F491487

General Info

Members Datasets Scaffolds Average Seq Length
1193 447 1192 114

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1003693|Ga0265337_10036933
Length 97
Sequence MNATVAELWPYLLLILVGYLPNEMWRMLGLVLARGLNEDSEIVVWSRAVATAIIAGLFAAGAAVCGFLAFLAVKRSVFVGVLVGEAVLLLGGYLFAH

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
151 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
152 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
153 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
154 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
155 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
156 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
175 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
257 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
259 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
260 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
272 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
273 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
274 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
275 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
276 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
277 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
278 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
279 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
280 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
281 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
282 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
283 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
284 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
285 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
286 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
288 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
289 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
290 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
291 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
295 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
300 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
301 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
317 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
346 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
347 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
405 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
406 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
407 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
408 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
411 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
412 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
413 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
414 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
422 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
440 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
441 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
442 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
443 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
444 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
445 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
446 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.08
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 6.54
Rhizosphere 91.28
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_285774 2162886011 Unclassified 824
2 MBSR1b_contig_13052938 2162886012 Unclassified 822
3 MBSR1b_contig_1596674 2162886012 Unclassified 824
4 2214628271 2209111006 Bacteria 5118
5 ARSoilYngRDRAFT_c00203 3300000042 Bacteria 9939
6 ARcpr5yngRDRAFT_c000031 3300000043 Bacteria 23285
7 ARSoilOldRDRAFT_c000027 3300000044 Bacteria 33288
8 ARCol0oldRDRAFT_c00076 3300000045 Bacteria 8189
9 ARCol0yngRDRAFT_1000016 3300000652 Bacteria 31710
10 JGI24752J21851_1013836 3300001976 Bacteria 1052
11 JGI24746J21847_1000923 3300001977 Bacteria 4595
12 JGI24747J21853_1007884 3300001978 Bacteria 1032
13 JGI24740J21852_10054506 3300001979 Bacteria 1129
14 JGI24739J22299_10040565 3300001989 Bacteria 1553
15 JGI24737J22298_10002170 3300001990 Bacteria 6993
16 JGI24737J22298_10008902 3300001990 Bacteria 3349
17 JGI24737J22298_10011120 3300001990 Bacteria 2954
18 JGI24737J22298_10012710 3300001990 Bacteria 2744
19 JGI24743J22301_10004801 3300001991 Bacteria 2223
20 JGI24750J21931_1001342 3300002070 Bacteria 3089
21 JGI24745J21846_1000152 3300002073 Bacteria 5479
22 JGI24748J21848_1002289 3300002074 Bacteria 2149
23 JGI24738J21930_10000909 3300002075 Bacteria 8517
24 JGI24749J21850_1007700 3300002076 Bacteria 1501
25 JGI24744J21845_10002614 3300002077 Bacteria 3681
26 JGI24744J21845_10002742 3300002077 Bacteria 3596
27 JGI24035J26624_1000140 3300002126 Bacteria 6418
28 JGI24033J26618_1000697 3300002155 Bacteria 3216
29 JGI24034J26672_10000370 3300002239 Bacteria 5834
30 JGI24742J22300_10021793 3300002244 Bacteria 1095
31 JGI24751J29686_10025837 3300002459 Unclassified 1218
32 JGI24751J29686_10052399 3300002459 Bacteria 841
33 JGI25165J46597_1054094 3300003214 Bacteria 514
34 JGI25405J52794_10012841 3300003911 Bacteria 1619
35 Ga0065716_1002003 3300005277 Bacteria 2486
36 Ga0065714_10229778 3300005288 Unclassified 819
37 Ga0065714_10366413 3300005288 Unclassified 620
38 Ga0065704_10004924 3300005289 Bacteria 4201
39 Ga0065712_10004249 3300005290 Bacteria 5140
40 Ga0065712_10069903 3300005290 Bacteria 6531
41 Ga0065712_10084253 3300005290 Bacteria 2779
42 Ga0065715_10005783 3300005293 Bacteria 5336
43 Ga0065715_10090726 3300005293 Bacteria 6563
44 Ga0065715_10193889 3300005293 Bacteria 1399
45 Ga0065715_10638147 3300005293 Unclassified 685
46 Ga0065707_10182513 3300005295 Unclassified 1409
47 Ga0065707_10632563 3300005295 Bacteria 673
48 Ga0070658_10003716 3300005327 Bacteria 12485
49 Ga0070658_10090733 3300005327 Bacteria 2518
50 Ga0070676_10207069 3300005328 Bacteria 1289
51 Ga0070676_10650819 3300005328 Unclassified 765
52 Ga0070683_100016231 3300005329 Bacteria 6561
53 Ga0070683_100079030 3300005329 Bacteria 3078
54 Ga0070690_100000972 3300005330 Bacteria 14582
55 Ga0070690_100031108 3300005330 Bacteria 3322
56 Ga0070690_100111001 3300005330 Bacteria 1830
57 Ga0070690_100360277 3300005330 Bacteria 1058
58 Ga0070670_100043184 3300005331 Bacteria 3876
59 Ga0070670_100318698 3300005331 Unclassified 1362
60 Ga0070677_10489080 3300005333 Bacteria 665
61 Ga0068869_100028165 3300005334 Bacteria 3923
62 Ga0068869_101212690 3300005334 Bacteria 663
63 Ga0070666_10029587 3300005335 Bacteria 3602
64 Ga0070666_10065487 3300005335 Bacteria 2466
65 Ga0070666_10131394 3300005335 Bacteria 1740
66 Ga0070666_10291177 3300005335 Bacteria 1162
67 Ga0070680_100013055 3300005336 Bacteria 6466
68 Ga0070680_100072254 3300005336 Bacteria 2835
69 Ga0070680_100266293 3300005336 Unclassified 1450
70 Ga0070680_100424387 3300005336 Bacteria 1134
71 Ga0070680_101492006 3300005336 Unclassified 586
72 Ga0070682_100022243 3300005337 Bacteria 3753
73 Ga0070682_100023896 3300005337 Bacteria 3632
74 Ga0070682_100065660 3300005337 Bacteria 2306
75 Ga0070682_100500616 3300005337 Bacteria 941
76 Ga0070682_101670143 3300005337 Unclassified 552
77 Ga0068868_100000287 3300005338 Bacteria 33828
78 Ga0068868_100843474 3300005338 Bacteria 830
79 Ga0070660_100011348 3300005339 Bacteria 6325
80 Ga0070660_100095616 3300005339 Bacteria 2348
81 Ga0070660_100165868 3300005339 Bacteria 1782
82 Ga0070689_100009382 3300005340 Bacteria 6935
83 Ga0070689_100028894 3300005340 Bacteria 4193
84 Ga0070689_100069911 3300005340 Bacteria 2740
85 Ga0070691_10007546 3300005341 Bacteria 4986
86 Ga0070691_10050476 3300005341 Bacteria 1985
87 Ga0070691_10112563 3300005341 Bacteria 1363
88 Ga0070687_100006226 3300005343 Bacteria 4880
89 Ga0070687_100038674 3300005343 Bacteria 2393
90 Ga0070661_100014754 3300005344 Bacteria 5510
91 Ga0070661_100483606 3300005344 Bacteria 989
92 Ga0070661_100558317 3300005344 Unclassified 922
93 Ga0070661_101815228 3300005344 Unclassified 518
94 Ga0070661_101897387 3300005344 Unclassified 506
95 Ga0070692_10003049 3300005345 Bacteria 6691
96 Ga0070692_10010883 3300005345 Bacteria 4160
97 Ga0070668_100072639 3300005347 Bacteria 2681
98 Ga0070669_100005691 3300005353 Bacteria 8989
99 Ga0070669_100018258 3300005353 Bacteria 5011
100 Ga0070675_100051571 3300005354 Bacteria 3381
101 Ga0070671_100033279 3300005355 Bacteria 4262
102 Ga0070671_100103035 3300005355 Bacteria 2394
103 Ga0070671_100157443 3300005355 Bacteria 1919
104 Ga0070671_100355244 3300005355 Bacteria 1251
105 Ga0070671_101045041 3300005355 Bacteria 716
106 Ga0070674_100056194 3300005356 Bacteria 2729
107 Ga0070674_100716276 3300005356 Bacteria 857
108 Ga0070673_100014645 3300005364 Bacteria 5473
109 Ga0070673_100483252 3300005364 Unclassified 1118
110 Ga0070688_100001436 3300005365 Bacteria 11847
111 Ga0070688_100008580 3300005365 Bacteria 5557
112 Ga0070688_100205308 3300005365 Unclassified 1381
113 Ga0070688_100351961 3300005365 Bacteria 1078
114 Ga0070659_100015882 3300005366 Bacteria 5647
115 Ga0070659_100059083 3300005366 Bacteria 3027
116 Ga0070659_101805771 3300005366 Unclassified 548
117 Ga0070667_100009541 3300005367 Bacteria 8047
118 Ga0070667_100060283 3300005367 Bacteria 3211
119 Ga0070667_100074742 3300005367 Bacteria 2891
120 Ga0070667_100527864 3300005367 Bacteria 1083
121 Ga0070667_101421973 3300005367 Unclassified 651
122 Ga0070703_10010153 3300005406 Bacteria 2655
123 Ga0070703_10145990 3300005406 Unclassified 884
124 Ga0070709_10029359 3300005434 Bacteria 3289
125 Ga0070709_10195406 3300005434 Bacteria 1430
126 Ga0070709_10235293 3300005434 Bacteria 1313
127 Ga0070709_10435526 3300005434 Bacteria 985
128 Ga0070714_100039918 3300005435 Bacteria 3955
129 Ga0070714_100619081 3300005435 Bacteria 1041
130 Ga0070713_100039180 3300005436 Bacteria 3844
131 Ga0070713_100045425 3300005436 Bacteria 3599
132 Ga0070713_100125089 3300005436 Bacteria 2260
133 Ga0070713_101539077 3300005436 Bacteria 645
134 Ga0070710_10015364 3300005437 Bacteria 3874
135 Ga0070710_10030570 3300005437 Bacteria 2899
136 Ga0070710_10056697 3300005437 Bacteria 2217
137 Ga0070710_10285132 3300005437 Bacteria 1073
138 Ga0070701_10001244 3300005438 Bacteria 9340
139 Ga0070701_10253876 3300005438 Bacteria 1063
140 Ga0070711_100019451 3300005439 Bacteria 4356
141 Ga0070711_100030277 3300005439 Bacteria 3581
142 Ga0070711_100674457 3300005439 Bacteria 868
143 Ga0070705_100033813 3300005440 Bacteria 2853
144 Ga0070705_100414548 3300005440 Bacteria 1001
145 Ga0070700_100014256 3300005441 Bacteria 4484
146 Ga0070694_100003715 3300005444 Bacteria 9100
147 Ga0070694_100057360 3300005444 Bacteria 2647
148 Ga0070694_101723693 3300005444 Unclassified 533
149 Ga0070708_100196674 3300005445 Bacteria 1886
150 Ga0070663_100007417 3300005455 Bacteria 6674
151 Ga0070663_100022554 3300005455 Bacteria 4210
152 Ga0070663_100084684 3300005455 Bacteria 2338
153 Ga0070663_100088886 3300005455 Bacteria 2285
154 Ga0070678_100004742 3300005456 Bacteria 7750
155 Ga0070678_100005474 3300005456 Bacteria 7346
156 Ga0070678_100119811 3300005456 Bacteria 2073
157 Ga0070662_100003647 3300005457 Bacteria 9612
158 Ga0070662_100040160 3300005457 Bacteria 3330
159 Ga0070662_100222516 3300005457 Unclassified 1506
160 Ga0070662_100652425 3300005457 Unclassified 888
161 Ga0070681_10018191 3300005458 Bacteria 7026
162 Ga0070681_10061315 3300005458 Bacteria 3736
163 Ga0070681_10236909 3300005458 Bacteria 1739
164 Ga0070681_10261025 3300005458 Bacteria 1644
165 Ga0068867_100029242 3300005459 Bacteria 3969
166 Ga0070685_10001963 3300005466 Bacteria 10678
167 Ga0070685_10147789 3300005466 Bacteria 1486
168 Ga0070685_11377201 3300005466 Bacteria 541
169 Ga0070706_100990111 3300005467 Unclassified 775
170 Ga0070707_100210734 3300005468 Bacteria 1894
171 Ga0070698_100594422 3300005471 Bacteria 1047
172 Ga0070699_100400899 3300005518 Unclassified 1240
173 Ga0070679_100109176 3300005530 Bacteria 2753
174 Ga0070679_100276893 3300005530 Bacteria 1631
175 Ga0070679_100332100 3300005530 Unclassified 1469
176 Ga0070679_100786135 3300005530 Unclassified 895
177 Ga0070679_101486148 3300005530 Unclassified 624
178 Ga0070684_100075913 3300005535 Bacteria 2965
179 Ga0070684_100267070 3300005535 Bacteria 1566
180 Ga0068853_100033477 3300005539 Bacteria 4361
181 Ga0068853_100053869 3300005539 Bacteria 3465
182 Ga0068853_100808694 3300005539 Bacteria 898
183 Ga0068853_101827818 3300005539 Unclassified 589
184 Ga0070672_100008973 3300005543 Bacteria 6873
185 Ga0070672_100267355 3300005543 Bacteria 1443
186 Ga0070672_100920927 3300005543 Unclassified 773
187 Ga0070686_100031841 3300005544 Bacteria 3228
188 Ga0070686_100038220 3300005544 Bacteria 2982
189 Ga0070686_100157183 3300005544 Bacteria 1598
190 Ga0070695_100035975 3300005545 Bacteria 3114
191 Ga0070695_100312777 3300005545 Bacteria 1165
192 Ga0070695_100357507 3300005545 Bacteria 1096
193 Ga0070696_100006672 3300005546 Bacteria 7710
194 Ga0070696_100012420 3300005546 Bacteria 5713
195 Ga0070696_100110438 3300005546 Bacteria 1980
196 Ga0070696_100200076 3300005546 Bacteria 1491
197 Ga0070693_100003566 3300005547 Bacteria 7261
198 Ga0070693_100076865 3300005547 Bacteria 1980
199 Ga0070693_100363275 3300005547 Unclassified 994
200 Ga0070693_100688940 3300005547 Bacteria 747
201 Ga0070693_100962907 3300005547 Unclassified 643
202 Ga0070693_101347088 3300005547 Bacteria 553
203 Ga0070665_100014185 3300005548 Bacteria 8007
204 Ga0070665_100353780 3300005548 Bacteria 1474
205 Ga0070665_101573946 3300005548 Unclassified 665
206 Ga0070704_100003927 3300005549 Bacteria 8561
207 Ga0068855_100031527 3300005563 Bacteria 6330
208 Ga0068855_100082168 3300005563 Bacteria 3734
209 Ga0068855_100476596 3300005563 Bacteria 1359
210 Ga0070664_100022768 3300005564 Bacteria 5168
211 Ga0070664_100071700 3300005564 Bacteria 2969
212 Ga0070664_100090054 3300005564 Bacteria 2655
213 Ga0070664_100191277 3300005564 Bacteria 1823
214 Ga0070664_100598642 3300005564 Bacteria 1022
215 Ga0070664_100867217 3300005564 Bacteria 846
216 Ga0068857_100006630 3300005577 Bacteria 9945
217 Ga0068857_100124888 3300005577 Bacteria 2318
218 Ga0068854_100056497 3300005578 Bacteria 2829
219 Ga0068854_100519143 3300005578 Bacteria 1006
220 Ga0068854_101354872 3300005578 Bacteria 642
221 Ga0068856_100037685 3300005614 Bacteria 4745
222 Ga0068856_100067110 3300005614 Bacteria 3545
223 Ga0068856_100753658 3300005614 Bacteria 994
224 Ga0070702_100099648 3300005615 Bacteria 1780
225 Ga0070702_100135159 3300005615 Bacteria 1563
226 Ga0070702_100274712 3300005615 Bacteria 1154
227 Ga0068852_100010452 3300005616 Bacteria 6939
228 Ga0068852_100332252 3300005616 Bacteria 1479
229 Ga0068852_102443610 3300005616 Bacteria 543
230 Ga0068859_100054633 3300005617 Bacteria 4017
231 Ga0068859_100079592 3300005617 Bacteria 3317
232 Ga0068864_100026602 3300005618 Bacteria 4879
233 Ga0068864_100502107 3300005618 Bacteria 1167
234 Ga0068864_101241574 3300005618 Bacteria 744
235 Ga0068866_10007526 3300005718 Bacteria 4563
236 Ga0068866_10328552 3300005718 Unclassified 964
237 Ga0068861_100007303 3300005719 Bacteria 7572
238 Ga0068861_100070066 3300005719 Bacteria 2715
239 Ga0068851_10298156 3300005834 Bacteria 926
240 Ga0068851_10589823 3300005834 Unclassified 675
241 Ga0068870_10007593 3300005840 Bacteria 4846
242 Ga0068863_100352022 3300005841 Bacteria 1434
243 Ga0068863_100580920 3300005841 Bacteria 1108
244 Ga0068863_101309895 3300005841 Unclassified 731
245 Ga0068858_100064184 3300005842 Bacteria 3398
246 Ga0068858_100276517 3300005842 Bacteria 1598
247 Ga0068858_100926117 3300005842 Bacteria 853
248 Ga0068858_101550702 3300005842 Bacteria 653
249 Ga0068860_100015452 3300005843 Bacteria 7455
250 Ga0068860_100028463 3300005843 Bacteria 5378
251 Ga0068860_100320286 3300005843 Bacteria 1522
252 Ga0068860_100451261 3300005843 Bacteria 1278
253 Ga0068860_101232334 3300005843 Unclassified 769
254 Ga0068862_100015822 3300005844 Bacteria 6267
255 Ga0068862_100025065 3300005844 Bacteria 5006
256 Ga0068862_100275368 3300005844 Bacteria 1540
257 Ga0081455_10000009 3300005937 Bacteria 249885
258 Ga0081455_10006976 3300005937 Bacteria 12004
259 Ga0081455_10123738 3300005937 Bacteria 2034
260 Ga0081538_10041429 3300005981 Bacteria 2923
261 Ga0070717_10056737 3300006028 Bacteria 3237
262 Ga0070717_10063805 3300006028 Bacteria 3059
263 Ga0075363_100073902 3300006048 Unclassified 1855
264 Ga0075432_10103079 3300006058 Unclassified 1056
265 Ga0070715_10011857 3300006163 Bacteria 3152
266 Ga0070715_10014758 3300006163 Bacteria 2901
267 Ga0070715_10495614 3300006163 Bacteria 698
268 Ga0070716_100009019 3300006173 Bacteria 4963
269 Ga0070716_100373485 3300006173 Bacteria 1017
270 Ga0070716_100406354 3300006173 Bacteria 981
271 Ga0070712_100183986 3300006175 Bacteria 1630
272 Ga0070712_100315604 3300006175 Bacteria 1270
273 Ga0070712_100381749 3300006175 Bacteria 1160
274 Ga0070712_101613176 3300006175 Bacteria 567
275 Ga0075367_10063419 3300006178 Bacteria 2209
