F491487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1193 | 447 | 1192 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300028556|Ga0265337_1003693|Ga0265337_10036933 |
| Length | 97 |
| Sequence | MNATVAELWPYLLLILVGYLPNEMWRMLGLVLARGLNEDSEIVVWSRAVATAIIAGLFAAGAAVCGFLAFLAVKRSVFVGVLVGEAVLLLGGYLFAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 18 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 24 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 29 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 151 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 152 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 153 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 154 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 155 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 156 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 174 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 272 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 273 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 274 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 275 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 278 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 280 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 289 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 295 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 312 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 313 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 317 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 439 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 441 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 442 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 443 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 444 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 446 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.08 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.84 |
| Nodule | 0 |
| Rhizoplane | 6.54 |
| Rhizosphere | 91.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_285774 | 2162886011 | Unclassified | 824 |
| 2 | MBSR1b_contig_13052938 | 2162886012 | Unclassified | 822 |
| 3 | MBSR1b_contig_1596674 | 2162886012 | Unclassified | 824 |
| 4 | 2214628271 | 2209111006 | Bacteria | 5118 |
| 5 | ARSoilYngRDRAFT_c00203 | 3300000042 | Bacteria | 9939 |
| 6 | ARcpr5yngRDRAFT_c000031 | 3300000043 | Bacteria | 23285 |
| 7 | ARSoilOldRDRAFT_c000027 | 3300000044 | Bacteria | 33288 |
| 8 | ARCol0oldRDRAFT_c00076 | 3300000045 | Bacteria | 8189 |
| 9 | ARCol0yngRDRAFT_1000016 | 3300000652 | Bacteria | 31710 |
| 10 | JGI24752J21851_1013836 | 3300001976 | Bacteria | 1052 |
| 11 | JGI24746J21847_1000923 | 3300001977 | Bacteria | 4595 |
| 12 | JGI24747J21853_1007884 | 3300001978 | Bacteria | 1032 |
| 13 | JGI24740J21852_10054506 | 3300001979 | Bacteria | 1129 |
| 14 | JGI24739J22299_10040565 | 3300001989 | Bacteria | 1553 |
| 15 | JGI24737J22298_10002170 | 3300001990 | Bacteria | 6993 |
| 16 | JGI24737J22298_10008902 | 3300001990 | Bacteria | 3349 |
| 17 | JGI24737J22298_10011120 | 3300001990 | Bacteria | 2954 |
| 18 | JGI24737J22298_10012710 | 3300001990 | Bacteria | 2744 |
| 19 | JGI24743J22301_10004801 | 3300001991 | Bacteria | 2223 |
| 20 | JGI24750J21931_1001342 | 3300002070 | Bacteria | 3089 |
| 21 | JGI24745J21846_1000152 | 3300002073 | Bacteria | 5479 |
| 22 | JGI24748J21848_1002289 | 3300002074 | Bacteria | 2149 |
| 23 | JGI24738J21930_10000909 | 3300002075 | Bacteria | 8517 |
| 24 | JGI24749J21850_1007700 | 3300002076 | Bacteria | 1501 |
| 25 | JGI24744J21845_10002614 | 3300002077 | Bacteria | 3681 |
| 26 | JGI24744J21845_10002742 | 3300002077 | Bacteria | 3596 |
| 27 | JGI24035J26624_1000140 | 3300002126 | Bacteria | 6418 |
| 28 | JGI24033J26618_1000697 | 3300002155 | Bacteria | 3216 |
| 29 | JGI24034J26672_10000370 | 3300002239 | Bacteria | 5834 |
| 30 | JGI24742J22300_10021793 | 3300002244 | Bacteria | 1095 |
| 31 | JGI24751J29686_10025837 | 3300002459 | Unclassified | 1218 |
| 32 | JGI24751J29686_10052399 | 3300002459 | Bacteria | 841 |
| 33 | JGI25165J46597_1054094 | 3300003214 | Bacteria | 514 |
| 34 | JGI25405J52794_10012841 | 3300003911 | Bacteria | 1619 |
| 35 | Ga0065716_1002003 | 3300005277 | Bacteria | 2486 |
| 36 | Ga0065714_10229778 | 3300005288 | Unclassified | 819 |
| 37 | Ga0065714_10366413 | 3300005288 | Unclassified | 620 |
| 38 | Ga0065704_10004924 | 3300005289 | Bacteria | 4201 |
| 39 | Ga0065712_10004249 | 3300005290 | Bacteria | 5140 |
| 40 | Ga0065712_10069903 | 3300005290 | Bacteria | 6531 |
| 41 | Ga0065712_10084253 | 3300005290 | Bacteria | 2779 |
| 42 | Ga0065715_10005783 | 3300005293 | Bacteria | 5336 |
| 43 | Ga0065715_10090726 | 3300005293 | Bacteria | 6563 |
| 44 | Ga0065715_10193889 | 3300005293 | Bacteria | 1399 |
| 45 | Ga0065715_10638147 | 3300005293 | Unclassified | 685 |
| 46 | Ga0065707_10182513 | 3300005295 | Unclassified | 1409 |
| 47 | Ga0065707_10632563 | 3300005295 | Bacteria | 673 |
| 48 | Ga0070658_10003716 | 3300005327 | Bacteria | 12485 |
| 49 | Ga0070658_10090733 | 3300005327 | Bacteria | 2518 |
| 50 | Ga0070676_10207069 | 3300005328 | Bacteria | 1289 |
| 51 | Ga0070676_10650819 | 3300005328 | Unclassified | 765 |
| 52 | Ga0070683_100016231 | 3300005329 | Bacteria | 6561 |
| 53 | Ga0070683_100079030 | 3300005329 | Bacteria | 3078 |
| 54 | Ga0070690_100000972 | 3300005330 | Bacteria | 14582 |
| 55 | Ga0070690_100031108 | 3300005330 | Bacteria | 3322 |
| 56 | Ga0070690_100111001 | 3300005330 | Bacteria | 1830 |
| 57 | Ga0070690_100360277 | 3300005330 | Bacteria | 1058 |
| 58 | Ga0070670_100043184 | 3300005331 | Bacteria | 3876 |
| 59 | Ga0070670_100318698 | 3300005331 | Unclassified | 1362 |
| 60 | Ga0070677_10489080 | 3300005333 | Bacteria | 665 |
| 61 | Ga0068869_100028165 | 3300005334 | Bacteria | 3923 |
| 62 | Ga0068869_101212690 | 3300005334 | Bacteria | 663 |
| 63 | Ga0070666_10029587 | 3300005335 | Bacteria | 3602 |
| 64 | Ga0070666_10065487 | 3300005335 | Bacteria | 2466 |
| 65 | Ga0070666_10131394 | 3300005335 | Bacteria | 1740 |
| 66 | Ga0070666_10291177 | 3300005335 | Bacteria | 1162 |
| 67 | Ga0070680_100013055 | 3300005336 | Bacteria | 6466 |
| 68 | Ga0070680_100072254 | 3300005336 | Bacteria | 2835 |
| 69 | Ga0070680_100266293 | 3300005336 | Unclassified | 1450 |
| 70 | Ga0070680_100424387 | 3300005336 | Bacteria | 1134 |
| 71 | Ga0070680_101492006 | 3300005336 | Unclassified | 586 |
| 72 | Ga0070682_100022243 | 3300005337 | Bacteria | 3753 |
| 73 | Ga0070682_100023896 | 3300005337 | Bacteria | 3632 |
| 74 | Ga0070682_100065660 | 3300005337 | Bacteria | 2306 |
| 75 | Ga0070682_100500616 | 3300005337 | Bacteria | 941 |
| 76 | Ga0070682_101670143 | 3300005337 | Unclassified | 552 |
| 77 | Ga0068868_100000287 | 3300005338 | Bacteria | 33828 |
| 78 | Ga0068868_100843474 | 3300005338 | Bacteria | 830 |
| 79 | Ga0070660_100011348 | 3300005339 | Bacteria | 6325 |
| 80 | Ga0070660_100095616 | 3300005339 | Bacteria | 2348 |
| 81 | Ga0070660_100165868 | 3300005339 | Bacteria | 1782 |
| 82 | Ga0070689_100009382 | 3300005340 | Bacteria | 6935 |
| 83 | Ga0070689_100028894 | 3300005340 | Bacteria | 4193 |
| 84 | Ga0070689_100069911 | 3300005340 | Bacteria | 2740 |
| 85 | Ga0070691_10007546 | 3300005341 | Bacteria | 4986 |
| 86 | Ga0070691_10050476 | 3300005341 | Bacteria | 1985 |
| 87 | Ga0070691_10112563 | 3300005341 | Bacteria | 1363 |
| 88 | Ga0070687_100006226 | 3300005343 | Bacteria | 4880 |
| 89 | Ga0070687_100038674 | 3300005343 | Bacteria | 2393 |
| 90 | Ga0070661_100014754 | 3300005344 | Bacteria | 5510 |
| 91 | Ga0070661_100483606 | 3300005344 | Bacteria | 989 |
| 92 | Ga0070661_100558317 | 3300005344 | Unclassified | 922 |
| 93 | Ga0070661_101815228 | 3300005344 | Unclassified | 518 |
| 94 | Ga0070661_101897387 | 3300005344 | Unclassified | 506 |
| 95 | Ga0070692_10003049 | 3300005345 | Bacteria | 6691 |
| 96 | Ga0070692_10010883 | 3300005345 | Bacteria | 4160 |
| 97 | Ga0070668_100072639 | 3300005347 | Bacteria | 2681 |
| 98 | Ga0070669_100005691 | 3300005353 | Bacteria | 8989 |
| 99 | Ga0070669_100018258 | 3300005353 | Bacteria | 5011 |
| 100 | Ga0070675_100051571 | 3300005354 | Bacteria | 3381 |
| 101 | Ga0070671_100033279 | 3300005355 | Bacteria | 4262 |
| 102 | Ga0070671_100103035 | 3300005355 | Bacteria | 2394 |
| 103 | Ga0070671_100157443 | 3300005355 | Bacteria | 1919 |
| 104 | Ga0070671_100355244 | 3300005355 | Bacteria | 1251 |
| 105 | Ga0070671_101045041 | 3300005355 | Bacteria | 716 |
| 106 | Ga0070674_100056194 | 3300005356 | Bacteria | 2729 |
| 107 | Ga0070674_100716276 | 3300005356 | Bacteria | 857 |
| 108 | Ga0070673_100014645 | 3300005364 | Bacteria | 5473 |
| 109 | Ga0070673_100483252 | 3300005364 | Unclassified | 1118 |
| 110 | Ga0070688_100001436 | 3300005365 | Bacteria | 11847 |
| 111 | Ga0070688_100008580 | 3300005365 | Bacteria | 5557 |
| 112 | Ga0070688_100205308 | 3300005365 | Unclassified | 1381 |
| 113 | Ga0070688_100351961 | 3300005365 | Bacteria | 1078 |
| 114 | Ga0070659_100015882 | 3300005366 | Bacteria | 5647 |
| 115 | Ga0070659_100059083 | 3300005366 | Bacteria | 3027 |
| 116 | Ga0070659_101805771 | 3300005366 | Unclassified | 548 |
| 117 | Ga0070667_100009541 | 3300005367 | Bacteria | 8047 |
| 118 | Ga0070667_100060283 | 3300005367 | Bacteria | 3211 |
| 119 | Ga0070667_100074742 | 3300005367 | Bacteria | 2891 |
| 120 | Ga0070667_100527864 | 3300005367 | Bacteria | 1083 |
| 121 | Ga0070667_101421973 | 3300005367 | Unclassified | 651 |
| 122 | Ga0070703_10010153 | 3300005406 | Bacteria | 2655 |
| 123 | Ga0070703_10145990 | 3300005406 | Unclassified | 884 |
| 124 | Ga0070709_10029359 | 3300005434 | Bacteria | 3289 |
| 125 | Ga0070709_10195406 | 3300005434 | Bacteria | 1430 |
| 126 | Ga0070709_10235293 | 3300005434 | Bacteria | 1313 |
| 127 | Ga0070709_10435526 | 3300005434 | Bacteria | 985 |
| 128 | Ga0070714_100039918 | 3300005435 | Bacteria | 3955 |
| 129 | Ga0070714_100619081 | 3300005435 | Bacteria | 1041 |
| 130 | Ga0070713_100039180 | 3300005436 | Bacteria | 3844 |
| 131 | Ga0070713_100045425 | 3300005436 | Bacteria | 3599 |
| 132 | Ga0070713_100125089 | 3300005436 | Bacteria | 2260 |
| 133 | Ga0070713_101539077 | 3300005436 | Bacteria | 645 |
| 134 | Ga0070710_10015364 | 3300005437 | Bacteria | 3874 |
| 135 | Ga0070710_10030570 | 3300005437 | Bacteria | 2899 |
| 136 | Ga0070710_10056697 | 3300005437 | Bacteria | 2217 |
| 137 | Ga0070710_10285132 | 3300005437 | Bacteria | 1073 |
| 138 | Ga0070701_10001244 | 3300005438 | Bacteria | 9340 |
| 139 | Ga0070701_10253876 | 3300005438 | Bacteria | 1063 |
| 140 | Ga0070711_100019451 | 3300005439 | Bacteria | 4356 |
| 141 | Ga0070711_100030277 | 3300005439 | Bacteria | 3581 |
| 142 | Ga0070711_100674457 | 3300005439 | Bacteria | 868 |
| 143 | Ga0070705_100033813 | 3300005440 | Bacteria | 2853 |
| 144 | Ga0070705_100414548 | 3300005440 | Bacteria | 1001 |
| 145 | Ga0070700_100014256 | 3300005441 | Bacteria | 4484 |
| 146 | Ga0070694_100003715 | 3300005444 | Bacteria | 9100 |
| 147 | Ga0070694_100057360 | 3300005444 | Bacteria | 2647 |
| 148 | Ga0070694_101723693 | 3300005444 | Unclassified | 533 |
| 149 | Ga0070708_100196674 | 3300005445 | Bacteria | 1886 |
| 150 | Ga0070663_100007417 | 3300005455 | Bacteria | 6674 |
| 151 | Ga0070663_100022554 | 3300005455 | Bacteria | 4210 |
| 152 | Ga0070663_100084684 | 3300005455 | Bacteria | 2338 |
| 153 | Ga0070663_100088886 | 3300005455 | Bacteria | 2285 |
| 154 | Ga0070678_100004742 | 3300005456 | Bacteria | 7750 |
| 155 | Ga0070678_100005474 | 3300005456 | Bacteria | 7346 |
| 156 | Ga0070678_100119811 | 3300005456 | Bacteria | 2073 |
| 157 | Ga0070662_100003647 | 3300005457 | Bacteria | 9612 |
