 Ga0070687_100028758
1301 Ga0070687_100088193
1302 Ga0070687_100187908
1303 Ga0070661_100003293
1304 Ga0070661_100065094
1305 Ga0070661_100092077
1306 Ga0070661_101600594
1307 Ga0070692_10082522
1308 Ga0070668_100016902
1309 Ga0070668_100020560
1310 Ga0070668_100114614
1311 Ga0070668_100518597
1312 Ga0070668_100562270
1313 Ga0070668_101484023
1314 Ga0070669_100006473
1315 Ga0070669_100012780
1316 Ga0070669_100053301
1317 Ga0070669_100078184
1318 Ga0070669_100123882
1319 Ga0070669_100234238
1320 Ga0070669_100439357
1321 Ga0070669_100573903
1322 Ga0070669_100688371
1323 Ga0070669_100790679
1324 Ga0070669_101360856
1325 Ga0070675_100001614
1326 Ga0070675_100002608
1327 Ga0070675_100018101
1328 Ga0070675_100032679
1329 Ga0070675_100063406
1330 Ga0070675_100113663
1331 Ga0070675_100240873
1332 Ga0070675_100361229
1333 Ga0070675_100492683
1334 Ga0070675_100929383
1335 Ga0070675_101355439
1336 Ga0070675_101613160
1337 Ga0070671_100122909
1338 Ga0070671_100184331
1339 Ga0070671_100229478
1340 Ga0070671_101024139
1341 Ga0070674_100000222
1342 Ga0070674_100033451
1343 Ga0070674_100155777
1344 Ga0070674_100345239
1345 Ga0070674_101137694
1346 Ga0070674_101605542
1347 Ga0070674_102172848
1348 Ga0070673_100020938
1349 Ga0070673_100025136
1350 Ga0070673_100115784
1351 Ga0070673_100120386
1352 Ga0070673_100123040
1353 Ga0070673_100129990
1354 Ga0070673_100153046
1355 Ga0070673_100173104
1356 Ga0070673_100232536
1357 Ga0070673_100397622
1358 Ga0070673_100443807
1359 Ga0070673_100464947
1360 Ga0070673_100469385
1361 Ga0070673_100598427
1362 Ga0070673_101039448
1363 Ga0070688_100013286
1364 Ga0070688_100031127
1365 Ga0070688_100102851
1366 Ga0070688_100120357
1367 Ga0070688_100186678
1368 Ga0070688_100287848
1369 Ga0070688_100457007
1370 Ga0070688_100936717
1371 Ga0070659_100114324
1372 Ga0070659_100135095
1373 Ga0070659_100668450
1374 Ga0070667_100178994
1375 Ga0070667_100270530
1376 Ga0070667_100272075
1377 Ga0070667_101867223
1378 Ga0070703_10188412
1379 Ga0070713_100848750
1380 Ga0070701_10009628
1381 Ga0070701_10082718
1382 Ga0070701_10093840
1383 Ga0070701_10138441
1384 Ga0070701_10910973
1385 Ga0070705_100000353
1386 Ga0070705_100008965
1387 Ga0070705_100029016
1388 Ga0070705_100079069
1389 Ga0070705_100085170
1390 Ga0070705_100434585
1391 Ga0070705_100499988
1392 Ga0070705_100728846
1393 Ga0070700_100013220
1394 Ga0070700_100222638
1395 Ga0070700_100520551
1396 Ga0070700_100564109
1397 Ga0070700_100684244
1398 Ga0070700_100699055
1399 Ga0070694_100001728
1400 Ga0070694_100008513
1401 Ga0070694_100010015
1402 Ga0070694_100813735
1403 Ga0070694_100912234
1404 Ga0070694_101056990
1405 Ga0070694_101277919
1406 Ga0070694_101455482
1407 Ga0070708_100071937
1408 Ga0070708_100135240
1409 Ga0070708_100305645
1410 Ga0070708_100675580
1411 Ga0070708_101019911
1412 Ga0070663_100014111
1413 Ga0070663_100084753
1414 Ga0070663_101524594
1415 Ga0070663_101759234
1416 Ga0070678_100041874
1417 Ga0070678_100146621
1418 Ga0070678_100448341
1419 Ga0070678_100480279
1420 Ga0070678_101647951
1421 Ga0070662_100006426
1422 Ga0070662_100019273
1423 Ga0070662_100059774
1424 Ga0070662_100509327
1425 Ga0070662_100710678
1426 Ga0070662_100848928
1427 Ga0070681_10002446
1428 Ga0068867_100007382
1429 Ga0068867_100019216
1430 Ga0068867_100060463
1431 Ga0068867_100129518
1432 Ga0068867_100600396
1433 Ga0068867_101489442
1434 Ga0070685_10015733
1435 Ga0070685_10027397
1436 Ga0070685_10264721
1437 Ga0070706_100169304
1438 Ga0070706_100555807
1439 Ga0070706_100794546
1440 Ga0070706_101381440
1441 Ga0070707_100874859