276 Ga0075367_10906292 3300006178 Unclassified 562
277 Ga0075427_10003835 3300006194 Bacteria 2098
278 Ga0097621_100000616 3300006237 Bacteria 25167
279 Ga0097621_100008744 3300006237 Bacteria 7316
280 Ga0097621_100030924 3300006237 Bacteria 4242
281 Ga0097621_100180771 3300006237 Bacteria 1822
282 Ga0075370_10532323 3300006353 Unclassified 710
283 Ga0068871_100000922 3300006358 Bacteria 19615
284 Ga0068871_100027615 3300006358 Bacteria 4440
285 Ga0075428_100017044 3300006844 Bacteria 8027
286 Ga0075430_100004240 3300006846 Bacteria 12111
287 Ga0075431_100237644 3300006847 Bacteria 1854
288 Ga0075433_10003318 3300006852 Bacteria 12434
289 Ga0075433_10005782 3300006852 Bacteria 9736
290 Ga0075433_10194998 3300006852 Bacteria 1802
291 Ga0075433_10214493 3300006852 Bacteria 1710
292 Ga0075434_100001367 3300006871 Bacteria 20481
293 Ga0075434_100003881 3300006871 Bacteria 13383
294 Ga0075434_100049800 3300006871 Bacteria 4160
295 Ga0075434_100286306 3300006871 Bacteria 1667
296 Ga0075429_100008546 3300006880 Bacteria 8907
297 Ga0068865_100006916 3300006881 Bacteria 6954
298 Ga0068865_100020346 3300006881 Bacteria 4302
299 Ga0068865_100076762 3300006881 Bacteria 2386
300 Ga0068865_100133440 3300006881 Bacteria 1863
301 Ga0075436_100502389 3300006914 Unclassified 887
302 Ga0097620_100054629 3300006931 Bacteria 4017
303 Ga0097620_100079594 3300006931 Bacteria 3317
304 Ga0075435_100068616 3300007076 Bacteria 2889
305 Ga0075435_100090670 3300007076 Bacteria 2521
306 Ga0075435_100334541 3300007076 Unclassified 1297
307 Ga0105251_10022056 3300009011 Bacteria 3315
308 Ga0105251_10332240 3300009011 Unclassified 692
309 Ga0105244_10018443 3300009036 Bacteria 3915
310 Ga0105250_10075208 3300009092 Bacteria 1366
311 Ga0105240_10223606 3300009093 Bacteria 2192
312 Ga0105240_10293420 3300009093 Bacteria 1863
313 Ga0105240_10654969 3300009093 Bacteria 1151
314 Ga0111539_10002796 3300009094 Bacteria 23160
315 Ga0111539_10013373 3300009094 Bacteria 10258
316 Ga0111539_10053737 3300009094 Bacteria 4795
317 Ga0111539_12207483 3300009094 Unclassified 639
318 Ga0105245_10004252 3300009098 Bacteria 12700
319 Ga0105245_10068509 3300009098 Bacteria 3216
320 Ga0105245_10148592 3300009098 Bacteria 2213
321 Ga0105245_10197571 3300009098 Bacteria 1930
322 Ga0105245_10240994 3300009098 Bacteria 1753
323 Ga0105247_10042814 3300009101 Bacteria 2774
324 Ga0105247_10043793 3300009101 Bacteria 2743
325 Ga0105247_10072953 3300009101 Bacteria 2150
326 Ga0105247_10094973 3300009101 Bacteria 1898
327 Ga0105247_10111925 3300009101 Bacteria 1758
328 Ga0114129_10029650 3300009147 Bacteria 7749
329 Ga0114129_10198080 3300009147 Bacteria 2722
330 Ga0114129_11197944 3300009147 Bacteria 946
331 Ga0105243_10016347 3300009148 Bacteria 5614
332 Ga0105243_10018577 3300009148 Bacteria 5269
333 Ga0105243_10019863 3300009148 Bacteria 5096
334 Ga0105243_10111305 3300009148 Bacteria 2292
335 Ga0105241_10021402 3300009174 Bacteria 4780
336 Ga0105241_10048036 3300009174 Bacteria 3246
337 Ga0105241_10212299 3300009174 Bacteria 1622
338 Ga0105242_10045458 3300009176 Bacteria 3559
339 Ga0105242_10177129 3300009176 Bacteria 1878
340 Ga0105242_10532664 3300009176 Bacteria 1123
341 Ga0105248_10034642 3300009177 Bacteria 5648
342 Ga0105248_10035800 3300009177 Bacteria 5553
343 Ga0105248_10110124 3300009177 Bacteria 3105
344 Ga0105248_10323791 3300009177 Bacteria 1736
345 Ga0105248_11449977 3300009177 Bacteria 777
346 Ga0105237_10008357 3300009545 Bacteria 11222
347 Ga0105237_10035386 3300009545 Bacteria 5053
348 Ga0105237_10596307 3300009545 Bacteria 1112
349 Ga0105238_10058732 3300009551 Bacteria 3855
350 Ga0105238_10197036 3300009551 Bacteria 1990
351 Ga0105249_10029412 3300009553 Bacteria 4961
352 Ga0105249_10152330 3300009553 Bacteria 2227
353 Ga0105249_10155472 3300009553 Bacteria 2205
354 Ga0105249_10351895 3300009553 Bacteria 1492
355 Ga0105239_10025073 3300010375 Bacteria 6569
356 Ga0105239_10100256 3300010375 Bacteria 3203
357 Ga0105239_10519024 3300010375 Bacteria 1355
358 Ga0105239_11012542 3300010375 Bacteria 955
359 Ga0105239_12056114 3300010375 Bacteria 663
360 Ga0105239_12551558 3300010375 Bacteria 596
361 Ga0105246_10259260 3300011119 Bacteria 1384
362 Ga0105246_10287281 3300011119 Bacteria 1322
363 Ga0105246_10703456 3300011119 Bacteria 886
364 Ga0105246_11068061 3300011119 Bacteria 735
365 Ga0157344_1003072 3300012476 Unclassified 922
366 Ga0157328_1004315 3300012478 Unclassified 783
367 Ga0157320_1000803 3300012481 Bacteria 1407
368 Ga0157341_1016513 3300012494 Bacteria 689
369 Ga0157341_1026473 3300012494 Unclassified 603
370 Ga0157347_1060145 3300012502 Unclassified 542
371 Ga0157316_1052765 3300012510 Unclassified 566
372 Ga0157338_1000546 3300012515 Bacteria 2290
373 Ga0157373_10007606 3300013100 Bacteria 8052
374 Ga0157373_10497015 3300013100 Bacteria 881
375 Ga0157373_10886556 3300013100 Bacteria 661
376 Ga0157373_11393197 3300013100 Bacteria 533
377 Ga0157371_10038816 3300013102 Bacteria 3406
378 Ga0157370_10032359 3300013104 Bacteria 5107
379 Ga0157370_10055478 3300013104 Bacteria 3774
380 Ga0157370_10843988 3300013104 Bacteria 833
381 Ga0157369_10196398 3300013105 Bacteria 2119
382 Ga0157369_10584456 3300013105 Bacteria 1153
383 Ga0157374_10015848 3300013296 Bacteria 6621
384 Ga0157374_10164647 3300013296 Bacteria 2161
385 Ga0157374_10538424 3300013296 Bacteria 1175
386 Ga0157374_10653901 3300013296 Bacteria 1063
387 Ga0157374_10749949 3300013296 Bacteria 991
388 Ga0157374_10933225 3300013296 Bacteria 886
389 Ga0157378_10007970 3300013297 Bacteria 9246
390 Ga0157378_10032054 3300013297 Bacteria 4642
391 Ga0157378_10429633 3300013297 Bacteria 1307
392 Ga0157378_12902846 3300013297 Unclassified 531
393 Ga0163162_10014117 3300013306 Bacteria 7806
394 Ga0163162_10048102 3300013306 Bacteria 4273
395 Ga0163162_10087113 3300013306 Bacteria 3201
396 Ga0163162_12960581 3300013306 Bacteria 546
397 Ga0157372_12011138 3300013307 Bacteria 664
398 Ga0157375_10017624 3300013308 Bacteria 6449
399 Ga0157375_10060051 3300013308 Bacteria 3769
400 Ga0157375_10281074 3300013308 Bacteria 1827
401 Ga0157375_10397256 3300013308 Bacteria 1545
402 Ga0163163_10001820 3300014325 Bacteria 18002
403 Ga0163163_10369436 3300014325 Bacteria 1491
404 Ga0163163_12469721 3300014325 Unclassified 578
405 Ga0157380_10009315 3300014326 Bacteria 7033
406 Ga0157380_10136692 3300014326 Bacteria 2099
407 Ga0157380_10140795 3300014326 Bacteria 2072
408 Ga0157380_12613610 3300014326 Unclassified 571
409 Ga0157377_10004131 3300014745 Bacteria 6635
410 Ga0157377_10154484 3300014745 Bacteria 1422
411 Ga0157379_10001178 3300014968 Bacteria 21270
412 Ga0157379_10118428 3300014968 Bacteria 2382
413 Ga0157379_10330904 3300014968 Unclassified 1392
414 Ga0157379_10386195 3300014968 Bacteria 1285
415 Ga0157379_10485136 3300014968 Bacteria 1144
416 Ga0157379_10902131 3300014968 Bacteria 838
417 Ga0157376_10007479 3300014969 Bacteria 7804
418 Ga0157376_10067889 3300014969 Bacteria 3017
419 Ga0157376_10195812 3300014969 Bacteria 1856
420 Ga0157376_11216154 3300014969 Bacteria 782
421 Ga0163161_10006785 3300017792 Bacteria 7911
422 Ga0163161_10118150 3300017792 Bacteria 1990
423 Ga0163161_10646958 3300017792 Bacteria 876
424 Ga0206353_10336741 3300020082 Bacteria 981
425 Ga0213876_10225361 3300021384 Bacteria 997
426 Ga0209233_1026909 3300025261 Bacteria 1400
427 Ga0207666_1000090 3300025271 Bacteria 14493
428 Ga0207666_1012978 3300025271 Unclassified 1166
429 Ga0207673_1000112 3300025290 Bacteria 7483
430 Ga0207697_10000579 3300025315 Bacteria 20843
431 Ga0207697_10007823 3300025315 Bacteria 4730
432 Ga0207655_1172023 3300025728 Unclassified 668
433 Ga0207653_10002769 3300025885 Bacteria 5578
434 Ga0207682_10008278 3300025893 Bacteria 4118
435 Ga0207692_10035418 3300025898 Bacteria 2425
436 Ga0207692_10258580 3300025898 Bacteria 1046
437 Ga0207692_10666300 3300025898 Bacteria 673
438 Ga0207642_10051826 3300025899 Bacteria 1859
439 Ga0207642_10205855 3300025899 Bacteria 1090
440 Ga0207642_10918754 3300025899 Unclassified 561
441 Ga0207710_10025350 3300025900 Bacteria 2559
442 Ga0207710_10035930 3300025900 Bacteria 2182
443 Ga0207688_10001006 3300025901 Bacteria 14351
444 Ga0207688_10047793 3300025901 Bacteria 2390
445 Ga0207688_10171790 3300025901 Bacteria 1289
446 Ga0207680_10045487 3300025903 Bacteria 2588
447 Ga0207680_10131226 3300025903 Bacteria 1652
448 Ga0207680_10142652 3300025903 Bacteria 1589
449 Ga0207680_10150354 3300025903 Bacteria 1552
450 Ga0207680_11173183 3300025903 Unclassified 548
451 Ga0207647_10025960 3300025904 Bacteria 3839
452 Ga0207647_10125642 3300025904 Bacteria 1510
453 Ga0207685_10021908 3300025905 Bacteria 2150
454 Ga0207685_10091124 3300025905 Bacteria 1284
455 Ga0207699_10090706 3300025906 Bacteria 1918
456 Ga0207645_10001020 3300025907 Bacteria 23147
457 Ga0207645_10058013 3300025907 Bacteria 2472
458 Ga0207645_10118774 3300025907 Bacteria 1715
459 Ga0207643_10000523 3300025908 Bacteria 24625
460 Ga0207705_10658128 3300025909 Bacteria 814
461 Ga0207684_10245846 3300025910 Unclassified 1544
462 Ga0207654_10047157 3300025911 Bacteria 2461
463 Ga0207654_10069882 3300025911 Bacteria 2083
464 Ga0207707_10018497 3300025912 Bacteria 6073
465 Ga0207707_10046164 3300025912 Bacteria 3793
466 Ga0207707_10059583 3300025912 Bacteria 3322
467 Ga0207707_10061465 3300025912 Bacteria 3268
468 Ga0207695_10321834 3300025913 Bacteria 1436
469 Ga0207695_10361672 3300025913 Bacteria 1338
470 Ga0207671_10113380 3300025914 Bacteria 2065
471 Ga0207671_10702584 3300025914 Bacteria 804
472 Ga0207693_10008072 3300025915 Bacteria 8632
473 Ga0207693_10053468 3300025915 Bacteria 3168
474 Ga0207693_10242740 3300025915 Bacteria 1414
475 Ga0207663_10056960 3300025916 Bacteria 2461
476 Ga0207663_10109844 3300025916 Bacteria 1869
477 Ga0207663_10584502 3300025916 Bacteria 876
478 Ga0207660_10014892 3300025917 Bacteria 5126
479 Ga0207660_10072595 3300025917 Bacteria 2507
480 Ga0207660_10154346 3300025917 Bacteria 1766
481 Ga0207660_10223267 3300025917 Bacteria 1479
482 Ga0207660_10349925 3300025917 Unclassified 1184
483 Ga0207662_10002710 3300025918 Bacteria 8938
484 Ga0207662_10045130 3300025918 Bacteria 2605
485 Ga0207657_10005692 3300025919 Bacteria 13002
486 Ga0207657_10019627 3300025919 Bacteria 6411
487 Ga0207657_10218444 3300025919 Bacteria 1528
488 Ga0207657_10346682 3300025919 Bacteria 1172
489 Ga0207657_10784052 3300025919 Bacteria 737
490 Ga0207649_10004225 3300025920 Bacteria 7828
491 Ga0207649_10414858 3300025920 Bacteria 1010
492 Ga0207652_10018458 3300025921 Bacteria 5722
493 Ga0207652_10069144 3300025921 Bacteria 3065
494 Ga0207652_10169410 3300025921 Bacteria 1959
495 Ga0207652_10180024 3300025921 Bacteria 1899
496 Ga0207652_10187627 3300025921 Bacteria 1859
497 Ga0207652_10191472 3300025921 Bacteria 1840
498 Ga0207652_10238457 3300025921 Bacteria 1639
499 Ga0207681_10004280 3300025923 Bacteria 8810
500 Ga0207681_10048111 3300025923 Bacteria 2877
501 Ga0207694_10170903 3300025924 Bacteria 1760
502 Ga0207650_10003662 3300025925 Bacteria 10511
503 Ga0207650_10107215 3300025925 Bacteria 2158
504 Ga0207659_10002130 3300025926 Bacteria 11734
505 Ga0207659_10266340 3300025926 Unclassified 1396
506 Ga0207659_11261056 3300025926 Bacteria 635
507 Ga0207687_10010078 3300025927 Bacteria 6180
508 Ga0207687_10051449 3300025927 Bacteria 2872
509 Ga0207700_10051330 3300025928 Bacteria 3078
510 Ga0207700_10107794 3300025928 Bacteria 2235
511 Ga0207700_10394305 3300025928 Bacteria 1212
512 Ga0207700_11221199 3300025928 Bacteria 671
513 Ga0207664_10014304 3300025929 Bacteria 5726
514 Ga0207664_10256980 3300025929 Bacteria 1526
515 Ga0207644_10006560 3300025931 Bacteria 7582
516 Ga0207644_10046794 3300025931 Bacteria 3083
517 Ga0207644_10417776 3300025931 Bacteria 1098
518 Ga0207690_10003881 3300025932 Bacteria 8837
519 Ga0207690_10077141 3300025932 Bacteria 2316
520 Ga0207690_10082766 3300025932 Bacteria 2245
521 Ga0207690_10262440 3300025932 Bacteria 1339
522 Ga0207706_10004561 3300025933 Bacteria 13002
523 Ga0207706_10057842 3300025933 Bacteria 3416
524 Ga0207706_10118814 3300025933 Bacteria 2325
525 Ga0207686_10002841 3300025934 Bacteria 9345
526 Ga0207686_10032302 3300025934 Bacteria 3115
527 Ga0207686_10075927 3300025934 Bacteria 2177
528 Ga0207686_10084799 3300025934 Bacteria 2076
529 Ga0207709_10003952 3300025935 Bacteria 8652
530 Ga0207709_10476299 3300025935 Unclassified 970
531 Ga0207709_10906584 3300025935 Bacteria 717
532 Ga0207670_10020819 3300025936 Bacteria 4036
533 Ga0207670_10217665 3300025936 Bacteria 1460
534 Ga0207670_10348513 3300025936 Unclassified 1172
535 Ga0207669_10000737 3300025937 Bacteria 14194
536 Ga0207669_10052926 3300025937 Bacteria 2442
537 Ga0207669_10603744 3300025937 Bacteria 892
538 Ga0207704_10209749 3300025938 Bacteria 1433
539 Ga0207704_10265516 3300025938 Bacteria 1296
540 Ga0207665_10005721 3300025939 Bacteria 8278
541 Ga0207665_10381703 3300025939 Bacteria 1069
542 Ga0207665_10434307 3300025939 Bacteria 1005
543 Ga0207691_10004854 3300025940 Bacteria 13002
544 Ga0207691_10486974 3300025940 Bacteria 1048
545 Ga0207711_10009494 3300025941 Bacteria 8117
546 Ga0207711_10073214 3300025941 Bacteria 2977
547 Ga0207711_10127495 3300025941 Bacteria 2278
548 Ga0207711_10129249 3300025941 Bacteria 2263
549 Ga0207689_10001399 3300025942 Bacteria 23007
550 Ga0207689_10516693 3300025942 Bacteria 1001
551 Ga0207689_10722718 3300025942 Bacteria 840
552 Ga0207689_10823707 3300025942 Unclassified 783
553 Ga0207661_10020336 3300025944 Bacteria 4961
554 Ga0207661_12143474 3300025944 Bacteria 505
555 Ga0207679_10000829 3300025945 Bacteria 19882
556 Ga0207679_10071037 3300025945 Bacteria 2625
557 Ga0207679_10364537 3300025945 Bacteria 1263
558 Ga0207679_10440271 3300025945 Bacteria 1154
559 Ga0207679_10463020 3300025945 Bacteria 1126
560 Ga0207679_10753055 3300025945 Bacteria 886
561 Ga0207667_10057202 3300025949 Bacteria 4094
562 Ga0207667_10121124 3300025949 Bacteria 2696
563 Ga0207667_10934397 3300025949 Bacteria 857
564 Ga0207651_10006082 3300025960 Bacteria 6273
565 Ga0207651_10111984 3300025960 Bacteria 2051
566 Ga0207651_10147297 3300025960 Bacteria 1828
567 Ga0207712_10052478 3300025961 Bacteria 2856
568 Ga0207712_10180598 3300025961 Bacteria 1657
569 Ga0207712_10576067 3300025961 Bacteria 971
570 Ga0207668_10002780 3300025972 Bacteria 10231
571 Ga0207668_10059050 3300025972 Bacteria 2685
572 Ga0207668_10265978 3300025972 Bacteria 1400
573 Ga0207640_10003641 3300025981 Bacteria 8308
574 Ga0207640_10076366 3300025981 Bacteria 2274
575 Ga0207640_10855539 3300025981 Bacteria 791
576 Ga0207658_10014267 3300025986 Bacteria 5440
577 Ga0207658_10052210 3300025986 Bacteria 3016
578 Ga0207658_10652374 3300025986 Bacteria 949
579 Ga0207658_10889762 3300025986 Unclassified 810
580 Ga0207677_10092877 3300026023 Bacteria 2198
581 Ga0207677_10936077 3300026023 Bacteria 783
582 Ga0207703_10005080 3300026035 Bacteria 10642
583 Ga0207703_11103410 3300026035 Bacteria 762
584 Ga0207639_10036135 3300026041 Bacteria 3659
585 Ga0207639_10065082 3300026041 Bacteria 2829
586 Ga0207678_10001694 3300026067 Bacteria 20208
587 Ga0207678_10012983 3300026067 Bacteria 7311
588 Ga0207678_10109778 3300026067 Bacteria 2353
589 Ga0207678_10120447 3300026067 Bacteria 2239
590 Ga0207708_10003453 3300026075 Bacteria 11648
591 Ga0207708_10022048 3300026075 Bacteria 4808
592 Ga0207702_10010469 3300026078 Bacteria 7756
593 Ga0207702_10613610 3300026078 Bacteria 1068
594 Ga0207648_10002393 3300026089 Bacteria 20202
595 Ga0207648_10050827 3300026089 Bacteria 3624
596 Ga0207676_10005110 3300026095 Bacteria 9289
597 Ga0207676_10118340 3300026095 Bacteria 2229
598 Ga0207676_11007531 3300026095 Bacteria 821
599 Ga0207674_10058986 3300026116 Bacteria 3885
600 Ga0207674_10832128 3300026116 Bacteria 890
601 Ga0207674_10881694 3300026116 Bacteria 862
602 Ga0207675_100001715 3300026118 Bacteria 21956
603 Ga0207675_100057767 3300026118 Bacteria 3620
604 Ga0207675_100236665 3300026118 Bacteria 1763
605 Ga0207675_100612320 3300026118 Bacteria 1093
606 Ga0207683_10001190 3300026121 Bacteria 23550
607 Ga0207683_10013747 3300026121 Bacteria 6900
608 Ga0207683_10028744 3300026121 Bacteria 4809
609 Ga0207698_10370313 3300026142 Bacteria 1359
610 Ga0207698_11224391 3300026142 Bacteria 765
611 Ga0209999_1036586 3300027543 Unclassified 917
612 Ga0209982_1004172 3300027552 Bacteria 2066
613 Ga0209970_1016555 3300027614 Bacteria 1230
614 Ga0210002_1000122 3300027617 Bacteria 12125
615 Ga0209983_1017838 3300027665 Bacteria 1471
616 Ga0209971_1009205 3300027682 Bacteria 2341
617 Ga0209966_1000667 3300027695 Bacteria 7572
618 Ga0209998_10001805 3300027717 Bacteria 5066
619 Ga0209998_10007762 3300027717 Bacteria 2227
620 Ga0209974_10000486 3300027876 Bacteria 13249
621 Ga0209974_10036353 3300027876 Bacteria 1636
622 Ga0207428_10000216 3300027907 Bacteria 79777
623 Ga0207428_10001434 3300027907 Bacteria 25064
624 Ga0207428_10019935 3300027907 Bacteria 5711
625 Ga0268266_10016607 3300028379 Bacteria 6291