| 158 | Ga0070662_100040160 | 3300005457 | Bacteria | 3330 |
| 159 | Ga0070662_100222516 | 3300005457 | Unclassified | 1506 |
| 160 | Ga0070662_100652425 | 3300005457 | Unclassified | 888 |
| 161 | Ga0070681_10018191 | 3300005458 | Bacteria | 7026 |
| 162 | Ga0070681_10061315 | 3300005458 | Bacteria | 3736 |
| 163 | Ga0070681_10236909 | 3300005458 | Bacteria | 1739 |
| 164 | Ga0070681_10261025 | 3300005458 | Bacteria | 1644 |
| 165 | Ga0068867_100029242 | 3300005459 | Bacteria | 3969 |
| 166 | Ga0070685_10001963 | 3300005466 | Bacteria | 10678 |
| 167 | Ga0070685_10147789 | 3300005466 | Bacteria | 1486 |
| 168 | Ga0070685_11377201 | 3300005466 | Bacteria | 541 |
| 169 | Ga0070706_100990111 | 3300005467 | Unclassified | 775 |
| 170 | Ga0070707_100210734 | 3300005468 | Bacteria | 1894 |
| 171 | Ga0070698_100594422 | 3300005471 | Bacteria | 1047 |
| 172 | Ga0070699_100400899 | 3300005518 | Unclassified | 1240 |
| 173 | Ga0070679_100109176 | 3300005530 | Bacteria | 2753 |
| 174 | Ga0070679_100276893 | 3300005530 | Bacteria | 1631 |
| 175 | Ga0070679_100332100 | 3300005530 | Unclassified | 1469 |
| 176 | Ga0070679_100786135 | 3300005530 | Unclassified | 895 |
| 177 | Ga0070679_101486148 | 3300005530 | Unclassified | 624 |
| 178 | Ga0070684_100075913 | 3300005535 | Bacteria | 2965 |
| 179 | Ga0070684_100267070 | 3300005535 | Bacteria | 1566 |
| 180 | Ga0068853_100033477 | 3300005539 | Bacteria | 4361 |
| 181 | Ga0068853_100053869 | 3300005539 | Bacteria | 3465 |
| 182 | Ga0068853_100808694 | 3300005539 | Bacteria | 898 |
| 183 | Ga0068853_101827818 | 3300005539 | Unclassified | 589 |
| 184 | Ga0070672_100008973 | 3300005543 | Bacteria | 6873 |
| 185 | Ga0070672_100267355 | 3300005543 | Bacteria | 1443 |
| 186 | Ga0070672_100920927 | 3300005543 | Unclassified | 773 |
| 187 | Ga0070686_100031841 | 3300005544 | Bacteria | 3228 |
| 188 | Ga0070686_100038220 | 3300005544 | Bacteria | 2982 |
| 189 | Ga0070686_100157183 | 3300005544 | Bacteria | 1598 |
| 190 | Ga0070695_100035975 | 3300005545 | Bacteria | 3114 |
| 191 | Ga0070695_100312777 | 3300005545 | Bacteria | 1165 |
| 192 | Ga0070695_100357507 | 3300005545 | Bacteria | 1096 |
| 193 | Ga0070696_100006672 | 3300005546 | Bacteria | 7710 |
| 194 | Ga0070696_100012420 | 3300005546 | Bacteria | 5713 |
| 195 | Ga0070696_100110438 | 3300005546 | Bacteria | 1980 |
| 196 | Ga0070696_100200076 | 3300005546 | Bacteria | 1491 |
| 197 | Ga0070693_100003566 | 3300005547 | Bacteria | 7261 |
| 198 | Ga0070693_100076865 | 3300005547 | Bacteria | 1980 |
| 199 | Ga0070693_100363275 | 3300005547 | Unclassified | 994 |
| 200 | Ga0070693_100688940 | 3300005547 | Bacteria | 747 |
| 201 | Ga0070693_100962907 | 3300005547 | Unclassified | 643 |
| 202 | Ga0070693_101347088 | 3300005547 | Bacteria | 553 |
| 203 | Ga0070665_100014185 | 3300005548 | Bacteria | 8007 |
| 204 | Ga0070665_100353780 | 3300005548 | Bacteria | 1474 |
| 205 | Ga0070665_101573946 | 3300005548 | Unclassified | 665 |
| 206 | Ga0070704_100003927 | 3300005549 | Bacteria | 8561 |
| 207 | Ga0068855_100031527 | 3300005563 | Bacteria | 6330 |
| 208 | Ga0068855_100082168 | 3300005563 | Bacteria | 3734 |
| 209 | Ga0068855_100476596 | 3300005563 | Bacteria | 1359 |
| 210 | Ga0070664_100022768 | 3300005564 | Bacteria | 5168 |
| 211 | Ga0070664_100071700 | 3300005564 | Bacteria | 2969 |
| 212 | Ga0070664_100090054 | 3300005564 | Bacteria | 2655 |
| 213 | Ga0070664_100191277 | 3300005564 | Bacteria | 1823 |
| 214 | Ga0070664_100598642 | 3300005564 | Bacteria | 1022 |
| 215 | Ga0070664_100867217 | 3300005564 | Bacteria | 846 |
| 216 | Ga0068857_100006630 | 3300005577 | Bacteria | 9945 |
| 217 | Ga0068857_100124888 | 3300005577 | Bacteria | 2318 |
| 218 | Ga0068854_100056497 | 3300005578 | Bacteria | 2829 |
| 219 | Ga0068854_100519143 | 3300005578 | Bacteria | 1006 |
| 220 | Ga0068854_101354872 | 3300005578 | Bacteria | 642 |
| 221 | Ga0068856_100037685 | 3300005614 | Bacteria | 4745 |
| 222 | Ga0068856_100067110 | 3300005614 | Bacteria | 3545 |
| 223 | Ga0068856_100753658 | 3300005614 | Bacteria | 994 |
| 224 | Ga0070702_100099648 | 3300005615 | Bacteria | 1780 |
| 225 | Ga0070702_100135159 | 3300005615 | Bacteria | 1563 |
| 226 | Ga0070702_100274712 | 3300005615 | Bacteria | 1154 |
| 227 | Ga0068852_100010452 | 3300005616 | Bacteria | 6939 |
| 228 | Ga0068852_100332252 | 3300005616 | Bacteria | 1479 |
| 229 | Ga0068852_102443610 | 3300005616 | Bacteria | 543 |
| 230 | Ga0068859_100054633 | 3300005617 | Bacteria | 4017 |
| 231 | Ga0068859_100079592 | 3300005617 | Bacteria | 3317 |
| 232 | Ga0068864_100026602 | 3300005618 | Bacteria | 4879 |
| 233 | Ga0068864_100502107 | 3300005618 | Bacteria | 1167 |
| 234 | Ga0068864_101241574 | 3300005618 | Bacteria | 744 |
| 235 | Ga0068866_10007526 | 3300005718 | Bacteria | 4563 |
| 236 | Ga0068866_10328552 | 3300005718 | Unclassified | 964 |
| 237 | Ga0068861_100007303 | 3300005719 | Bacteria | 7572 |
| 238 | Ga0068861_100070066 | 3300005719 | Bacteria | 2715 |
| 239 | Ga0068851_10298156 | 3300005834 | Bacteria | 926 |
| 240 | Ga0068851_10589823 | 3300005834 | Unclassified | 675 |
| 241 | Ga0068870_10007593 | 3300005840 | Bacteria | 4846 |
| 242 | Ga0068863_100352022 | 3300005841 | Bacteria | 1434 |
| 243 | Ga0068863_100580920 | 3300005841 | Bacteria | 1108 |
| 244 | Ga0068863_101309895 | 3300005841 | Unclassified | 731 |
| 245 | Ga0068858_100064184 | 3300005842 | Bacteria | 3398 |
| 246 | Ga0068858_100276517 | 3300005842 | Bacteria | 1598 |
| 247 | Ga0068858_100926117 | 3300005842 | Bacteria | 853 |
| 248 | Ga0068858_101550702 | 3300005842 | Bacteria | 653 |
| 249 | Ga0068860_100015452 | 3300005843 | Bacteria | 7455 |
| 250 | Ga0068860_100028463 | 3300005843 | Bacteria | 5378 |
| 251 | Ga0068860_100320286 | 3300005843 | Bacteria | 1522 |
| 252 | Ga0068860_100451261 | 3300005843 | Bacteria | 1278 |
| 253 | Ga0068860_101232334 | 3300005843 | Unclassified | 769 |
| 254 | Ga0068862_100015822 | 3300005844 | Bacteria | 6267 |
| 255 | Ga0068862_100025065 | 3300005844 | Bacteria | 5006 |
| 256 | Ga0068862_100275368 | 3300005844 | Bacteria | 1540 |
| 257 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 258 | Ga0081455_10006976 | 3300005937 | Bacteria | 12004 |
| 259 | Ga0081455_10123738 | 3300005937 | Bacteria | 2034 |
| 260 | Ga0081538_10041429 | 3300005981 | Bacteria | 2923 |
| 261 | Ga0070717_10056737 | 3300006028 | Bacteria | 3237 |
| 262 | Ga0070717_10063805 | 3300006028 | Bacteria | 3059 |
| 263 | Ga0075363_100073902 | 3300006048 | Unclassified | 1855 |
| 264 | Ga0075432_10103079 | 3300006058 | Unclassified | 1056 |
| 265 | Ga0070715_10011857 | 3300006163 | Bacteria | 3152 |
| 266 | Ga0070715_10014758 | 3300006163 | Bacteria | 2901 |
| 267 | Ga0070715_10495614 | 3300006163 | Bacteria | 698 |
| 268 | Ga0070716_100009019 | 3300006173 | Bacteria | 4963 |
| 269 | Ga0070716_100373485 | 3300006173 | Bacteria | 1017 |
| 270 | Ga0070716_100406354 | 3300006173 | Bacteria | 981 |
| 271 | Ga0070712_100183986 | 3300006175 | Bacteria | 1630 |
| 272 | Ga0070712_100315604 | 3300006175 | Bacteria | 1270 |
| 273 | Ga0070712_100381749 | 3300006175 | Bacteria | 1160 |
| 274 | Ga0070712_101613176 | 3300006175 | Bacteria | 567 |
| 275 | Ga0075367_10063419 | 3300006178 | Bacteria | 2209 |
| 276 | Ga0075367_10906292 | 3300006178 | Unclassified | 562 |
| 277 | Ga0075427_10003835 | 3300006194 | Bacteria | 2098 |
| 278 | Ga0097621_100000616 | 3300006237 | Bacteria | 25167 |
| 279 | Ga0097621_100008744 | 3300006237 | Bacteria | 7316 |
| 280 | Ga0097621_100030924 | 3300006237 | Bacteria | 4242 |
| 281 | Ga0097621_100180771 | 3300006237 | Bacteria | 1822 |
| 282 | Ga0075370_10532323 | 3300006353 | Unclassified | 710 |
| 283 | Ga0068871_100000922 | 3300006358 | Bacteria | 19615 |
| 284 | Ga0068871_100027615 | 3300006358 | Bacteria | 4440 |
| 285 | Ga0075428_100017044 | 3300006844 | Bacteria | 8027 |
| 286 | Ga0075430_100004240 | 3300006846 | Bacteria | 12111 |
| 287 | Ga0075431_100237644 | 3300006847 | Bacteria | 1854 |
| 288 | Ga0075433_10003318 | 3300006852 | Bacteria | 12434 |
| 289 | Ga0075433_10005782 | 3300006852 | Bacteria | 9736 |
| 290 | Ga0075433_10194998 | 3300006852 | Bacteria | 1802 |
| 291 | Ga0075433_10214493 | 3300006852 | Bacteria | 1710 |
| 292 | Ga0075434_100001367 | 3300006871 | Bacteria | 20481 |
| 293 | Ga0075434_100003881 | 3300006871 | Bacteria | 13383 |
| 294 | Ga0075434_100049800 | 3300006871 | Bacteria | 4160 |
| 295 | Ga0075434_100286306 | 3300006871 | Bacteria | 1667 |
| 296 | Ga0075429_100008546 | 3300006880 | Bacteria | 8907 |
| 297 | Ga0068865_100006916 | 3300006881 | Bacteria | 6954 |
| 298 | Ga0068865_100020346 | 3300006881 | Bacteria | 4302 |
| 299 | Ga0068865_100076762 | 3300006881 | Bacteria | 2386 |
| 300 | Ga0068865_100133440 | 3300006881 | Bacteria | 1863 |
| 301 | Ga0075436_100502389 | 3300006914 | Unclassified | 887 |
| 302 | Ga0097620_100054629 | 3300006931 | Bacteria | 4017 |
| 303 | Ga0097620_100079594 | 3300006931 | Bacteria | 3317 |
| 304 | Ga0075435_100068616 | 3300007076 | Bacteria | 2889 |
| 305 | Ga0075435_100090670 | 3300007076 | Bacteria | 2521 |
| 306 | Ga0075435_100334541 | 3300007076 | Unclassified | 1297 |
| 307 | Ga0105251_10022056 | 3300009011 | Bacteria | 3315 |
| 308 | Ga0105251_10332240 | 3300009011 | Unclassified | 692 |
| 309 | Ga0105244_10018443 | 3300009036 | Bacteria | 3915 |
| 310 | Ga0105250_10075208 | 3300009092 | Bacteria | 1366 |
| 311 | Ga0105240_10223606 | 3300009093 | Bacteria | 2192 |
| 312 | Ga0105240_10293420 | 3300009093 | Bacteria | 1863 |
| 313 | Ga0105240_10654969 | 3300009093 | Bacteria | 1151 |
| 314 | Ga0111539_10002796 | 3300009094 | Bacteria | 23160 |
| 315 | Ga0111539_10013373 | 3300009094 | Bacteria | 10258 |
| 316 | Ga0111539_10053737 | 3300009094 | Bacteria | 4795 |
| 317 | Ga0111539_12207483 | 3300009094 | Unclassified | 639 |
| 318 | Ga0105245_10004252 | 3300009098 | Bacteria | 12700 |
| 319 | Ga0105245_10068509 | 3300009098 | Bacteria | 3216 |
| 320 | Ga0105245_10148592 | 3300009098 | Bacteria | 2213 |
| 321 | Ga0105245_10197571 | 3300009098 | Bacteria | 1930 |
| 322 | Ga0105245_10240994 | 3300009098 | Bacteria | 1753 |
| 323 | Ga0105247_10042814 | 3300009101 | Bacteria | 2774 |
| 324 | Ga0105247_10043793 | 3300009101 | Bacteria | 2743 |
| 325 | Ga0105247_10072953 | 3300009101 | Bacteria | 2150 |
| 326 | Ga0105247_10094973 | 3300009101 | Bacteria | 1898 |
| 327 | Ga0105247_10111925 | 3300009101 | Bacteria | 1758 |
| 328 | Ga0114129_10029650 | 3300009147 | Bacteria | 7749 |
| 329 | Ga0114129_10198080 | 3300009147 | Bacteria | 2722 |
| 330 | Ga0114129_11197944 | 3300009147 | Bacteria | 946 |
| 331 | Ga0105243_10016347 | 3300009148 | Bacteria | 5614 |
| 332 | Ga0105243_10018577 | 3300009148 | Bacteria | 5269 |
| 333 | Ga0105243_10019863 | 3300009148 | Bacteria | 5096 |
| 334 | Ga0105243_10111305 | 3300009148 | Bacteria | 2292 |
| 335 | Ga0105241_10021402 | 3300009174 | Bacteria | 4780 |
| 336 | Ga0105241_10048036 | 3300009174 | Bacteria | 3246 |
| 337 | Ga0105241_10212299 | 3300009174 | Bacteria | 1622 |
| 338 | Ga0105242_10045458 | 3300009176 | Bacteria | 3559 |
| 339 | Ga0105242_10177129 | 3300009176 | Bacteria | 1878 |
| 340 | Ga0105242_10532664 | 3300009176 | Bacteria | 1123 |
| 341 | Ga0105248_10034642 | 3300009177 | Bacteria | 5648 |
| 342 | Ga0105248_10035800 | 3300009177 | Bacteria | 5553 |
| 343 | Ga0105248_10110124 | 3300009177 | Bacteria | 3105 |
| 344 | Ga0105248_10323791 | 3300009177 | Bacteria | 1736 |
| 345 | Ga0105248_11449977 | 3300009177 | Bacteria | 777 |
| 346 | Ga0105237_10008357 | 3300009545 | Bacteria | 11222 |
| 347 | Ga0105237_10035386 | 3300009545 | Bacteria | 5053 |
| 348 | Ga0105237_10596307 | 3300009545 | Bacteria | 1112 |
| 349 | Ga0105238_10058732 | 3300009551 | Bacteria | 3855 |