1442 Ga0070707_101422599
1443 Ga0070698_100005270
1444 Ga0070698_100029738
1445 Ga0070698_100100980
1446 Ga0070698_100153539
1447 Ga0070698_100279604
1448 Ga0070698_100536546
1449 Ga0070698_100719809
1450 Ga0070698_101015617
1451 Ga0070698_101848618
1452 Ga0070699_100003285
1453 Ga0070699_100007386
1454 Ga0070699_100022796
1455 Ga0070679_100597545
1456 Ga0070679_101008571
1457 Ga0070684_100099393
1458 Ga0070684_100175655
1459 Ga0070684_100470762
1460 Ga0070684_100748943
1461 Ga0070684_102300879
1462 Ga0070697_100313326
1463 Ga0070697_101028189
1464 Ga0068853_100448603
1465 Ga0070672_100009505
1466 Ga0070672_100043637
1467 Ga0070672_100056073
1468 Ga0070672_100104949
1469 Ga0070672_100150200
1470 Ga0070672_100274683
1471 Ga0070672_100619546
1472 Ga0070672_100788673
1473 Ga0070672_100911719
1474 Ga0070672_100923746
1475 Ga0070672_101364412
1476 Ga0070672_101458649
1477 Ga0070672_101971580
1478 Ga0070686_100006474
1479 Ga0070686_100273209
1480 Ga0070686_100345857
1481 Ga0070686_100416253
1482 Ga0070686_100627161
1483 Ga0070686_101116921
1484 Ga0070686_101363773
1485 Ga0070695_100003268
1486 Ga0070695_100020676
1487 Ga0070695_100935128
1488 Ga0070695_101011094
1489 Ga0070695_101196999
1490 Ga0070696_100000751
1491 Ga0070696_100013141
1492 Ga0070696_100039033
1493 Ga0070696_100172919
1494 Ga0070696_101002298
1495 Ga0070693_100334479
1496 Ga0070693_100501711
1497 Ga0070665_100090893
1498 Ga0070665_101608319
1499 Ga0070665_102232540
1500 Ga0070704_100002185
1501 Ga0070704_100014281
1502 Ga0070704_100047016
1503 Ga0070704_100073926
1504 Ga0070704_100115315
1505 Ga0070704_100248857
1506 Ga0070704_100793674
1507 Ga0070704_101448904
1508 Ga0070704_101775293
1509 Ga0070664_100018194
1510 Ga0070664_100039531
1511 Ga0070664_100053084
1512 Ga0070664_100175999
1513 Ga0070664_100222908
1514 Ga0070664_100272927
1515 Ga0070664_100504310
1516 Ga0070664_100589293
1517 Ga0070664_101082640
1518 Ga0068857_100138766
1519 Ga0068857_100202629
1520 Ga0068857_100711697
1521 Ga0068854_100040004
1522 Ga0068854_100840812
1523 Ga0068854_100955854
1524 Ga0068854_101189487
1525 Ga0068856_101752580
1526 Ga0070702_100098240
1527 Ga0070702_100348949
1528 Ga0070702_100788075
1529 Ga0070702_100793281
1530 Ga0068852_100051784
1531 Ga0068852_100623592
1532 Ga0068852_100635292
1533 Ga0068852_100744886
1534 Ga0068852_100761046
1535 Ga0068859_100039000
1536 Ga0068859_100117279
1537 Ga0068859_100189178
1538 Ga0068859_100256673
1539 Ga0068859_100319892
1540 Ga0068859_100582281
1541 Ga0068859_101225249
1542 Ga0068859_101239689
1543 Ga0068859_102270249
1544 Ga0068864_100047439
1545 Ga0068864_100066467
1546 Ga0068864_100102782
1547 Ga0068864_100123147
1548 Ga0068864_100305474
1549 Ga0068864_100328649
1550 Ga0068864_100356891
1551 Ga0068864_100486019
1552 Ga0068864_101143360
1553 Ga0068866_10006225
1554 Ga0068866_10259654
1555 Ga0068866_11153648
1556 Ga0068861_100012791
1557 Ga0068861_100032640
1558 Ga0068861_100085352
1559 Ga0068861_100133379
1560 Ga0068861_100912979
1561 Ga0068861_102238726
1562 Ga0068851_10008481
1563 Ga0068851_10922979
1564 Ga0068870_10018525
1565 Ga0068870_10028570
1566 Ga0068870_10029356
1567 Ga0068870_10114191
1568 Ga0068870_10179614
1569 Ga0068870_10267855
1570 Ga0068870_10354043
1571 Ga0068870_10550614
1572 Ga0068870_10844517
1573 Ga0068870_10933317
1574 Ga0068870_11179445
1575 Ga0068863_100002899
1576 Ga0068863_100025702
1577 Ga0068863_100124010
1578 Ga0068863_102384778
1579 Ga0068858_100007484
1580 Ga0068858_100018524
1581 Ga0068858_100267963
1582 Ga0068858_100272659
1583 Ga0068858_100344119
1584 Ga0068858_101314986