626 Ga0268266_10089573 3300028379 Bacteria 2694
627 Ga0268266_11861489 3300028379 Unclassified 576
628 Ga0268265_10068406 3300028380 Bacteria 2753
629 Ga0268265_10430445 3300028380 Bacteria 1227
630 Ga0268264_10009868 3300028381 Bacteria 7903
631 Ga0268264_10037830 3300028381 Bacteria 3980
632 Ga0268264_10551602 3300028381 Bacteria 1130
633 Ga0265337_1003693 3300028556 Bacteria 6551
634 Ga0265318_10187235 3300028577 Bacteria 758
635 Ga0265318_10273465 3300028577 Bacteria 616
636 Ga0265338_10134384 3300028800 Bacteria 1948
637 Ga0265330_10020395 3300031235 Bacteria 3029
638 Ga0265325_10000048 3300031241 Bacteria 82899
639 Ga0265325_10025252 3300031241 Bacteria 3227
640 Ga0265325_10048132 3300031241 Bacteria 2205
641 Ga0265340_10020827 3300031247 Bacteria 3365
642 Ga0265340_10237127 3300031247 Unclassified 814
643 Ga0265339_10150552 3300031249 Unclassified 1177
644 Ga0265331_10009513 3300031250 Bacteria 5451
645 Ga0265316_10200564 3300031344 Bacteria 1479
646 Ga0265316_10258928 3300031344 Bacteria 1276
647 Ga0265313_10028748 3300031595 Bacteria 2885
648 Ga0265313_10139333 3300031595 Bacteria 1044
649 Ga0316575_10024682 3300031665 Bacteria 2329
650 Ga0265314_10004264 3300031711 Bacteria 13384
651 Ga0265314_10005957 3300031711 Bacteria 10889
652 Ga0307406_10475704 3300031901 Bacteria 1008
653 Ga0307416_101198459 3300032002 Bacteria 865
654 Ga0307415_100480274 3300032126 Bacteria 1082
655 Ga0373930_0015286 3300034816 Bacteria 1440
656 Ga0373930_0032077 3300034816 Bacteria 1086
657 Ga0373930_0033680 3300034816 Bacteria 1065
658 Ga0373930_0038718 3300034816 Unclassified 1008
659 Ga0373948_0000410 3300034817 Bacteria 5285
660 Ga0373948_0217720 3300034817 Unclassified 504
661 Ga0373950_0000808 3300034818 Bacteria 3923
662 Ga0373950_0036772 3300034818 Bacteria 925
663 Ga0373958_0001617 3300034819 Bacteria 3052
664 Ga0373958_0004911 3300034819 Bacteria 2003
665 Ga0373958_0068004 3300034819 Bacteria 785
666 Ga0373958_0080361 3300034819 Bacteria 737
667 Ga0373959_0070654 3300034820 Bacteria 789
668 Ga0373938_0000681 3300034957 Bacteria 5463
669 Ga0373926_0021412 3300035083 Bacteria 2239
670 Ga0373926_0065910 3300035083 Bacteria 1325
671 Ga0373928_0004171 3300035084 Bacteria 2754
672 Ga0373928_0005886 3300035084 Bacteria 2345
673 Ga0373928_0068112 3300035084 Bacteria 874
674 Ga0373928_0157390 3300035084 Bacteria 633
675 Ga0373929_0001045 3300035085 Bacteria 5365
676 Ga0373929_0015912 3300035085 Bacteria 1468
677 Ga0373929_0211754 3300035085 Bacteria 547
678 Ga0373934_0068557 3300035086 Bacteria 1417
679 Ga0373934_0071466 3300035086 Bacteria 1388
680 Ga0373934_0168069 3300035086 Bacteria 900
681 Ga0373940_0000034 3300035088 Bacteria 14984
682 Ga0373940_0001993 3300035088 Bacteria 3864
683 Ga0373940_0157104 3300035088 Bacteria 728
684 Ga0373944_0019469 3300035089 Bacteria 1948
685 Ga0373949_0001494 3300035090 Bacteria 6649
686 Ga0373949_0023580 3300035090 Bacteria 1426
687 Ga0373949_0040187 3300035090 Bacteria 1147
688 Ga0373949_0268000 3300035090 Unclassified 533
689 Ga0373949_0297125 3300035090 Unclassified 511
690 Ga0373951_0006292 3300035091 Bacteria 2716
691 Ga0373951_0006726 3300035091 Bacteria 2625
692 Ga0373951_0019160 3300035091 Bacteria 1558
693 Ga0373952_0000499 3300035092 Bacteria 6828
694 Ga0373952_0026576 3300035092 Bacteria 1258
695 Ga0373952_0031323 3300035092 Bacteria 1182
696 Ga0373923_0035431 3300035111 Bacteria 2032
697 Ga0373923_0127098 3300035111 Unclassified 1143
698 Ga0373923_0181010 3300035111 Bacteria 968
699 Ga0373932_0000153 3300035112 Bacteria 19891
700 Ga0373932_0003391 3300035112 Bacteria 3838
701 Ga0373939_0000182 3300035114 Bacteria 17440
702 Ga0373939_0001329 3300035114 Bacteria 6003
703 Ga0373939_0002892 3300035114 Bacteria 4035
704 Ga0373939_0058772 3300035114 Bacteria 1217
705 Ga0373939_0143332 3300035114 Unclassified 863
706 Ga0373941_0000351 3300035115 Bacteria 9066
707 Ga0373941_0004347 3300035115 Bacteria 3266
708 Ga0373941_0064242 3300035115 Unclassified 1202
709 Ga0373941_0180985 3300035115 Bacteria 791
710 Ga0373945_0049929 3300035116 Bacteria 1536
711 Ga0373945_0107321 3300035116 Bacteria 1098
712 Ga0373953_0010294 3300035117 Bacteria 3250
713 Ga0373954_0027838 3300035118 Bacteria 2596
714 Ga0373954_0253155 3300035118 Bacteria 867
715 Ga0373956_0007365 3300035119 Bacteria 4430
716 Ga0373956_0022400 3300035119 Bacteria 2703
717 Ga0373956_0123625 3300035119 Bacteria 1209
718 Ga0373956_0156836 3300035119 Bacteria 1072
719 Ga0373957_0031423 3300035120 Bacteria 1951
720 Ga0373957_0054574 3300035120 Bacteria 1535
721 Ga0373957_0147804 3300035120 Bacteria 963
722 Ga0373960_0000322 3300035121 Bacteria 9091
723 Ga0373960_0062962 3300035121 Bacteria 1129
724 Ga0373960_0250675 3300035121 Unclassified 643
725 Ga0373943_0005045 3300035170 Bacteria 5955
726 Ga0373943_0935381 3300035170 Bacteria 518
727 Ga0373946_0007767 3300035171 Bacteria 3934
728 Ga0373946_0197285 3300035171 Bacteria 962
729 Ga0373955_0003725 3300035172 Bacteria 6712
730 Ga0373955_0009409 3300035172 Bacteria 4571
731 Ga0373955_0036131 3300035172 Bacteria 2620
732 Ga0373955_0672880 3300035172 Bacteria 635
733 Ga0373955_0807047 3300035172 Bacteria 577
734 Ga0373942_0000405 3300035207 Bacteria 11997
735 Ga0373942_0015907 3300035207 Bacteria 1839
736 Ga0373942_0026694 3300035207 Bacteria 1497
737 Ga0373961_0001013 3300035241 Bacteria 9186
738 Ga0373961_0048773 3300035241 Bacteria 1249
739 Ga0373961_0092053 3300035241 Bacteria 970
740 Ga0373961_0304116 3300035241 Bacteria 591
741 Ga0373962_0001641 3300035242 Bacteria 5314
742 Ga0373962_0001705 3300035242 Bacteria 5226
743 Ga0373962_0033329 3300035242 Bacteria 1421
744 Ga0373924_0008230 3300035410 Bacteria 3784
745 Ga0373924_0196540 3300035410 Bacteria 889
746 Ga0373931_0046111 3300035691 Bacteria 2303
747 Ga0373931_0242259 3300035691 Bacteria 1093
748 Ga0373931_1061369 3300035691 Bacteria 550
749 Ga0373935_0041202 3300035692 Bacteria 2901
750 Ga0373935_0124050 3300035692 Bacteria 1728
751 Ga0373927_0032885 3300035695 Bacteria 3377
752 Ga0373933_0004422 3300035724 Bacteria 7714
753 Ga0373933_0066670 3300035724 Bacteria 2182
754 Ga0373933_0070080 3300035724 Bacteria 2132
755 Ga0373933_0526669 3300035724 Bacteria 775
756 Ga0373947_0011056 3300035725 Bacteria 5181
757 Ga0373947_0677090 3300035725 Bacteria 703
758 Ga0373937_0014903 3300036401 Bacteria 6865
759 Ga0373937_0017492 3300036401 Bacteria 6388
760 Ga0373937_0048364 3300036401 Bacteria 3893
761 Ga0373937_0150711 3300036401 Bacteria 2178
762 Ga0373937_1397703 3300036401 Unclassified 648
763 Ga0316582_0316671 3300036647 Bacteria 1072
764 Ga0373925_0095869 3300037068 Bacteria 2273
765 Ga0373925_0134404 3300037068 Bacteria 1931
766 Ga0373925_1052653 3300037068 Unclassified 670
767 Ga0373925_1225309 3300037068 Bacteria 616
768 Ga0395899_0009657 3300037312 Bacteria 7405
769 Ga0395900_0003135 3300037418 Bacteria 17934
770 Ga0395898_0051585 3300037466 Bacteria 4022
771 Ga0395901_0020098 3300038443 Bacteria 6834
772 Ga0395901_0268724 3300038443 Bacteria 1774
773 Ga0395901_1308869 3300038443 Bacteria 686
774 Ga0436365_0566814 3300039437 Bacteria 956
775 Ga0436365_1828125 3300039437 Bacteria 5509
776 Ga0439453_0111251 3300041408 Unclassified 620
777 Ga0439464_0032655 3300042439 Unclassified 1463
778 Ga0451577_0158113 3300042876 Bacteria 2040
779 Ga0451577_0682662 3300042876 Bacteria 931
780 Ga0439440_0021628 3300042993 Bacteria 1452
781 Ga0466963_0024510 3300044694 Bacteria 3841
782 Ga0466964_0171183 3300044706 Bacteria 1023
783 Ga0453684_0605479 3300044712 Bacteria 1200
784 Ga0466957_0131988 3300044842 Bacteria 1601
785 Ga0451576_0173408 3300045051 Bacteria 2251
786 Ga0466958_0027374 3300045836 Bacteria 3375
787 Ga0466967_0016669 3300045976 Bacteria 5802
788 Ga0495592_0001176 3300046454 Bacteria 18145
789 Ga0495592_0136082 3300046454 Bacteria 1713
790 Ga0495603_0233395 3300046455 Bacteria 1060
791 Ga0495603_0381374 3300046455 Bacteria 808
792 Ga0495629_0002326 3300046459 Bacteria 14645
793 Ga0495629_0038860 3300046459 Bacteria 3351
794 Ga0495638_0155149 3300046460 Unclassified 1325
795 Ga0495641_0238020 3300046461 Bacteria 818
796 Ga0495641_0409428 3300046461 Unclassified 615
797 Ga0495651_0000921 3300046462 Bacteria 22808
798 Ga0495651_0112899 3300046462 Bacteria 2007
799 Ga0495651_0174784 3300046462 Bacteria 1526
800 Ga0495653_0001436 3300046463 Bacteria 18599
801 Ga0495653_0114518 3300046463 Bacteria 1932
802 Ga0495653_0251071 3300046463 Bacteria 1174
803 Ga0495580_0377888 3300046472 Bacteria 957
804 Ga0495582_0012004 3300046473 Bacteria 4772
805 Ga0495582_0077819 3300046473 Bacteria 1840
806 Ga0495639_0168167 3300046475 Bacteria 1063
807 Ga0495639_0197163 3300046475 Bacteria 984
808 Ga0495639_0258397 3300046475 Bacteria 862
809 Ga0495662_0070535 3300046476 Bacteria 1693
810 Ga0495664_0027048 3300046477 Bacteria 3343
811 Ga0495664_0070680 3300046477 Bacteria 2084
812 Ga0495584_0178697 3300046491 Bacteria 1079
813 Ga0495594_0031273 3300046499 Bacteria 2885
814 Ga0495594_0169787 3300046499 Bacteria 1241
815 Ga0495608_0001582 3300046511 Bacteria 16261
816 Ga0495608_0113647 3300046511 Bacteria 1739
817 Ga0495618_0033958 3300046514 Bacteria 3198
818 Ga0495628_0012601 3300046516 Bacteria 7125
819 Ga0495628_0201686 3300046516 Bacteria 1498
820 Ga0495630_0178246 3300046517 Bacteria 1620
821 Ga0495630_0821357 3300046517 Bacteria 709
822 Ga0495644_0197672 3300046523 Bacteria 775
823 Ga0495666_0216948 3300046526 Bacteria 877
824 Ga0495652_0117918 3300046529 Bacteria 2122
825 Ga0495652_0252975 3300046529 Bacteria 1304
826 Ga0495665_0035534 3300046531 Bacteria 2662
827 Ga0495665_0397386 3300046531 Bacteria 699
828 Ga0495640_0047836 3300046533 Bacteria 2958
829 Ga0495640_0387326 3300046533 Unclassified 859
830 Ga0495640_0709575 3300046533 Unclassified 603
831 Ga0495586_0012264 3300046535 Bacteria 4549
832 Ga0495587_0008788 3300046536 Bacteria 6481
833 Ga0495587_0067974 3300046536 Bacteria 2076
834 Ga0495587_0184009 3300046536 Unclassified 1184
835 Ga0495587_0236508 3300046536 Unclassified 1028
836 Ga0495645_0062076 3300046543 Bacteria 2707
837 Ga0495645_0103777 3300046543 Bacteria 2019
838 Ga0495645_0700649 3300046543 Bacteria 615
839 Ga0495667_0076608 3300046559 Bacteria 2176
840 Ga0495667_0081908 3300046559 Bacteria 2097
841 Ga0495667_0117346 3300046559 Bacteria 1719
842 Ga0495634_0055078 3300046642 Bacteria 2660
843 Ga0495635_0007233 3300046663 Bacteria 7755
844 Ga0495635_0062421 3300046663 Bacteria 2559
845 Ga0495635_0104544 3300046663 Bacteria 1935
846 Ga0495635_0132807 3300046663 Bacteria 1697
847 Ga0495635_0156761 3300046663 Bacteria 1550
848 Ga0495588_0683567 3300046674 Bacteria 537
849 Ga0495657_0005844 3300046675 Bacteria 9683
850 Ga0495657_0191333 3300046675 Bacteria 1250
851 Ga0495599_0006246 3300046678 Bacteria 7181
852 Ga0495599_0020143 3300046678 Bacteria 4155
853 Ga0495623_0005873 3300046679 Bacteria 7999
854 Ga0495623_0050706 3300046679 Bacteria 2628
855 Ga0495646_0171435 3300046680 Bacteria 1196
856 Ga0495647_0164650 3300046681 Bacteria 957
857 Ga0495647_0187987 3300046681 Bacteria 901
858 Ga0495658_0008925 3300046683 Bacteria 4985
859 Ga0495658_0086285 3300046683 Bacteria 1851
860 Ga0495613_0093005 3300046689 Bacteria 2183
861 Ga0495613_0856238 3300046689 Bacteria 590
862 Ga0495624_0470836 3300046690 Bacteria 752
863 Ga0495600_0071447 3300046809 Bacteria 2267
864 Ga0495600_0108162 3300046809 Unclassified 1811
865 Ga0495600_0118383 3300046809 Bacteria 1723
866 Ga0495600_0202556 3300046809 Bacteria 1274
867 Ga0495600_0296046 3300046809 Bacteria 1022
868 Ga0495581_0298574 3300047315 Bacteria 941
869 Ga0495581_0331754 3300047315 Bacteria 888
870 Ga0495581_0888800 3300047315 Unclassified 509
871 Ga0495604_0005412 3300047317 Bacteria 10125
872 Ga0495604_0018521 3300047317 Bacteria 5578
873 Ga0495604_0034540 3300047317 Bacteria 4000
874 Ga0495604_0109429 3300047317 Bacteria 2017
875 Ga0495674_0012552 3300047319 Bacteria 7980
876 Ga0495674_0044171 3300047319 Bacteria 3963
877 Ga0495674_0092176 3300047319 Bacteria 2587
878 Ga0495674_0724492 3300047319 Bacteria 779
879 Ga0495680_0013950 3300047322 Bacteria 6987
880 Ga0495680_0026104 3300047322 Bacteria 4822
881 Ga0495680_0175710 3300047322 Bacteria 1549
882 Ga0495680_0176720 3300047322 Bacteria 1543
883 Ga0495680_0711110 3300047322 Unclassified 663
884 Ga0495675_0002919 3300047444 Bacteria 10270
885 Ga0495675_0029357 3300047444 Bacteria 3507
886 Ga0495675_0254488 3300047444 Unclassified 1054
887 Ga0495593_0014850 3300047673 Bacteria 4424
888 Ga0495593_0083148 3300047673 Bacteria 1654
889 Ga0495602_0000618 3300048088 Bacteria 33441
890 Ga0495602_0010978 3300048088 Bacteria 9383
891 Ga0495602_0362367 3300048088 Bacteria 1043
892 Ga0495614_0105045 3300048089 Bacteria 1237
893 Ga0495614_0211586 3300048089 Bacteria 879
894 Ga0495626_0406313 3300048091 Unclassified 526
895 Ga0496100_0008731 3300048903 Bacteria 5661
896 Ga0496100_0011005 3300048903 Bacteria 5132
897 Ga0496100_0636214 3300048903 Bacteria 830
898 Ga0496101_0193177 3300048904 Bacteria 1571
899 Ga0496101_0244250 3300048904 Bacteria 1397
900 Ga0496101_0424264 3300048904 Bacteria 1048
901 Ga0496101_0594558 3300048904 Bacteria 875
902 Ga0496102_0009606 3300048905 Bacteria 8319
903 Ga0496102_0032780 3300048905 Bacteria 4668
904 Ga0496102_0068715 3300048905 Bacteria 3251
905 Ga0496102_0776715 3300048905 Bacteria 880
906 Ga0496102_1519250 3300048905 Unclassified 588
907 Ga0496103_0003651 3300048906 Bacteria 9370
908 Ga0496103_0006551 3300048906 Bacteria 6947
909 Ga0496103_0043635 3300048906 Bacteria 2761
910 Ga0496103_0258265 3300048906 Bacteria 1121
911 Ga0496103_0348092 3300048906 Unclassified 953
912 Ga0496104_0000196 3300048907 Bacteria 53901
913 Ga0496104_0003411 3300048907 Bacteria 13715
914 Ga0496104_0178276 3300048907 Bacteria 2035
915 Ga0496104_0345947 3300048907 Bacteria 1399
916 Ga0496104_0584238 3300048907 Unclassified 1027
917 Ga0496105_0004873 3300048908 Bacteria 10137
918 Ga0496105_0029068 3300048908 Bacteria 4524
919 Ga0496105_0091794 3300048908 Bacteria 2507
920 Ga0496105_0273851 3300048908 Bacteria 1362
921 Ga0496105_0540633 3300048908 Bacteria 910
922 Ga0496105_0654904 3300048908 Unclassified 810
923 Ga0496106_0024841 3300048909 Bacteria 4455
924 Ga0496106_0127514 3300048909 Bacteria 1993
925 Ga0496106_0143308 3300048909 Bacteria 1880
926 Ga0496106_0308063 3300048909 Bacteria 1270
927 Ga0496107_0031992 3300048910 Bacteria 3757
928 Ga0496107_0043706 3300048910 Bacteria 3219
929 Ga0496107_0154684 3300048910 Bacteria 1697
930 Ga0496107_0187453 3300048910 Bacteria 1537
931 Ga0496108_0008566 3300048911 Bacteria 8292
932 Ga0496108_0154898 3300048911 Bacteria 1978
933 Ga0496108_0243278 3300048911 Bacteria 1565
934 Ga0496108_0335043 3300048911 Bacteria 1319
935 Ga0496108_0383956 3300048911 Unclassified 1226
936 Ga0496109_0001554 3300048912 Bacteria 19107
937 Ga0496109_0037839 3300048912 Bacteria 4360
938 Ga0496109_0112776 3300048912 Bacteria 2528
939 Ga0496109_0118317 3300048912 Bacteria 2466
940 Ga0496109_0331643 3300048912 Bacteria 1436
941 Ga0496110_0019989 3300048913 Bacteria 5645
942 Ga0496110_0072383 3300048913 Bacteria 3058
943 Ga0496110_0084321 3300048913 Bacteria 2836
944 Ga0496110_0234794 3300048913 Bacteria 1668
945 Ga0496110_0325880 3300048913 Bacteria 1399
946 Ga0496111_0035114 3300048914 Bacteria 3582
947 Ga0496111_0199812 3300048914 Unclassified 1486
948 Ga0496111_0236609 3300048914 Bacteria 1356
949 Ga0496111_0254702 3300048914 Bacteria 1302
950 Ga0496112_0003337 3300048915 Bacteria 13247
951 Ga0496112_0128268 3300048915 Bacteria 2507
952 Ga0496112_0158741 3300048915 Bacteria 2228
953 Ga0496112_0274241 3300048915 Bacteria 1634
954 Ga0496112_0978126 3300048915 Bacteria 766
955 Ga0496112_1430576 3300048915 Unclassified 606
956 Ga0496112_1552547 3300048915 Bacteria 575
957 Ga0496113_0007502 3300048916 Bacteria 7027
958 Ga0496113_0015368 3300048916 Bacteria 5259
959 Ga0496113_0236829 3300048916 Bacteria 1456
960 Ga0496113_0345871 3300048916 Bacteria 1193
961 Ga0496113_0508090 3300048916 Bacteria 967
962 Ga0496113_0572547 3300048916 Bacteria 905
963 Ga0496114_0001741 3300048917 Bacteria 16526
964 Ga0496114_0012467 3300048917 Bacteria 6805
965 Ga0496114_0091782 3300048917 Bacteria 2580
966 Ga0496114_1480879 3300048917 Bacteria 566
967 Ga0496115_0032793 3300048918 Bacteria 4099
968 Ga0496115_0034934 3300048918 Bacteria 3974
969 Ga0496115_0265424 3300048918 Unclassified 1411
970 Ga0496115_0280790 3300048918 Bacteria 1367
971 Ga0496115_1126288 3300048918 Unclassified 593
972 Ga0496115_1215716 3300048918 Bacteria 565
973 Ga0501032_0024985 3300049569 Bacteria 4121
974 Ga0501032_0079968 3300049569 Bacteria 2175
975 Ga0501032_0086656 3300049569 Bacteria 2081
976 Ga0501032_0322061 3300049569 Bacteria 997
977 Ga0501032_0447545 3300049569 Bacteria 827
978 Ga0501032_0688659 3300049569 Bacteria 648
979 Ga0501033_0006958 3300049570 Bacteria 8831
980 Ga0501033_0025887 3300049570 Bacteria 4417
981 Ga0501033_0165755 3300049570 Bacteria 1588
982 Ga0501033_0262685 3300049570 Bacteria 1221
983 Ga0501033_0307675 3300049570 Bacteria 1115