| 350 | Ga0105238_10197036 | 3300009551 | Bacteria | 1990 |
| 351 | Ga0105249_10029412 | 3300009553 | Bacteria | 4961 |
| 352 | Ga0105249_10152330 | 3300009553 | Bacteria | 2227 |
| 353 | Ga0105249_10155472 | 3300009553 | Bacteria | 2205 |
| 354 | Ga0105249_10351895 | 3300009553 | Bacteria | 1492 |
| 355 | Ga0105239_10025073 | 3300010375 | Bacteria | 6569 |
| 356 | Ga0105239_10100256 | 3300010375 | Bacteria | 3203 |
| 357 | Ga0105239_10519024 | 3300010375 | Bacteria | 1355 |
| 358 | Ga0105239_11012542 | 3300010375 | Bacteria | 955 |
| 359 | Ga0105239_12056114 | 3300010375 | Bacteria | 663 |
| 360 | Ga0105239_12551558 | 3300010375 | Bacteria | 596 |
| 361 | Ga0105246_10259260 | 3300011119 | Bacteria | 1384 |
| 362 | Ga0105246_10287281 | 3300011119 | Bacteria | 1322 |
| 363 | Ga0105246_10703456 | 3300011119 | Bacteria | 886 |
| 364 | Ga0105246_11068061 | 3300011119 | Bacteria | 735 |
| 365 | Ga0157344_1003072 | 3300012476 | Unclassified | 922 |
| 366 | Ga0157328_1004315 | 3300012478 | Unclassified | 783 |
| 367 | Ga0157320_1000803 | 3300012481 | Bacteria | 1407 |
| 368 | Ga0157341_1016513 | 3300012494 | Bacteria | 689 |
| 369 | Ga0157341_1026473 | 3300012494 | Unclassified | 603 |
| 370 | Ga0157347_1060145 | 3300012502 | Unclassified | 542 |
| 371 | Ga0157316_1052765 | 3300012510 | Unclassified | 566 |
| 372 | Ga0157338_1000546 | 3300012515 | Bacteria | 2290 |
| 373 | Ga0157373_10007606 | 3300013100 | Bacteria | 8052 |
| 374 | Ga0157373_10497015 | 3300013100 | Bacteria | 881 |
| 375 | Ga0157373_10886556 | 3300013100 | Bacteria | 661 |
| 376 | Ga0157373_11393197 | 3300013100 | Bacteria | 533 |
| 377 | Ga0157371_10038816 | 3300013102 | Bacteria | 3406 |
| 378 | Ga0157370_10032359 | 3300013104 | Bacteria | 5107 |
| 379 | Ga0157370_10055478 | 3300013104 | Bacteria | 3774 |
| 380 | Ga0157370_10843988 | 3300013104 | Bacteria | 833 |
| 381 | Ga0157369_10196398 | 3300013105 | Bacteria | 2119 |
| 382 | Ga0157369_10584456 | 3300013105 | Bacteria | 1153 |
| 383 | Ga0157374_10015848 | 3300013296 | Bacteria | 6621 |
| 384 | Ga0157374_10164647 | 3300013296 | Bacteria | 2161 |
| 385 | Ga0157374_10538424 | 3300013296 | Bacteria | 1175 |
| 386 | Ga0157374_10653901 | 3300013296 | Bacteria | 1063 |
| 387 | Ga0157374_10749949 | 3300013296 | Bacteria | 991 |
| 388 | Ga0157374_10933225 | 3300013296 | Bacteria | 886 |
| 389 | Ga0157378_10007970 | 3300013297 | Bacteria | 9246 |
| 390 | Ga0157378_10032054 | 3300013297 | Bacteria | 4642 |
| 391 | Ga0157378_10429633 | 3300013297 | Bacteria | 1307 |
| 392 | Ga0157378_12902846 | 3300013297 | Unclassified | 531 |
| 393 | Ga0163162_10014117 | 3300013306 | Bacteria | 7806 |
| 394 | Ga0163162_10048102 | 3300013306 | Bacteria | 4273 |
| 395 | Ga0163162_10087113 | 3300013306 | Bacteria | 3201 |
| 396 | Ga0163162_12960581 | 3300013306 | Bacteria | 546 |
| 397 | Ga0157372_12011138 | 3300013307 | Bacteria | 664 |
| 398 | Ga0157375_10017624 | 3300013308 | Bacteria | 6449 |
| 399 | Ga0157375_10060051 | 3300013308 | Bacteria | 3769 |
| 400 | Ga0157375_10281074 | 3300013308 | Bacteria | 1827 |
| 401 | Ga0157375_10397256 | 3300013308 | Bacteria | 1545 |
| 402 | Ga0163163_10001820 | 3300014325 | Bacteria | 18002 |
| 403 | Ga0163163_10369436 | 3300014325 | Bacteria | 1491 |
| 404 | Ga0163163_12469721 | 3300014325 | Unclassified | 578 |
| 405 | Ga0157380_10009315 | 3300014326 | Bacteria | 7033 |
| 406 | Ga0157380_10136692 | 3300014326 | Bacteria | 2099 |
| 407 | Ga0157380_10140795 | 3300014326 | Bacteria | 2072 |
| 408 | Ga0157380_12613610 | 3300014326 | Unclassified | 571 |
| 409 | Ga0157377_10004131 | 3300014745 | Bacteria | 6635 |
| 410 | Ga0157377_10154484 | 3300014745 | Bacteria | 1422 |
| 411 | Ga0157379_10001178 | 3300014968 | Bacteria | 21270 |
| 412 | Ga0157379_10118428 | 3300014968 | Bacteria | 2382 |
| 413 | Ga0157379_10330904 | 3300014968 | Unclassified | 1392 |
| 414 | Ga0157379_10386195 | 3300014968 | Bacteria | 1285 |
| 415 | Ga0157379_10485136 | 3300014968 | Bacteria | 1144 |
| 416 | Ga0157379_10902131 | 3300014968 | Bacteria | 838 |
| 417 | Ga0157376_10007479 | 3300014969 | Bacteria | 7804 |
| 418 | Ga0157376_10067889 | 3300014969 | Bacteria | 3017 |
| 419 | Ga0157376_10195812 | 3300014969 | Bacteria | 1856 |
| 420 | Ga0157376_11216154 | 3300014969 | Bacteria | 782 |
| 421 | Ga0163161_10006785 | 3300017792 | Bacteria | 7911 |
| 422 | Ga0163161_10118150 | 3300017792 | Bacteria | 1990 |
| 423 | Ga0163161_10646958 | 3300017792 | Bacteria | 876 |
| 424 | Ga0206353_10336741 | 3300020082 | Bacteria | 981 |
| 425 | Ga0213876_10225361 | 3300021384 | Bacteria | 997 |
| 426 | Ga0209233_1026909 | 3300025261 | Bacteria | 1400 |
| 427 | Ga0207666_1000090 | 3300025271 | Bacteria | 14493 |
| 428 | Ga0207666_1012978 | 3300025271 | Unclassified | 1166 |
| 429 | Ga0207673_1000112 | 3300025290 | Bacteria | 7483 |
| 430 | Ga0207697_10000579 | 3300025315 | Bacteria | 20843 |
| 431 | Ga0207697_10007823 | 3300025315 | Bacteria | 4730 |
| 432 | Ga0207655_1172023 | 3300025728 | Unclassified | 668 |
| 433 | Ga0207653_10002769 | 3300025885 | Bacteria | 5578 |
| 434 | Ga0207682_10008278 | 3300025893 | Bacteria | 4118 |
| 435 | Ga0207692_10035418 | 3300025898 | Bacteria | 2425 |
| 436 | Ga0207692_10258580 | 3300025898 | Bacteria | 1046 |
| 437 | Ga0207692_10666300 | 3300025898 | Bacteria | 673 |
| 438 | Ga0207642_10051826 | 3300025899 | Bacteria | 1859 |
| 439 | Ga0207642_10205855 | 3300025899 | Bacteria | 1090 |
| 440 | Ga0207642_10918754 | 3300025899 | Unclassified | 561 |
| 441 | Ga0207710_10025350 | 3300025900 | Bacteria | 2559 |
| 442 | Ga0207710_10035930 | 3300025900 | Bacteria | 2182 |
| 443 | Ga0207688_10001006 | 3300025901 | Bacteria | 14351 |
| 444 | Ga0207688_10047793 | 3300025901 | Bacteria | 2390 |
| 445 | Ga0207688_10171790 | 3300025901 | Bacteria | 1289 |
| 446 | Ga0207680_10045487 | 3300025903 | Bacteria | 2588 |
| 447 | Ga0207680_10131226 | 3300025903 | Bacteria | 1652 |
| 448 | Ga0207680_10142652 | 3300025903 | Bacteria | 1589 |
| 449 | Ga0207680_10150354 | 3300025903 | Bacteria | 1552 |
| 450 | Ga0207680_11173183 | 3300025903 | Unclassified | 548 |
| 451 | Ga0207647_10025960 | 3300025904 | Bacteria | 3839 |
| 452 | Ga0207647_10125642 | 3300025904 | Bacteria | 1510 |
| 453 | Ga0207685_10021908 | 3300025905 | Bacteria | 2150 |
| 454 | Ga0207685_10091124 | 3300025905 | Bacteria | 1284 |
| 455 | Ga0207699_10090706 | 3300025906 | Bacteria | 1918 |
| 456 | Ga0207645_10001020 | 3300025907 | Bacteria | 23147 |
| 457 | Ga0207645_10058013 | 3300025907 | Bacteria | 2472 |
| 458 | Ga0207645_10118774 | 3300025907 | Bacteria | 1715 |
| 459 | Ga0207643_10000523 | 3300025908 | Bacteria | 24625 |
| 460 | Ga0207705_10658128 | 3300025909 | Bacteria | 814 |
| 461 | Ga0207684_10245846 | 3300025910 | Unclassified | 1544 |
| 462 | Ga0207654_10047157 | 3300025911 | Bacteria | 2461 |
| 463 | Ga0207654_10069882 | 3300025911 | Bacteria | 2083 |
| 464 | Ga0207707_10018497 | 3300025912 | Bacteria | 6073 |
| 465 | Ga0207707_10046164 | 3300025912 | Bacteria | 3793 |
| 466 | Ga0207707_10059583 | 3300025912 | Bacteria | 3322 |
| 467 | Ga0207707_10061465 | 3300025912 | Bacteria | 3268 |
| 468 | Ga0207695_10321834 | 3300025913 | Bacteria | 1436 |
| 469 | Ga0207695_10361672 | 3300025913 | Bacteria | 1338 |
| 470 | Ga0207671_10113380 | 3300025914 | Bacteria | 2065 |
| 471 | Ga0207671_10702584 | 3300025914 | Bacteria | 804 |
| 472 | Ga0207693_10008072 | 3300025915 | Bacteria | 8632 |
| 473 | Ga0207693_10053468 | 3300025915 | Bacteria | 3168 |
| 474 | Ga0207693_10242740 | 3300025915 | Bacteria | 1414 |
| 475 | Ga0207663_10056960 | 3300025916 | Bacteria | 2461 |
| 476 | Ga0207663_10109844 | 3300025916 | Bacteria | 1869 |
| 477 | Ga0207663_10584502 | 3300025916 | Bacteria | 876 |
| 478 | Ga0207660_10014892 | 3300025917 | Bacteria | 5126 |
| 479 | Ga0207660_10072595 | 3300025917 | Bacteria | 2507 |
| 480 | Ga0207660_10154346 | 3300025917 | Bacteria | 1766 |
| 481 | Ga0207660_10223267 | 3300025917 | Bacteria | 1479 |
| 482 | Ga0207660_10349925 | 3300025917 | Unclassified | 1184 |
| 483 | Ga0207662_10002710 | 3300025918 | Bacteria | 8938 |
| 484 | Ga0207662_10045130 | 3300025918 | Bacteria | 2605 |
| 485 | Ga0207657_10005692 | 3300025919 | Bacteria | 13002 |
| 486 | Ga0207657_10019627 | 3300025919 | Bacteria | 6411 |
| 487 | Ga0207657_10218444 | 3300025919 | Bacteria | 1528 |
| 488 | Ga0207657_10346682 | 3300025919 | Bacteria | 1172 |
| 489 | Ga0207657_10784052 | 3300025919 | Bacteria | 737 |
| 490 | Ga0207649_10004225 | 3300025920 | Bacteria | 7828 |
| 491 | Ga0207649_10414858 | 3300025920 | Bacteria | 1010 |
| 492 | Ga0207652_10018458 | 3300025921 | Bacteria | 5722 |
| 493 | Ga0207652_10069144 | 3300025921 | Bacteria | 3065 |
| 494 | Ga0207652_10169410 | 3300025921 | Bacteria | 1959 |
| 495 | Ga0207652_10180024 | 3300025921 | Bacteria | 1899 |
| 496 | Ga0207652_10187627 | 3300025921 | Bacteria | 1859 |
| 497 | Ga0207652_10191472 | 3300025921 | Bacteria | 1840 |
| 498 | Ga0207652_10238457 | 3300025921 | Bacteria | 1639 |
| 499 | Ga0207681_10004280 | 3300025923 | Bacteria | 8810 |
| 500 | Ga0207681_10048111 | 3300025923 | Bacteria | 2877 |
| 501 | Ga0207694_10170903 | 3300025924 | Bacteria | 1760 |
| 502 | Ga0207650_10003662 | 3300025925 | Bacteria | 10511 |
| 503 | Ga0207650_10107215 | 3300025925 | Bacteria | 2158 |
| 504 | Ga0207659_10002130 | 3300025926 | Bacteria | 11734 |
| 505 | Ga0207659_10266340 | 3300025926 | Unclassified | 1396 |
| 506 | Ga0207659_11261056 | 3300025926 | Bacteria | 635 |
| 507 | Ga0207687_10010078 | 3300025927 | Bacteria | 6180 |
| 508 | Ga0207687_10051449 | 3300025927 | Bacteria | 2872 |
| 509 | Ga0207700_10051330 | 3300025928 | Bacteria | 3078 |
| 510 | Ga0207700_10107794 | 3300025928 | Bacteria | 2235 |
| 511 | Ga0207700_10394305 | 3300025928 | Bacteria | 1212 |
| 512 | Ga0207700_11221199 | 3300025928 | Bacteria | 671 |
| 513 | Ga0207664_10014304 | 3300025929 | Bacteria | 5726 |
| 514 | Ga0207664_10256980 | 3300025929 | Bacteria | 1526 |
| 515 | Ga0207644_10006560 | 3300025931 | Bacteria | 7582 |
| 516 | Ga0207644_10046794 | 3300025931 | Bacteria | 3083 |
| 517 | Ga0207644_10417776 | 3300025931 | Bacteria | 1098 |
| 518 | Ga0207690_10003881 | 3300025932 | Bacteria | 8837 |
| 519 | Ga0207690_10077141 | 3300025932 | Bacteria | 2316 |
| 520 | Ga0207690_10082766 | 3300025932 | Bacteria | 2245 |
| 521 | Ga0207690_10262440 | 3300025932 | Bacteria | 1339 |
| 522 | Ga0207706_10004561 | 3300025933 | Bacteria | 13002 |
| 523 | Ga0207706_10057842 | 3300025933 | Bacteria | 3416 |
| 524 | Ga0207706_10118814 | 3300025933 | Bacteria | 2325 |
| 525 | Ga0207686_10002841 | 3300025934 | Bacteria | 9345 |
| 526 | Ga0207686_10032302 | 3300025934 | Bacteria | 3115 |
| 527 | Ga0207686_10075927 | 3300025934 | Bacteria | 2177 |
| 528 | Ga0207686_10084799 | 3300025934 | Bacteria | 2076 |
| 529 | Ga0207709_10003952 | 3300025935 | Bacteria | 8652 |
| 530 | Ga0207709_10476299 | 3300025935 | Unclassified | 970 |
| 531 | Ga0207709_10906584 | 3300025935 | Bacteria | 717 |
| 532 | Ga0207670_10020819 | 3300025936 | Bacteria | 4036 |
| 533 | Ga0207670_10217665 | 3300025936 | Bacteria | 1460 |
| 534 | Ga0207670_10348513 | 3300025936 | Unclassified | 1172 |
| 535 | Ga0207669_10000737 | 3300025937 | Bacteria | 14194 |
| 536 | Ga0207669_10052926 | 3300025937 | Bacteria | 2442 |
| 537 | Ga0207669_10603744 | 3300025937 | Bacteria | 892 |
| 538 | Ga0207704_10209749 | 3300025938 | Bacteria | 1433 |
| 539 | Ga0207704_10265516 | 3300025938 | Bacteria | 1296 |
| 540 | Ga0207665_10005721 | 3300025939 | Bacteria | 8278 |
| 541 | Ga0207665_10381703 | 3300025939 | Bacteria | 1069 |
| 542 | Ga0207665_10434307 | 3300025939 | Bacteria | 1005 |
| 543 | Ga0207691_10004854 | 3300025940 | Bacteria | 13002 |