1585 Ga0068860_100014383
1586 Ga0068860_100185323
1587 Ga0068860_100440099
1588 Ga0068860_100580002
1589 Ga0068862_100002073
1590 Ga0068862_100111241
1591 Ga0068862_100407820
1592 Ga0068862_100704301
1593 Ga0068862_100803665
1594 Ga0068862_100922615
1595 Ga0068862_101201879
1596 Ga0068862_101530753
1597 Ga0068862_102271404
1598 Ga0068862_102377259
1599 Ga0068862_102664939
1600 Ga0081455_10858315
1601 Ga0081539_10372093
1602 Ga0070717_10631548
1603 Ga0075432_10094707
1604 Ga0070712_100876359
1605 Ga0097621_100417979
1606 Ga0097621_100800049
1607 Ga0097621_100910532
1608 Ga0097621_101009588
1609 Ga0097621_101221959
1610 Ga0097621_101883344
1611 Ga0068871_100195632
1612 Ga0068871_100203037
1613 Ga0068871_100233077
1614 Ga0068871_100774957
1615 Ga0075428_100001205
1616 Ga0075428_100011446
1617 Ga0075428_100012226
1618 Ga0075428_100042724
1619 Ga0075428_100523099
1620 Ga0075428_100668990
1621 Ga0075430_100089047
1622 Ga0075430_100188316
1623 Ga0075430_100206542
1624 Ga0075430_100208917
1625 Ga0075430_100251135
1626 Ga0075430_100460028
1627 Ga0075430_100533554
1628 Ga0075430_100688712
1629 Ga0075431_100005109
1630 Ga0075431_100010681
1631 Ga0075431_100183629
1632 Ga0075431_100747466
1633 Ga0075433_10001688
1634 Ga0075433_10018246
1635 Ga0075433_10050964
1636 Ga0075433_10055219
1637 Ga0075433_10061199
1638 Ga0075434_100000943
1639 Ga0075434_100002545
1640 Ga0075434_100035306
1641 Ga0075434_100064826
1642 Ga0075434_100158188
1643 Ga0075434_100228243
1644 Ga0075434_100718790
1645 Ga0075434_101490509
1646 Ga0075429_100025834
1647 Ga0075429_100038522
1648 Ga0075429_100051940
1649 Ga0075429_100109495
1650 Ga0075429_100117682
1651 Ga0075429_100629963
1652 Ga0075429_100946140
1653 Ga0068865_100053704
1654 Ga0068865_100199111
1655 Ga0068865_100295905
1656 Ga0068865_100533146
1657 Ga0068865_100561968
1658 Ga0075436_100023031
1659 Ga0097620_100039000
1660 Ga0097620_100117285
1661 Ga0097620_100189167
1662 Ga0097620_100256662
1663 Ga0097620_100319883
1664 Ga0097620_100582328
1665 Ga0097620_101225226
1666 Ga0097620_101239600
1667 Ga0097620_102270193
1668 Ga0075435_100002880
1669 Ga0075435_100010137
1670 Ga0075435_100010913
1671 Ga0075435_100178693
1672 Ga0075435_100479813
1673 Ga0075435_101534962
1674 Ga0105251_10314861
1675 Ga0111539_10000542
1676 Ga0111539_10002846
1677 Ga0111539_10022938
1678 Ga0111539_10138512
1679 Ga0111539_10197442
1680 Ga0111539_10197900
1681 Ga0111539_10216760
1682 Ga0111539_10323210
1683 Ga0111539_10544753
1684 Ga0111539_10886226
1685 Ga0111539_11007936
1686 Ga0111539_12453436
1687 Ga0111539_12989662
1688 Ga0105245_10338554
1689 Ga0105245_11157318
1690 Ga0105245_11176052
1691 Ga0105245_11276792
1692 Ga0105245_11529375
1693 Ga0105247_10086466
1694 Ga0105247_11264744
1695 Ga0114129_10001659
1696 Ga0114129_10003888
1697 Ga0114129_10016436
1698 Ga0114129_10086038
1699 Ga0114129_10116266
1700 Ga0114129_10223067
1701 Ga0114129_10394086
1702 Ga0114129_10800058
1703 Ga0114129_11166255
1704 Ga0114129_11284148
1705 Ga0114129_11958811
1706 Ga0114129_11982710
1707 Ga0114129_12111479
1708 Ga0105243_10027038
1709 Ga0105243_10093757
1710 Ga0105243_10158402
1711 Ga0105243_10168660
1712 Ga0105243_10969829
1713 Ga0105243_10983644
1714 Ga0105243_11028703
1715 Ga0105243_13131978
1716 Ga0105241_10909626
1717 Ga0105241_11919499
1718 Ga0105242_10011817
1719 Ga0105242_10065331
1720 Ga0105242_10185772
1721 Ga0105242_11463668
1722 Ga0105242_11907954
1723 Ga0105248_10051872
1724 Ga0105248_10113273
1725 Ga0105248_10280214
1726 Ga0105248_10396219
1727 Ga0105248_10583212
1728 Ga0105248_11543960