984 Ga0501034_0001401 3300049571 Bacteria 32406
985 Ga0501034_0001763 3300049571 Bacteria 27682
986 Ga0501034_0038051 3300049571 Bacteria 4873
987 Ga0501034_0089853 3300049571 Bacteria 3069
988 Ga0501034_0101694 3300049571 Bacteria 2867
989 Ga0501034_0173889 3300049571 Bacteria 2120
990 Ga0501034_0190194 3300049571 Bacteria 2015
991 Ga0501034_0210555 3300049571 Bacteria 1899
992 Ga0501034_0286102 3300049571 Bacteria 1587
993 Ga0501034_1379156 3300049571 Bacteria 580
994 Ga0501036_0000164 3300049572 Bacteria 43588
995 Ga0501036_0002829 3300049572 Bacteria 13751
996 Ga0501036_0006271 3300049572 Bacteria 9646
997 Ga0501036_0018152 3300049572 Bacteria 5891
998 Ga0501036_0062034 3300049572 Bacteria 3166
999 Ga0501036_0235077 3300049572 Bacteria 1537
1000 Ga0501036_0668165 3300049572 Bacteria 859
1001 Ga0501036_1154165 3300049572 Bacteria 632
1002 Ga0501037_0007497 3300049573 Bacteria 7986
1003 Ga0501037_0010040 3300049573 Bacteria 6945
1004 Ga0501037_0032091 3300049573 Bacteria 3877
1005 Ga0501037_0047340 3300049573 Bacteria 3151
1006 Ga0501037_0047911 3300049573 Bacteria 3131
1007 Ga0501037_0152168 3300049573 Bacteria 1653
1008 Ga0501038_0003058 3300049574 Bacteria 15602
1009 Ga0501038_0007470 3300049574 Bacteria 10084
1010 Ga0501038_0028917 3300049574 Bacteria 4918
1011 Ga0501038_0134370 3300049574 Bacteria 2028
1012 Ga0501038_0157122 3300049574 Bacteria 1851
1013 Ga0501038_0269031 3300049574 Bacteria 1344
1014 Ga0501039_0041250 3300049575 Bacteria 3564
1015 Ga0501039_0048297 3300049575 Bacteria 3290
1016 Ga0501039_0113164 3300049575 Bacteria 2122
1017 Ga0501039_0188753 3300049575 Bacteria 1621
1018 Ga0501039_1182773 3300049575 Bacteria 592
1019 Ga0501040_0132124 3300049576 Bacteria 1756
1020 Ga0501040_0414509 3300049576 Bacteria 968
1021 Ga0501042_0266195 3300049578 Bacteria 1237
1022 Ga0501042_0456764 3300049578 Bacteria 926
1023 Ga0501043_0001255 3300049579 Bacteria 22361
1024 Ga0501043_0040784 3300049579 Bacteria 3648
1025 Ga0501043_0050128 3300049579 Bacteria 3282
1026 Ga0501043_0059802 3300049579 Bacteria 2990
1027 Ga0501043_0080522 3300049579 Bacteria 2559
1028 Ga0501043_0086876 3300049579 Bacteria 2457
1029 Ga0501043_0094350 3300049579 Bacteria 2352
1030 Ga0501043_0157721 3300049579 Bacteria 1774
1031 Ga0501043_0413677 3300049579 Bacteria 1017
1032 Ga0501043_1290321 3300049579 Bacteria 510
1033 Ga0501046_0022166 3300049580 Bacteria 5234
1034 Ga0501046_0033837 3300049580 Bacteria 4127
1035 Ga0501046_0044911 3300049580 Bacteria 3512
1036 Ga0501047_0003578 3300049581 Bacteria 14663
1037 Ga0501047_0062444 3300049581 Bacteria 3593
1038 Ga0501047_0164896 3300049581 Bacteria 2086
1039 Ga0501047_0314369 3300049581 Bacteria 1407
1040 Ga0501047_0396385 3300049581 Bacteria 1213
1041 Ga0501047_0900222 3300049581 Bacteria 698
1042 Ga0501047_0937237 3300049581 Bacteria 679
1043 Ga0501047_1123481 3300049581 Bacteria 599
1044 Ga0501048_0009262 3300049582 Bacteria 7397
1045 Ga0501048_0025760 3300049582 Bacteria 4284
1046 Ga0501048_0342437 3300049582 Bacteria 1066
1047 Ga0501048_0663350 3300049582 Bacteria 749
1048 Ga0501067_0009519 3300049583 Bacteria 5382
1049 Ga0501067_0216510 3300049583 Bacteria 1066
1050 Ga0501068_0124279 3300049584 Bacteria 1610
1051 Ga0501068_0283780 3300049584 Bacteria 1058
1052 Ga0501068_0486212 3300049584 Bacteria 800
1053 Ga0501069_0001900 3300049585 Bacteria 10423
1054 Ga0501069_0045493 3300049585 Bacteria 2432
1055 Ga0501069_0093060 3300049585 Bacteria 1705
1056 Ga0501069_0210813 3300049585 Bacteria 1128
1057 Ga0501069_0640647 3300049585 Bacteria 639
1058 Ga0501070_0012006 3300049586 Bacteria 7311
1059 Ga0501070_0016439 3300049586 Bacteria 6217
1060 Ga0501070_0016597 3300049586 Bacteria 6185
1061 Ga0501070_0045944 3300049586 Bacteria 3631
1062 Ga0501070_0057750 3300049586 Bacteria 3217
1063 Ga0501070_0061415 3300049586 Bacteria 3113
1064 Ga0501070_0075785 3300049586 Bacteria 2785
1065 Ga0501070_0207323 3300049586 Bacteria 1609
1066 Ga0501070_0604916 3300049586 Bacteria 873
1067 Ga0501071_0020855 3300049587 Bacteria 4559
1068 Ga0501071_0116255 3300049587 Bacteria 1980
1069 Ga0501071_0280001 3300049587 Bacteria 1262
1070 Ga0501072_0051958 3300049588 Bacteria 3227
1071 Ga0501072_0169336 3300049588 Bacteria 1743
1072 Ga0501073_0005996 3300049589 Bacteria 9068
1073 Ga0501073_0021522 3300049589 Bacteria 4649
1074 Ga0501073_0064834 3300049589 Bacteria 2547
1075 Ga0501073_0397268 3300049589 Bacteria 952
1076 Ga0501074_0019707 3300049590 Bacteria 4897
1077 Ga0501074_0023154 3300049590 Bacteria 4516
1078 Ga0501074_0083323 3300049590 Bacteria 2292
1079 Ga0501074_0183906 3300049590 Bacteria 1490
1080 Ga0501074_0355580 3300049590 Bacteria 1039
1081 Ga0501075_0637749 3300049591 Bacteria 812
1082 Ga0501076_0020689 3300049592 Bacteria 5039
1083 Ga0501076_0106186 3300049592 Bacteria 2266
1084 Ga0501076_0133297 3300049592 Bacteria 2016
1085 Ga0501077_0260823 3300049593 Bacteria 1102
1086 Ga0501077_0831454 3300049593 Bacteria 594
1087 Ga0501079_0037272 3300049741 Bacteria 3747
1088 Ga0501079_0098737 3300049741 Bacteria 2263
1089 Ga0501079_0290426 3300049741 Bacteria 1279
1090 Ga0501079_1321314 3300049741 Bacteria 568
1091 Ga0501080_0001467 3300049742 Bacteria 19851
1092 Ga0501080_0066497 3300049742 Bacteria 3352
1093 Ga0501080_0078531 3300049742 Bacteria 3069
1094 Ga0501080_0090333 3300049742 Bacteria 2845
1095 Ga0501080_0100594 3300049742 Bacteria 2682
1096 Ga0501080_0137157 3300049742 Bacteria 2263
1097 Ga0501081_0576892 3300049743 Bacteria 841
1098 Ga0501083_0001750 3300049744 Bacteria 14813
1099 Ga0501083_0009826 3300049744 Bacteria 6754
1100 Ga0501083_0028469 3300049744 Bacteria 3849
1101 Ga0501083_0066516 3300049744 Bacteria 2399
1102 Ga0501083_0146385 3300049744 Bacteria 1547
1103 Ga0501083_0388204 3300049744 Bacteria 908
1104 Ga0501083_0423787 3300049744 Bacteria 866
1105 Ga0501083_0611721 3300049744 Unclassified 709
1106 Ga0501035_0046577 3300049822 Bacteria 3900
1107 Ga0501035_0052529 3300049822 Bacteria 3646
1108 Ga0501035_0074968 3300049822 Bacteria 2992
1109 Ga0501035_0128726 3300049822 Bacteria 2208
1110 Ga0501035_0177424 3300049822 Bacteria 1837
1111 Ga0501035_0398300 3300049822 Bacteria 1146
1112 Ga0501035_0405438 3300049822 Bacteria 1134
1113 Ga0501035_0526792 3300049822 Bacteria 970
1114 Ga0501035_1263840 3300049822 Bacteria 570
1115 Ga0501044_0000822 3300049823 Bacteria 37410
1116 Ga0501044_0002823 3300049823 Bacteria 19779
1117 Ga0501044_0038058 3300049823 Bacteria 5023
1118 Ga0501044_0106489 3300049823 Bacteria 2816
1119 Ga0501044_0173293 3300049823 Bacteria 2127
1120 Ga0501044_0190872 3300049823 Bacteria 2011
1121 Ga0501044_0197490 3300049823 Bacteria 1971
1122 Ga0501044_0243942 3300049823 Bacteria 1739
1123 Ga0501044_0625621 3300049823 Bacteria 967
1124 Ga0501044_0873711 3300049823 Bacteria 775
1125 Ga0501044_0928257 3300049823 Bacteria 744
1126 Ga0501044_1188973 3300049823 Bacteria 630
1127 Ga0501045_0466841 3300049824 Bacteria 938
1128 nmdc:mga03n38_493697_c1 3300050490 Unclassified 686
1129 nmdc:mga06z11_20872_c1 3300050494 Bacteria 3034
1130 nmdc:mga06z11_832525_c1 3300050494 Unclassified 562
1131 nmdc:mga05p37_6013_c1 3300050507 Bacteria 14287
1132 nmdc:mga05p37_87679_c1 3300050507 Bacteria 3836
1133 nmdc:mga09592_2783_c1 3300050508 Bacteria 14165
1134 nmdc:mga0qj67_1876_c1 3300050509 Bacteria 14908
1135 nmdc:mga06r32_22491_c1 3300050510 Bacteria 5829
1136 nmdc:mga08y16_1034470_c1 3300050511 Unclassified 800
1137 nmdc:mga08y16_12040_c1 3300050511 Bacteria 9088
1138 nmdc:mga08y16_2031_c1 3300050511 Bacteria 20733
1139 nmdc:mga0n895_1539_c1 3300050512 Bacteria 17321
1140 nmdc:mga0n895_436410_c1 3300050512 Bacteria 1323
1141 nmdc:mga0n895_51388_c1 3300050512 Bacteria 4044
1142 nmdc:mga0n895_5922_c1 3300050512 Bacteria 10279
1143 nmdc:mga0n895_97038_c1 3300050512 Bacteria 2953
1144 nmdc:mga0rr50_164488_c1 3300050513 Bacteria 1803
1145 nmdc:mga0rr50_321712_c1 3300050513 Unclassified 1297
1146 nmdc:mga0rr50_383255_c1 3300050513 Bacteria 1186
1147 nmdc:mga0rr50_505582_c1 3300050513 Bacteria 1028
1148 nmdc:mga0rr50_72220_c1 3300050513 Bacteria 2635
1149 nmdc:mga08x19_915456_c1 3300050514 Unclassified 623
1150 nmdc:mga0a205_1056427_c1 3300050515 Bacteria 659
1151 nmdc:mga0a205_185748_c1 3300050515 Bacteria 1972
1152 nmdc:mga0a205_232147_c1 3300050515 Bacteria 1728
1153 nmdc:mga0a205_34744_c1 3300050515 Bacteria 4838
1154 nmdc:mga0a205_46035_c1 3300050515 Bacteria 4207
1155 Ga0495601_0000456 3300053077 Bacteria 21456
1156 Ga0495601_0000507 3300053077 Bacteria 20511
1157 Ga0495601_0009329 3300053077 Bacteria 5801
1158 Ga0495601_0012444 3300053077 Bacteria 5104
1159 Ga0495601_0101803 3300053077 Bacteria 1855
1160 Ga0495612_0005524 3300053078 Bacteria 5226
1161 Ga0495612_0007164 3300053078 Bacteria 4564
1162 Ga0495612_0107037 3300053078 Bacteria 1194
1163 Ga0495595_0000513 3300053084 Bacteria 14746
1164 Ga0495595_0001524 3300053084 Bacteria 9029
1165 Ga0495619_0000043 3300053085 Bacteria 109865
1166 Ga0495619_0000551 3300053085 Bacteria 24828
1167 Ga0495619_0002087 3300053085 Bacteria 13282
1168 Ga0495619_0025754 3300053085 Bacteria 3780
1169 Ga0495619_0032006 3300053085 Bacteria 3410
1170 Ga0495619_0109308 3300053085 Bacteria 1888
1171 Ga0495619_0241111 3300053085 Bacteria 1253
1172 Ga0500643_002121 3300053087 Bacteria 10523
1173 Ga0500651_0041727 3300053093 Bacteria 2892
1174 Ga0500651_0113892 3300053093 Bacteria 1648
1175 Ga0500651_0667351 3300053093 Bacteria 558
1176 Ga0500566_0086671 3300053094 Bacteria 1735
1177 Ga0500650_0140675 3300053098 Bacteria 1119
1178 Ga0500594_0062053 3300053118 Bacteria 1080
1179 Ga0500595_000002 3300053119 Bacteria 1074388
1180 Ga0500621_211535 3300053126 Bacteria 679
1181 Ga0500616_0000002 3300053153 Bacteria 1611257
1182 Ga0500616_0117024 3300053153 Bacteria 1278
1183 Ga0500645_000568 3300053730 Bacteria 24115
1184 Ga0500645_017683 3300053730 Bacteria 2232
1185 Ga0501084_0098435 3300054114 Bacteria 2456
1186 Ga0501084_0422737 3300054114 Bacteria 1126
1187 Ga0501084_0486821 3300054114 Bacteria 1043
1188 Ga0501084_0667190 3300054114 Bacteria 877
1189 Ga0501082_0019802 3300060353 Bacteria 5803
1190 Ga0501082_0052191 3300060353 Bacteria 3525
1191 Ga0501082_0064261 3300060353 Bacteria 3161
1192 Ga0501082_0626427 3300060353 Bacteria 941

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1003693 Ga0265337_10036933 97
2 3300046491 Ga0495584_0178697 Ga0495584_0178697_38_346 102
3 3300048906 Ga0496103_0348092 Ga0496103_0348092_29_337 102
4 3300048915 Ga0496112_0978126 Ga0496112_0978126_15_326 103
5 3300048915 Ga0496112_1552547 Ga0496112_1552547_15_326 103
6 3300049823 Ga0501044_0106489 Ga0501044_0106489_1600_1911 103
7 3300046533 Ga0495640_0709575 Ga0495640_0709575_34_348 104
8 3300025942 Ga0207689_10722718 Ga0207689_107227182 108
9 3300035114 Ga0373939_0002892 Ga0373939_0002892_506_832 108
10 3300005434 Ga0070709_10435526 Ga0070709_104355262 111
11 3300005616 Ga0068852_102443610 Ga0068852_1024436102 111
12 3300025921 Ga0207652_10191472 Ga0207652_101914723 111
13 3300026142 Ga0207698_11224391 Ga0207698_112243912 111
14 3300037312 Ga0395899_0009657 Ga0395899_0009657_1091_1426 111
15 3300037418 Ga0395900_0003135 Ga0395900_0003135_13418_13753 111
16 3300037466 Ga0395898_0051585 Ga0395898_0051585_2313_2648 111
17 3300038443 Ga0395901_0020098 Ga0395901_0020098_531_866 111
18 3300038443 Ga0395901_0268724 Ga0395901_0268724_1398_1733 111
19 3300044694 Ga0466963_0024510 Ga0466963_0024510_2570_2905 111
20 3300044706 Ga0466964_0171183 Ga0466964_0171183_166_501 111
21 3300044842 Ga0466957_0131988 Ga0466957_0131988_885_1220 111
22 3300045836 Ga0466958_0027374 Ga0466958_0027374_1960_2295 111
23 3300045976 Ga0466967_0016669 Ga0466967_0016669_4503_4838 111
24 iso_pu_bacteria 2643221547 2643755923 111
25 3300005981 Ga0081538_10041429 Ga0081538_100414292 112
26 3300006173 Ga0070716_100373485 Ga0070716_1003734852 112
27 3300028577 Ga0265318_10273465 Ga0265318_102734652 112
28 3300031247 Ga0265340_10020827 Ga0265340_100208272 112
29 3300049575 Ga0501039_1182773 Ga0501039_1182773_65_403 112
30 3300003911 JGI25405J52794_10012841 JGI25405J52794_100128413 113
31 3300005295 Ga0065707_10632563 Ga0065707_106325631 113
32 3300005328 Ga0070676_10207069 Ga0070676_102070691 113
33 3300005329 Ga0070683_100079030 Ga0070683_1000790303 113
34 3300005335 Ga0070666_10291177 Ga0070666_102911772 113
35 3300005337 Ga0070682_100023896 Ga0070682_1000238963 113
36 3300005344 Ga0070661_101815228 Ga0070661_1018152282 113
37 3300005355 Ga0070671_100157443 Ga0070671_1001574432 113
38 3300005355 Ga0070671_101045041 Ga0070671_1010450412 113
39 3300005365 Ga0070688_100351961 Ga0070688_1003519613 113
40 3300005366 Ga0070659_101805771 Ga0070659_1018057712 113
41 3300005367 Ga0070667_100527864 Ga0070667_1005278642 113
42 3300005434 Ga0070709_10195406 Ga0070709_101954062 113
43 3300005434 Ga0070709_10235293 Ga0070709_102352931 113
44 3300005435 Ga0070714_100619081 Ga0070714_1006190812 113
45 3300005436 Ga0070713_100039180 Ga0070713_1000391803 113
46 3300005436 Ga0070713_101539077 Ga0070713_1015390772 113
47 3300005437 Ga0070710_10056697 Ga0070710_100566973 113
48 3300005437 Ga0070710_10285132 Ga0070710_102851322 113
49 3300005439 Ga0070711_100674457 Ga0070711_1006744572 113
50 3300005440 Ga0070705_100033813 Ga0070705_1000338135 113
51 3300005455 Ga0070663_100088886 Ga0070663_1000888863 113
52 3300005456 Ga0070678_100005474 Ga0070678_1000054744 113
53 3300005466 Ga0070685_10147789 Ga0070685_101477891 113
54 3300005543 Ga0070672_100920927 Ga0070672_1009209272 113
55 3300005547 Ga0070693_100688940 Ga0070693_1006889402 113
56 3300005548 Ga0070665_100353780 Ga0070665_1003537802 113
57 3300005564 Ga0070664_100191277 Ga0070664_1001912773 113
58 3300005615 Ga0070702_100099648 Ga0070702_1000996482 113
59 3300005618 Ga0068864_101241574 Ga0068864_1012415742 113
60 3300005841 Ga0068863_100352022 Ga0068863_1003520222 113
61 3300005842 Ga0068858_100276517 Ga0068858_1002765173 113
62 3300005842 Ga0068858_101550702 Ga0068858_1015507022 113
63 3300005843 Ga0068860_100451261 Ga0068860_1004512612 113
64 3300005843 Ga0068860_101232334 Ga0068860_1012323341 113
65 3300005844 Ga0068862_100275368 Ga0068862_1002753682 113
66 3300005937 Ga0081455_10006976 Ga0081455_100069768 113
67 3300005937 Ga0081455_10123738 Ga0081455_101237383 113
68 3300006163 Ga0070715_10014758 Ga0070715_100147584 113
69 3300006173 Ga0070716_100009019 Ga0070716_1000090193 113
70 3300006175 Ga0070712_100183986 Ga0070712_1001839863 113
71 3300006194 Ga0075427_10003835 Ga0075427_100038352 113
72 3300006237 Ga0097621_100030924 Ga0097621_1000309244 113
73 3300006237 Ga0097621_100180771 Ga0097621_1001807712 113
74 3300006844 Ga0075428_100017044 Ga0075428_1000170442 113
75 3300006846 Ga0075430_100004240 Ga0075430_10000424010 113
76 3300006847 Ga0075431_100237644 Ga0075431_1002376442 113
77 3300006852 Ga0075433_10003318 Ga0075433_1000331810 113
78 3300006852 Ga0075433_10194998 Ga0075433_101949983 113
79 3300006871 Ga0075434_100003881 Ga0075434_10000388110 113
80 3300006871 Ga0075434_100049800 Ga0075434_1000498003 113
81 3300006871 Ga0075434_100286306 Ga0075434_1002863063 113
82 3300006880 Ga0075429_100008546 Ga0075429_10000854610 113
83 3300006881 Ga0068865_100020346 Ga0068865_1000203463 113
84 3300007076 Ga0075435_100090670 Ga0075435_1000906702 113
85 3300009011 Ga0105251_10022056 Ga0105251_100220563 113
86 3300009011 Ga0105251_10332240 Ga0105251_103322402 113
87 3300009092 Ga0105250_10075208 Ga0105250_100752082 113
88 3300009094 Ga0111539_10002796 Ga0111539_100027963 113
89 3300009094 Ga0111539_12207483 Ga0111539_122074831 113
90 3300009098 Ga0105245_10068509 Ga0105245_100685093 113
91 3300009101 Ga0105247_10042814 Ga0105247_100428143 113
92 3300009147 Ga0114129_10029650 Ga0114129_1002965010 113
93 3300009147 Ga0114129_10198080 Ga0114129_101980803 113
94 3300009148 Ga0105243_10016347 Ga0105243_100163475 113
95 3300009174 Ga0105241_10048036 Ga0105241_100480363 113
96 3300009176 Ga0105242_10532664 Ga0105242_105326643 113
97 3300009177 Ga0105248_10323791 Ga0105248_103237913 113
98 3300009177 Ga0105248_11449977 Ga0105248_114499772 113
99 3300009545 Ga0105237_10596307 Ga0105237_105963072 113
100 3300009551 Ga0105238_10058732 Ga0105238_100587323 113
101 3300009553 Ga0105249_10152330 Ga0105249_101523303 113
102 3300010375 Ga0105239_11012542 Ga0105239_110125422 113
103 3300011119 Ga0105246_11068061 Ga0105246_110680612 113
104 3300012494 Ga0157341_1026473 Ga0157341_10264732 113
105 3300012510 Ga0157316_1052765 Ga0157316_10527652 113
106 3300013100 Ga0157373_10497015 Ga0157373_104970152 113
107 3300013296 Ga0157374_10538424 Ga0157374_105384242 113
108 3300013296 Ga0157374_10653901 Ga0157374_106539012 113
109 3300013296 Ga0157374_10749949 Ga0157374_107499492 113
110 3300013297 Ga0157378_10032054 Ga0157378_100320546 113
111 3300013306 Ga0163162_12960581 Ga0163162_129605811 113
112 3300013308 Ga0157375_10397256 Ga0157375_103972563 113
113 3300014325 Ga0163163_10369436 Ga0163163_103694362 113
114 3300014326 Ga0157380_10136692 Ga0157380_101366922 113