| 544 | Ga0207691_10486974 | 3300025940 | Bacteria | 1048 |
| 545 | Ga0207711_10009494 | 3300025941 | Bacteria | 8117 |
| 546 | Ga0207711_10073214 | 3300025941 | Bacteria | 2977 |
| 547 | Ga0207711_10127495 | 3300025941 | Bacteria | 2278 |
| 548 | Ga0207711_10129249 | 3300025941 | Bacteria | 2263 |
| 549 | Ga0207689_10001399 | 3300025942 | Bacteria | 23007 |
| 550 | Ga0207689_10516693 | 3300025942 | Bacteria | 1001 |
| 551 | Ga0207689_10722718 | 3300025942 | Bacteria | 840 |
| 552 | Ga0207689_10823707 | 3300025942 | Unclassified | 783 |
| 553 | Ga0207661_10020336 | 3300025944 | Bacteria | 4961 |
| 554 | Ga0207661_12143474 | 3300025944 | Bacteria | 505 |
| 555 | Ga0207679_10000829 | 3300025945 | Bacteria | 19882 |
| 556 | Ga0207679_10071037 | 3300025945 | Bacteria | 2625 |
| 557 | Ga0207679_10364537 | 3300025945 | Bacteria | 1263 |
| 558 | Ga0207679_10440271 | 3300025945 | Bacteria | 1154 |
| 559 | Ga0207679_10463020 | 3300025945 | Bacteria | 1126 |
| 560 | Ga0207679_10753055 | 3300025945 | Bacteria | 886 |
| 561 | Ga0207667_10057202 | 3300025949 | Bacteria | 4094 |
| 562 | Ga0207667_10121124 | 3300025949 | Bacteria | 2696 |
| 563 | Ga0207667_10934397 | 3300025949 | Bacteria | 857 |
| 564 | Ga0207651_10006082 | 3300025960 | Bacteria | 6273 |
| 565 | Ga0207651_10111984 | 3300025960 | Bacteria | 2051 |
| 566 | Ga0207651_10147297 | 3300025960 | Bacteria | 1828 |
| 567 | Ga0207712_10052478 | 3300025961 | Bacteria | 2856 |
| 568 | Ga0207712_10180598 | 3300025961 | Bacteria | 1657 |
| 569 | Ga0207712_10576067 | 3300025961 | Bacteria | 971 |
| 570 | Ga0207668_10002780 | 3300025972 | Bacteria | 10231 |
| 571 | Ga0207668_10059050 | 3300025972 | Bacteria | 2685 |
| 572 | Ga0207668_10265978 | 3300025972 | Bacteria | 1400 |
| 573 | Ga0207640_10003641 | 3300025981 | Bacteria | 8308 |
| 574 | Ga0207640_10076366 | 3300025981 | Bacteria | 2274 |
| 575 | Ga0207640_10855539 | 3300025981 | Bacteria | 791 |
| 576 | Ga0207658_10014267 | 3300025986 | Bacteria | 5440 |
| 577 | Ga0207658_10052210 | 3300025986 | Bacteria | 3016 |
| 578 | Ga0207658_10652374 | 3300025986 | Bacteria | 949 |
| 579 | Ga0207658_10889762 | 3300025986 | Unclassified | 810 |
| 580 | Ga0207677_10092877 | 3300026023 | Bacteria | 2198 |
| 581 | Ga0207677_10936077 | 3300026023 | Bacteria | 783 |
| 582 | Ga0207703_10005080 | 3300026035 | Bacteria | 10642 |
| 583 | Ga0207703_11103410 | 3300026035 | Bacteria | 762 |
| 584 | Ga0207639_10036135 | 3300026041 | Bacteria | 3659 |
| 585 | Ga0207639_10065082 | 3300026041 | Bacteria | 2829 |
| 586 | Ga0207678_10001694 | 3300026067 | Bacteria | 20208 |
| 587 | Ga0207678_10012983 | 3300026067 | Bacteria | 7311 |
| 588 | Ga0207678_10109778 | 3300026067 | Bacteria | 2353 |
| 589 | Ga0207678_10120447 | 3300026067 | Bacteria | 2239 |
| 590 | Ga0207708_10003453 | 3300026075 | Bacteria | 11648 |
| 591 | Ga0207708_10022048 | 3300026075 | Bacteria | 4808 |
| 592 | Ga0207702_10010469 | 3300026078 | Bacteria | 7756 |
| 593 | Ga0207702_10613610 | 3300026078 | Bacteria | 1068 |
| 594 | Ga0207648_10002393 | 3300026089 | Bacteria | 20202 |
| 595 | Ga0207648_10050827 | 3300026089 | Bacteria | 3624 |
| 596 | Ga0207676_10005110 | 3300026095 | Bacteria | 9289 |
| 597 | Ga0207676_10118340 | 3300026095 | Bacteria | 2229 |
| 598 | Ga0207676_11007531 | 3300026095 | Bacteria | 821 |
| 599 | Ga0207674_10058986 | 3300026116 | Bacteria | 3885 |
| 600 | Ga0207674_10832128 | 3300026116 | Bacteria | 890 |
| 601 | Ga0207674_10881694 | 3300026116 | Bacteria | 862 |
| 602 | Ga0207675_100001715 | 3300026118 | Bacteria | 21956 |
| 603 | Ga0207675_100057767 | 3300026118 | Bacteria | 3620 |
| 604 | Ga0207675_100236665 | 3300026118 | Bacteria | 1763 |
| 605 | Ga0207675_100612320 | 3300026118 | Bacteria | 1093 |
| 606 | Ga0207683_10001190 | 3300026121 | Bacteria | 23550 |
| 607 | Ga0207683_10013747 | 3300026121 | Bacteria | 6900 |
| 608 | Ga0207683_10028744 | 3300026121 | Bacteria | 4809 |
| 609 | Ga0207698_10370313 | 3300026142 | Bacteria | 1359 |
| 610 | Ga0207698_11224391 | 3300026142 | Bacteria | 765 |
| 611 | Ga0209999_1036586 | 3300027543 | Unclassified | 917 |
| 612 | Ga0209982_1004172 | 3300027552 | Bacteria | 2066 |
| 613 | Ga0209970_1016555 | 3300027614 | Bacteria | 1230 |
| 614 | Ga0210002_1000122 | 3300027617 | Bacteria | 12125 |
| 615 | Ga0209983_1017838 | 3300027665 | Bacteria | 1471 |
| 616 | Ga0209971_1009205 | 3300027682 | Bacteria | 2341 |
| 617 | Ga0209966_1000667 | 3300027695 | Bacteria | 7572 |
| 618 | Ga0209998_10001805 | 3300027717 | Bacteria | 5066 |
| 619 | Ga0209998_10007762 | 3300027717 | Bacteria | 2227 |
| 620 | Ga0209974_10000486 | 3300027876 | Bacteria | 13249 |
| 621 | Ga0209974_10036353 | 3300027876 | Bacteria | 1636 |
| 622 | Ga0207428_10000216 | 3300027907 | Bacteria | 79777 |
| 623 | Ga0207428_10001434 | 3300027907 | Bacteria | 25064 |
| 624 | Ga0207428_10019935 | 3300027907 | Bacteria | 5711 |
| 625 | Ga0268266_10016607 | 3300028379 | Bacteria | 6291 |
| 626 | Ga0268266_10089573 | 3300028379 | Bacteria | 2694 |
| 627 | Ga0268266_11861489 | 3300028379 | Unclassified | 576 |
| 628 | Ga0268265_10068406 | 3300028380 | Bacteria | 2753 |
| 629 | Ga0268265_10430445 | 3300028380 | Bacteria | 1227 |
| 630 | Ga0268264_10009868 | 3300028381 | Bacteria | 7903 |
| 631 | Ga0268264_10037830 | 3300028381 | Bacteria | 3980 |
| 632 | Ga0268264_10551602 | 3300028381 | Bacteria | 1130 |
| 633 | Ga0265337_1003693 | 3300028556 | Bacteria | 6551 |
| 634 | Ga0265318_10187235 | 3300028577 | Bacteria | 758 |
| 635 | Ga0265318_10273465 | 3300028577 | Bacteria | 616 |
| 636 | Ga0265338_10134384 | 3300028800 | Bacteria | 1948 |
| 637 | Ga0265330_10020395 | 3300031235 | Bacteria | 3029 |
| 638 | Ga0265325_10000048 | 3300031241 | Bacteria | 82899 |
| 639 | Ga0265325_10025252 | 3300031241 | Bacteria | 3227 |
| 640 | Ga0265325_10048132 | 3300031241 | Bacteria | 2205 |
| 641 | Ga0265340_10020827 | 3300031247 | Bacteria | 3365 |
| 642 | Ga0265340_10237127 | 3300031247 | Unclassified | 814 |
| 643 | Ga0265339_10150552 | 3300031249 | Unclassified | 1177 |
| 644 | Ga0265331_10009513 | 3300031250 | Bacteria | 5451 |
| 645 | Ga0265316_10200564 | 3300031344 | Bacteria | 1479 |
| 646 | Ga0265316_10258928 | 3300031344 | Bacteria | 1276 |
| 647 | Ga0265313_10028748 | 3300031595 | Bacteria | 2885 |
| 648 | Ga0265313_10139333 | 3300031595 | Bacteria | 1044 |
| 649 | Ga0316575_10024682 | 3300031665 | Bacteria | 2329 |
| 650 | Ga0265314_10004264 | 3300031711 | Bacteria | 13384 |
| 651 | Ga0265314_10005957 | 3300031711 | Bacteria | 10889 |
| 652 | Ga0307406_10475704 | 3300031901 | Bacteria | 1008 |
| 653 | Ga0307416_101198459 | 3300032002 | Bacteria | 865 |
| 654 | Ga0307415_100480274 | 3300032126 | Bacteria | 1082 |
| 655 | Ga0373930_0015286 | 3300034816 | Bacteria | 1440 |
| 656 | Ga0373930_0032077 | 3300034816 | Bacteria | 1086 |
| 657 | Ga0373930_0033680 | 3300034816 | Bacteria | 1065 |
| 658 | Ga0373930_0038718 | 3300034816 | Unclassified | 1008 |
| 659 | Ga0373948_0000410 | 3300034817 | Bacteria | 5285 |
| 660 | Ga0373948_0217720 | 3300034817 | Unclassified | 504 |
| 661 | Ga0373950_0000808 | 3300034818 | Bacteria | 3923 |
| 662 | Ga0373950_0036772 | 3300034818 | Bacteria | 925 |
| 663 | Ga0373958_0001617 | 3300034819 | Bacteria | 3052 |
| 664 | Ga0373958_0004911 | 3300034819 | Bacteria | 2003 |
| 665 | Ga0373958_0068004 | 3300034819 | Bacteria | 785 |
| 666 | Ga0373958_0080361 | 3300034819 | Bacteria | 737 |
| 667 | Ga0373959_0070654 | 3300034820 | Bacteria | 789 |
| 668 | Ga0373938_0000681 | 3300034957 | Bacteria | 5463 |
| 669 | Ga0373926_0021412 | 3300035083 | Bacteria | 2239 |
| 670 | Ga0373926_0065910 | 3300035083 | Bacteria | 1325 |
| 671 | Ga0373928_0004171 | 3300035084 | Bacteria | 2754 |
| 672 | Ga0373928_0005886 | 3300035084 | Bacteria | 2345 |
| 673 | Ga0373928_0068112 | 3300035084 | Bacteria | 874 |
| 674 | Ga0373928_0157390 | 3300035084 | Bacteria | 633 |
| 675 | Ga0373929_0001045 | 3300035085 | Bacteria | 5365 |
| 676 | Ga0373929_0015912 | 3300035085 | Bacteria | 1468 |
| 677 | Ga0373929_0211754 | 3300035085 | Bacteria | 547 |
| 678 | Ga0373934_0068557 | 3300035086 | Bacteria | 1417 |
| 679 | Ga0373934_0071466 | 3300035086 | Bacteria | 1388 |
| 680 | Ga0373934_0168069 | 3300035086 | Bacteria | 900 |
| 681 | Ga0373940_0000034 | 3300035088 | Bacteria | 14984 |
| 682 | Ga0373940_0001993 | 3300035088 | Bacteria | 3864 |
| 683 | Ga0373940_0157104 | 3300035088 | Bacteria | 728 |
| 684 | Ga0373944_0019469 | 3300035089 | Bacteria | 1948 |
| 685 | Ga0373949_0001494 | 3300035090 | Bacteria | 6649 |
| 686 | Ga0373949_0023580 | 3300035090 | Bacteria | 1426 |
| 687 | Ga0373949_0040187 | 3300035090 | Bacteria | 1147 |
| 688 | Ga0373949_0268000 | 3300035090 | Unclassified | 533 |
| 689 | Ga0373949_0297125 | 3300035090 | Unclassified | 511 |
| 690 | Ga0373951_0006292 | 3300035091 | Bacteria | 2716 |
| 691 | Ga0373951_0006726 | 3300035091 | Bacteria | 2625 |
| 692 | Ga0373951_0019160 | 3300035091 | Bacteria | 1558 |
| 693 | Ga0373952_0000499 | 3300035092 | Bacteria | 6828 |
| 694 | Ga0373952_0026576 | 3300035092 | Bacteria | 1258 |
| 695 | Ga0373952_0031323 | 3300035092 | Bacteria | 1182 |
| 696 | Ga0373923_0035431 | 3300035111 | Bacteria | 2032 |
| 697 | Ga0373923_0127098 | 3300035111 | Unclassified | 1143 |
| 698 | Ga0373923_0181010 | 3300035111 | Bacteria | 968 |
| 699 | Ga0373932_0000153 | 3300035112 | Bacteria | 19891 |
| 700 | Ga0373932_0003391 | 3300035112 | Bacteria | 3838 |
| 701 | Ga0373939_0000182 | 3300035114 | Bacteria | 17440 |
| 702 | Ga0373939_0001329 | 3300035114 | Bacteria | 6003 |
| 703 | Ga0373939_0002892 | 3300035114 | Bacteria | 4035 |
| 704 | Ga0373939_0058772 | 3300035114 | Bacteria | 1217 |
| 705 | Ga0373939_0143332 | 3300035114 | Unclassified | 863 |
| 706 | Ga0373941_0000351 | 3300035115 | Bacteria | 9066 |
| 707 | Ga0373941_0004347 | 3300035115 | Bacteria | 3266 |
| 708 | Ga0373941_0064242 | 3300035115 | Unclassified | 1202 |
| 709 | Ga0373941_0180985 | 3300035115 | Bacteria | 791 |
| 710 | Ga0373945_0049929 | 3300035116 | Bacteria | 1536 |
| 711 | Ga0373945_0107321 | 3300035116 | Bacteria | 1098 |
| 712 | Ga0373953_0010294 | 3300035117 | Bacteria | 3250 |
| 713 | Ga0373954_0027838 | 3300035118 | Bacteria | 2596 |
| 714 | Ga0373954_0253155 | 3300035118 | Bacteria | 867 |
| 715 | Ga0373956_0007365 | 3300035119 | Bacteria | 4430 |
| 716 | Ga0373956_0022400 | 3300035119 | Bacteria | 2703 |
| 717 | Ga0373956_0123625 | 3300035119 | Bacteria | 1209 |
| 718 | Ga0373956_0156836 | 3300035119 | Bacteria | 1072 |
| 719 | Ga0373957_0031423 | 3300035120 | Bacteria | 1951 |
| 720 | Ga0373957_0054574 | 3300035120 | Bacteria | 1535 |
| 721 | Ga0373957_0147804 | 3300035120 | Bacteria | 963 |
| 722 | Ga0373960_0000322 | 3300035121 | Bacteria | 9091 |
| 723 | Ga0373960_0062962 | 3300035121 | Bacteria | 1129 |
| 724 | Ga0373960_0250675 | 3300035121 | Unclassified | 643 |
| 725 | Ga0373943_0005045 | 3300035170 | Bacteria | 5955 |
| 726 | Ga0373943_0935381 | 3300035170 | Bacteria | 518 |
| 727 | Ga0373946_0007767 | 3300035171 | Bacteria | 3934 |
| 728 | Ga0373946_0197285 | 3300035171 | Bacteria | 962 |
| 729 | Ga0373955_0003725 | 3300035172 | Bacteria | 6712 |
| 730 | Ga0373955_0009409 | 3300035172 | Bacteria | 4571 |
| 731 | Ga0373955_0036131 | 3300035172 | Bacteria | 2620 |
| 732 | Ga0373955_0672880 | 3300035172 | Bacteria | 635 |
| 733 | Ga0373955_0807047 | 3300035172 | Bacteria | 577 |
| 734 | Ga0373942_0000405 | 3300035207 | Bacteria | 11997 |
| 735 | Ga0373942_0015907 | 3300035207 | Bacteria | 1839 |
| 736 | Ga0373942_0026694 | 3300035207 | Bacteria | 1497 |
| 737 | Ga0373961_0001013 | 3300035241 | Bacteria | 9186 |
| 738 | Ga0373961_0048773 | 3300035241 | Bacteria | 1249 |
| 739 | Ga0373961_0092053 | 3300035241 | Bacteria | 970 |