1729 Ga0105238_10058346
1730 Ga0105238_11788035
1731 Ga0105249_10000672
1732 Ga0105249_10001821
1733 Ga0105249_10252825
1734 Ga0105249_10377841
1735 Ga0105249_11121917
1736 Ga0105249_11285126
1737 Ga0105249_11570110
1738 Ga0105249_12210631
1739 Ga0105249_12414026
1740 Ga0105249_12623344
1741 Ga0105249_12673871
1742 Ga0105239_11372302
1743 Ga0105246_10364554
1744 Ga0105246_10651790
1745 Ga0157337_1014616
1746 Ga0157335_1030830
1747 Ga0157345_1054407
1748 Ga0157324_1001288
1749 Ga0157371_10413871
1750 Ga0157371_10624768
1751 Ga0157371_11182638
1752 Ga0157370_10073957
1753 Ga0157374_10157407
1754 Ga0157374_10185254
1755 Ga0157374_11254284
1756 Ga0157374_12050102
1757 Ga0157378_10137274
1758 Ga0157378_10491431
1759 Ga0157378_10513867
1760 Ga0157378_11000408
1761 Ga0157378_11160127
1762 Ga0157378_12007646
1763 Ga0157378_12952901
1764 Ga0163162_10007803
1765 Ga0163162_10087199
1766 Ga0163162_10574529
1767 Ga0163162_10859515
1768 Ga0163162_11154024
1769 Ga0163162_12681753
1770 Ga0157372_11020583
1771 Ga0157372_11924360
1772 Ga0157375_10011615
1773 Ga0157375_10015562
1774 Ga0157375_10246137
1775 Ga0157375_10311956
1776 Ga0157375_10320781
1777 Ga0157375_10422420
1778 Ga0157375_10447625
1779 Ga0157375_10774905
1780 Ga0157375_10942782
1781 Ga0157375_11492868
1782 Ga0157375_11784441
1783 Ga0163163_10034093
1784 Ga0163163_10098812
1785 Ga0163163_10303044
1786 Ga0163163_10320181
1787 Ga0163163_10569774
1788 Ga0163163_12278427
1789 Ga0157380_10004513
1790 Ga0157380_10040095
1791 Ga0157380_10042139
1792 Ga0157380_10145336
1793 Ga0157380_10216223
1794 Ga0157380_10236903
1795 Ga0157380_10301823
1796 Ga0157380_10458235
1797 Ga0157380_11016065
1798 Ga0157380_11228405
1799 Ga0157380_12010684
1800 Ga0157377_10027043
1801 Ga0157377_10042179
1802 Ga0157377_10081058
1803 Ga0157377_10096840
1804 Ga0157377_10171699
1805 Ga0157377_11189132
1806 Ga0157379_10013361
1807 Ga0157379_11966972
1808 Ga0157376_10083020
1809 Ga0157376_10095058
1810 Ga0157376_10362594
1811 Ga0157376_12183167
1812 Ga0182005_1156778
1813 Ga0163161_10114895
1814 Ga0163161_10159995
1815 Ga0163161_10303867
1816 Ga0163161_10784279
1817 Ga0163161_11119694
1818 Ga0163161_11176652
1819 Ga0207666_1006342
1820 Ga0207673_1001644
1821 Ga0207697_10000027
1822 Ga0207697_10046882
1823 Ga0207697_10274833
1824 Ga0207697_10306687
1825 Ga0207656_10017536
1826 Ga0207653_10213155
1827 Ga0207653_10428451
1828 Ga0207653_10442355
1829 Ga0207682_10003092
1830 Ga0207682_10004644
1831 Ga0207682_10014485
1832 Ga0207682_10016389
1833 Ga0207682_10082721
1834 Ga0207682_10204672
1835 Ga0207682_10250462
1836 Ga0207682_10319816
1837 Ga0207682_10548639
1838 Ga0207642_10312102
1839 Ga0207710_10389828
1840 Ga0207688_10000041
1841 Ga0207688_10019397
1842 Ga0207688_10134788
1843 Ga0207688_10237014
1844 Ga0207688_10578706
1845 Ga0207688_10665973
1846 Ga0207680_10020405
1847 Ga0207680_10057104
1848 Ga0207680_10111674
1849 Ga0207680_10358492
1850 Ga0207680_10565025
1851 Ga0207680_10858227
1852 Ga0207680_11367048
1853 Ga0207647_10363802
1854 Ga0207645_10000227
1855 Ga0207645_10008759
1856 Ga0207645_10018641
1857 Ga0207645_10057170
1858 Ga0207645_10205039
1859 Ga0207645_11153404
1860 Ga0207643_10005161
1861 Ga0207643_10023237
1862 Ga0207643_10159631
1863 Ga0207643_10161325
1864 Ga0207643_10411311
1865 Ga0207643_10427906
1866 Ga0207643_10664826
1867 Ga0207643_10734289
1868 Ga0207684_10095825
1869 Ga0207684_10220997
1870 Ga0207684_10669911
1871 Ga0207684_10917149
1872 Ga0207684_10920302
1873 Ga0207707_10030021
1874 Ga0207660_10166418
1875 Ga0207660_10384042
1876 Ga0207660_11418199