115 3300014968 Ga0157379_10386195 Ga0157379_103861952 113
116 3300014968 Ga0157379_10902131 Ga0157379_109021312 113
117 3300014969 Ga0157376_10195812 Ga0157376_101958123 113
118 3300025898 Ga0207692_10258580 Ga0207692_102585803 113
119 3300025901 Ga0207688_10171790 Ga0207688_101717902 113
120 3300025903 Ga0207680_10131226 Ga0207680_101312262 113
121 3300025905 Ga0207685_10021908 Ga0207685_100219082 113
122 3300025907 Ga0207645_10058013 Ga0207645_100580133 113
123 3300025911 Ga0207654_10069882 Ga0207654_100698822 113
124 3300025914 Ga0207671_10113380 Ga0207671_101133803 113
125 3300025915 Ga0207693_10008072 Ga0207693_100080724 113
126 3300025916 Ga0207663_10584502 Ga0207663_105845022 113
127 3300025928 Ga0207700_10394305 Ga0207700_103943052 113
128 3300025928 Ga0207700_11221199 Ga0207700_112211992 113
129 3300025929 Ga0207664_10256980 Ga0207664_102569802 113
130 3300025931 Ga0207644_10046794 Ga0207644_100467943 113
131 3300025932 Ga0207690_10262440 Ga0207690_102624402 113
132 3300025934 Ga0207686_10084799 Ga0207686_100847993 113
133 3300025935 Ga0207709_10906584 Ga0207709_109065842 113
134 3300025936 Ga0207670_10217665 Ga0207670_102176652 113
135 3300025937 Ga0207669_10603744 Ga0207669_106037442 113
136 3300025938 Ga0207704_10265516 Ga0207704_102655162 113
137 3300025939 Ga0207665_10005721 Ga0207665_100057214 113
138 3300025940 Ga0207691_10486974 Ga0207691_104869742 113
139 3300025941 Ga0207711_10009494 Ga0207711_100094946 113
140 3300025942 Ga0207689_10823707 Ga0207689_108237071 113
141 3300025944 Ga0207661_10020336 Ga0207661_100203362 113
142 3300025945 Ga0207679_10753055 Ga0207679_107530552 113
143 3300025972 Ga0207668_10265978 Ga0207668_102659782 113
144 3300025986 Ga0207658_10052210 Ga0207658_100522102 113
145 3300026035 Ga0207703_11103410 Ga0207703_111034102 113
146 3300026067 Ga0207678_10012983 Ga0207678_1001298310 113
147 3300026095 Ga0207676_10118340 Ga0207676_101183403 113
148 3300026116 Ga0207674_10881694 Ga0207674_108816941 113
149 3300026118 Ga0207675_100612320 Ga0207675_1006123202 113
150 3300026121 Ga0207683_10028744 Ga0207683_100287443 113
151 3300026142 Ga0207698_10370313 Ga0207698_103703132 113
152 3300027907 Ga0207428_10000216 Ga0207428_1000021636 113
153 3300028379 Ga0268266_10089573 Ga0268266_100895733 113
154 3300028381 Ga0268264_10551602 Ga0268264_105516022 113
155 3300034816 Ga0373930_0032077 Ga0373930_0032077_112_453 113
156 3300034818 Ga0373950_0036772 Ga0373950_0036772_443_784 113
157 3300034819 Ga0373958_0068004 Ga0373958_0068004_357_698 113
158 3300034820 Ga0373959_0070654 Ga0373959_0070654_344_685 113
159 3300035083 Ga0373926_0021412 Ga0373926_0021412_40_381 113
160 3300035084 Ga0373928_0157390 Ga0373928_0157390_82_423 113
161 3300035088 Ga0373940_0157104 Ga0373940_0157104_279_620 113
162 3300035090 Ga0373949_0297125 Ga0373949_0297125_91_432 113
163 3300035091 Ga0373951_0006292 Ga0373951_0006292_389_730 113
164 3300035092 Ga0373952_0031323 Ga0373952_0031323_505_846 113
165 3300035114 Ga0373939_0058772 Ga0373939_0058772_423_764 113
166 3300035115 Ga0373941_0004347 Ga0373941_0004347_2075_2416 113
167 3300035115 Ga0373941_0180985 Ga0373941_0180985_164_505 113
168 3300035116 Ga0373945_0049929 Ga0373945_0049929_935_1276 113
169 3300035121 Ga0373960_0250675 Ga0373960_0250675_229_570 113
170 3300035170 Ga0373943_0005045 Ga0373943_0005045_3883_4224 113
171 3300035171 Ga0373946_0197285 Ga0373946_0197285_336_677 113
172 3300035207 Ga0373942_0026694 Ga0373942_0026694_540_881 113
173 3300035241 Ga0373961_0092053 Ga0373961_0092053_277_618 113
174 3300035242 Ga0373962_0033329 Ga0373962_0033329_42_383 113
175 3300035692 Ga0373935_0041202 Ga0373935_0041202_569_910 113
176 3300035725 Ga0373947_0011056 Ga0373947_0011056_2374_2715 113
177 3300037068 Ga0373925_0095869 Ga0373925_0095869_610_951 113
178 3300037068 Ga0373925_1052653 Ga0373925_1052653_11_352 113
179 3300042876 Ga0451577_0682662 Ga0451577_0682662_421_762 113
180 3300046455 Ga0495603_0381374 Ga0495603_0381374_224_565 113
181 3300046459 Ga0495629_0002326 Ga0495629_0002326_9237_9578 113
182 3300046461 Ga0495641_0409428 Ga0495641_0409428_142_483 113
183 3300046462 Ga0495651_0174784 Ga0495651_0174784_1113_1454 113
184 3300046473 Ga0495582_0012004 Ga0495582_0012004_1986_2327 113
185 3300046475 Ga0495639_0197163 Ga0495639_0197163_547_888 113
186 3300046499 Ga0495594_0031273 Ga0495594_0031273_939_1280 113
187 3300046681 Ga0495647_0164650 Ga0495647_0164650_257_598 113
188 3300046683 Ga0495658_0008925 Ga0495658_0008925_4372_4713 113
189 3300046689 Ga0495613_0093005 Ga0495613_0093005_1322_1663 113
190 3300046809 Ga0495600_0118383 Ga0495600_0118383_423_764 113
191 3300047315 Ga0495581_0888800 Ga0495581_0888800_105_446 113
192 3300047319 Ga0495674_0724492 Ga0495674_0724492_248_589 113
193 3300047322 Ga0495680_0026104 Ga0495680_0026104_3916_4257 113
194 3300047673 Ga0495593_0014850 Ga0495593_0014850_3297_3638 113
195 3300048089 Ga0495614_0105045 Ga0495614_0105045_184_525 113
196 3300048903 Ga0496100_0636214 Ga0496100_0636214_64_405 113
197 3300048905 Ga0496102_0032780 Ga0496102_0032780_2547_2888 113
198 3300048905 Ga0496102_0776715 Ga0496102_0776715_205_546 113
199 3300048906 Ga0496103_0003651 Ga0496103_0003651_4379_4720 113
200 3300048907 Ga0496104_0345947 Ga0496104_0345947_448_789 113
201 3300048908 Ga0496105_0091794 Ga0496105_0091794_564_905 113
202 3300048908 Ga0496105_0273851 Ga0496105_0273851_730_1071 113
203 3300048908 Ga0496105_0540633 Ga0496105_0540633_179_520 113
204 3300048910 Ga0496107_0031992 Ga0496107_0031992_2809_3150 113
205 3300048911 Ga0496108_0154898 Ga0496108_0154898_975_1316 113
206 3300048911 Ga0496108_0335043 Ga0496108_0335043_326_667 113
207 3300048912 Ga0496109_0112776 Ga0496109_0112776_1603_1944 113
208 3300048912 Ga0496109_0118317 Ga0496109_0118317_508_849 113
209 3300048912 Ga0496109_0331643 Ga0496109_0331643_873_1214 113
210 3300048913 Ga0496110_0019989 Ga0496110_0019989_2202_2543 113
211 3300048914 Ga0496111_0254702 Ga0496111_0254702_505_846 113
212 3300048915 Ga0496112_0128268 Ga0496112_0128268_1897_2238 113
213 3300048915 Ga0496112_0274241 Ga0496112_0274241_515_856 113
214 3300048916 Ga0496113_0345871 Ga0496113_0345871_48_389 113
215 3300048916 Ga0496113_0508090 Ga0496113_0508090_13_354 113
216 3300048917 Ga0496114_0091782 Ga0496114_0091782_1632_1973 113
217 3300048918 Ga0496115_1126288 Ga0496115_1126288_200_541 113
218 3300048918 Ga0496115_1215716 Ga0496115_1215716_41_382 113
219 3300049569 Ga0501032_0024985 Ga0501032_0024985_343_684 113
220 3300049569 Ga0501032_0086656 Ga0501032_0086656_94_435 113
221 3300049569 Ga0501032_0322061 Ga0501032_0322061_37_378 113
222 3300049569 Ga0501032_0447545 Ga0501032_0447545_180_521 113
223 3300049570 Ga0501033_0006958 Ga0501033_0006958_6125_6466 113
224 3300049570 Ga0501033_0165755 Ga0501033_0165755_686_1027 113
225 3300049570 Ga0501033_0262685 Ga0501033_0262685_180_521 113
226 3300049571 Ga0501034_0001401 Ga0501034_0001401_17600_17941 113
227 3300049571 Ga0501034_0001763 Ga0501034_0001763_2220_2561 113
228 3300049571 Ga0501034_0038051 Ga0501034_0038051_1523_1864 113
229 3300049571 Ga0501034_0089853 Ga0501034_0089853_2143_2484 113
230 3300049571 Ga0501034_0190194 Ga0501034_0190194_473_814 113
231 3300049571 Ga0501034_0286102 Ga0501034_0286102_432_773 113
232 3300049572 Ga0501036_0000164 Ga0501036_0000164_26541_26882 113
233 3300049572 Ga0501036_0006271 Ga0501036_0006271_2234_2575 113
234 3300049572 Ga0501036_0018152 Ga0501036_0018152_695_1036 113
235 3300049572 Ga0501036_0062034 Ga0501036_0062034_2211_2552 113
236 3300049572 Ga0501036_0668165 Ga0501036_0668165_338_679 113
237 3300049572 Ga0501036_1154165 Ga0501036_1154165_116_457 113
238 3300049573 Ga0501037_0007497 Ga0501037_0007497_1190_1531 113
239 3300049573 Ga0501037_0010040 Ga0501037_0010040_4144_4485 113
240 3300049573 Ga0501037_0047340 Ga0501037_0047340_2466_2807 113
241 3300049573 Ga0501037_0047911 Ga0501037_0047911_18_359 113
242 3300049574 Ga0501038_0003058 Ga0501038_0003058_14239_14580 113
243 3300049574 Ga0501038_0007470 Ga0501038_0007470_1816_2157 113
244 3300049574 Ga0501038_0269031 Ga0501038_0269031_451_792 113
245 3300049575 Ga0501039_0041250 Ga0501039_0041250_2341_2682 113
246 3300049575 Ga0501039_0113164 Ga0501039_0113164_1317_1658 113
247 3300049575 Ga0501039_0188753 Ga0501039_0188753_63_404 113
248 3300049576 Ga0501040_0132124 Ga0501040_0132124_592_933 113
249 3300049576 Ga0501040_0414509 Ga0501040_0414509_327_668 113
250 3300049578 Ga0501042_0456764 Ga0501042_0456764_229_570 113
251 3300049579 Ga0501043_0001255 Ga0501043_0001255_5014_5355 113
252 3300049579 Ga0501043_0040784 Ga0501043_0040784_1522_1863 113
253 3300049579 Ga0501043_0050128 Ga0501043_0050128_1463_1804 113
254 3300049579 Ga0501043_0086876 Ga0501043_0086876_395_736 113
255 3300049579 Ga0501043_0157721 Ga0501043_0157721_661_1002 113
256 3300049579 Ga0501043_0413677 Ga0501043_0413677_11_352 113
257 3300049579 Ga0501043_1290321 Ga0501043_1290321_82_423 113
258 3300049580 Ga0501046_0033837 Ga0501046_0033837_3399_3740 113
259 3300049580 Ga0501046_0044911 Ga0501046_0044911_815_1156 113
260 3300049581 Ga0501047_0003578 Ga0501047_0003578_2433_2774 113
261 3300049581 Ga0501047_0062444 Ga0501047_0062444_2275_2616 113
262 3300049581 Ga0501047_0164896 Ga0501047_0164896_619_960 113
263 3300049581 Ga0501047_0396385 Ga0501047_0396385_172_513 113
264 3300049581 Ga0501047_0937237 Ga0501047_0937237_39_380 113
265 3300049581 Ga0501047_1123481 Ga0501047_1123481_184_525 113
266 3300049582 Ga0501048_0025760 Ga0501048_0025760_1511_1852 113
267 3300049582 Ga0501048_0342437 Ga0501048_0342437_693_1034 113
268 3300049583 Ga0501067_0216510 Ga0501067_0216510_569_910 113
269 3300049584 Ga0501068_0124279 Ga0501068_0124279_331_672 113
270 3300049584 Ga0501068_0486212 Ga0501068_0486212_59_400 113
271 3300049585 Ga0501069_0093060 Ga0501069_0093060_164_505 113
272 3300049585 Ga0501069_0210813 Ga0501069_0210813_586_927 113
273 3300049586 Ga0501070_0012006 Ga0501070_0012006_4623_4964 113
274 3300049586 Ga0501070_0016597 Ga0501070_0016597_3457_3798 113
275 3300049586 Ga0501070_0045944 Ga0501070_0045944_2463_2804 113
276 3300049586 Ga0501070_0057750 Ga0501070_0057750_688_1029 113
277 3300049586 Ga0501070_0075785 Ga0501070_0075785_628_969 113
278 3300049586 Ga0501070_0604916 Ga0501070_0604916_410_751 113
279 3300049587 Ga0501071_0116255 Ga0501071_0116255_968_1309 113
280 3300049588 Ga0501072_0051958 Ga0501072_0051958_1058_1399 113
281 3300049588 Ga0501072_0169336 Ga0501072_0169336_203_544 113
282 3300049589 Ga0501073_0005996 Ga0501073_0005996_6588_6929 113
283 3300049589 Ga0501073_0064834 Ga0501073_0064834_1379_1720 113
284 3300049590 Ga0501074_0019707 Ga0501074_0019707_2248_2589 113
285 3300049590 Ga0501074_0083323 Ga0501074_0083323_215_556 113
286 3300049590 Ga0501074_0183906 Ga0501074_0183906_1077_1418 113
287 3300049591 Ga0501075_0637749 Ga0501075_0637749_115_456 113
288 3300049592 Ga0501076_0133297 Ga0501076_0133297_25_366 113
289 3300049741 Ga0501079_0037272 Ga0501079_0037272_2163_2504 113
290 3300049742 Ga0501080_0001467 Ga0501080_0001467_2433_2774 113
291 3300049742 Ga0501080_0066497 Ga0501080_0066497_799_1140 113
292 3300049742 Ga0501080_0090333 Ga0501080_0090333_2466_2807 113
293 3300049742 Ga0501080_0137157 Ga0501080_0137157_1220_1561 113
294 3300049744 Ga0501083_0009826 Ga0501083_0009826_2405_2746 113
295 3300049744 Ga0501083_0066516 Ga0501083_0066516_686_1027 113
296 3300049822 Ga0501035_0052529 Ga0501035_0052529_2328_2669 113
297 3300049822 Ga0501035_0074968 Ga0501035_0074968_781_1122 113
298 3300049822 Ga0501035_0128726 Ga0501035_0128726_1402_1743 113
299 3300049822 Ga0501035_0405438 Ga0501035_0405438_174_515 113
300 3300049822 Ga0501035_1263840 Ga0501035_1263840_168_509 113
301 3300049823 Ga0501044_0002823 Ga0501044_0002823_2362_2703 113
302 3300049823 Ga0501044_0038058 Ga0501044_0038058_3993_4334 113
303 3300049823 Ga0501044_0173293 Ga0501044_0173293_218_559 113
304 3300049823 Ga0501044_0243942 Ga0501044_0243942_526_867 113
305 3300049823 Ga0501044_0625621 Ga0501044_0625621_190_531 113
306 3300049823 Ga0501044_1188973 Ga0501044_1188973_158_499 113
307 3300049824 Ga0501045_0466841 Ga0501045_0466841_159_500 113
308 3300050507 nmdc:mga05p37_6013_c1 nmdc:mga05p37_6013_c1_7192_7533 113
309 3300050507 nmdc:mga05p37_87679_c1 nmdc:mga05p37_87679_c1_1765_2106 113
310 3300050508 nmdc:mga09592_2783_c1 nmdc:mga09592_2783_c1_1023_1364 113
311 3300050509 nmdc:mga0qj67_1876_c1 nmdc:mga0qj67_1876_c1_12290_12631 113
312 3300050510 nmdc:mga06r32_22491_c1 nmdc:mga06r32_22491_c1_4072_4413 113
313 3300050511 nmdc:mga08y16_12040_c1 nmdc:mga08y16_12040_c1_1954_2295 113
314 3300050512 nmdc:mga0n895_1539_c1 nmdc:mga0n895_1539_c1_9417_9758 113
315 3300050512 nmdc:mga0n895_436410_c1 nmdc:mga0n895_436410_c1_599_940 113
316 3300050512 nmdc:mga0n895_5922_c1 nmdc:mga0n895_5922_c1_2709_3050 113
317 3300050512 nmdc:mga0n895_97038_c1 nmdc:mga0n895_97038_c1_1650_1991 113
318 3300050513 nmdc:mga0rr50_383255_c1 nmdc:mga0rr50_383255_c1_134_475 113
319 3300050513 nmdc:mga0rr50_505582_c1 nmdc:mga0rr50_505582_c1_516_857 113
320 3300050513 nmdc:mga0rr50_72220_c1 nmdc:mga0rr50_72220_c1_217_558 113
321 3300050515 nmdc:mga0a205_1056427_c1 nmdc:mga0a205_1056427_c1_98_439 113
322 3300050515 nmdc:mga0a205_34744_c1 nmdc:mga0a205_34744_c1_2544_2885 113
323 3300050515 nmdc:mga0a205_46035_c1 nmdc:mga0a205_46035_c1_1399_1740 113
324 3300053085 Ga0495619_0025754 Ga0495619_0025754_1156_1497 113
325 3300054114 Ga0501084_0098435 Ga0501084_0098435_182_523 113
326 3300054114 Ga0501084_0667190 Ga0501084_0667190_394_735 113
327 3300060353 Ga0501082_0064261 Ga0501082_0064261_2199_2540 113
328 3300005327 Ga0070658_10003716 Ga0070658_100037164 114
329 3300005336 Ga0070680_100013055 Ga0070680_1000130553 114
330 3300005458 Ga0070681_10261025 Ga0070681_102610252 114
331 3300005530 Ga0070679_100332100 Ga0070679_1003321001 114
332 3300005563 Ga0068855_100082168 Ga0068855_1000821685 114
333 3300005578 Ga0068854_100056497 Ga0068854_1000564973 114
334 3300009093 Ga0105240_10293420 Ga0105240_102934203 114
335 3300013100 Ga0157373_11393197 Ga0157373_113931972 114
336 3300013104 Ga0157370_10055478 Ga0157370_100554782 114
337 3300013104 Ga0157370_10843988 Ga0157370_108439882 114
338 3300020082 Ga0206353_10336741 Ga0206353_103367412 114
339 3300021384 Ga0213876_10225361 Ga0213876_102253613 114
340 3300025912 Ga0207707_10059583 Ga0207707_100595834 114
341 3300025917 Ga0207660_10223267 Ga0207660_102232673 114
342 3300025919 Ga0207657_10019627 Ga0207657_100196273 114
343 3300025921 Ga0207652_10069144 Ga0207652_100691443 114
344 3300025949 Ga0207667_10121124 Ga0207667_101211242 114
345 3300025981 Ga0207640_10076366 Ga0207640_100763663 114
346 3300031711 Ga0265314_10004264 Ga0265314_1000426411 114
347 3300031901 Ga0307406_10475704 Ga0307406_104757042 114
348 3300032002 Ga0307416_101198459 Ga0307416_1011984592 114
349 3300032126 Ga0307415_100480274 Ga0307415_1004802742 114
350 3300035084 Ga0373928_0068112 Ga0373928_0068112_63_407 114
351 3300035085 Ga0373929_0211754 Ga0373929_0211754_175_519 114
352 3300035724 Ga0373933_0526669 Ga0373933_0526669_386_730 114
353 3300036401 Ga0373937_1397703 Ga0373937_1397703_197_541 114
354 3300038443 Ga0395901_1308869 Ga0395901_1308869_261_605 114
355 3300039437 Ga0436365_0566814 Ga0436365_0566814_567_920 114
356 3300039437 Ga0436365_1828125 Ga0436365_1828125_2002_2346 114
357 3300048905 Ga0496102_0068715 Ga0496102_0068715_2759_3103 114
358 3300049569 Ga0501032_0688659 Ga0501032_0688659_69_413 114
359 3300049571 Ga0501034_0173889 Ga0501034_0173889_312_656 114
360 3300049573 Ga0501037_0152168 Ga0501037_0152168_176_520 114
361 3300049574 Ga0501038_0134370 Ga0501038_0134370_715_1059 114
362 3300049581 Ga0501047_0314369 Ga0501047_0314369_137_481 114
363 3300049585 Ga0501069_0045493 Ga0501069_0045493_1981_2325 114
364 3300049585 Ga0501069_0640647 Ga0501069_0640647_164_508 114
365 3300049586 Ga0501070_0061415 Ga0501070_0061415_1062_1406 114
366 3300049589 Ga0501073_0021522 Ga0501073_0021522_2770_3114 114
367 3300049589 Ga0501073_0397268 Ga0501073_0397268_271_615 114
368 3300049590 Ga0501074_0355580 Ga0501074_0355580_159_503 114
369 3300049593 Ga0501077_0831454 Ga0501077_0831454_50_394 114
370 3300049741 Ga0501079_0290426 Ga0501079_0290426_741_1085 114
371 3300049741 Ga0501079_1321314 Ga0501079_1321314_155_499 114
372 3300049742 Ga0501080_0100594 Ga0501080_0100594_2143_2487 114
373 3300049744 Ga0501083_0028469 Ga0501083_0028469_2275_2619 114
374 3300049744 Ga0501083_0388204 Ga0501083_0388204_221_565 114
375 3300049822 Ga0501035_0177424 Ga0501035_0177424_1233_1577 114
376 3300049823 Ga0501044_0197490 Ga0501044_0197490_316_660 114
377 3300049823 Ga0501044_0928257 Ga0501044_0928257_217_561 114
378 3300054114 Ga0501084_0422737 Ga0501084_0422737_16_360 114
379 3300060353 Ga0501082_0019802 Ga0501082_0019802_809_1153 114
380 3300060353 Ga0501082_0626427 Ga0501082_0626427_184_528 114
381 2162886011 MRS1b_contig_285774 MRS1b_0766.00002840 115
382 2162886012 MBSR1b_contig_13052938 MBSR1b_0617.00000150 115
383 2162886012 MBSR1b_contig_1596674 MBSR1b_0904.00000530 115