| 740 | Ga0373961_0304116 | 3300035241 | Bacteria | 591 |
| 741 | Ga0373962_0001641 | 3300035242 | Bacteria | 5314 |
| 742 | Ga0373962_0001705 | 3300035242 | Bacteria | 5226 |
| 743 | Ga0373962_0033329 | 3300035242 | Bacteria | 1421 |
| 744 | Ga0373924_0008230 | 3300035410 | Bacteria | 3784 |
| 745 | Ga0373924_0196540 | 3300035410 | Bacteria | 889 |
| 746 | Ga0373931_0046111 | 3300035691 | Bacteria | 2303 |
| 747 | Ga0373931_0242259 | 3300035691 | Bacteria | 1093 |
| 748 | Ga0373931_1061369 | 3300035691 | Bacteria | 550 |
| 749 | Ga0373935_0041202 | 3300035692 | Bacteria | 2901 |
| 750 | Ga0373935_0124050 | 3300035692 | Bacteria | 1728 |
| 751 | Ga0373927_0032885 | 3300035695 | Bacteria | 3377 |
| 752 | Ga0373933_0004422 | 3300035724 | Bacteria | 7714 |
| 753 | Ga0373933_0066670 | 3300035724 | Bacteria | 2182 |
| 754 | Ga0373933_0070080 | 3300035724 | Bacteria | 2132 |
| 755 | Ga0373933_0526669 | 3300035724 | Bacteria | 775 |
| 756 | Ga0373947_0011056 | 3300035725 | Bacteria | 5181 |
| 757 | Ga0373947_0677090 | 3300035725 | Bacteria | 703 |
| 758 | Ga0373937_0014903 | 3300036401 | Bacteria | 6865 |
| 759 | Ga0373937_0017492 | 3300036401 | Bacteria | 6388 |
| 760 | Ga0373937_0048364 | 3300036401 | Bacteria | 3893 |
| 761 | Ga0373937_0150711 | 3300036401 | Bacteria | 2178 |
| 762 | Ga0373937_1397703 | 3300036401 | Unclassified | 648 |
| 763 | Ga0316582_0316671 | 3300036647 | Bacteria | 1072 |
| 764 | Ga0373925_0095869 | 3300037068 | Bacteria | 2273 |
| 765 | Ga0373925_0134404 | 3300037068 | Bacteria | 1931 |
| 766 | Ga0373925_1052653 | 3300037068 | Unclassified | 670 |
| 767 | Ga0373925_1225309 | 3300037068 | Bacteria | 616 |
| 768 | Ga0395899_0009657 | 3300037312 | Bacteria | 7405 |
| 769 | Ga0395900_0003135 | 3300037418 | Bacteria | 17934 |
| 770 | Ga0395898_0051585 | 3300037466 | Bacteria | 4022 |
| 771 | Ga0395901_0020098 | 3300038443 | Bacteria | 6834 |
| 772 | Ga0395901_0268724 | 3300038443 | Bacteria | 1774 |
| 773 | Ga0395901_1308869 | 3300038443 | Bacteria | 686 |
| 774 | Ga0436365_0566814 | 3300039437 | Bacteria | 956 |
| 775 | Ga0436365_1828125 | 3300039437 | Bacteria | 5509 |
| 776 | Ga0439453_0111251 | 3300041408 | Unclassified | 620 |
| 777 | Ga0439464_0032655 | 3300042439 | Unclassified | 1463 |
| 778 | Ga0451577_0158113 | 3300042876 | Bacteria | 2040 |
| 779 | Ga0451577_0682662 | 3300042876 | Bacteria | 931 |
| 780 | Ga0439440_0021628 | 3300042993 | Bacteria | 1452 |
| 781 | Ga0466963_0024510 | 3300044694 | Bacteria | 3841 |
| 782 | Ga0466964_0171183 | 3300044706 | Bacteria | 1023 |
| 783 | Ga0453684_0605479 | 3300044712 | Bacteria | 1200 |
| 784 | Ga0466957_0131988 | 3300044842 | Bacteria | 1601 |
| 785 | Ga0451576_0173408 | 3300045051 | Bacteria | 2251 |
| 786 | Ga0466958_0027374 | 3300045836 | Bacteria | 3375 |
| 787 | Ga0466967_0016669 | 3300045976 | Bacteria | 5802 |
| 788 | Ga0495592_0001176 | 3300046454 | Bacteria | 18145 |
| 789 | Ga0495592_0136082 | 3300046454 | Bacteria | 1713 |
| 790 | Ga0495603_0233395 | 3300046455 | Bacteria | 1060 |
| 791 | Ga0495603_0381374 | 3300046455 | Bacteria | 808 |
| 792 | Ga0495629_0002326 | 3300046459 | Bacteria | 14645 |
| 793 | Ga0495629_0038860 | 3300046459 | Bacteria | 3351 |
| 794 | Ga0495638_0155149 | 3300046460 | Unclassified | 1325 |
| 795 | Ga0495641_0238020 | 3300046461 | Bacteria | 818 |
| 796 | Ga0495641_0409428 | 3300046461 | Unclassified | 615 |
| 797 | Ga0495651_0000921 | 3300046462 | Bacteria | 22808 |
| 798 | Ga0495651_0112899 | 3300046462 | Bacteria | 2007 |
| 799 | Ga0495651_0174784 | 3300046462 | Bacteria | 1526 |
| 800 | Ga0495653_0001436 | 3300046463 | Bacteria | 18599 |
| 801 | Ga0495653_0114518 | 3300046463 | Bacteria | 1932 |
| 802 | Ga0495653_0251071 | 3300046463 | Bacteria | 1174 |
| 803 | Ga0495580_0377888 | 3300046472 | Bacteria | 957 |
| 804 | Ga0495582_0012004 | 3300046473 | Bacteria | 4772 |
| 805 | Ga0495582_0077819 | 3300046473 | Bacteria | 1840 |
| 806 | Ga0495639_0168167 | 3300046475 | Bacteria | 1063 |
| 807 | Ga0495639_0197163 | 3300046475 | Bacteria | 984 |
| 808 | Ga0495639_0258397 | 3300046475 | Bacteria | 862 |
| 809 | Ga0495662_0070535 | 3300046476 | Bacteria | 1693 |
| 810 | Ga0495664_0027048 | 3300046477 | Bacteria | 3343 |
| 811 | Ga0495664_0070680 | 3300046477 | Bacteria | 2084 |
| 812 | Ga0495584_0178697 | 3300046491 | Bacteria | 1079 |
| 813 | Ga0495594_0031273 | 3300046499 | Bacteria | 2885 |
| 814 | Ga0495594_0169787 | 3300046499 | Bacteria | 1241 |
| 815 | Ga0495608_0001582 | 3300046511 | Bacteria | 16261 |
| 816 | Ga0495608_0113647 | 3300046511 | Bacteria | 1739 |
| 817 | Ga0495618_0033958 | 3300046514 | Bacteria | 3198 |
| 818 | Ga0495628_0012601 | 3300046516 | Bacteria | 7125 |
| 819 | Ga0495628_0201686 | 3300046516 | Bacteria | 1498 |
| 820 | Ga0495630_0178246 | 3300046517 | Bacteria | 1620 |
| 821 | Ga0495630_0821357 | 3300046517 | Bacteria | 709 |
| 822 | Ga0495644_0197672 | 3300046523 | Bacteria | 775 |
| 823 | Ga0495666_0216948 | 3300046526 | Bacteria | 877 |
| 824 | Ga0495652_0117918 | 3300046529 | Bacteria | 2122 |
| 825 | Ga0495652_0252975 | 3300046529 | Bacteria | 1304 |
| 826 | Ga0495665_0035534 | 3300046531 | Bacteria | 2662 |
| 827 | Ga0495665_0397386 | 3300046531 | Bacteria | 699 |
| 828 | Ga0495640_0047836 | 3300046533 | Bacteria | 2958 |
| 829 | Ga0495640_0387326 | 3300046533 | Unclassified | 859 |
| 830 | Ga0495640_0709575 | 3300046533 | Unclassified | 603 |
| 831 | Ga0495586_0012264 | 3300046535 | Bacteria | 4549 |
| 832 | Ga0495587_0008788 | 3300046536 | Bacteria | 6481 |
| 833 | Ga0495587_0067974 | 3300046536 | Bacteria | 2076 |
| 834 | Ga0495587_0184009 | 3300046536 | Unclassified | 1184 |
| 835 | Ga0495587_0236508 | 3300046536 | Unclassified | 1028 |
| 836 | Ga0495645_0062076 | 3300046543 | Bacteria | 2707 |
| 837 | Ga0495645_0103777 | 3300046543 | Bacteria | 2019 |
| 838 | Ga0495645_0700649 | 3300046543 | Bacteria | 615 |
| 839 | Ga0495667_0076608 | 3300046559 | Bacteria | 2176 |
| 840 | Ga0495667_0081908 | 3300046559 | Bacteria | 2097 |
| 841 | Ga0495667_0117346 | 3300046559 | Bacteria | 1719 |
| 842 | Ga0495634_0055078 | 3300046642 | Bacteria | 2660 |
| 843 | Ga0495635_0007233 | 3300046663 | Bacteria | 7755 |
| 844 | Ga0495635_0062421 | 3300046663 | Bacteria | 2559 |
| 845 | Ga0495635_0104544 | 3300046663 | Bacteria | 1935 |
| 846 | Ga0495635_0132807 | 3300046663 | Bacteria | 1697 |
| 847 | Ga0495635_0156761 | 3300046663 | Bacteria | 1550 |
| 848 | Ga0495588_0683567 | 3300046674 | Bacteria | 537 |
| 849 | Ga0495657_0005844 | 3300046675 | Bacteria | 9683 |
| 850 | Ga0495657_0191333 | 3300046675 | Bacteria | 1250 |
| 851 | Ga0495599_0006246 | 3300046678 | Bacteria | 7181 |
| 852 | Ga0495599_0020143 | 3300046678 | Bacteria | 4155 |
| 853 | Ga0495623_0005873 | 3300046679 | Bacteria | 7999 |
| 854 | Ga0495623_0050706 | 3300046679 | Bacteria | 2628 |
| 855 | Ga0495646_0171435 | 3300046680 | Bacteria | 1196 |
| 856 | Ga0495647_0164650 | 3300046681 | Bacteria | 957 |
| 857 | Ga0495647_0187987 | 3300046681 | Bacteria | 901 |
| 858 | Ga0495658_0008925 | 3300046683 | Bacteria | 4985 |
| 859 | Ga0495658_0086285 | 3300046683 | Bacteria | 1851 |
| 860 | Ga0495613_0093005 | 3300046689 | Bacteria | 2183 |
| 861 | Ga0495613_0856238 | 3300046689 | Bacteria | 590 |
| 862 | Ga0495624_0470836 | 3300046690 | Bacteria | 752 |
| 863 | Ga0495600_0071447 | 3300046809 | Bacteria | 2267 |
| 864 | Ga0495600_0108162 | 3300046809 | Unclassified | 1811 |
| 865 | Ga0495600_0118383 | 3300046809 | Bacteria | 1723 |
| 866 | Ga0495600_0202556 | 3300046809 | Bacteria | 1274 |
| 867 | Ga0495600_0296046 | 3300046809 | Bacteria | 1022 |
| 868 | Ga0495581_0298574 | 3300047315 | Bacteria | 941 |
| 869 | Ga0495581_0331754 | 3300047315 | Bacteria | 888 |
| 870 | Ga0495581_0888800 | 3300047315 | Unclassified | 509 |
| 871 | Ga0495604_0005412 | 3300047317 | Bacteria | 10125 |
| 872 | Ga0495604_0018521 | 3300047317 | Bacteria | 5578 |
| 873 | Ga0495604_0034540 | 3300047317 | Bacteria | 4000 |
| 874 | Ga0495604_0109429 | 3300047317 | Bacteria | 2017 |
| 875 | Ga0495674_0012552 | 3300047319 | Bacteria | 7980 |
| 876 | Ga0495674_0044171 | 3300047319 | Bacteria | 3963 |
| 877 | Ga0495674_0092176 | 3300047319 | Bacteria | 2587 |
| 878 | Ga0495674_0724492 | 3300047319 | Bacteria | 779 |
| 879 | Ga0495680_0013950 | 3300047322 | Bacteria | 6987 |
| 880 | Ga0495680_0026104 | 3300047322 | Bacteria | 4822 |
| 881 | Ga0495680_0175710 | 3300047322 | Bacteria | 1549 |
| 882 | Ga0495680_0176720 | 3300047322 | Bacteria | 1543 |
| 883 | Ga0495680_0711110 | 3300047322 | Unclassified | 663 |
| 884 | Ga0495675_0002919 | 3300047444 | Bacteria | 10270 |
| 885 | Ga0495675_0029357 | 3300047444 | Bacteria | 3507 |
| 886 | Ga0495675_0254488 | 3300047444 | Unclassified | 1054 |
| 887 | Ga0495593_0014850 | 3300047673 | Bacteria | 4424 |
| 888 | Ga0495593_0083148 | 3300047673 | Bacteria | 1654 |
| 889 | Ga0495602_0000618 | 3300048088 | Bacteria | 33441 |
| 890 | Ga0495602_0010978 | 3300048088 | Bacteria | 9383 |
| 891 | Ga0495602_0362367 | 3300048088 | Bacteria | 1043 |
| 892 | Ga0495614_0105045 | 3300048089 | Bacteria | 1237 |
| 893 | Ga0495614_0211586 | 3300048089 | Bacteria | 879 |
| 894 | Ga0495626_0406313 | 3300048091 | Unclassified | 526 |
| 895 | Ga0496100_0008731 | 3300048903 | Bacteria | 5661 |
| 896 | Ga0496100_0011005 | 3300048903 | Bacteria | 5132 |
| 897 | Ga0496100_0636214 | 3300048903 | Bacteria | 830 |
| 898 | Ga0496101_0193177 | 3300048904 | Bacteria | 1571 |
| 899 | Ga0496101_0244250 | 3300048904 | Bacteria | 1397 |
| 900 | Ga0496101_0424264 | 3300048904 | Bacteria | 1048 |
| 901 | Ga0496101_0594558 | 3300048904 | Bacteria | 875 |
| 902 | Ga0496102_0009606 | 3300048905 | Bacteria | 8319 |
| 903 | Ga0496102_0032780 | 3300048905 | Bacteria | 4668 |
| 904 | Ga0496102_0068715 | 3300048905 | Bacteria | 3251 |
| 905 | Ga0496102_0776715 | 3300048905 | Bacteria | 880 |
| 906 | Ga0496102_1519250 | 3300048905 | Unclassified | 588 |
| 907 | Ga0496103_0003651 | 3300048906 | Bacteria | 9370 |
| 908 | Ga0496103_0006551 | 3300048906 | Bacteria | 6947 |
| 909 | Ga0496103_0043635 | 3300048906 | Bacteria | 2761 |
| 910 | Ga0496103_0258265 | 3300048906 | Bacteria | 1121 |
| 911 | Ga0496103_0348092 | 3300048906 | Unclassified | 953 |
| 912 | Ga0496104_0000196 | 3300048907 | Bacteria | 53901 |
| 913 | Ga0496104_0003411 | 3300048907 | Bacteria | 13715 |
| 914 | Ga0496104_0178276 | 3300048907 | Bacteria | 2035 |
| 915 | Ga0496104_0345947 | 3300048907 | Bacteria | 1399 |
| 916 | Ga0496104_0584238 | 3300048907 | Unclassified | 1027 |
| 917 | Ga0496105_0004873 | 3300048908 | Bacteria | 10137 |
| 918 | Ga0496105_0029068 | 3300048908 | Bacteria | 4524 |
| 919 | Ga0496105_0091794 | 3300048908 | Bacteria | 2507 |
| 920 | Ga0496105_0273851 | 3300048908 | Bacteria | 1362 |
| 921 | Ga0496105_0540633 | 3300048908 | Bacteria | 910 |
| 922 | Ga0496105_0654904 | 3300048908 | Unclassified | 810 |
| 923 | Ga0496106_0024841 | 3300048909 | Bacteria | 4455 |
| 924 | Ga0496106_0127514 | 3300048909 | Bacteria | 1993 |
| 925 | Ga0496106_0143308 | 3300048909 | Bacteria | 1880 |
| 926 | Ga0496106_0308063 | 3300048909 | Bacteria | 1270 |
| 927 | Ga0496107_0031992 | 3300048910 | Bacteria | 3757 |
| 928 | Ga0496107_0043706 | 3300048910 | Bacteria | 3219 |
| 929 | Ga0496107_0154684 | 3300048910 | Bacteria | 1697 |
| 930 | Ga0496107_0187453 | 3300048910 | Bacteria | 1537 |
| 931 | Ga0496108_0008566 | 3300048911 | Bacteria | 8292 |
| 932 | Ga0496108_0154898 | 3300048911 | Bacteria | 1978 |
| 933 | Ga0496108_0243278 | 3300048911 | Bacteria | 1565 |
| 934 | Ga0496108_0335043 | 3300048911 | Bacteria | 1319 |
| 935 | Ga0496108_0383956 | 3300048911 | Unclassified | 1226 |
| 936 | Ga0496109_0001554 | 3300048912 | Bacteria | 19107 |