1877 Ga0207662_10024630
1878 Ga0207662_10030980
1879 Ga0207662_10068357
1880 Ga0207662_10156944
1881 Ga0207662_10501961
1882 Ga0207662_11183984
1883 Ga0207657_10448169
1884 Ga0207657_11336236
1885 Ga0207649_10018539
1886 Ga0207649_10091573
1887 Ga0207649_10481471
1888 Ga0207649_11144210
1889 Ga0207652_10542291
1890 Ga0207652_10946649
1891 Ga0207646_10166324
1892 Ga0207646_10390394
1893 Ga0207646_10714768
1894 Ga0207646_10858789
1895 Ga0207646_10965596
1896 Ga0207646_11893978
1897 Ga0207681_10003610
1898 Ga0207681_10023535
1899 Ga0207681_10060021
1900 Ga0207681_10185862
1901 Ga0207681_10461898
1902 Ga0207681_10528749
1903 Ga0207681_10534268
1904 Ga0207681_11514895
1905 Ga0207694_10019305
1906 Ga0207694_11196723
1907 Ga0207650_10023366
1908 Ga0207650_10060265
1909 Ga0207650_10084559
1910 Ga0207650_10216404
1911 Ga0207650_10536255
1912 Ga0207650_10592425
1913 Ga0207650_11074573
1914 Ga0207659_10004790
1915 Ga0207659_10007594
1916 Ga0207659_10010993
1917 Ga0207659_10033197
1918 Ga0207659_10043481
1919 Ga0207659_10067577
1920 Ga0207659_10147189
1921 Ga0207659_10409452
1922 Ga0207659_10461407
1923 Ga0207659_10807302
1924 Ga0207659_10868420
1925 Ga0207687_10067308
1926 Ga0207687_11590172
1927 Ga0207687_11638564
1928 Ga0207700_10005256
1929 Ga0207644_10091929
1930 Ga0207644_10163201
1931 Ga0207644_10630925
1932 Ga0207644_11838933
1933 Ga0207644_11875034
1934 Ga0207690_10055770
1935 Ga0207690_10177085
1936 Ga0207690_10610160
1937 Ga0207706_10005190
1938 Ga0207706_10038984
1939 Ga0207706_10044964
1940 Ga0207706_10357466
1941 Ga0207706_10499097
1942 Ga0207706_10789932
1943 Ga0207706_11695047
1944 Ga0207686_10004901
1945 Ga0207686_10251325
1946 Ga0207686_10284028
1947 Ga0207686_11221683
1948 Ga0207709_10049606
1949 Ga0207709_10217781
1950 Ga0207670_10012814
1951 Ga0207670_10139766
1952 Ga0207670_10155653
1953 Ga0207670_10159309
1954 Ga0207670_10218970
1955 Ga0207670_10256920
1956 Ga0207670_10292785
1957 Ga0207670_10395934
1958 Ga0207670_10576504
1959 Ga0207670_11540448
1960 Ga0207669_10000418
1961 Ga0207669_10010943
1962 Ga0207669_10370696
1963 Ga0207669_10594225
1964 Ga0207669_10801385
1965 Ga0207669_11649151
1966 Ga0207704_10047486
1967 Ga0207704_10085927
1968 Ga0207704_10092318
1969 Ga0207704_10648741
1970 Ga0207704_10742056
1971 Ga0207704_11892334
1972 Ga0207691_10000239
1973 Ga0207691_10036456
1974 Ga0207691_10043175
1975 Ga0207691_10051379
1976 Ga0207691_10158261
1977 Ga0207691_10160903
1978 Ga0207691_10180509
1979 Ga0207691_10243277
1980 Ga0207691_10519534
1981 Ga0207691_10654628
1982 Ga0207691_11019759
1983 Ga0207691_11091549
1984 Ga0207691_11349630
1985 Ga0207711_10021329
1986 Ga0207711_10200733
1987 Ga0207711_10349380
1988 Ga0207711_10494309
1989 Ga0207711_10721437
1990 Ga0207689_10002100
1991 Ga0207689_10003638
1992 Ga0207689_10084114
1993 Ga0207689_10123559
1994 Ga0207689_10394788
1995 Ga0207689_10413666
1996 Ga0207689_10997739
1997 Ga0207661_11325057
1998 Ga0207661_11609543
1999 Ga0207679_10026957
2000 Ga0207679_10237538
2001 Ga0207679_10273180
2002 Ga0207679_10338864
2003 Ga0207679_10499982
2004 Ga0207679_10571183
2005 Ga0207679_11169589
2006 Ga0207679_11562215
2007 Ga0207679_11676924
2008 Ga0207651_10001713
2009 Ga0207651_10063358
2010 Ga0207651_10065560
2011 Ga0207651_10070442
2012 Ga0207651_10074908
2013 Ga0207651_10174603
2014 Ga0207651_10248280
2015 Ga0207651_10274330
2016 Ga0207651_10484530
2017 Ga0207651_10566454
2018 Ga0207651_11096068
2019 Ga0207712_10020206
2020 Ga0207712_10025216
2021 Ga0207712_10978144
2022 Ga0207712_11440235
2023 Ga0207668_10018526