384 2209111006 2214628271 2213659716 115
385 3300000042 ARSoilYngRDRAFT_c00203 ARSoilYngRDRAFT_002034 115
386 3300000043 ARcpr5yngRDRAFT_c000031 ARcpr5yngRDRAFT_0000319 115
387 3300000044 ARSoilOldRDRAFT_c000027 ARSoilOldRDRAFT_00002725 115
388 3300000045 ARCol0oldRDRAFT_c00076 ARCol0oldRDRAFT_000766 115
389 3300000652 ARCol0yngRDRAFT_1000016 ARCol0yngRDRAFT_100001625 115
390 3300001976 JGI24752J21851_1013836 JGI24752J21851_10138361 115
391 3300001977 JGI24746J21847_1000923 JGI24746J21847_10009234 115
392 3300001978 JGI24747J21853_1007884 JGI24747J21853_10078843 115
393 3300001979 JGI24740J21852_10054506 JGI24740J21852_100545063 115
394 3300001989 JGI24739J22299_10040565 JGI24739J22299_100405653 115
395 3300001990 JGI24737J22298_10002170 JGI24737J22298_100021708 115
396 3300001990 JGI24737J22298_10008902 JGI24737J22298_100089023 115
397 3300001990 JGI24737J22298_10011120 JGI24737J22298_100111202 115
398 3300001990 JGI24737J22298_10012710 JGI24737J22298_100127102 115
399 3300001991 JGI24743J22301_10004801 JGI24743J22301_100048013 115
400 3300002070 JGI24750J21931_1001342 JGI24750J21931_10013424 115
401 3300002073 JGI24745J21846_1000152 JGI24745J21846_10001524 115
402 3300002074 JGI24748J21848_1002289 JGI24748J21848_10022893 115
403 3300002075 JGI24738J21930_10000909 JGI24738J21930_100009097 115
404 3300002076 JGI24749J21850_1007700 JGI24749J21850_10077003 115
405 3300002077 JGI24744J21845_10002614 JGI24744J21845_100026143 115
406 3300002077 JGI24744J21845_10002742 JGI24744J21845_100027423 115
407 3300002126 JGI24035J26624_1000140 JGI24035J26624_10001403 115
408 3300002155 JGI24033J26618_1000697 JGI24033J26618_10006975 115
409 3300002239 JGI24034J26672_10000370 JGI24034J26672_100003707 115
410 3300002244 JGI24742J22300_10021793 JGI24742J22300_100217932 115
411 3300002459 JGI24751J29686_10025837 JGI24751J29686_100258373 115
412 3300002459 JGI24751J29686_10052399 JGI24751J29686_100523991 115
413 3300003214 JGI25165J46597_1054094 JGI25165J46597_10540941 115
414 3300005277 Ga0065716_1002003 Ga0065716_10020032 115
415 3300005288 Ga0065714_10229778 Ga0065714_102297782 115
416 3300005288 Ga0065714_10366413 Ga0065714_103664132 115
417 3300005289 Ga0065704_10004924 Ga0065704_100049248 115
418 3300005290 Ga0065712_10004249 Ga0065712_100042494 115
419 3300005290 Ga0065712_10069903 Ga0065712_100699035 115
420 3300005290 Ga0065712_10084253 Ga0065712_100842532 115
421 3300005293 Ga0065715_10005783 Ga0065715_100057834 115
422 3300005293 Ga0065715_10090726 Ga0065715_100907262 115
423 3300005293 Ga0065715_10193889 Ga0065715_101938893 115
424 3300005293 Ga0065715_10638147 Ga0065715_106381471 115
425 3300005295 Ga0065707_10182513 Ga0065707_101825131 115
426 3300005327 Ga0070658_10090733 Ga0070658_100907333 115
427 3300005328 Ga0070676_10650819 Ga0070676_106508191 115
428 3300005329 Ga0070683_100016231 Ga0070683_1000162317 115
429 3300005330 Ga0070690_100000972 Ga0070690_10000097216 115
430 3300005330 Ga0070690_100031108 Ga0070690_1000311083 115
431 3300005330 Ga0070690_100111001 Ga0070690_1001110011 115
432 3300005330 Ga0070690_100360277 Ga0070690_1003602771 115
433 3300005331 Ga0070670_100043184 Ga0070670_1000431843 115
434 3300005331 Ga0070670_100318698 Ga0070670_1003186982 115
435 3300005333 Ga0070677_10489080 Ga0070677_104890801 115
436 3300005334 Ga0068869_100028165 Ga0068869_1000281655 115
437 3300005334 Ga0068869_101212690 Ga0068869_1012126901 115
438 3300005335 Ga0070666_10029587 Ga0070666_100295872 115
439 3300005335 Ga0070666_10065487 Ga0070666_100654873 115
440 3300005335 Ga0070666_10131394 Ga0070666_101313943 115
441 3300005336 Ga0070680_100072254 Ga0070680_1000722543 115
442 3300005336 Ga0070680_100266293 Ga0070680_1002662933 115
443 3300005336 Ga0070680_100424387 Ga0070680_1004243872 115
444 3300005336 Ga0070680_101492006 Ga0070680_1014920061 115
445 3300005337 Ga0070682_100022243 Ga0070682_1000222434 115
446 3300005337 Ga0070682_100065660 Ga0070682_1000656603 115
447 3300005337 Ga0070682_100500616 Ga0070682_1005006162 115
448 3300005337 Ga0070682_101670143 Ga0070682_1016701431 115
449 3300005338 Ga0068868_100000287 Ga0068868_10000028713 115
450 3300005338 Ga0068868_100843474 Ga0068868_1008434742 115
451 3300005339 Ga0070660_100011348 Ga0070660_1000113487 115
452 3300005339 Ga0070660_100095616 Ga0070660_1000956163 115
453 3300005339 Ga0070660_100165868 Ga0070660_1001658682 115
454 3300005340 Ga0070689_100009382 Ga0070689_1000093827 115
455 3300005340 Ga0070689_100028894 Ga0070689_1000288943 115
456 3300005340 Ga0070689_100069911 Ga0070689_1000699111 115
457 3300005341 Ga0070691_10007546 Ga0070691_100075466 115
458 3300005341 Ga0070691_10050476 Ga0070691_100504763 115
459 3300005341 Ga0070691_10112563 Ga0070691_101125632 115
460 3300005343 Ga0070687_100006226 Ga0070687_1000062263 115
461 3300005343 Ga0070687_100038674 Ga0070687_1000386742 115
462 3300005344 Ga0070661_100014754 Ga0070661_1000147543 115
463 3300005344 Ga0070661_100483606 Ga0070661_1004836062 115
464 3300005344 Ga0070661_100558317 Ga0070661_1005583171 115
465 3300005344 Ga0070661_101897387 Ga0070661_1018973871 115
466 3300005345 Ga0070692_10003049 Ga0070692_100030493 115
467 3300005345 Ga0070692_10010883 Ga0070692_100108832 115
468 3300005347 Ga0070668_100072639 Ga0070668_1000726393 115
469 3300005353 Ga0070669_100005691 Ga0070669_10000569111 115
470 3300005353 Ga0070669_100018258 Ga0070669_1000182584 115
471 3300005354 Ga0070675_100051571 Ga0070675_1000515713 115
472 3300005355 Ga0070671_100033279 Ga0070671_1000332793 115
473 3300005355 Ga0070671_100103035 Ga0070671_1001030353 115
474 3300005355 Ga0070671_100355244 Ga0070671_1003552443 115
475 3300005356 Ga0070674_100056194 Ga0070674_1000561942 115
476 3300005356 Ga0070674_100716276 Ga0070674_1007162761 115
477 3300005364 Ga0070673_100014645 Ga0070673_1000146453 115
478 3300005364 Ga0070673_100483252 Ga0070673_1004832522 115
479 3300005365 Ga0070688_100001436 Ga0070688_1000014364 115
480 3300005365 Ga0070688_100008580 Ga0070688_1000085805 115
481 3300005365 Ga0070688_100205308 Ga0070688_1002053082 115
482 3300005366 Ga0070659_100015882 Ga0070659_1000158824 115
483 3300005366 Ga0070659_100059083 Ga0070659_1000590833 115
484 3300005367 Ga0070667_100009541 Ga0070667_1000095413 115
485 3300005367 Ga0070667_100060283 Ga0070667_1000602834 115
486 3300005367 Ga0070667_100074742 Ga0070667_1000747423 115
487 3300005367 Ga0070667_101421973 Ga0070667_1014219731 115
488 3300005406 Ga0070703_10010153 Ga0070703_100101533 115
489 3300005406 Ga0070703_10145990 Ga0070703_101459902 115
490 3300005434 Ga0070709_10029359 Ga0070709_100293593 115
491 3300005435 Ga0070714_100039918 Ga0070714_1000399184 115
492 3300005436 Ga0070713_100045425 Ga0070713_1000454252 115
493 3300005436 Ga0070713_100125089 Ga0070713_1001250893 115
494 3300005437 Ga0070710_10015364 Ga0070710_100153647 115
495 3300005437 Ga0070710_10030570 Ga0070710_100305703 115
496 3300005438 Ga0070701_10001244 Ga0070701_100012447 115
497 3300005438 Ga0070701_10253876 Ga0070701_102538761 115
498 3300005439 Ga0070711_100019451 Ga0070711_1000194513 115
499 3300005439 Ga0070711_100030277 Ga0070711_1000302773 115
500 3300005440 Ga0070705_100414548 Ga0070705_1004145482 115
501 3300005441 Ga0070700_100014256 Ga0070700_1000142564 115
502 3300005444 Ga0070694_100003715 Ga0070694_1000037157 115
503 3300005444 Ga0070694_100057360 Ga0070694_1000573603 115
504 3300005444 Ga0070694_101723693 Ga0070694_1017236932 115
505 3300005445 Ga0070708_100196674 Ga0070708_1001966741 115
506 3300005455 Ga0070663_100007417 Ga0070663_1000074178 115
507 3300005455 Ga0070663_100022554 Ga0070663_1000225543 115
508 3300005455 Ga0070663_100084684 Ga0070663_1000846843 115
509 3300005456 Ga0070678_100004742 Ga0070678_1000047427 115
510 3300005456 Ga0070678_100119811 Ga0070678_1001198113 115
511 3300005457 Ga0070662_100003647 Ga0070662_1000036473 115
512 3300005457 Ga0070662_100040160 Ga0070662_1000401603 115
513 3300005457 Ga0070662_100222516 Ga0070662_1002225162 115
514 3300005457 Ga0070662_100652425 Ga0070662_1006524252 115
515 3300005458 Ga0070681_10018191 Ga0070681_100181918 115
516 3300005458 Ga0070681_10061315 Ga0070681_100613154 115
517 3300005458 Ga0070681_10236909 Ga0070681_102369093 115
518 3300005459 Ga0068867_100029242 Ga0068867_1000292423 115
519 3300005466 Ga0070685_10001963 Ga0070685_100019633 115
520 3300005466 Ga0070685_11377201 Ga0070685_113772012 115
521 3300005467 Ga0070706_100990111 Ga0070706_1009901112 115
522 3300005468 Ga0070707_100210734 Ga0070707_1002107342 115
523 3300005471 Ga0070698_100594422 Ga0070698_1005944222 115
524 3300005518 Ga0070699_100400899 Ga0070699_1004008991 115
525 3300005530 Ga0070679_100109176 Ga0070679_1001091762 115
526 3300005530 Ga0070679_100276893 Ga0070679_1002768933 115
527 3300005530 Ga0070679_100786135 Ga0070679_1007861352 115
528 3300005530 Ga0070679_101486148 Ga0070679_1014861481 115
529 3300005535 Ga0070684_100075913 Ga0070684_1000759132 115
530 3300005535 Ga0070684_100267070 Ga0070684_1002670702 115
531 3300005539 Ga0068853_100033477 Ga0068853_1000334775 115
532 3300005539 Ga0068853_100053869 Ga0068853_1000538693 115
533 3300005539 Ga0068853_100808694 Ga0068853_1008086942 115
534 3300005539 Ga0068853_101827818 Ga0068853_1018278181 115
535 3300005543 Ga0070672_100008973 Ga0070672_1000089739 115
536 3300005543 Ga0070672_100267355 Ga0070672_1002673552 115
537 3300005544 Ga0070686_100031841 Ga0070686_1000318413 115
538 3300005544 Ga0070686_100038220 Ga0070686_1000382202 115
539 3300005544 Ga0070686_100157183 Ga0070686_1001571833 115
540 3300005545 Ga0070695_100035975 Ga0070695_1000359753 115
541 3300005545 Ga0070695_100312777 Ga0070695_1003127773 115
542 3300005545 Ga0070695_100357507 Ga0070695_1003575072 115
543 3300005546 Ga0070696_100006672 Ga0070696_1000066723 115
544 3300005546 Ga0070696_100012420 Ga0070696_1000124203 115
545 3300005546 Ga0070696_100110438 Ga0070696_1001104383 115
546 3300005546 Ga0070696_100200076 Ga0070696_1002000762 115
547 3300005547 Ga0070693_100003566 Ga0070693_1000035663 115
548 3300005547 Ga0070693_100076865 Ga0070693_1000768653 115
549 3300005547 Ga0070693_100363275 Ga0070693_1003632752 115
550 3300005547 Ga0070693_100962907 Ga0070693_1009629072 115
551 3300005547 Ga0070693_101347088 Ga0070693_1013470881 115
552 3300005548 Ga0070665_100014185 Ga0070665_1000141857 115
553 3300005548 Ga0070665_101573946 Ga0070665_1015739462 115
554 3300005549 Ga0070704_100003927 Ga0070704_1000039274 115
555 3300005563 Ga0068855_100031527 Ga0068855_1000315273 115
556 3300005563 Ga0068855_100476596 Ga0068855_1004765962 115
557 3300005564 Ga0070664_100022768 Ga0070664_1000227683 115
558 3300005564 Ga0070664_100071700 Ga0070664_1000717004 115
559 3300005564 Ga0070664_100090054 Ga0070664_1000900543 115
560 3300005564 Ga0070664_100598642 Ga0070664_1005986422 115
561 3300005564 Ga0070664_100867217 Ga0070664_1008672172 115
562 3300005577 Ga0068857_100006630 Ga0068857_1000066304 115
563 3300005577 Ga0068857_100124888 Ga0068857_1001248882 115
564 3300005578 Ga0068854_100519143 Ga0068854_1005191432 115
565 3300005578 Ga0068854_101354872 Ga0068854_1013548722 115
566 3300005614 Ga0068856_100037685 Ga0068856_1000376853 115
567 3300005614 Ga0068856_100067110 Ga0068856_1000671103 115
568 3300005614 Ga0068856_100753658 Ga0068856_1007536582 115
569 3300005615 Ga0070702_100135159 Ga0070702_1001351592 115
570 3300005615 Ga0070702_100274712 Ga0070702_1002747122 115
571 3300005616 Ga0068852_100010452 Ga0068852_1000104524 115
572 3300005616 Ga0068852_100332252 Ga0068852_1003322522 115
573 3300005617 Ga0068859_100054633 Ga0068859_1000546333 115
574 3300005617 Ga0068859_100079592 Ga0068859_1000795923 115
575 3300005618 Ga0068864_100026602 Ga0068864_1000266024 115
576 3300005618 Ga0068864_100502107 Ga0068864_1005021072 115
577 3300005718 Ga0068866_10007526 Ga0068866_100075264 115
578 3300005718 Ga0068866_10328552 Ga0068866_103285522 115
579 3300005719 Ga0068861_100007303 Ga0068861_1000073034 115
580 3300005719 Ga0068861_100070066 Ga0068861_1000700662 115
581 3300005834 Ga0068851_10298156 Ga0068851_102981563 115
582 3300005834 Ga0068851_10589823 Ga0068851_105898232 115
583 3300005840 Ga0068870_10007593 Ga0068870_100075934 115
584 3300005841 Ga0068863_100580920 Ga0068863_1005809203 115
585 3300005841 Ga0068863_101309895 Ga0068863_1013098952 115
586 3300005842 Ga0068858_100064184 Ga0068858_1000641844 115
587 3300005842 Ga0068858_100926117 Ga0068858_1009261172 115
588 3300005843 Ga0068860_100015452 Ga0068860_1000154523 115
589 3300005843 Ga0068860_100028463 Ga0068860_1000284633 115
590 3300005843 Ga0068860_100320286 Ga0068860_1003202863 115
591 3300005844 Ga0068862_100015822 Ga0068862_1000158227 115
592 3300005844 Ga0068862_100025065 Ga0068862_1000250653 115
593 3300005937 Ga0081455_10000009 Ga0081455_10000009219 115
594 3300006028 Ga0070717_10056737 Ga0070717_100567372 115
595 3300006028 Ga0070717_10063805 Ga0070717_100638053 115
596 3300006048 Ga0075363_100073902 Ga0075363_1000739022 115
597 3300006058 Ga0075432_10103079 Ga0075432_101030792 115
598 3300006163 Ga0070715_10011857 Ga0070715_100118572 115
599 3300006163 Ga0070715_10495614 Ga0070715_104956142 115
600 3300006173 Ga0070716_100406354 Ga0070716_1004063542 115
601 3300006175 Ga0070712_100315604 Ga0070712_1003156043 115
602 3300006175 Ga0070712_100381749 Ga0070712_1003817492 115
603 3300006175 Ga0070712_101613176 Ga0070712_1016131762 115
604 3300006178 Ga0075367_10063419 Ga0075367_100634193 115
605 3300006178 Ga0075367_10906292 Ga0075367_109062921 115
606 3300006237 Ga0097621_100000616 Ga0097621_1000006162 115
607 3300006237 Ga0097621_100008744 Ga0097621_1000087443 115
608 3300006353 Ga0075370_10532323 Ga0075370_105323231 115
609 3300006358 Ga0068871_100000922 Ga0068871_10000092219 115
610 3300006358 Ga0068871_100027615 Ga0068871_1000276153 115
611 3300006852 Ga0075433_10005782 Ga0075433_100057827 115
612 3300006852 Ga0075433_10214493 Ga0075433_102144932 115
613 3300006871 Ga0075434_100001367 Ga0075434_10000136719 115
614 3300006881 Ga0068865_100006916 Ga0068865_1000069163 115
615 3300006881 Ga0068865_100076762 Ga0068865_1000767624 115
616 3300006881 Ga0068865_100133440 Ga0068865_1001334403 115
617 3300006914 Ga0075436_100502389 Ga0075436_1005023892 115
618 3300006931 Ga0097620_100054629 Ga0097620_1000546293 115
619 3300006931 Ga0097620_100079594 Ga0097620_1000795943 115
620 3300007076 Ga0075435_100068616 Ga0075435_1000686164 115
621 3300007076 Ga0075435_100334541 Ga0075435_1003345413 115
622 3300009036 Ga0105244_10018443 Ga0105244_100184433 115
623 3300009093 Ga0105240_10223606 Ga0105240_102236063 115
624 3300009093 Ga0105240_10654969 Ga0105240_106549691 115
625 3300009094 Ga0111539_10013373 Ga0111539_100133734 115
626 3300009094 Ga0111539_10053737 Ga0111539_100537373 115
627 3300009098 Ga0105245_10004252 Ga0105245_1000425213 115
628 3300009098 Ga0105245_10148592 Ga0105245_101485923 115
629 3300009098 Ga0105245_10197571 Ga0105245_101975712 115
630 3300009098 Ga0105245_10240994 Ga0105245_102409943 115
631 3300009101 Ga0105247_10043793 Ga0105247_100437933 115
632 3300009101 Ga0105247_10072953 Ga0105247_100729532 115
633 3300009101 Ga0105247_10094973 Ga0105247_100949733 115
634 3300009101 Ga0105247_10111925 Ga0105247_101119253 115
635 3300009147 Ga0114129_11197944 Ga0114129_111979441 115
636 3300009148 Ga0105243_10018577 Ga0105243_100185778 115
637 3300009148 Ga0105243_10019863 Ga0105243_100198634 115
638 3300009148 Ga0105243_10111305 Ga0105243_101113052 115
639 3300009174 Ga0105241_10021402 Ga0105241_100214025 115
640 3300009174 Ga0105241_10212299 Ga0105241_102122992 115
641 3300009176 Ga0105242_10045458 Ga0105242_100454584 115
642 3300009176 Ga0105242_10177129 Ga0105242_101771292 115
643 3300009177 Ga0105248_10034642 Ga0105248_100346423 115
644 3300009177 Ga0105248_10035800 Ga0105248_100358005 115
645 3300009177 Ga0105248_10110124 Ga0105248_101101242 115
646 3300009545 Ga0105237_10008357 Ga0105237_1000835714 115
647 3300009545 Ga0105237_10035386 Ga0105237_100353863 115
648 3300009551 Ga0105238_10197036 Ga0105238_101970363 115
649 3300009553 Ga0105249_10029412 Ga0105249_100294123 115
650 3300009553 Ga0105249_10155472 Ga0105249_101554723 115
651 3300009553 Ga0105249_10351895 Ga0105249_103518952 115
652 3300010375 Ga0105239_10025073 Ga0105239_100250733 115
653 3300010375 Ga0105239_10100256 Ga0105239_101002563 115
654 3300010375 Ga0105239_10519024 Ga0105239_105190242 115
655 3300010375 Ga0105239_12056114 Ga0105239_120561142 115
656 3300010375 Ga0105239_12551558 Ga0105239_125515582 115
657 3300011119 Ga0105246_10259260 Ga0105246_102592602 115
658 3300011119 Ga0105246_10287281 Ga0105246_102872812 115
659 3300011119 Ga0105246_10703456 Ga0105246_107034562 115
660 3300012476 Ga0157344_1003072 Ga0157344_10030722 115
661 3300012478 Ga0157328_1004315 Ga0157328_10043152 115
662 3300012481 Ga0157320_1000803 Ga0157320_10008032 115
663 3300012494 Ga0157341_1016513 Ga0157341_10165132 115
664 3300012502 Ga0157347_1060145 Ga0157347_10601451 115
665 3300012515 Ga0157338_1000546 Ga0157338_10005462 115