| 937 | Ga0496109_0037839 | 3300048912 | Bacteria | 4360 |
| 938 | Ga0496109_0112776 | 3300048912 | Bacteria | 2528 |
| 939 | Ga0496109_0118317 | 3300048912 | Bacteria | 2466 |
| 940 | Ga0496109_0331643 | 3300048912 | Bacteria | 1436 |
| 941 | Ga0496110_0019989 | 3300048913 | Bacteria | 5645 |
| 942 | Ga0496110_0072383 | 3300048913 | Bacteria | 3058 |
| 943 | Ga0496110_0084321 | 3300048913 | Bacteria | 2836 |
| 944 | Ga0496110_0234794 | 3300048913 | Bacteria | 1668 |
| 945 | Ga0496110_0325880 | 3300048913 | Bacteria | 1399 |
| 946 | Ga0496111_0035114 | 3300048914 | Bacteria | 3582 |
| 947 | Ga0496111_0199812 | 3300048914 | Unclassified | 1486 |
| 948 | Ga0496111_0236609 | 3300048914 | Bacteria | 1356 |
| 949 | Ga0496111_0254702 | 3300048914 | Bacteria | 1302 |
| 950 | Ga0496112_0003337 | 3300048915 | Bacteria | 13247 |
| 951 | Ga0496112_0128268 | 3300048915 | Bacteria | 2507 |
| 952 | Ga0496112_0158741 | 3300048915 | Bacteria | 2228 |
| 953 | Ga0496112_0274241 | 3300048915 | Bacteria | 1634 |
| 954 | Ga0496112_0978126 | 3300048915 | Bacteria | 766 |
| 955 | Ga0496112_1430576 | 3300048915 | Unclassified | 606 |
| 956 | Ga0496112_1552547 | 3300048915 | Bacteria | 575 |
| 957 | Ga0496113_0007502 | 3300048916 | Bacteria | 7027 |
| 958 | Ga0496113_0015368 | 3300048916 | Bacteria | 5259 |
| 959 | Ga0496113_0236829 | 3300048916 | Bacteria | 1456 |
| 960 | Ga0496113_0345871 | 3300048916 | Bacteria | 1193 |
| 961 | Ga0496113_0508090 | 3300048916 | Bacteria | 967 |
| 962 | Ga0496113_0572547 | 3300048916 | Bacteria | 905 |
| 963 | Ga0496114_0001741 | 3300048917 | Bacteria | 16526 |
| 964 | Ga0496114_0012467 | 3300048917 | Bacteria | 6805 |
| 965 | Ga0496114_0091782 | 3300048917 | Bacteria | 2580 |
| 966 | Ga0496114_1480879 | 3300048917 | Bacteria | 566 |
| 967 | Ga0496115_0032793 | 3300048918 | Bacteria | 4099 |
| 968 | Ga0496115_0034934 | 3300048918 | Bacteria | 3974 |
| 969 | Ga0496115_0265424 | 3300048918 | Unclassified | 1411 |
| 970 | Ga0496115_0280790 | 3300048918 | Bacteria | 1367 |
| 971 | Ga0496115_1126288 | 3300048918 | Unclassified | 593 |
| 972 | Ga0496115_1215716 | 3300048918 | Bacteria | 565 |
| 973 | Ga0501032_0024985 | 3300049569 | Bacteria | 4121 |
| 974 | Ga0501032_0079968 | 3300049569 | Bacteria | 2175 |
| 975 | Ga0501032_0086656 | 3300049569 | Bacteria | 2081 |
| 976 | Ga0501032_0322061 | 3300049569 | Bacteria | 997 |
| 977 | Ga0501032_0447545 | 3300049569 | Bacteria | 827 |
| 978 | Ga0501032_0688659 | 3300049569 | Bacteria | 648 |
| 979 | Ga0501033_0006958 | 3300049570 | Bacteria | 8831 |
| 980 | Ga0501033_0025887 | 3300049570 | Bacteria | 4417 |
| 981 | Ga0501033_0165755 | 3300049570 | Bacteria | 1588 |
| 982 | Ga0501033_0262685 | 3300049570 | Bacteria | 1221 |
| 983 | Ga0501033_0307675 | 3300049570 | Bacteria | 1115 |
| 984 | Ga0501034_0001401 | 3300049571 | Bacteria | 32406 |
| 985 | Ga0501034_0001763 | 3300049571 | Bacteria | 27682 |
| 986 | Ga0501034_0038051 | 3300049571 | Bacteria | 4873 |
| 987 | Ga0501034_0089853 | 3300049571 | Bacteria | 3069 |
| 988 | Ga0501034_0101694 | 3300049571 | Bacteria | 2867 |
| 989 | Ga0501034_0173889 | 3300049571 | Bacteria | 2120 |
| 990 | Ga0501034_0190194 | 3300049571 | Bacteria | 2015 |
| 991 | Ga0501034_0210555 | 3300049571 | Bacteria | 1899 |
| 992 | Ga0501034_0286102 | 3300049571 | Bacteria | 1587 |
| 993 | Ga0501034_1379156 | 3300049571 | Bacteria | 580 |
| 994 | Ga0501036_0000164 | 3300049572 | Bacteria | 43588 |
| 995 | Ga0501036_0002829 | 3300049572 | Bacteria | 13751 |
| 996 | Ga0501036_0006271 | 3300049572 | Bacteria | 9646 |
| 997 | Ga0501036_0018152 | 3300049572 | Bacteria | 5891 |
| 998 | Ga0501036_0062034 | 3300049572 | Bacteria | 3166 |
| 999 | Ga0501036_0235077 | 3300049572 | Bacteria | 1537 |
| 1000 | Ga0501036_0668165 | 3300049572 | Bacteria | 859 |
| 1001 | Ga0501036_1154165 | 3300049572 | Bacteria | 632 |
| 1002 | Ga0501037_0007497 | 3300049573 | Bacteria | 7986 |
| 1003 | Ga0501037_0010040 | 3300049573 | Bacteria | 6945 |
| 1004 | Ga0501037_0032091 | 3300049573 | Bacteria | 3877 |
| 1005 | Ga0501037_0047340 | 3300049573 | Bacteria | 3151 |
| 1006 | Ga0501037_0047911 | 3300049573 | Bacteria | 3131 |
| 1007 | Ga0501037_0152168 | 3300049573 | Bacteria | 1653 |
| 1008 | Ga0501038_0003058 | 3300049574 | Bacteria | 15602 |
| 1009 | Ga0501038_0007470 | 3300049574 | Bacteria | 10084 |
| 1010 | Ga0501038_0028917 | 3300049574 | Bacteria | 4918 |
| 1011 | Ga0501038_0134370 | 3300049574 | Bacteria | 2028 |
| 1012 | Ga0501038_0157122 | 3300049574 | Bacteria | 1851 |
| 1013 | Ga0501038_0269031 | 3300049574 | Bacteria | 1344 |
| 1014 | Ga0501039_0041250 | 3300049575 | Bacteria | 3564 |
| 1015 | Ga0501039_0048297 | 3300049575 | Bacteria | 3290 |
| 1016 | Ga0501039_0113164 | 3300049575 | Bacteria | 2122 |
| 1017 | Ga0501039_0188753 | 3300049575 | Bacteria | 1621 |
| 1018 | Ga0501039_1182773 | 3300049575 | Bacteria | 592 |
| 1019 | Ga0501040_0132124 | 3300049576 | Bacteria | 1756 |
| 1020 | Ga0501040_0414509 | 3300049576 | Bacteria | 968 |
| 1021 | Ga0501042_0266195 | 3300049578 | Bacteria | 1237 |
| 1022 | Ga0501042_0456764 | 3300049578 | Bacteria | 926 |
| 1023 | Ga0501043_0001255 | 3300049579 | Bacteria | 22361 |
| 1024 | Ga0501043_0040784 | 3300049579 | Bacteria | 3648 |
| 1025 | Ga0501043_0050128 | 3300049579 | Bacteria | 3282 |
| 1026 | Ga0501043_0059802 | 3300049579 | Bacteria | 2990 |
| 1027 | Ga0501043_0080522 | 3300049579 | Bacteria | 2559 |
| 1028 | Ga0501043_0086876 | 3300049579 | Bacteria | 2457 |
| 1029 | Ga0501043_0094350 | 3300049579 | Bacteria | 2352 |
| 1030 | Ga0501043_0157721 | 3300049579 | Bacteria | 1774 |
| 1031 | Ga0501043_0413677 | 3300049579 | Bacteria | 1017 |
| 1032 | Ga0501043_1290321 | 3300049579 | Bacteria | 510 |
| 1033 | Ga0501046_0022166 | 3300049580 | Bacteria | 5234 |
| 1034 | Ga0501046_0033837 | 3300049580 | Bacteria | 4127 |
| 1035 | Ga0501046_0044911 | 3300049580 | Bacteria | 3512 |
| 1036 | Ga0501047_0003578 | 3300049581 | Bacteria | 14663 |
| 1037 | Ga0501047_0062444 | 3300049581 | Bacteria | 3593 |
| 1038 | Ga0501047_0164896 | 3300049581 | Bacteria | 2086 |
| 1039 | Ga0501047_0314369 | 3300049581 | Bacteria | 1407 |
| 1040 | Ga0501047_0396385 | 3300049581 | Bacteria | 1213 |
| 1041 | Ga0501047_0900222 | 3300049581 | Bacteria | 698 |
| 1042 | Ga0501047_0937237 | 3300049581 | Bacteria | 679 |
| 1043 | Ga0501047_1123481 | 3300049581 | Bacteria | 599 |
| 1044 | Ga0501048_0009262 | 3300049582 | Bacteria | 7397 |
| 1045 | Ga0501048_0025760 | 3300049582 | Bacteria | 4284 |
| 1046 | Ga0501048_0342437 | 3300049582 | Bacteria | 1066 |
| 1047 | Ga0501048_0663350 | 3300049582 | Bacteria | 749 |
| 1048 | Ga0501067_0009519 | 3300049583 | Bacteria | 5382 |
| 1049 | Ga0501067_0216510 | 3300049583 | Bacteria | 1066 |
| 1050 | Ga0501068_0124279 | 3300049584 | Bacteria | 1610 |
| 1051 | Ga0501068_0283780 | 3300049584 | Bacteria | 1058 |
| 1052 | Ga0501068_0486212 | 3300049584 | Bacteria | 800 |
| 1053 | Ga0501069_0001900 | 3300049585 | Bacteria | 10423 |
| 1054 | Ga0501069_0045493 | 3300049585 | Bacteria | 2432 |
| 1055 | Ga0501069_0093060 | 3300049585 | Bacteria | 1705 |
| 1056 | Ga0501069_0210813 | 3300049585 | Bacteria | 1128 |
| 1057 | Ga0501069_0640647 | 3300049585 | Bacteria | 639 |
| 1058 | Ga0501070_0012006 | 3300049586 | Bacteria | 7311 |
| 1059 | Ga0501070_0016439 | 3300049586 | Bacteria | 6217 |
| 1060 | Ga0501070_0016597 | 3300049586 | Bacteria | 6185 |
| 1061 | Ga0501070_0045944 | 3300049586 | Bacteria | 3631 |
| 1062 | Ga0501070_0057750 | 3300049586 | Bacteria | 3217 |
| 1063 | Ga0501070_0061415 | 3300049586 | Bacteria | 3113 |
| 1064 | Ga0501070_0075785 | 3300049586 | Bacteria | 2785 |
| 1065 | Ga0501070_0207323 | 3300049586 | Bacteria | 1609 |
| 1066 | Ga0501070_0604916 | 3300049586 | Bacteria | 873 |
| 1067 | Ga0501071_0020855 | 3300049587 | Bacteria | 4559 |
| 1068 | Ga0501071_0116255 | 3300049587 | Bacteria | 1980 |
| 1069 | Ga0501071_0280001 | 3300049587 | Bacteria | 1262 |
| 1070 | Ga0501072_0051958 | 3300049588 | Bacteria | 3227 |
| 1071 | Ga0501072_0169336 | 3300049588 | Bacteria | 1743 |
| 1072 | Ga0501073_0005996 | 3300049589 | Bacteria | 9068 |
| 1073 | Ga0501073_0021522 | 3300049589 | Bacteria | 4649 |
| 1074 | Ga0501073_0064834 | 3300049589 | Bacteria | 2547 |
| 1075 | Ga0501073_0397268 | 3300049589 | Bacteria | 952 |
| 1076 | Ga0501074_0019707 | 3300049590 | Bacteria | 4897 |
| 1077 | Ga0501074_0023154 | 3300049590 | Bacteria | 4516 |
| 1078 | Ga0501074_0083323 | 3300049590 | Bacteria | 2292 |
| 1079 | Ga0501074_0183906 | 3300049590 | Bacteria | 1490 |
| 1080 | Ga0501074_0355580 | 3300049590 | Bacteria | 1039 |
| 1081 | Ga0501075_0637749 | 3300049591 | Bacteria | 812 |
| 1082 | Ga0501076_0020689 | 3300049592 | Bacteria | 5039 |
| 1083 | Ga0501076_0106186 | 3300049592 | Bacteria | 2266 |
| 1084 | Ga0501076_0133297 | 3300049592 | Bacteria | 2016 |
| 1085 | Ga0501077_0260823 | 3300049593 | Bacteria | 1102 |
| 1086 | Ga0501077_0831454 | 3300049593 | Bacteria | 594 |
| 1087 | Ga0501079_0037272 | 3300049741 | Bacteria | 3747 |
| 1088 | Ga0501079_0098737 | 3300049741 | Bacteria | 2263 |
| 1089 | Ga0501079_0290426 | 3300049741 | Bacteria | 1279 |
| 1090 | Ga0501079_1321314 | 3300049741 | Bacteria | 568 |
| 1091 | Ga0501080_0001467 | 3300049742 | Bacteria | 19851 |
| 1092 | Ga0501080_0066497 | 3300049742 | Bacteria | 3352 |
| 1093 | Ga0501080_0078531 | 3300049742 | Bacteria | 3069 |
| 1094 | Ga0501080_0090333 | 3300049742 | Bacteria | 2845 |
| 1095 | Ga0501080_0100594 | 3300049742 | Bacteria | 2682 |
| 1096 | Ga0501080_0137157 | 3300049742 | Bacteria | 2263 |
| 1097 | Ga0501081_0576892 | 3300049743 | Bacteria | 841 |
| 1098 | Ga0501083_0001750 | 3300049744 | Bacteria | 14813 |
| 1099 | Ga0501083_0009826 | 3300049744 | Bacteria | 6754 |
| 1100 | Ga0501083_0028469 | 3300049744 | Bacteria | 3849 |
| 1101 | Ga0501083_0066516 | 3300049744 | Bacteria | 2399 |
| 1102 | Ga0501083_0146385 | 3300049744 | Bacteria | 1547 |
| 1103 | Ga0501083_0388204 | 3300049744 | Bacteria | 908 |
| 1104 | Ga0501083_0423787 | 3300049744 | Bacteria | 866 |
| 1105 | Ga0501083_0611721 | 3300049744 | Unclassified | 709 |
| 1106 | Ga0501035_0046577 | 3300049822 | Bacteria | 3900 |
| 1107 | Ga0501035_0052529 | 3300049822 | Bacteria | 3646 |
| 1108 | Ga0501035_0074968 | 3300049822 | Bacteria | 2992 |
| 1109 | Ga0501035_0128726 | 3300049822 | Bacteria | 2208 |
| 1110 | Ga0501035_0177424 | 3300049822 | Bacteria | 1837 |
| 1111 | Ga0501035_0398300 | 3300049822 | Bacteria | 1146 |
| 1112 | Ga0501035_0405438 | 3300049822 | Bacteria | 1134 |
| 1113 | Ga0501035_0526792 | 3300049822 | Bacteria | 970 |
| 1114 | Ga0501035_1263840 | 3300049822 | Bacteria | 570 |
| 1115 | Ga0501044_0000822 | 3300049823 | Bacteria | 37410 |
| 1116 | Ga0501044_0002823 | 3300049823 | Bacteria | 19779 |
| 1117 | Ga0501044_0038058 | 3300049823 | Bacteria | 5023 |
| 1118 | Ga0501044_0106489 | 3300049823 | Bacteria | 2816 |
| 1119 | Ga0501044_0173293 | 3300049823 | Bacteria | 2127 |
| 1120 | Ga0501044_0190872 | 3300049823 | Bacteria | 2011 |
| 1121 | Ga0501044_0197490 | 3300049823 | Bacteria | 1971 |
| 1122 | Ga0501044_0243942 | 3300049823 | Bacteria | 1739 |
| 1123 | Ga0501044_0625621 | 3300049823 | Bacteria | 967 |
| 1124 | Ga0501044_0873711 | 3300049823 | Bacteria | 775 |
| 1125 | Ga0501044_0928257 | 3300049823 | Bacteria | 744 |
| 1126 | Ga0501044_1188973 | 3300049823 | Bacteria | 630 |
| 1127 | Ga0501045_0466841 | 3300049824 | Bacteria | 938 |
| 1128 | nmdc:mga03n38_493697_c1 | 3300050490 | Unclassified | 686 |
| 1129 | nmdc:mga06z11_20872_c1 | 3300050494 | Bacteria | 3034 |
| 1130 | nmdc:mga06z11_832525_c1 | 3300050494 | Unclassified | 562 |
| 1131 | nmdc:mga05p37_6013_c1 | 3300050507 | Bacteria | 14287 |