2024 Ga0207668_10099010
2025 Ga0207668_10234454
2026 Ga0207640_10029510
2027 Ga0207640_10988983
2028 Ga0207640_11374874
2029 Ga0207658_10211044
2030 Ga0207658_10219518
2031 Ga0207658_10432497
2032 Ga0207658_10907413
2033 Ga0207677_10055612
2034 Ga0207677_10144604
2035 Ga0207677_10457017
2036 Ga0207677_10637943
2037 Ga0207677_11218498
2038 Ga0207677_11369574
2039 Ga0207677_11567873
2040 Ga0207703_10009365
2041 Ga0207703_10041677
2042 Ga0207703_10155756
2043 Ga0207703_10239799
2044 Ga0207703_10561128
2045 Ga0207703_11059363
2046 Ga0207639_10518173
2047 Ga0207678_10019741
2048 Ga0207678_10201267
2049 Ga0207678_10783794
2050 Ga0207678_11400286
2051 Ga0207678_11911452
2052 Ga0207708_10008322
2053 Ga0207708_10017268
2054 Ga0207708_10041033
2055 Ga0207708_10147588
2056 Ga0207708_10262877
2057 Ga0207708_10366948
2058 Ga0207708_10393440
2059 Ga0207708_10411795
2060 Ga0207708_10453195
2061 Ga0207708_10570254
2062 Ga0207708_10639095
2063 Ga0207708_10908528
2064 Ga0207702_11798716
2065 Ga0207641_10053541
2066 Ga0207641_10114845
2067 Ga0207641_10388821
2068 Ga0207641_10437850
2069 Ga0207641_10911062
2070 Ga0207648_10000945
2071 Ga0207648_10005096
2072 Ga0207648_10009645
2073 Ga0207648_10044557
2074 Ga0207648_10178752
2075 Ga0207648_10317199
2076 Ga0207648_10538608
2077 Ga0207648_10649501
2078 Ga0207648_10797965
2079 Ga0207648_10897152
2080 Ga0207648_11152260
2081 Ga0207676_10048220
2082 Ga0207676_10071875
2083 Ga0207676_10092775
2084 Ga0207676_10157753
2085 Ga0207676_10224131
2086 Ga0207676_10324654
2087 Ga0207676_10336341
2088 Ga0207676_10438962
2089 Ga0207676_10540002
2090 Ga0207674_10107420
2091 Ga0207674_10108580
2092 Ga0207674_10114338
2093 Ga0207674_10131336
2094 Ga0207674_10166513
2095 Ga0207674_11393225
2096 Ga0207674_11653184
2097 Ga0207675_100005724
2098 Ga0207675_100015280
2099 Ga0207675_100022564
2100 Ga0207675_100198146
2101 Ga0207675_100429742
2102 Ga0207675_101457217
2103 Ga0207683_10002140
2104 Ga0207683_10024888
2105 Ga0207683_10256952
2106 Ga0207683_10563352
2107 Ga0207683_10999847
2108 Ga0207683_11457127
2109 Ga0207683_11917920
2110 Ga0207698_10122886
2111 Ga0207698_10266732
2112 Ga0207698_10401482
2113 Ga0207698_10565191
2114 Ga0207698_10792787
2115 Ga0207698_10916983
2116 Ga0207698_10945499
2117 Ga0207698_12015381
2118 Ga0209973_1018226
2119 Ga0209967_1061133
2120 Ga0209968_1006266
2121 Ga0209999_1031658
2122 Ga0210002_1026697
2123 Ga0209966_1066059
2124 Ga0209974_10057113
2125 Ga0209974_10066894
2126 Ga0209974_10143736
2127 Ga0209974_10471803
2128 Ga0207428_10000712
2129 Ga0207428_10003385
2130 Ga0207428_10003621
2131 Ga0207428_10014253
2132 Ga0207428_10020924
2133 Ga0207428_10364693
2134 Ga0207428_10436585
2135 Ga0207428_10590962
2136 Ga0268266_10145381
2137 Ga0268266_10302778
2138 Ga0268266_11154731
2139 Ga0268265_10001193
2140 Ga0268265_10005363
2141 Ga0268265_10118951
2142 Ga0268265_10421163
2143 Ga0268265_10557341
2144 Ga0268265_10623573
2145 Ga0268265_11445481
2146 Ga0268265_11794311
2147 Ga0268265_12093360
2148 Ga0268265_12384938
2149 Ga0268264_10004339
2150 Ga0268264_10090200
2151 Ga0268264_10221263
2152 Ga0268264_10591113
2153 Ga0307408_100330602
2154 Ga0307405_10103932
2155 Ga0307405_10279159
2156 Ga0307413_10082909
2157 Ga0307413_11148022
2158 Ga0307410_10033548
2159 Ga0307410_10127209
2160 Ga0307407_10311119
2161 Ga0307407_10437374
2162 Ga0307412_10072599
2163 Ga0307412_10248597
2164 Ga0307412_10527573
2165 Ga0307412_11031866
2166 Ga0307409_100026651
2167 Ga0307409_100960908
2168 Ga0307409_101721773
2169 Ga0307409_101981816
2170 Ga0307416_100153108