666 3300013100 Ga0157373_10007606 Ga0157373_100076063 115
667 3300013100 Ga0157373_10886556 Ga0157373_108865562 115
668 3300013102 Ga0157371_10038816 Ga0157371_100388163 115
669 3300013104 Ga0157370_10032359 Ga0157370_100323595 115
670 3300013105 Ga0157369_10196398 Ga0157369_101963982 115
671 3300013105 Ga0157369_10584456 Ga0157369_105844562 115
672 3300013296 Ga0157374_10015848 Ga0157374_100158488 115
673 3300013296 Ga0157374_10164647 Ga0157374_101646471 115
674 3300013296 Ga0157374_10933225 Ga0157374_109332251 115
675 3300013297 Ga0157378_10007970 Ga0157378_100079703 115
676 3300013297 Ga0157378_10429633 Ga0157378_104296333 115
677 3300013297 Ga0157378_12902846 Ga0157378_129028462 115
678 3300013306 Ga0163162_10014117 Ga0163162_100141174 115
679 3300013306 Ga0163162_10048102 Ga0163162_100481023 115
680 3300013306 Ga0163162_10087113 Ga0163162_100871133 115
681 3300013307 Ga0157372_12011138 Ga0157372_120111382 115
682 3300013308 Ga0157375_10017624 Ga0157375_100176247 115
683 3300013308 Ga0157375_10060051 Ga0157375_100600513 115
684 3300013308 Ga0157375_10281074 Ga0157375_102810743 115
685 3300014325 Ga0163163_10001820 Ga0163163_100018204 115
686 3300014325 Ga0163163_12469721 Ga0163163_124697212 115
687 3300014326 Ga0157380_10009315 Ga0157380_100093158 115
688 3300014326 Ga0157380_10140795 Ga0157380_101407953 115
689 3300014326 Ga0157380_12613610 Ga0157380_126136101 115
690 3300014745 Ga0157377_10004131 Ga0157377_100041318 115
691 3300014745 Ga0157377_10154484 Ga0157377_101544842 115
692 3300014968 Ga0157379_10001178 Ga0157379_100011783 115
693 3300014968 Ga0157379_10118428 Ga0157379_101184284 115
694 3300014968 Ga0157379_10330904 Ga0157379_103309042 115
695 3300014968 Ga0157379_10485136 Ga0157379_104851362 115
696 3300014969 Ga0157376_10007479 Ga0157376_1000747910 115
697 3300014969 Ga0157376_10067889 Ga0157376_100678894 115
698 3300014969 Ga0157376_11216154 Ga0157376_112161542 115
699 3300017792 Ga0163161_10006785 Ga0163161_100067857 115
700 3300017792 Ga0163161_10118150 Ga0163161_101181503 115
701 3300017792 Ga0163161_10646958 Ga0163161_106469581 115
702 3300025261 Ga0209233_1026909 Ga0209233_10269093 115
703 3300025271 Ga0207666_1000090 Ga0207666_10000903 115
704 3300025271 Ga0207666_1012978 Ga0207666_10129782 115
705 3300025290 Ga0207673_1000112 Ga0207673_10001122 115
706 3300025315 Ga0207697_10000579 Ga0207697_1000057921 115
707 3300025315 Ga0207697_10007823 Ga0207697_100078233 115
708 3300025728 Ga0207655_1172023 Ga0207655_11720232 115
709 3300025885 Ga0207653_10002769 Ga0207653_100027695 115
710 3300025893 Ga0207682_10008278 Ga0207682_100082783 115
711 3300025898 Ga0207692_10035418 Ga0207692_100354183 115
712 3300025898 Ga0207692_10666300 Ga0207692_106663002 115
713 3300025899 Ga0207642_10051826 Ga0207642_100518263 115
714 3300025899 Ga0207642_10205855 Ga0207642_102058553 115
715 3300025899 Ga0207642_10918754 Ga0207642_109187542 115
716 3300025900 Ga0207710_10025350 Ga0207710_100253502 115
717 3300025900 Ga0207710_10035930 Ga0207710_100359302 115
718 3300025901 Ga0207688_10001006 Ga0207688_100010064 115
719 3300025901 Ga0207688_10047793 Ga0207688_100477933 115
720 3300025903 Ga0207680_10045487 Ga0207680_100454873 115
721 3300025903 Ga0207680_10142652 Ga0207680_101426522 115
722 3300025903 Ga0207680_10150354 Ga0207680_101503542 115
723 3300025903 Ga0207680_11173183 Ga0207680_111731832 115
724 3300025904 Ga0207647_10025960 Ga0207647_100259603 115
725 3300025904 Ga0207647_10125642 Ga0207647_101256421 115
726 3300025905 Ga0207685_10091124 Ga0207685_100911242 115
727 3300025906 Ga0207699_10090706 Ga0207699_100907062 115
728 3300025907 Ga0207645_10001020 Ga0207645_1000102023 115
729 3300025907 Ga0207645_10118774 Ga0207645_101187743 115
730 3300025908 Ga0207643_10000523 Ga0207643_1000052323 115
731 3300025909 Ga0207705_10658128 Ga0207705_106581282 115
732 3300025910 Ga0207684_10245846 Ga0207684_102458462 115
733 3300025911 Ga0207654_10047157 Ga0207654_100471573 115
734 3300025912 Ga0207707_10018497 Ga0207707_100184973 115
735 3300025912 Ga0207707_10046164 Ga0207707_100461642 115
736 3300025912 Ga0207707_10061465 Ga0207707_100614654 115
737 3300025913 Ga0207695_10321834 Ga0207695_103218343 115
738 3300025913 Ga0207695_10361672 Ga0207695_103616722 115
739 3300025914 Ga0207671_10702584 Ga0207671_107025841 115
740 3300025915 Ga0207693_10053468 Ga0207693_100534682 115
741 3300025915 Ga0207693_10242740 Ga0207693_102427402 115
742 3300025916 Ga0207663_10056960 Ga0207663_100569603 115
743 3300025916 Ga0207663_10109844 Ga0207663_101098443 115
744 3300025917 Ga0207660_10014892 Ga0207660_100148924 115
745 3300025917 Ga0207660_10072595 Ga0207660_100725953 115
746 3300025917 Ga0207660_10154346 Ga0207660_101543462 115
747 3300025917 Ga0207660_10349925 Ga0207660_103499252 115
748 3300025918 Ga0207662_10002710 Ga0207662_100027107 115
749 3300025918 Ga0207662_10045130 Ga0207662_100451303 115
750 3300025919 Ga0207657_10005692 Ga0207657_100056923 115
751 3300025919 Ga0207657_10218444 Ga0207657_102184441 115
752 3300025919 Ga0207657_10346682 Ga0207657_103466823 115
753 3300025919 Ga0207657_10784052 Ga0207657_107840522 115
754 3300025920 Ga0207649_10004225 Ga0207649_100042252 115
755 3300025920 Ga0207649_10414858 Ga0207649_104148582 115
756 3300025921 Ga0207652_10018458 Ga0207652_100184583 115
757 3300025921 Ga0207652_10169410 Ga0207652_101694102 115
758 3300025921 Ga0207652_10180024 Ga0207652_101800242 115
759 3300025921 Ga0207652_10187627 Ga0207652_101876272 115
760 3300025921 Ga0207652_10238457 Ga0207652_102384572 115
761 3300025923 Ga0207681_10004280 Ga0207681_100042806 115
762 3300025923 Ga0207681_10048111 Ga0207681_100481113 115
763 3300025924 Ga0207694_10170903 Ga0207694_101709032 115
764 3300025925 Ga0207650_10003662 Ga0207650_100036627 115
765 3300025925 Ga0207650_10107215 Ga0207650_101072152 115
766 3300025926 Ga0207659_10002130 Ga0207659_1000213010 115
767 3300025926 Ga0207659_10266340 Ga0207659_102663402 115
768 3300025926 Ga0207659_11261056 Ga0207659_112610561 115
769 3300025927 Ga0207687_10010078 Ga0207687_100100783 115
770 3300025927 Ga0207687_10051449 Ga0207687_100514493 115
771 3300025928 Ga0207700_10051330 Ga0207700_100513303 115
772 3300025928 Ga0207700_10107794 Ga0207700_101077942 115
773 3300025929 Ga0207664_10014304 Ga0207664_100143043 115
774 3300025931 Ga0207644_10006560 Ga0207644_100065605 115
775 3300025931 Ga0207644_10417776 Ga0207644_104177763 115
776 3300025932 Ga0207690_10003881 Ga0207690_100038818 115
777 3300025932 Ga0207690_10077141 Ga0207690_100771413 115
778 3300025932 Ga0207690_10082766 Ga0207690_100827663 115
779 3300025933 Ga0207706_10004561 Ga0207706_1000456116 115
780 3300025933 Ga0207706_10057842 Ga0207706_100578423 115
781 3300025933 Ga0207706_10118814 Ga0207706_101188143 115
782 3300025934 Ga0207686_10002841 Ga0207686_100028417 115
783 3300025934 Ga0207686_10032302 Ga0207686_100323023 115
784 3300025934 Ga0207686_10075927 Ga0207686_100759273 115
785 3300025935 Ga0207709_10003952 Ga0207709_100039523 115
786 3300025935 Ga0207709_10476299 Ga0207709_104762992 115
787 3300025936 Ga0207670_10020819 Ga0207670_100208195 115
788 3300025936 Ga0207670_10348513 Ga0207670_103485132 115
789 3300025937 Ga0207669_10000737 Ga0207669_100007374 115
790 3300025937 Ga0207669_10052926 Ga0207669_100529263 115
791 3300025938 Ga0207704_10209749 Ga0207704_102097492 115
792 3300025939 Ga0207665_10381703 Ga0207665_103817032 115
793 3300025939 Ga0207665_10434307 Ga0207665_104343072 115
794 3300025940 Ga0207691_10004854 Ga0207691_1000485416 115
795 3300025941 Ga0207711_10073214 Ga0207711_100732143 115
796 3300025941 Ga0207711_10127495 Ga0207711_101274953 115
797 3300025941 Ga0207711_10129249 Ga0207711_101292492 115
798 3300025942 Ga0207689_10001399 Ga0207689_1000139924 115
799 3300025942 Ga0207689_10516693 Ga0207689_105166932 115
800 3300025944 Ga0207661_12143474 Ga0207661_121434742 115
801 3300025945 Ga0207679_10000829 Ga0207679_1000082919 115
802 3300025945 Ga0207679_10071037 Ga0207679_100710372 115
803 3300025945 Ga0207679_10364537 Ga0207679_103645372 115
804 3300025945 Ga0207679_10440271 Ga0207679_104402712 115
805 3300025945 Ga0207679_10463020 Ga0207679_104630203 115
806 3300025949 Ga0207667_10057202 Ga0207667_100572025 115
807 3300025949 Ga0207667_10934397 Ga0207667_109343972 115
808 3300025960 Ga0207651_10006082 Ga0207651_100060822 115
809 3300025960 Ga0207651_10111984 Ga0207651_101119843 115
810 3300025960 Ga0207651_10147297 Ga0207651_101472972 115
811 3300025961 Ga0207712_10052478 Ga0207712_100524782 115
812 3300025961 Ga0207712_10180598 Ga0207712_101805982 115
813 3300025961 Ga0207712_10576067 Ga0207712_105760672 115
814 3300025972 Ga0207668_10002780 Ga0207668_1000278010 115
815 3300025972 Ga0207668_10059050 Ga0207668_100590503 115
816 3300025981 Ga0207640_10003641 Ga0207640_100036413 115
817 3300025981 Ga0207640_10855539 Ga0207640_108555392 115
818 3300025986 Ga0207658_10014267 Ga0207658_100142673 115
819 3300025986 Ga0207658_10652374 Ga0207658_106523742 115
820 3300025986 Ga0207658_10889762 Ga0207658_108897622 115
821 3300026023 Ga0207677_10092877 Ga0207677_100928772 115
822 3300026023 Ga0207677_10936077 Ga0207677_109360772 115
823 3300026035 Ga0207703_10005080 Ga0207703_100050809 115
824 3300026041 Ga0207639_10036135 Ga0207639_100361354 115
825 3300026041 Ga0207639_10065082 Ga0207639_100650823 115
826 3300026067 Ga0207678_10001694 Ga0207678_1000169420 115
827 3300026067 Ga0207678_10109778 Ga0207678_101097783 115
828 3300026067 Ga0207678_10120447 Ga0207678_101204473 115
829 3300026075 Ga0207708_10003453 Ga0207708_100034533 115
830 3300026075 Ga0207708_10022048 Ga0207708_100220486 115
831 3300026078 Ga0207702_10010469 Ga0207702_100104696 115
832 3300026078 Ga0207702_10613610 Ga0207702_106136101 115
833 3300026089 Ga0207648_10002393 Ga0207648_100023933 115
834 3300026089 Ga0207648_10050827 Ga0207648_100508274 115
835 3300026095 Ga0207676_10005110 Ga0207676_100051107 115
836 3300026095 Ga0207676_11007531 Ga0207676_110075312 115
837 3300026116 Ga0207674_10058986 Ga0207674_100589863 115
838 3300026116 Ga0207674_10832128 Ga0207674_108321282 115
839 3300026118 Ga0207675_100001715 Ga0207675_10000171520 115
840 3300026118 Ga0207675_100057767 Ga0207675_1000577672 115
841 3300026118 Ga0207675_100236665 Ga0207675_1002366652 115
842 3300026121 Ga0207683_10001190 Ga0207683_1000119020 115
843 3300026121 Ga0207683_10013747 Ga0207683_1001374710 115
844 3300027543 Ga0209999_1036586 Ga0209999_10365862 115
845 3300027552 Ga0209982_1004172 Ga0209982_10041723 115
846 3300027614 Ga0209970_1016555 Ga0209970_10165553 115
847 3300027617 Ga0210002_1000122 Ga0210002_10001222 115
848 3300027665 Ga0209983_1017838 Ga0209983_10178382 115
849 3300027682 Ga0209971_1009205 Ga0209971_10092053 115
850 3300027695 Ga0209966_1000667 Ga0209966_10006673 115
851 3300027717 Ga0209998_10001805 Ga0209998_100018056 115
852 3300027717 Ga0209998_10007762 Ga0209998_100077622 115
853 3300027876 Ga0209974_10000486 Ga0209974_1000048614 115
854 3300027876 Ga0209974_10036353 Ga0209974_100363533 115
855 3300027907 Ga0207428_10001434 Ga0207428_100014348 115
856 3300027907 Ga0207428_10019935 Ga0207428_100199356 115
857 3300028379 Ga0268266_10016607 Ga0268266_100166076 115
858 3300028379 Ga0268266_11861489 Ga0268266_118614892 115
859 3300028380 Ga0268265_10068406 Ga0268265_100684062 115
860 3300028380 Ga0268265_10430445 Ga0268265_104304452 115
861 3300028381 Ga0268264_10009868 Ga0268264_100098682 115
862 3300028381 Ga0268264_10037830 Ga0268264_100378303 115
863 3300028577 Ga0265318_10187235 Ga0265318_101872351 115
864 3300028800 Ga0265338_10134384 Ga0265338_101343842 115
865 3300031235 Ga0265330_10020395 Ga0265330_100203955 115
866 3300031241 Ga0265325_10000048 Ga0265325_1000004885 115
867 3300031241 Ga0265325_10025252 Ga0265325_100252523 115
868 3300031241 Ga0265325_10048132 Ga0265325_100481323 115
869 3300031247 Ga0265340_10237127 Ga0265340_102371272 115
870 3300031249 Ga0265339_10150552 Ga0265339_101505522 115
871 3300031250 Ga0265331_10009513 Ga0265331_100095138 115
872 3300031344 Ga0265316_10200564 Ga0265316_102005643 115
873 3300031344 Ga0265316_10258928 Ga0265316_102589282 115
874 3300031595 Ga0265313_10028748 Ga0265313_100287482 115
875 3300031595 Ga0265313_10139333 Ga0265313_101393332 115
876 3300031665 Ga0316575_10024682 Ga0316575_100246823 115
877 3300031711 Ga0265314_10005957 Ga0265314_100059575 115
878 3300034816 Ga0373930_0015286 Ga0373930_0015286_979_1326 115
879 3300034816 Ga0373930_0033680 Ga0373930_0033680_19_366 115
880 3300034816 Ga0373930_0038718 Ga0373930_0038718_458_805 115
881 3300034817 Ga0373948_0000410 Ga0373948_0000410_4259_4606 115
882 3300034817 Ga0373948_0217720 Ga0373948_0217720_108_455 115
883 3300034818 Ga0373950_0000808 Ga0373950_0000808_3455_3802 115
884 3300034819 Ga0373958_0001617 Ga0373958_0001617_2486_2833 115
885 3300034819 Ga0373958_0004911 Ga0373958_0004911_1112_1459 115
886 3300034819 Ga0373958_0080361 Ga0373958_0080361_195_542 115
887 3300034957 Ga0373938_0000681 Ga0373938_0000681_4378_4725 115
888 3300035083 Ga0373926_0065910 Ga0373926_0065910_357_704 115
889 3300035084 Ga0373928_0004171 Ga0373928_0004171_1558_1905 115
890 3300035084 Ga0373928_0005886 Ga0373928_0005886_13_360 115
891 3300035085 Ga0373929_0001045 Ga0373929_0001045_2893_3240 115
892 3300035085 Ga0373929_0015912 Ga0373929_0015912_992_1339 115
893 3300035086 Ga0373934_0068557 Ga0373934_0068557_536_883 115
894 3300035086 Ga0373934_0071466 Ga0373934_0071466_51_398 115
895 3300035086 Ga0373934_0168069 Ga0373934_0168069_153_500 115
896 3300035088 Ga0373940_0000034 Ga0373940_0000034_7436_7783 115
897 3300035088 Ga0373940_0001993 Ga0373940_0001993_935_1282 115
898 3300035089 Ga0373944_0019469 Ga0373944_0019469_587_934 115
899 3300035090 Ga0373949_0001494 Ga0373949_0001494_2127_2474 115
900 3300035090 Ga0373949_0023580 Ga0373949_0023580_694_1041 115
901 3300035090 Ga0373949_0040187 Ga0373949_0040187_223_570 115
902 3300035090 Ga0373949_0268000 Ga0373949_0268000_33_380 115
903 3300035091 Ga0373951_0006726 Ga0373951_0006726_457_804 115
904 3300035091 Ga0373951_0019160 Ga0373951_0019160_1139_1486 115
905 3300035092 Ga0373952_0000499 Ga0373952_0000499_2386_2733 115
906 3300035092 Ga0373952_0026576 Ga0373952_0026576_82_429 115
907 3300035111 Ga0373923_0035431 Ga0373923_0035431_1025_1372 115
908 3300035111 Ga0373923_0127098 Ga0373923_0127098_364_711 115
909 3300035111 Ga0373923_0181010 Ga0373923_0181010_258_605 115
910 3300035112 Ga0373932_0000153 Ga0373932_0000153_14686_15033 115
911 3300035112 Ga0373932_0003391 Ga0373932_0003391_1905_2252 115
912 3300035114 Ga0373939_0000182 Ga0373939_0000182_14799_15146 115
913 3300035114 Ga0373939_0001329 Ga0373939_0001329_2802_3149 115
914 3300035114 Ga0373939_0143332 Ga0373939_0143332_429_776 115
915 3300035115 Ga0373941_0000351 Ga0373941_0000351_2272_2619 115
916 3300035115 Ga0373941_0064242 Ga0373941_0064242_727_1074 115
917 3300035116 Ga0373945_0107321 Ga0373945_0107321_59_406 115
918 3300035117 Ga0373953_0010294 Ga0373953_0010294_1350_1697 115
919 3300035118 Ga0373954_0027838 Ga0373954_0027838_290_637 115
920 3300035118 Ga0373954_0253155 Ga0373954_0253155_114_461 115
921 3300035119 Ga0373956_0007365 Ga0373956_0007365_2231_2578 115
922 3300035119 Ga0373956_0022400 Ga0373956_0022400_944_1291 115
923 3300035119 Ga0373956_0123625 Ga0373956_0123625_249_596 115
924 3300035119 Ga0373956_0156836 Ga0373956_0156836_252_599 115
925 3300035120 Ga0373957_0031423 Ga0373957_0031423_336_683 115
926 3300035120 Ga0373957_0054574 Ga0373957_0054574_454_801 115
927 3300035120 Ga0373957_0147804 Ga0373957_0147804_378_725 115
928 3300035121 Ga0373960_0000322 Ga0373960_0000322_6093_6440 115
929 3300035121 Ga0373960_0062962 Ga0373960_0062962_223_570 115
930 3300035170 Ga0373943_0935381 Ga0373943_0935381_118_465 115
931 3300035171 Ga0373946_0007767 Ga0373946_0007767_3362_3709 115
932 3300035172 Ga0373955_0003725 Ga0373955_0003725_2552_2899 115
933 3300035172 Ga0373955_0009409 Ga0373955_0009409_1109_1456 115
934 3300035172 Ga0373955_0036131 Ga0373955_0036131_1149_1496 115
935 3300035172 Ga0373955_0672880 Ga0373955_0672880_48_395 115
936 3300035172 Ga0373955_0807047 Ga0373955_0807047_73_420 115
937 3300035207 Ga0373942_0000405 Ga0373942_0000405_6475_6822 115
938 3300035207 Ga0373942_0015907 Ga0373942_0015907_826_1173 115
939 3300035241 Ga0373961_0001013 Ga0373961_0001013_2241_2588 115
940 3300035241 Ga0373961_0048773 Ga0373961_0048773_67_414 115
941 3300035241 Ga0373961_0304116 Ga0373961_0304116_222_569 115
942 3300035242 Ga0373962_0001641 Ga0373962_0001641_674_1021 115
943 3300035242 Ga0373962_0001705 Ga0373962_0001705_223_570 115
944 3300035410 Ga0373924_0008230 Ga0373924_0008230_694_1041 115
945 3300035410 Ga0373924_0196540 Ga0373924_0196540_90_437 115
946 3300035691 Ga0373931_0046111 Ga0373931_0046111_577_924 115
947 3300035691 Ga0373931_0242259 Ga0373931_0242259_289_636 115
948 3300035691 Ga0373931_1061369 Ga0373931_1061369_155_502 115
949 3300035692 Ga0373935_0124050 Ga0373935_0124050_304_651 115