| 1132 | nmdc:mga05p37_87679_c1 | 3300050507 | Bacteria | 3836 |
| 1133 | nmdc:mga09592_2783_c1 | 3300050508 | Bacteria | 14165 |
| 1134 | nmdc:mga0qj67_1876_c1 | 3300050509 | Bacteria | 14908 |
| 1135 | nmdc:mga06r32_22491_c1 | 3300050510 | Bacteria | 5829 |
| 1136 | nmdc:mga08y16_1034470_c1 | 3300050511 | Unclassified | 800 |
| 1137 | nmdc:mga08y16_12040_c1 | 3300050511 | Bacteria | 9088 |
| 1138 | nmdc:mga08y16_2031_c1 | 3300050511 | Bacteria | 20733 |
| 1139 | nmdc:mga0n895_1539_c1 | 3300050512 | Bacteria | 17321 |
| 1140 | nmdc:mga0n895_436410_c1 | 3300050512 | Bacteria | 1323 |
| 1141 | nmdc:mga0n895_51388_c1 | 3300050512 | Bacteria | 4044 |
| 1142 | nmdc:mga0n895_5922_c1 | 3300050512 | Bacteria | 10279 |
| 1143 | nmdc:mga0n895_97038_c1 | 3300050512 | Bacteria | 2953 |
| 1144 | nmdc:mga0rr50_164488_c1 | 3300050513 | Bacteria | 1803 |
| 1145 | nmdc:mga0rr50_321712_c1 | 3300050513 | Unclassified | 1297 |
| 1146 | nmdc:mga0rr50_383255_c1 | 3300050513 | Bacteria | 1186 |
| 1147 | nmdc:mga0rr50_505582_c1 | 3300050513 | Bacteria | 1028 |
| 1148 | nmdc:mga0rr50_72220_c1 | 3300050513 | Bacteria | 2635 |
| 1149 | nmdc:mga08x19_915456_c1 | 3300050514 | Unclassified | 623 |
| 1150 | nmdc:mga0a205_1056427_c1 | 3300050515 | Bacteria | 659 |
| 1151 | nmdc:mga0a205_185748_c1 | 3300050515 | Bacteria | 1972 |
| 1152 | nmdc:mga0a205_232147_c1 | 3300050515 | Bacteria | 1728 |
| 1153 | nmdc:mga0a205_34744_c1 | 3300050515 | Bacteria | 4838 |
| 1154 | nmdc:mga0a205_46035_c1 | 3300050515 | Bacteria | 4207 |
| 1155 | Ga0495601_0000456 | 3300053077 | Bacteria | 21456 |
| 1156 | Ga0495601_0000507 | 3300053077 | Bacteria | 20511 |
| 1157 | Ga0495601_0009329 | 3300053077 | Bacteria | 5801 |
| 1158 | Ga0495601_0012444 | 3300053077 | Bacteria | 5104 |
| 1159 | Ga0495601_0101803 | 3300053077 | Bacteria | 1855 |
| 1160 | Ga0495612_0005524 | 3300053078 | Bacteria | 5226 |
| 1161 | Ga0495612_0007164 | 3300053078 | Bacteria | 4564 |
| 1162 | Ga0495612_0107037 | 3300053078 | Bacteria | 1194 |
| 1163 | Ga0495595_0000513 | 3300053084 | Bacteria | 14746 |
| 1164 | Ga0495595_0001524 | 3300053084 | Bacteria | 9029 |
| 1165 | Ga0495619_0000043 | 3300053085 | Bacteria | 109865 |
| 1166 | Ga0495619_0000551 | 3300053085 | Bacteria | 24828 |
| 1167 | Ga0495619_0002087 | 3300053085 | Bacteria | 13282 |
| 1168 | Ga0495619_0025754 | 3300053085 | Bacteria | 3780 |
| 1169 | Ga0495619_0032006 | 3300053085 | Bacteria | 3410 |
| 1170 | Ga0495619_0109308 | 3300053085 | Bacteria | 1888 |
| 1171 | Ga0495619_0241111 | 3300053085 | Bacteria | 1253 |
| 1172 | Ga0500643_002121 | 3300053087 | Bacteria | 10523 |
| 1173 | Ga0500651_0041727 | 3300053093 | Bacteria | 2892 |
| 1174 | Ga0500651_0113892 | 3300053093 | Bacteria | 1648 |
| 1175 | Ga0500651_0667351 | 3300053093 | Bacteria | 558 |
| 1176 | Ga0500566_0086671 | 3300053094 | Bacteria | 1735 |
| 1177 | Ga0500650_0140675 | 3300053098 | Bacteria | 1119 |
| 1178 | Ga0500594_0062053 | 3300053118 | Bacteria | 1080 |
| 1179 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1180 | Ga0500621_211535 | 3300053126 | Bacteria | 679 |
| 1181 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1182 | Ga0500616_0117024 | 3300053153 | Bacteria | 1278 |
| 1183 | Ga0500645_000568 | 3300053730 | Bacteria | 24115 |
| 1184 | Ga0500645_017683 | 3300053730 | Bacteria | 2232 |
| 1185 | Ga0501084_0098435 | 3300054114 | Bacteria | 2456 |
| 1186 | Ga0501084_0422737 | 3300054114 | Bacteria | 1126 |
| 1187 | Ga0501084_0486821 | 3300054114 | Bacteria | 1043 |
| 1188 | Ga0501084_0667190 | 3300054114 | Bacteria | 877 |
| 1189 | Ga0501082_0019802 | 3300060353 | Bacteria | 5803 |
| 1190 | Ga0501082_0052191 | 3300060353 | Bacteria | 3525 |
| 1191 | Ga0501082_0064261 | 3300060353 | Bacteria | 3161 |
| 1192 | Ga0501082_0626427 | 3300060353 | Bacteria | 941 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1003693 | Ga0265337_10036933 | 97 |
| 2 | 3300046491 | Ga0495584_0178697 | Ga0495584_0178697_38_346 | 102 |
| 3 | 3300048906 | Ga0496103_0348092 | Ga0496103_0348092_29_337 | 102 |
| 4 | 3300048915 | Ga0496112_0978126 | Ga0496112_0978126_15_326 | 103 |
| 5 | 3300048915 | Ga0496112_1552547 | Ga0496112_1552547_15_326 | 103 |
| 6 | 3300049823 | Ga0501044_0106489 | Ga0501044_0106489_1600_1911 | 103 |
| 7 | 3300046533 | Ga0495640_0709575 | Ga0495640_0709575_34_348 | 104 |
| 8 | 3300025942 | Ga0207689_10722718 | Ga0207689_107227182 | 108 |
| 9 | 3300035114 | Ga0373939_0002892 | Ga0373939_0002892_506_832 | 108 |
| 10 | 3300005434 | Ga0070709_10435526 | Ga0070709_104355262 | 111 |
| 11 | 3300005616 | Ga0068852_102443610 | Ga0068852_1024436102 | 111 |
| 12 | 3300025921 | Ga0207652_10191472 | Ga0207652_101914723 | 111 |
| 13 | 3300026142 | Ga0207698_11224391 | Ga0207698_112243912 | 111 |
| 14 | 3300037312 | Ga0395899_0009657 | Ga0395899_0009657_1091_1426 | 111 |
| 15 | 3300037418 | Ga0395900_0003135 | Ga0395900_0003135_13418_13753 | 111 |
| 16 | 3300037466 | Ga0395898_0051585 | Ga0395898_0051585_2313_2648 | 111 |
| 17 | 3300038443 | Ga0395901_0020098 | Ga0395901_0020098_531_866 | 111 |
| 18 | 3300038443 | Ga0395901_0268724 | Ga0395901_0268724_1398_1733 | 111 |
| 19 | 3300044694 | Ga0466963_0024510 | Ga0466963_0024510_2570_2905 | 111 |
| 20 | 3300044706 | Ga0466964_0171183 | Ga0466964_0171183_166_501 | 111 |
| 21 | 3300044842 | Ga0466957_0131988 | Ga0466957_0131988_885_1220 | 111 |
| 22 | 3300045836 | Ga0466958_0027374 | Ga0466958_0027374_1960_2295 | 111 |
| 23 | 3300045976 | Ga0466967_0016669 | Ga0466967_0016669_4503_4838 | 111 |
| 24 | iso_pu_bacteria | 2643221547 | 2643755923 | 111 |
| 25 | 3300005981 | Ga0081538_10041429 | Ga0081538_100414292 | 112 |
| 26 | 3300006173 | Ga0070716_100373485 | Ga0070716_1003734852 | 112 |
| 27 | 3300028577 | Ga0265318_10273465 | Ga0265318_102734652 | 112 |
| 28 | 3300031247 | Ga0265340_10020827 | Ga0265340_100208272 | 112 |
| 29 | 3300049575 | Ga0501039_1182773 | Ga0501039_1182773_65_403 | 112 |
| 30 | 3300003911 | JGI25405J52794_10012841 | JGI25405J52794_100128413 | 113 |
| 31 | 3300005295 | Ga0065707_10632563 | Ga0065707_106325631 | 113 |
| 32 | 3300005328 | Ga0070676_10207069 | Ga0070676_102070691 | 113 |
| 33 | 3300005329 | Ga0070683_100079030 | Ga0070683_1000790303 | 113 |
| 34 | 3300005335 | Ga0070666_10291177 | Ga0070666_102911772 | 113 |
| 35 | 3300005337 | Ga0070682_100023896 | Ga0070682_1000238963 | 113 |
| 36 | 3300005344 | Ga0070661_101815228 | Ga0070661_1018152282 | 113 |
| 37 | 3300005355 | Ga0070671_100157443 | Ga0070671_1001574432 | 113 |
| 38 | 3300005355 | Ga0070671_101045041 | Ga0070671_1010450412 | 113 |
| 39 | 3300005365 | Ga0070688_100351961 | Ga0070688_1003519613 | 113 |
| 40 | 3300005366 | Ga0070659_101805771 | Ga0070659_1018057712 | 113 |
| 41 | 3300005367 | Ga0070667_100527864 | Ga0070667_1005278642 | 113 |
| 42 | 3300005434 | Ga0070709_10195406 | Ga0070709_101954062 | 113 |
| 43 | 3300005434 | Ga0070709_10235293 | Ga0070709_102352931 | 113 |
| 44 | 3300005435 | Ga0070714_100619081 | Ga0070714_1006190812 | 113 |
| 45 | 3300005436 | Ga0070713_100039180 | Ga0070713_1000391803 | 113 |
| 46 | 3300005436 | Ga0070713_101539077 | Ga0070713_1015390772 | 113 |
| 47 | 3300005437 | Ga0070710_10056697 | Ga0070710_100566973 | 113 |
| 48 | 3300005437 | Ga0070710_10285132 | Ga0070710_102851322 | 113 |
| 49 | 3300005439 | Ga0070711_100674457 | Ga0070711_1006744572 | 113 |
| 50 | 3300005440 | Ga0070705_100033813 | Ga0070705_1000338135 | 113 |
| 51 | 3300005455 | Ga0070663_100088886 | Ga0070663_1000888863 | 113 |
| 52 | 3300005456 | Ga0070678_100005474 | Ga0070678_1000054744 | 113 |
| 53 | 3300005466 | Ga0070685_10147789 | Ga0070685_101477891 | 113 |
| 54 | 3300005543 | Ga0070672_100920927 | Ga0070672_1009209272 | 113 |
| 55 | 3300005547 | Ga0070693_100688940 | Ga0070693_1006889402 | 113 |
| 56 | 3300005548 | Ga0070665_100353780 | Ga0070665_1003537802 | 113 |
| 57 | 3300005564 | Ga0070664_100191277 | Ga0070664_1001912773 | 113 |
| 58 | 3300005615 | Ga0070702_100099648 | Ga0070702_1000996482 | 113 |
| 59 | 3300005618 | Ga0068864_101241574 | Ga0068864_1012415742 | 113 |
| 60 | 3300005841 | Ga0068863_100352022 | Ga0068863_1003520222 | 113 |
| 61 | 3300005842 | Ga0068858_100276517 | Ga0068858_1002765173 | 113 |
| 62 | 3300005842 | Ga0068858_101550702 | Ga0068858_1015507022 | 113 |
| 63 | 3300005843 | Ga0068860_100451261 | Ga0068860_1004512612 | 113 |
| 64 | 3300005843 | Ga0068860_101232334 | Ga0068860_1012323341 | 113 |
| 65 | 3300005844 | Ga0068862_100275368 | Ga0068862_1002753682 | 113 |
| 66 | 3300005937 | Ga0081455_10006976 | Ga0081455_100069768 | 113 |
| 67 | 3300005937 | Ga0081455_10123738 | Ga0081455_101237383 | 113 |
| 68 | 3300006163 | Ga0070715_10014758 | Ga0070715_100147584 | 113 |
| 69 | 3300006173 | Ga0070716_100009019 | Ga0070716_1000090193 | 113 |
| 70 | 3300006175 | Ga0070712_100183986 | Ga0070712_1001839863 | 113 |
| 71 | 3300006194 | Ga0075427_10003835 | Ga0075427_100038352 | 113 |
| 72 | 3300006237 | Ga0097621_100030924 | Ga0097621_1000309244 | 113 |
| 73 | 3300006237 | Ga0097621_100180771 | Ga0097621_1001807712 | 113 |
| 74 | 3300006844 | Ga0075428_100017044 | Ga0075428_1000170442 | 113 |
| 75 | 3300006846 | Ga0075430_100004240 | Ga0075430_10000424010 | 113 |
| 76 | 3300006847 | Ga0075431_100237644 | Ga0075431_1002376442 | 113 |
| 77 | 3300006852 | Ga0075433_10003318 | Ga0075433_1000331810 | 113 |
| 78 | 3300006852 | Ga0075433_10194998 | Ga0075433_101949983 | 113 |
| 79 | 3300006871 | Ga0075434_100003881 | Ga0075434_10000388110 | 113 |
| 80 | 3300006871 | Ga0075434_100049800 | Ga0075434_1000498003 | 113 |
| 81 | 3300006871 | Ga0075434_100286306 | Ga0075434_1002863063 | 113 |
| 82 | 3300006880 | Ga0075429_100008546 | Ga0075429_10000854610 | 113 |
| 83 | 3300006881 | Ga0068865_100020346 | Ga0068865_1000203463 | 113 |
| 84 | 3300007076 | Ga0075435_100090670 | Ga0075435_1000906702 | 113 |
| 85 | 3300009011 | Ga0105251_10022056 | Ga0105251_100220563 | 113 |
| 86 | 3300009011 | Ga0105251_10332240 | Ga0105251_103322402 | 113 |
| 87 | 3300009092 | Ga0105250_10075208 | Ga0105250_100752082 | 113 |
| 88 | 3300009094 | Ga0111539_10002796 | Ga0111539_100027963 | 113 |
| 89 | 3300009094 | Ga0111539_12207483 | Ga0111539_122074831 | 113 |
| 90 | 3300009098 | Ga0105245_10068509 | Ga0105245_100685093 | 113 |
| 91 | 3300009101 | Ga0105247_10042814 | Ga0105247_100428143 | 113 |
| 92 | 3300009147 | Ga0114129_10029650 | Ga0114129_1002965010 | 113 |
| 93 | 3300009147 | Ga0114129_10198080 | Ga0114129_101980803 | 113 |
| 94 | 3300009148 | Ga0105243_10016347 | Ga0105243_100163475 | 113 |
| 95 | 3300009174 | Ga0105241_10048036 | Ga0105241_100480363 | 113 |
| 96 | 3300009176 | Ga0105242_10532664 | Ga0105242_105326643 | 113 |
| 97 | 3300009177 | Ga0105248_10323791 | Ga0105248_103237913 | 113 |
| 98 | 3300009177 | Ga0105248_11449977 | Ga0105248_114499772 | 113 |
| 99 | 3300009545 | Ga0105237_10596307 | Ga0105237_105963072 | 113 |
| 100 | 3300009551 | Ga0105238_10058732 | Ga0105238_100587323 | 113 |
| 101 | 3300009553 | Ga0105249_10152330 | Ga0105249_101523303 | 113 |
| 102 | 3300010375 | Ga0105239_11012542 | Ga0105239_110125422 | 113 |
| 103 | 3300011119 | Ga0105246_11068061 | Ga0105246_110680612 | 113 |
| 104 | 3300012494 | Ga0157341_1026473 | Ga0157341_10264732 | 113 |
| 105 | 3300012510 | Ga0157316_1052765 | Ga0157316_10527652 | 113 |
| 106 | 3300013100 | Ga0157373_10497015 | Ga0157373_104970152 | 113 |
| 107 | 3300013296 | Ga0157374_10538424 | Ga0157374_105384242 | 113 |
| 108 | 3300013296 | Ga0157374_10653901 | Ga0157374_106539012 | 113 |
| 109 | 3300013296 | Ga0157374_10749949 | Ga0157374_107499492 | 113 |
| 110 | 3300013297 | Ga0157378_10032054 | Ga0157378_100320546 | 113 |
| 111 | 3300013306 | Ga0163162_12960581 | Ga0163162_129605811 | 113 |
| 112 | 3300013308 | Ga0157375_10397256 | Ga0157375_103972563 | 113 |