2171 Ga0307416_100160503
2172 Ga0307416_100937144
2173 Ga0307416_103292215
2174 Ga0307416_103509715
2175 Ga0307414_10229349
2176 Ga0307414_11928435
2177 Ga0307411_10033406
2178 Ga0307411_10332286
2179 Ga0307415_100044852
2180 Ga0373930_0056077
2181 Ga0373948_0166737
2182 Ga0373938_0086091
2183 Ga0373940_0119441
2184 Ga0373949_0016508
2185 Ga0373951_0024736
2186 Ga0373941_0035619
2187 Ga0373943_0625757
2188 Ga0373955_0174056
2189 Ga0373961_0064328
2190 Ga0373961_0442464
2191 Ga0373962_0010858
2192 Ga0316574_0790300
2193 Ga0373924_0272494
2194 Ga0373935_0117923
2195 Ga0373933_0233675
2196 Ga0373947_0186396
2197 Ga0373937_0026134
2198 Ga0373925_1221150
2199 Ga0373925_1520537
2200 Ga0439453_0067396
2201 Ga0451798_0980588
2202 Ga0451800_1250676
2203 Ga0451807_0661252
2204 Ga0451807_1408989
2205 Ga0451839_0937225
2206 Ga0451847_0750152
2207 Ga0451853_1414792
2208 Ga0439448_0267573
2209 Ga0439450_005909
2210 Ga0450890_040919
2211 Ga0439446_0227123
2212 Ga0450908_089933
2213 Ga0439435_0011938
2214 Ga0439444_0157052
2215 Ga0439459_0195251
2216 Ga0439464_0034234
2217 Ga0439464_0140599
2218 Ga0439460_0022758
2219 Ga0450916_010876
2220 Ga0450918_068287
2221 Ga0450893_0135755
2222 Ga0451577_0851872
2223 Ga0453683_0528129
2224 Ga0451576_0012634
2225 Ga0451576_0058861
2226 Ga0451576_0156556
2227 Ga0451576_0265115
2228 Ga0451576_0273634
2229 Ga0451576_0620486
2230 Ga0451576_1129359
2231 Ga0495627_229461
2232 Ga0495580_0068165
2233 Ga0495582_0102419
2234 Ga0495639_0089871
2235 Ga0495584_0029611
2236 Ga0495584_0560794
2237 Ga0495637_0360257
2238 Ga0495643_0002815
2239 Ga0495644_0010822
2240 Ga0495663_0184678
2241 Ga0495642_0401020
2242 Ga0495665_0218846
2243 Ga0495598_0007773
2244 Ga0495598_0024579
2245 Ga0495598_0036341
2246 Ga0495598_0058652
2247 Ga0495598_0150546
2248 Ga0495598_0182740
2249 Ga0495609_0012011
2250 Ga0495609_0042546
2251 Ga0495621_0014062
2252 Ga0495621_0029785
2253 Ga0495621_0038883
2254 Ga0495621_0148753
2255 Ga0495645_0165975
2256 Ga0495633_0042236
2257 Ga0495656_0013094
2258 Ga0495656_0125245
2259 Ga0495656_0174465
2260 Ga0495668_0202500
2261 Ga0495668_0403784
2262 Ga0495659_0004263
2263 Ga0495659_0024829
2264 Ga0495659_0035778
2265 Ga0495659_0090683
2266 Ga0495588_0185482
2267 Ga0495658_0246093
2268 Ga0495658_0629864
2269 Ga0495669_0072519
2270 Ga0495669_0132747
2271 Ga0495670_0011708
2272 Ga0495670_0263306
2273 Ga0495670_0267303
2274 Ga0495670_0753188
2275 Ga0495636_0069851
2276 Ga0495636_0089111
2277 Ga0495636_0297248
2278 Ga0495681_0371517
2279 Ga0495684_0505847
2280 Ga0495593_0613228
2281 Ga0496102_0261172
2282 Ga0496103_1058891
2283 Ga0496109_0445681
2284 Ga0496110_0503166
2285 Ga0496112_0294441
2286 Ga0496113_0048818
2287 Ga0496113_1065649
2288 Ga0496114_0404169
2289 Ga0496114_1658518
2290 Ga0501290_093934
2291 Ga0501299_155563
2292 Ga0501031_0778307
2293 Ga0501038_1293720
2294 Ga0501039_0504810
2295 Ga0501040_0038103
2296 Ga0501041_0015406
2297 Ga0501041_0602498
2298 Ga0501042_0006294
2299 Ga0501042_0097820
2300 Ga0501046_0203832
2301 Ga0501048_0227370
2302 Ga0501048_0946233
2303 Ga0501048_1225511
2304 Ga0501067_0218144
2305 Ga0501069_0080171
2306 Ga0501070_0655922
2307 Ga0501074_0035716
2308 Ga0501075_0404982
2309 Ga0501076_0241434
2310 Ga0501076_0658127
2311 Ga0501077_0530309
2312 Ga0501216_162944
2313 Ga0501079_0505695
2314 Ga0501079_0552345
2315 Ga0501080_0779302
2316 Ga0501081_0000708
2317 Ga0501045_0032841
2318 nmdc:mga05p37_106692_c1
2319 nmdc:mga05p37_1771377_c1
2320 nmdc:mga05p37_199120_c1
2321 nmdc:mga05p37_223620_c1
2322 nmdc:mga05p37_2706_c1
2323 nmdc:mga05p37_485684_c1