950 3300035695 Ga0373927_0032885 Ga0373927_0032885_880_1227 115
951 3300035724 Ga0373933_0004422 Ga0373933_0004422_4959_5306 115
952 3300035724 Ga0373933_0066670 Ga0373933_0066670_1399_1746 115
953 3300035724 Ga0373933_0070080 Ga0373933_0070080_1576_1923 115
954 3300035725 Ga0373947_0677090 Ga0373947_0677090_13_360 115
955 3300036401 Ga0373937_0014903 Ga0373937_0014903_2409_2756 115
956 3300036401 Ga0373937_0017492 Ga0373937_0017492_4581_4928 115
957 3300036401 Ga0373937_0048364 Ga0373937_0048364_2476_2823 115
958 3300036401 Ga0373937_0150711 Ga0373937_0150711_1009_1356 115
959 3300036647 Ga0316582_0316671 Ga0316582_0316671_168_515 115
960 3300037068 Ga0373925_0134404 Ga0373925_0134404_1342_1689 115
961 3300037068 Ga0373925_1225309 Ga0373925_1225309_121_468 115
962 3300041408 Ga0439453_0111251 Ga0439453_0111251_66_413 115
963 3300042439 Ga0439464_0032655 Ga0439464_0032655_109_456 115
964 3300042876 Ga0451577_0158113 Ga0451577_0158113_276_623 115
965 3300042993 Ga0439440_0021628 Ga0439440_0021628_954_1301 115
966 3300044712 Ga0453684_0605479 Ga0453684_0605479_488_835 115
967 3300045051 Ga0451576_0173408 Ga0451576_0173408_801_1148 115
968 3300046454 Ga0495592_0001176 Ga0495592_0001176_1951_2298 115
969 3300046454 Ga0495592_0136082 Ga0495592_0136082_1077_1424 115
970 3300046455 Ga0495603_0233395 Ga0495603_0233395_272_619 115
971 3300046459 Ga0495629_0038860 Ga0495629_0038860_1078_1425 115
972 3300046460 Ga0495638_0155149 Ga0495638_0155149_273_620 115
973 3300046461 Ga0495641_0238020 Ga0495641_0238020_195_542 115
974 3300046462 Ga0495651_0000921 Ga0495651_0000921_2172_2519 115
975 3300046462 Ga0495651_0112899 Ga0495651_0112899_77_424 115
976 3300046463 Ga0495653_0001436 Ga0495653_0001436_8791_9138 115
977 3300046463 Ga0495653_0114518 Ga0495653_0114518_461_808 115
978 3300046463 Ga0495653_0251071 Ga0495653_0251071_545_892 115
979 3300046472 Ga0495580_0377888 Ga0495580_0377888_211_558 115
980 3300046473 Ga0495582_0077819 Ga0495582_0077819_625_972 115
981 3300046475 Ga0495639_0168167 Ga0495639_0168167_595_942 115
982 3300046475 Ga0495639_0258397 Ga0495639_0258397_228_575 115
983 3300046476 Ga0495662_0070535 Ga0495662_0070535_736_1083 115
984 3300046477 Ga0495664_0027048 Ga0495664_0027048_1741_2088 115
985 3300046477 Ga0495664_0070680 Ga0495664_0070680_1664_2011 115
986 3300046499 Ga0495594_0169787 Ga0495594_0169787_874_1221 115
987 3300046511 Ga0495608_0001582 Ga0495608_0001582_8472_8819 115
988 3300046511 Ga0495608_0113647 Ga0495608_0113647_236_583 115
989 3300046514 Ga0495618_0033958 Ga0495618_0033958_1487_1834 115
990 3300046516 Ga0495628_0012601 Ga0495628_0012601_3481_3828 115
991 3300046516 Ga0495628_0201686 Ga0495628_0201686_75_422 115
992 3300046517 Ga0495630_0178246 Ga0495630_0178246_911_1258 115
993 3300046517 Ga0495630_0821357 Ga0495630_0821357_130_477 115
994 3300046523 Ga0495644_0197672 Ga0495644_0197672_28_375 115
995 3300046526 Ga0495666_0216948 Ga0495666_0216948_36_383 115
996 3300046529 Ga0495652_0117918 Ga0495652_0117918_1214_1561 115
997 3300046529 Ga0495652_0252975 Ga0495652_0252975_55_402 115
998 3300046531 Ga0495665_0035534 Ga0495665_0035534_1141_1488 115
999 3300046531 Ga0495665_0397386 Ga0495665_0397386_222_569 115
1000 3300046533 Ga0495640_0047836 Ga0495640_0047836_902_1249 115
1001 3300046533 Ga0495640_0387326 Ga0495640_0387326_387_734 115
1002 3300046535 Ga0495586_0012264 Ga0495586_0012264_1494_1841 115
1003 3300046536 Ga0495587_0008788 Ga0495587_0008788_4524_4871 115
1004 3300046536 Ga0495587_0067974 Ga0495587_0067974_247_594 115
1005 3300046536 Ga0495587_0184009 Ga0495587_0184009_52_399 115
1006 3300046536 Ga0495587_0236508 Ga0495587_0236508_72_419 115
1007 3300046543 Ga0495645_0062076 Ga0495645_0062076_947_1294 115
1008 3300046543 Ga0495645_0103777 Ga0495645_0103777_724_1071 115
1009 3300046543 Ga0495645_0700649 Ga0495645_0700649_50_397 115
1010 3300046559 Ga0495667_0076608 Ga0495667_0076608_510_857 115
1011 3300046559 Ga0495667_0081908 Ga0495667_0081908_1208_1555 115
1012 3300046559 Ga0495667_0117346 Ga0495667_0117346_1072_1419 115
1013 3300046642 Ga0495634_0055078 Ga0495634_0055078_838_1185 115
1014 3300046663 Ga0495635_0007233 Ga0495635_0007233_3050_3397 115
1015 3300046663 Ga0495635_0062421 Ga0495635_0062421_985_1332 115
1016 3300046663 Ga0495635_0104544 Ga0495635_0104544_416_763 115
1017 3300046663 Ga0495635_0132807 Ga0495635_0132807_231_578 115
1018 3300046663 Ga0495635_0156761 Ga0495635_0156761_443_790 115
1019 3300046674 Ga0495588_0683567 Ga0495588_0683567_145_492 115
1020 3300046675 Ga0495657_0005844 Ga0495657_0005844_2936_3283 115
1021 3300046675 Ga0495657_0191333 Ga0495657_0191333_36_383 115
1022 3300046678 Ga0495599_0006246 Ga0495599_0006246_999_1346 115
1023 3300046678 Ga0495599_0020143 Ga0495599_0020143_2146_2493 115
1024 3300046679 Ga0495623_0005873 Ga0495623_0005873_6025_6372 115
1025 3300046679 Ga0495623_0050706 Ga0495623_0050706_423_770 115
1026 3300046680 Ga0495646_0171435 Ga0495646_0171435_324_671 115
1027 3300046681 Ga0495647_0187987 Ga0495647_0187987_426_773 115
1028 3300046683 Ga0495658_0086285 Ga0495658_0086285_490_837 115
1029 3300046689 Ga0495613_0856238 Ga0495613_0856238_126_473 115
1030 3300046690 Ga0495624_0470836 Ga0495624_0470836_197_544 115
1031 3300046809 Ga0495600_0071447 Ga0495600_0071447_1484_1831 115
1032 3300046809 Ga0495600_0108162 Ga0495600_0108162_1097_1444 115
1033 3300046809 Ga0495600_0202556 Ga0495600_0202556_188_535 115
1034 3300046809 Ga0495600_0296046 Ga0495600_0296046_432_779 115
1035 3300047315 Ga0495581_0298574 Ga0495581_0298574_521_868 115
1036 3300047315 Ga0495581_0331754 Ga0495581_0331754_504_851 115
1037 3300047317 Ga0495604_0005412 Ga0495604_0005412_1439_1786 115
1038 3300047317 Ga0495604_0018521 Ga0495604_0018521_569_916 115
1039 3300047317 Ga0495604_0034540 Ga0495604_0034540_3541_3888 115
1040 3300047317 Ga0495604_0109429 Ga0495604_0109429_1422_1769 115
1041 3300047319 Ga0495674_0012552 Ga0495674_0012552_6685_7032 115
1042 3300047319 Ga0495674_0044171 Ga0495674_0044171_972_1319 115
1043 3300047319 Ga0495674_0092176 Ga0495674_0092176_2227_2574 115
1044 3300047322 Ga0495680_0013950 Ga0495680_0013950_5544_5891 115
1045 3300047322 Ga0495680_0175710 Ga0495680_0175710_32_379 115
1046 3300047322 Ga0495680_0176720 Ga0495680_0176720_410_757 115
1047 3300047322 Ga0495680_0711110 Ga0495680_0711110_177_524 115
1048 3300047444 Ga0495675_0002919 Ga0495675_0002919_6685_7032 115
1049 3300047444 Ga0495675_0029357 Ga0495675_0029357_2049_2396 115
1050 3300047444 Ga0495675_0254488 Ga0495675_0254488_668_1015 115
1051 3300047673 Ga0495593_0083148 Ga0495593_0083148_475_822 115
1052 3300048088 Ga0495602_0000618 Ga0495602_0000618_13224_13571 115
1053 3300048088 Ga0495602_0010978 Ga0495602_0010978_7906_8253 115
1054 3300048088 Ga0495602_0362367 Ga0495602_0362367_569_916 115
1055 3300048089 Ga0495614_0211586 Ga0495614_0211586_153_500 115
1056 3300048091 Ga0495626_0406313 Ga0495626_0406313_62_409 115
1057 3300048903 Ga0496100_0008731 Ga0496100_0008731_1151_1498 115
1058 3300048903 Ga0496100_0011005 Ga0496100_0011005_2472_2819 115
1059 3300048904 Ga0496101_0193177 Ga0496101_0193177_340_687 115
1060 3300048904 Ga0496101_0244250 Ga0496101_0244250_889_1236 115
1061 3300048904 Ga0496101_0424264 Ga0496101_0424264_634_981 115
1062 3300048904 Ga0496101_0594558 Ga0496101_0594558_137_484 115
1063 3300048905 Ga0496102_0009606 Ga0496102_0009606_4152_4499 115
1064 3300048905 Ga0496102_1519250 Ga0496102_1519250_126_473 115
1065 3300048906 Ga0496103_0006551 Ga0496103_0006551_1943_2290 115
1066 3300048906 Ga0496103_0043635 Ga0496103_0043635_1310_1657 115
1067 3300048906 Ga0496103_0258265 Ga0496103_0258265_260_607 115
1068 3300048907 Ga0496104_0000196 Ga0496104_0000196_27286_27633 115
1069 3300048907 Ga0496104_0003411 Ga0496104_0003411_2782_3129 115
1070 3300048907 Ga0496104_0178276 Ga0496104_0178276_456_803 115
1071 3300048907 Ga0496104_0584238 Ga0496104_0584238_602_949 115
1072 3300048908 Ga0496105_0004873 Ga0496105_0004873_9189_9536 115
1073 3300048908 Ga0496105_0029068 Ga0496105_0029068_811_1158 115
1074 3300048908 Ga0496105_0654904 Ga0496105_0654904_381_728 115
1075 3300048909 Ga0496106_0024841 Ga0496106_0024841_2313_2660 115
1076 3300048909 Ga0496106_0127514 Ga0496106_0127514_743_1090 115
1077 3300048909 Ga0496106_0143308 Ga0496106_0143308_1310_1657 115
1078 3300048909 Ga0496106_0308063 Ga0496106_0308063_833_1180 115
1079 3300048910 Ga0496107_0043706 Ga0496107_0043706_1034_1381 115
1080 3300048910 Ga0496107_0154684 Ga0496107_0154684_669_1016 115
1081 3300048910 Ga0496107_0187453 Ga0496107_0187453_628_975 115
1082 3300048911 Ga0496108_0008566 Ga0496108_0008566_2419_2766 115
1083 3300048911 Ga0496108_0243278 Ga0496108_0243278_427_774 115
1084 3300048911 Ga0496108_0383956 Ga0496108_0383956_70_417 115
1085 3300048912 Ga0496109_0001554 Ga0496109_0001554_2709_3056 115
1086 3300048912 Ga0496109_0037839 Ga0496109_0037839_2793_3140 115
1087 3300048913 Ga0496110_0072383 Ga0496110_0072383_1301_1648 115
1088 3300048913 Ga0496110_0084321 Ga0496110_0084321_1402_1749 115
1089 3300048913 Ga0496110_0234794 Ga0496110_0234794_601_948 115
1090 3300048913 Ga0496110_0325880 Ga0496110_0325880_976_1323 115
1091 3300048914 Ga0496111_0035114 Ga0496111_0035114_2151_2498 115
1092 3300048914 Ga0496111_0199812 Ga0496111_0199812_288_635 115
1093 3300048914 Ga0496111_0236609 Ga0496111_0236609_71_418 115
1094 3300048915 Ga0496112_0003337 Ga0496112_0003337_4997_5344 115
1095 3300048915 Ga0496112_0158741 Ga0496112_0158741_1171_1518 115
1096 3300048915 Ga0496112_1430576 Ga0496112_1430576_243_590 115
1097 3300048916 Ga0496113_0007502 Ga0496113_0007502_876_1223 115
1098 3300048916 Ga0496113_0015368 Ga0496113_0015368_825_1172 115
1099 3300048916 Ga0496113_0236829 Ga0496113_0236829_231_578 115
1100 3300048916 Ga0496113_0572547 Ga0496113_0572547_295_642 115
1101 3300048917 Ga0496114_0001741 Ga0496114_0001741_1869_2216 115
1102 3300048917 Ga0496114_0012467 Ga0496114_0012467_3569_3916 115
1103 3300048917 Ga0496114_1480879 Ga0496114_1480879_107_454 115
1104 3300048918 Ga0496115_0032793 Ga0496115_0032793_3487_3834 115
1105 3300048918 Ga0496115_0034934 Ga0496115_0034934_1183_1530 115
1106 3300048918 Ga0496115_0265424 Ga0496115_0265424_659_1006 115
1107 3300048918 Ga0496115_0280790 Ga0496115_0280790_613_960 115
1108 3300049569 Ga0501032_0079968 Ga0501032_0079968_98_445 115
1109 3300049570 Ga0501033_0025887 Ga0501033_0025887_2221_2568 115
1110 3300049570 Ga0501033_0307675 Ga0501033_0307675_232_579 115
1111 3300049571 Ga0501034_0101694 Ga0501034_0101694_1850_2197 115
1112 3300049571 Ga0501034_0210555 Ga0501034_0210555_728_1075 115
1113 3300049571 Ga0501034_1379156 Ga0501034_1379156_106_453 115
1114 3300049572 Ga0501036_0002829 Ga0501036_0002829_1731_2078 115
1115 3300049572 Ga0501036_0235077 Ga0501036_0235077_78_425 115
1116 3300049573 Ga0501037_0032091 Ga0501037_0032091_2595_2942 115
1117 3300049574 Ga0501038_0028917 Ga0501038_0028917_3244_3591 115
1118 3300049574 Ga0501038_0157122 Ga0501038_0157122_1349_1696 115
1119 3300049575 Ga0501039_0048297 Ga0501039_0048297_721_1068 115
1120 3300049578 Ga0501042_0266195 Ga0501042_0266195_713_1060 115
1121 3300049579 Ga0501043_0059802 Ga0501043_0059802_462_809 115
1122 3300049579 Ga0501043_0080522 Ga0501043_0080522_2059_2406 115
1123 3300049579 Ga0501043_0094350 Ga0501043_0094350_236_583 115
1124 3300049580 Ga0501046_0022166 Ga0501046_0022166_4592_4939 115
1125 3300049581 Ga0501047_0900222 Ga0501047_0900222_250_597 115
1126 3300049582 Ga0501048_0009262 Ga0501048_0009262_4994_5341 115
1127 3300049582 Ga0501048_0663350 Ga0501048_0663350_352_699 115
1128 3300049583 Ga0501067_0009519 Ga0501067_0009519_4485_4832 115
1129 3300049584 Ga0501068_0283780 Ga0501068_0283780_697_1044 115
1130 3300049585 Ga0501069_0001900 Ga0501069_0001900_5164_5511 115
1131 3300049586 Ga0501070_0016439 Ga0501070_0016439_3245_3592 115
1132 3300049586 Ga0501070_0207323 Ga0501070_0207323_289_636 115
1133 3300049587 Ga0501071_0020855 Ga0501071_0020855_2192_2539 115
1134 3300049587 Ga0501071_0280001 Ga0501071_0280001_94_441 115
1135 3300049590 Ga0501074_0023154 Ga0501074_0023154_2058_2405 115
1136 3300049592 Ga0501076_0020689 Ga0501076_0020689_886_1233 115
1137 3300049592 Ga0501076_0106186 Ga0501076_0106186_1555_1902 115
1138 3300049593 Ga0501077_0260823 Ga0501077_0260823_264_611 115
1139 3300049741 Ga0501079_0098737 Ga0501079_0098737_152_499 115
1140 3300049742 Ga0501080_0078531 Ga0501080_0078531_207_554 115
1141 3300049743 Ga0501081_0576892 Ga0501081_0576892_476_823 115
1142 3300049744 Ga0501083_0001750 Ga0501083_0001750_2852_3199 115
1143 3300049744 Ga0501083_0146385 Ga0501083_0146385_376_723 115
1144 3300049744 Ga0501083_0423787 Ga0501083_0423787_17_367 115
1145 3300049744 Ga0501083_0611721 Ga0501083_0611721_212_559 115
1146 3300049822 Ga0501035_0046577 Ga0501035_0046577_799_1146 115
1147 3300049822 Ga0501035_0398300 Ga0501035_0398300_353_700 115
1148 3300049822 Ga0501035_0526792 Ga0501035_0526792_82_429 115
1149 3300049823 Ga0501044_0000822 Ga0501044_0000822_237_584 115
1150 3300049823 Ga0501044_0190872 Ga0501044_0190872_1594_1941 115
1151 3300049823 Ga0501044_0873711 Ga0501044_0873711_380_727 115
1152 3300050490 nmdc:mga03n38_493697_c1 nmdc:mga03n38_493697_c1_105_452 115
1153 3300050494 nmdc:mga06z11_20872_c1 nmdc:mga06z11_20872_c1_99_446 115
1154 3300050494 nmdc:mga06z11_832525_c1 nmdc:mga06z11_832525_c1_37_384 115
1155 3300050511 nmdc:mga08y16_1034470_c1 nmdc:mga08y16_1034470_c1_71_418 115
1156 3300050511 nmdc:mga08y16_2031_c1 nmdc:mga08y16_2031_c1_20098_20445 115
1157 3300050512 nmdc:mga0n895_51388_c1 nmdc:mga0n895_51388_c1_1142_1489 115
1158 3300050513 nmdc:mga0rr50_164488_c1 nmdc:mga0rr50_164488_c1_734_1081 115
1159 3300050513 nmdc:mga0rr50_321712_c1 nmdc:mga0rr50_321712_c1_315_662 115
1160 3300050514 nmdc:mga08x19_915456_c1 nmdc:mga08x19_915456_c1_133_480 115
1161 3300050515 nmdc:mga0a205_185748_c1 nmdc:mga0a205_185748_c1_679_1026 115
1162 3300050515 nmdc:mga0a205_232147_c1 nmdc:mga0a205_232147_c1_975_1322 115
1163 3300053077 Ga0495601_0000456 Ga0495601_0000456_15433_15780 115
1164 3300053077 Ga0495601_0000507 Ga0495601_0000507_15057_15404 115
1165 3300053077 Ga0495601_0009329 Ga0495601_0009329_4403_4750 115
1166 3300053077 Ga0495601_0012444 Ga0495601_0012444_3924_4271 115
1167 3300053077 Ga0495601_0101803 Ga0495601_0101803_290_637 115
1168 3300053078 Ga0495612_0005524 Ga0495612_0005524_724_1071 115
1169 3300053078 Ga0495612_0007164 Ga0495612_0007164_1077_1424 115
1170 3300053078 Ga0495612_0107037 Ga0495612_0107037_616_963 115
1171 3300053084 Ga0495595_0000513 Ga0495595_0000513_11634_11981 115
1172 3300053084 Ga0495595_0001524 Ga0495595_0001524_1957_2304 115
1173 3300053085 Ga0495619_0000043 Ga0495619_0000043_72315_72662 115
1174 3300053085 Ga0495619_0000551 Ga0495619_0000551_4584_4931 115
1175 3300053085 Ga0495619_0002087 Ga0495619_0002087_9325_9672 115
1176 3300053085 Ga0495619_0032006 Ga0495619_0032006_2155_2502 115
1177 3300053085 Ga0495619_0109308 Ga0495619_0109308_408_755 115
1178 3300053085 Ga0495619_0241111 Ga0495619_0241111_144_491 115
1179 3300053087 Ga0500643_002121 Ga0500643_002121_7517_7864 115
1180 3300053093 Ga0500651_0041727 Ga0500651_0041727_966_1313 115
1181 3300053093 Ga0500651_0113892 Ga0500651_0113892_339_686 115
1182 3300053093 Ga0500651_0667351 Ga0500651_0667351_65_412 115
1183 3300053094 Ga0500566_0086671 Ga0500566_0086671_165_512 115
1184 3300053098 Ga0500650_0140675 Ga0500650_0140675_666_1013 115
1185 3300053118 Ga0500594_0062053 Ga0500594_0062053_321_668 115
1186 3300053119 Ga0500595_000002 Ga0500595_000002_367371_367718 115
1187 3300053126 Ga0500621_211535 Ga0500621_211535_126_473 115
1188 3300053153 Ga0500616_0000002 Ga0500616_0000002_444089_444436 115
1189 3300053153 Ga0500616_0117024 Ga0500616_0117024_886_1233 115
1190 3300053730 Ga0500645_000568 Ga0500645_000568_9091_9438 115
1191 3300053730 Ga0500645_017683 Ga0500645_017683_1816_2163 115
1192 3300054114 Ga0501084_0486821 Ga0501084_0486821_77_424 115
1193 3300060353 Ga0501082_0052191 Ga0501082_0052191_1868_2215 115

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_A1ZBN7_5_59_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7656 79 103 1.10.10.60
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.4041 58 113 1.10.3470.10
af_A1ZBN7_5_59_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3819 79 103 1.10.10.60
af_I1MBG1_11_158_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.2592 35 115 1.50.40.10
af_F1QU05_1_268_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2421 1 112 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6N6STS4-F1-model_v4 AzlD domain-containing protein 0.9525 10 112 GO:0016020
AF-A0A0Q5H729-F1-model_v4 Branched-chain amino acid transport 0.9372 8 112 GO:0016020
AF-A0A8B2NN41-F1-model_v4 Branched-chain amino acid transport 0.9322 2 113 GO:0016020
AF-A0A8A7D2M3-F1-model_v4 deleted 0.9177 14 112
AF-A0A068T988-F1-model_v4 Branched-chain amino acid transport 0.9138 5 112 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.56 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map