2324 nmdc:mga05p37_59257_c1
2325 nmdc:mga05p37_68798_c1
2326 nmdc:mga05p37_93129_c1
2327 nmdc:mga05p37_974318_c1
2328 nmdc:mga09592_23365_c1
2329 nmdc:mga09592_4784_c1
2330 nmdc:mga09592_8217_c1
2331 nmdc:mga09592_871963_c1
2332 nmdc:mga09592_9092_c1
2333 nmdc:mga0qj67_104681_c2
2334 nmdc:mga0qj67_14732_c1
2335 nmdc:mga0qj67_1512_c1
2336 nmdc:mga0qj67_178948_c1
2337 nmdc:mga0qj67_196722_c1
2338 nmdc:mga0qj67_299002_c1
2339 nmdc:mga0qj67_595996_c1
2340 nmdc:mga06r32_104941_c1
2341 nmdc:mga06r32_1296648_c1
2342 nmdc:mga06r32_13471_c1
2343 nmdc:mga06r32_194944_c1
2344 nmdc:mga06r32_3881_c1
2345 nmdc:mga08y16_123029_c1
2346 nmdc:mga08y16_12708_c1
2347 nmdc:mga08y16_1443171_c1
2348 nmdc:mga08y16_225793_c1
2349 nmdc:mga08y16_23899_c1
2350 nmdc:mga08y16_262941_c1
2351 nmdc:mga08y16_38458_c1
2352 nmdc:mga08y16_387053_c1
2353 nmdc:mga08y16_48960_c1
2354 nmdc:mga08y16_611_c1
2355 nmdc:mga08y16_628285_c1
2356 nmdc:mga08y16_960088_c1
2357 nmdc:mga0n895_11471_c1
2358 nmdc:mga0n895_136748_c1
2359 nmdc:mga0n895_1825256_c1
2360 nmdc:mga0n895_267989_c1
2361 nmdc:mga0n895_409293_c1
2362 nmdc:mga0n895_5739_c1
2363 nmdc:mga0n895_839248_c1
2364 nmdc:mga0n895_87579_c1
2365 nmdc:mga0n895_916967_c1
2366 nmdc:mga0n895_955191_c1
2367 nmdc:mga0rr50_13165_c1
2368 nmdc:mga0rr50_136685_c1
2369 nmdc:mga0rr50_1904079_c1
2370 nmdc:mga0rr50_290916_c1
2371 nmdc:mga0rr50_3113_c1
2372 nmdc:mga0rr50_33925_c1
2373 nmdc:mga0rr50_980115_c1
2374 nmdc:mga08x19_4710_c1
2375 nmdc:mga0a205_102428_c1
2376 nmdc:mga0a205_1204613_c1
2377 nmdc:mga0a205_265250_c1
2378 nmdc:mga0a205_2970_c1
2379 nmdc:mga0a205_44696_c1
2380 nmdc:mga0a205_46915_c1
2381 nmdc:mga0a205_53372_c1
2382 nmdc:mga0a205_60215_c1
2383 nmdc:mga0a205_962431_c1
2384 nmdc:mga0a205_986_c1
2385 Ga0501084_0284771
2386 Ga0501084_0450578
2387 Ga0590071_070774
2388 Ga0590074_054982
2389 Ga0590075_144421
2390 Ga0590077_024636
2391 Ga0501082_1621217
2392 Ga0530510_1233745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ur3-assembly2.cif.gz_E crystal structure of the pce reductive dehalogenase from s. multivorans p2(1) crystal form 0.5074 5 31
4s2q-assembly1.cif.gz_D crystal structure of hmg domain of the chondrogenesis master regulator, sox9 in complex with chip-seq identified dna element 0.5051 21 78
4ur3-assembly1.cif.gz_A crystal structure of the pce reductive dehalogenase from s. multivorans p2(1) crystal form 0.4846 2 33
4ur0-assembly1.cif.gz_A crystal structure of the pce reductive dehalogenase from s. multivorans in complex with trichloroethene 0.4841 2 33
4ur3-assembly3.cif.gz_D crystal structure of the pce reductive dehalogenase from s. multivorans p2(1) crystal form 0.4838 2 33
ID Description Score Start End Superfamily
af_Q9VHX4_2_327_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8236 1 16 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7644 2 16 3.20.20.100
5dz9A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7022 3 15 2.60.40.740
af_Q61488_199_345_2.170.16.10 Mainly Beta;Beta Complex;Endonuclease - Pi-scei; Chain A, domain 1;Hedgehog/Intein (Hint) domain 0.6947 3 16 2.170.16.10
af_A0A2R8Q2M9_24_199_1.10.555.10 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.6656 23 78 1.10.555.10
ID Description Score Start End GO Terms
AF-A0A3D4FPW9-F1-model_v4 Uncharacterized protein 0.9811 4 89
AF-A0A2V8BHK7-F1-model_v4 Uncharacterized protein 0.9773 4 77
AF-A0A1E3YD93-F1-model_v4 Uncharacterized protein 0.9724 4 87
AF-A0A317HFK6-F1-model_v4 Uncharacterized protein 0.9568 4 64
AF-A0A2V8BHK7-F1-model_v4 Uncharacterized protein 0.94 4 77

Map