| 113 | 3300014325 | Ga0163163_10369436 | Ga0163163_103694362 | 113 |
| 114 | 3300014326 | Ga0157380_10136692 | Ga0157380_101366922 | 113 |
| 115 | 3300014968 | Ga0157379_10386195 | Ga0157379_103861952 | 113 |
| 116 | 3300014968 | Ga0157379_10902131 | Ga0157379_109021312 | 113 |
| 117 | 3300014969 | Ga0157376_10195812 | Ga0157376_101958123 | 113 |
| 118 | 3300025898 | Ga0207692_10258580 | Ga0207692_102585803 | 113 |
| 119 | 3300025901 | Ga0207688_10171790 | Ga0207688_101717902 | 113 |
| 120 | 3300025903 | Ga0207680_10131226 | Ga0207680_101312262 | 113 |
| 121 | 3300025905 | Ga0207685_10021908 | Ga0207685_100219082 | 113 |
| 122 | 3300025907 | Ga0207645_10058013 | Ga0207645_100580133 | 113 |
| 123 | 3300025911 | Ga0207654_10069882 | Ga0207654_100698822 | 113 |
| 124 | 3300025914 | Ga0207671_10113380 | Ga0207671_101133803 | 113 |
| 125 | 3300025915 | Ga0207693_10008072 | Ga0207693_100080724 | 113 |
| 126 | 3300025916 | Ga0207663_10584502 | Ga0207663_105845022 | 113 |
| 127 | 3300025928 | Ga0207700_10394305 | Ga0207700_103943052 | 113 |
| 128 | 3300025928 | Ga0207700_11221199 | Ga0207700_112211992 | 113 |
| 129 | 3300025929 | Ga0207664_10256980 | Ga0207664_102569802 | 113 |
| 130 | 3300025931 | Ga0207644_10046794 | Ga0207644_100467943 | 113 |
| 131 | 3300025932 | Ga0207690_10262440 | Ga0207690_102624402 | 113 |
| 132 | 3300025934 | Ga0207686_10084799 | Ga0207686_100847993 | 113 |
| 133 | 3300025935 | Ga0207709_10906584 | Ga0207709_109065842 | 113 |
| 134 | 3300025936 | Ga0207670_10217665 | Ga0207670_102176652 | 113 |
| 135 | 3300025937 | Ga0207669_10603744 | Ga0207669_106037442 | 113 |
| 136 | 3300025938 | Ga0207704_10265516 | Ga0207704_102655162 | 113 |
| 137 | 3300025939 | Ga0207665_10005721 | Ga0207665_100057214 | 113 |
| 138 | 3300025940 | Ga0207691_10486974 | Ga0207691_104869742 | 113 |
| 139 | 3300025941 | Ga0207711_10009494 | Ga0207711_100094946 | 113 |
| 140 | 3300025942 | Ga0207689_10823707 | Ga0207689_108237071 | 113 |
| 141 | 3300025944 | Ga0207661_10020336 | Ga0207661_100203362 | 113 |
| 142 | 3300025945 | Ga0207679_10753055 | Ga0207679_107530552 | 113 |
| 143 | 3300025972 | Ga0207668_10265978 | Ga0207668_102659782 | 113 |
| 144 | 3300025986 | Ga0207658_10052210 | Ga0207658_100522102 | 113 |
| 145 | 3300026035 | Ga0207703_11103410 | Ga0207703_111034102 | 113 |
| 146 | 3300026067 | Ga0207678_10012983 | Ga0207678_1001298310 | 113 |
| 147 | 3300026095 | Ga0207676_10118340 | Ga0207676_101183403 | 113 |
| 148 | 3300026116 | Ga0207674_10881694 | Ga0207674_108816941 | 113 |
| 149 | 3300026118 | Ga0207675_100612320 | Ga0207675_1006123202 | 113 |
| 150 | 3300026121 | Ga0207683_10028744 | Ga0207683_100287443 | 113 |
| 151 | 3300026142 | Ga0207698_10370313 | Ga0207698_103703132 | 113 |
| 152 | 3300027907 | Ga0207428_10000216 | Ga0207428_1000021636 | 113 |
| 153 | 3300028379 | Ga0268266_10089573 | Ga0268266_100895733 | 113 |
| 154 | 3300028381 | Ga0268264_10551602 | Ga0268264_105516022 | 113 |
| 155 | 3300034816 | Ga0373930_0032077 | Ga0373930_0032077_112_453 | 113 |
| 156 | 3300034818 | Ga0373950_0036772 | Ga0373950_0036772_443_784 | 113 |
| 157 | 3300034819 | Ga0373958_0068004 | Ga0373958_0068004_357_698 | 113 |
| 158 | 3300034820 | Ga0373959_0070654 | Ga0373959_0070654_344_685 | 113 |
| 159 | 3300035083 | Ga0373926_0021412 | Ga0373926_0021412_40_381 | 113 |
| 160 | 3300035084 | Ga0373928_0157390 | Ga0373928_0157390_82_423 | 113 |
| 161 | 3300035088 | Ga0373940_0157104 | Ga0373940_0157104_279_620 | 113 |
| 162 | 3300035090 | Ga0373949_0297125 | Ga0373949_0297125_91_432 | 113 |
| 163 | 3300035091 | Ga0373951_0006292 | Ga0373951_0006292_389_730 | 113 |
| 164 | 3300035092 | Ga0373952_0031323 | Ga0373952_0031323_505_846 | 113 |
| 165 | 3300035114 | Ga0373939_0058772 | Ga0373939_0058772_423_764 | 113 |
| 166 | 3300035115 | Ga0373941_0004347 | Ga0373941_0004347_2075_2416 | 113 |
| 167 | 3300035115 | Ga0373941_0180985 | Ga0373941_0180985_164_505 | 113 |
| 168 | 3300035116 | Ga0373945_0049929 | Ga0373945_0049929_935_1276 | 113 |
| 169 | 3300035121 | Ga0373960_0250675 | Ga0373960_0250675_229_570 | 113 |
| 170 | 3300035170 | Ga0373943_0005045 | Ga0373943_0005045_3883_4224 | 113 |
| 171 | 3300035171 | Ga0373946_0197285 | Ga0373946_0197285_336_677 | 113 |
| 172 | 3300035207 | Ga0373942_0026694 | Ga0373942_0026694_540_881 | 113 |
| 173 | 3300035241 | Ga0373961_0092053 | Ga0373961_0092053_277_618 | 113 |
| 174 | 3300035242 | Ga0373962_0033329 | Ga0373962_0033329_42_383 | 113 |
| 175 | 3300035692 | Ga0373935_0041202 | Ga0373935_0041202_569_910 | 113 |
| 176 | 3300035725 | Ga0373947_0011056 | Ga0373947_0011056_2374_2715 | 113 |
| 177 | 3300037068 | Ga0373925_0095869 | Ga0373925_0095869_610_951 | 113 |
| 178 | 3300037068 | Ga0373925_1052653 | Ga0373925_1052653_11_352 | 113 |
| 179 | 3300042876 | Ga0451577_0682662 | Ga0451577_0682662_421_762 | 113 |
| 180 | 3300046455 | Ga0495603_0381374 | Ga0495603_0381374_224_565 | 113 |
| 181 | 3300046459 | Ga0495629_0002326 | Ga0495629_0002326_9237_9578 | 113 |
| 182 | 3300046461 | Ga0495641_0409428 | Ga0495641_0409428_142_483 | 113 |
| 183 | 3300046462 | Ga0495651_0174784 | Ga0495651_0174784_1113_1454 | 113 |
| 184 | 3300046473 | Ga0495582_0012004 | Ga0495582_0012004_1986_2327 | 113 |
| 185 | 3300046475 | Ga0495639_0197163 | Ga0495639_0197163_547_888 | 113 |
| 186 | 3300046499 | Ga0495594_0031273 | Ga0495594_0031273_939_1280 | 113 |
| 187 | 3300046681 | Ga0495647_0164650 | Ga0495647_0164650_257_598 | 113 |
| 188 | 3300046683 | Ga0495658_0008925 | Ga0495658_0008925_4372_4713 | 113 |
| 189 | 3300046689 | Ga0495613_0093005 | Ga0495613_0093005_1322_1663 | 113 |
| 190 | 3300046809 | Ga0495600_0118383 | Ga0495600_0118383_423_764 | 113 |
| 191 | 3300047315 | Ga0495581_0888800 | Ga0495581_0888800_105_446 | 113 |
| 192 | 3300047319 | Ga0495674_0724492 | Ga0495674_0724492_248_589 | 113 |
| 193 | 3300047322 | Ga0495680_0026104 | Ga0495680_0026104_3916_4257 | 113 |
| 194 | 3300047673 | Ga0495593_0014850 | Ga0495593_0014850_3297_3638 | 113 |
| 195 | 3300048089 | Ga0495614_0105045 | Ga0495614_0105045_184_525 | 113 |
| 196 | 3300048903 | Ga0496100_0636214 | Ga0496100_0636214_64_405 | 113 |
| 197 | 3300048905 | Ga0496102_0032780 | Ga0496102_0032780_2547_2888 | 113 |
| 198 | 3300048905 | Ga0496102_0776715 | Ga0496102_0776715_205_546 | 113 |
| 199 | 3300048906 | Ga0496103_0003651 | Ga0496103_0003651_4379_4720 | 113 |
| 200 | 3300048907 | Ga0496104_0345947 | Ga0496104_0345947_448_789 | 113 |
| 201 | 3300048908 | Ga0496105_0091794 | Ga0496105_0091794_564_905 | 113 |
| 202 | 3300048908 | Ga0496105_0273851 | Ga0496105_0273851_730_1071 | 113 |
| 203 | 3300048908 | Ga0496105_0540633 | Ga0496105_0540633_179_520 | 113 |
| 204 | 3300048910 | Ga0496107_0031992 | Ga0496107_0031992_2809_3150 | 113 |
| 205 | 3300048911 | Ga0496108_0154898 | Ga0496108_0154898_975_1316 | 113 |
| 206 | 3300048911 | Ga0496108_0335043 | Ga0496108_0335043_326_667 | 113 |
| 207 | 3300048912 | Ga0496109_0112776 | Ga0496109_0112776_1603_1944 | 113 |
| 208 | 3300048912 | Ga0496109_0118317 | Ga0496109_0118317_508_849 | 113 |
| 209 | 3300048912 | Ga0496109_0331643 | Ga0496109_0331643_873_1214 | 113 |
| 210 | 3300048913 | Ga0496110_0019989 | Ga0496110_0019989_2202_2543 | 113 |
| 211 | 3300048914 | Ga0496111_0254702 | Ga0496111_0254702_505_846 | 113 |
| 212 | 3300048915 | Ga0496112_0128268 | Ga0496112_0128268_1897_2238 | 113 |
| 213 | 3300048915 | Ga0496112_0274241 | Ga0496112_0274241_515_856 | 113 |
| 214 | 3300048916 | Ga0496113_0345871 | Ga0496113_0345871_48_389 | 113 |
| 215 | 3300048916 | Ga0496113_0508090 | Ga0496113_0508090_13_354 | 113 |
| 216 | 3300048917 | Ga0496114_0091782 | Ga0496114_0091782_1632_1973 | 113 |
| 217 | 3300048918 | Ga0496115_1126288 | Ga0496115_1126288_200_541 | 113 |
| 218 | 3300048918 | Ga0496115_1215716 | Ga0496115_1215716_41_382 | 113 |
| 219 | 3300049569 | Ga0501032_0024985 | Ga0501032_0024985_343_684 | 113 |
| 220 | 3300049569 | Ga0501032_0086656 | Ga0501032_0086656_94_435 | 113 |
| 221 | 3300049569 | Ga0501032_0322061 | Ga0501032_0322061_37_378 | 113 |
| 222 | 3300049569 | Ga0501032_0447545 | Ga0501032_0447545_180_521 | 113 |
| 223 | 3300049570 | Ga0501033_0006958 | Ga0501033_0006958_6125_6466 | 113 |
| 224 | 3300049570 | Ga0501033_0165755 | Ga0501033_0165755_686_1027 | 113 |
| 225 | 3300049570 | Ga0501033_0262685 | Ga0501033_0262685_180_521 | 113 |
| 226 | 3300049571 | Ga0501034_0001401 | Ga0501034_0001401_17600_17941 | 113 |
| 227 | 3300049571 | Ga0501034_0001763 | Ga0501034_0001763_2220_2561 | 113 |
| 228 | 3300049571 | Ga0501034_0038051 | Ga0501034_0038051_1523_1864 | 113 |
| 229 | 3300049571 | Ga0501034_0089853 | Ga0501034_0089853_2143_2484 | 113 |
| 230 | 3300049571 | Ga0501034_0190194 | Ga0501034_0190194_473_814 | 113 |
| 231 | 3300049571 | Ga0501034_0286102 | Ga0501034_0286102_432_773 | 113 |
| 232 | 3300049572 | Ga0501036_0000164 | Ga0501036_0000164_26541_26882 | 113 |
| 233 | 3300049572 | Ga0501036_0006271 | Ga0501036_0006271_2234_2575 | 113 |
| 234 | 3300049572 | Ga0501036_0018152 | Ga0501036_0018152_695_1036 | 113 |
| 235 | 3300049572 | Ga0501036_0062034 | Ga0501036_0062034_2211_2552 | 113 |
| 236 | 3300049572 | Ga0501036_0668165 | Ga0501036_0668165_338_679 | 113 |
| 237 | 3300049572 | Ga0501036_1154165 | Ga0501036_1154165_116_457 | 113 |
| 238 | 3300049573 | Ga0501037_0007497 | Ga0501037_0007497_1190_1531 | 113 |
| 239 | 3300049573 | Ga0501037_0010040 | Ga0501037_0010040_4144_4485 | 113 |
| 240 | 3300049573 | Ga0501037_0047340 | Ga0501037_0047340_2466_2807 | 113 |
| 241 | 3300049573 | Ga0501037_0047911 | Ga0501037_0047911_18_359 | 113 |
| 242 | 3300049574 | Ga0501038_0003058 | Ga0501038_0003058_14239_14580 | 113 |
| 243 | 3300049574 | Ga0501038_0007470 | Ga0501038_0007470_1816_2157 | 113 |
| 244 | 3300049574 | Ga0501038_0269031 | Ga0501038_0269031_451_792 | 113 |
| 245 | 3300049575 | Ga0501039_0041250 | Ga0501039_0041250_2341_2682 | 113 |
| 246 | 3300049575 | Ga0501039_0113164 | Ga0501039_0113164_1317_1658 | 113 |
| 247 | 3300049575 | Ga0501039_0188753 | Ga0501039_0188753_63_404 | 113 |
| 248 | 3300049576 | Ga0501040_0132124 | Ga0501040_0132124_592_933 | 113 |
| 249 | 3300049576 | Ga0501040_0414509 | Ga0501040_0414509_327_668 | 113 |
| 250 | 3300049578 | Ga0501042_0456764 | Ga0501042_0456764_229_570 | 113 |
| 251 | 3300049579 | Ga0501043_0001255 | Ga0501043_0001255_5014_5355 | 113 |
| 252 | 3300049579 | Ga0501043_0040784 | Ga0501043_0040784_1522_1863 | 113 |
| 253 | 3300049579 | Ga0501043_0050128 | Ga0501043_0050128_1463_1804 | 113 |
| 254 | 3300049579 | Ga0501043_0086876 | Ga0501043_0086876_395_736 | 113 |
| 255 | 3300049579 | Ga0501043_0157721 | Ga0501043_0157721_661_1002 | 113 |
| 256 | 3300049579 | Ga0501043_0413677 | Ga0501043_0413677_11_352 | 113 |
| 257 | 3300049579 | Ga0501043_1290321 | Ga0501043_1290321_82_423 | 113 |
| 258 | 3300049580 | Ga0501046_0033837 | Ga0501046_0033837_3399_3740 | 113 |
| 259 | 3300049580 | Ga0501046_0044911 | Ga0501046_0044911_815_1156 | 113 |
| 260 | 3300049581 | Ga0501047_0003578 | Ga0501047_0003578_2433_2774 | 113 |
| 261 | 3300049581 | Ga0501047_0062444 | Ga0501047_0062444_2275_2616 | 113 |
| 262 | 3300049581 | Ga0501047_0164896 | Ga0501047_0164896_619_960 | 113 |
| 263 | 3300049581 | Ga0501047_0396385 | Ga0501047_0396385_172_513 | 113 |
| 264 | 3300049581 | Ga0501047_0937237 | Ga0501047_0937237_39_380 | 113 |
| 265 | 3300049581 | Ga0501047_1123481 | Ga0501047_1123481_184_525 | 113 |
| 266 | 3300049582 | Ga0501048_0025760 | Ga0501048_0025760_1511_1852 | 113 |
| 267 | 3300049582 | Ga0501048_0342437 | Ga0501048_0342437_693_1034 | 113 |
| 268 | 3300049583 | Ga0501067_0216510 | Ga0501067_0216510_569_910 | 113 |
| 269 | 3300049584 | Ga0501068_0124279 | Ga0501068_0124279_331_672 | 113 |
| 270 | 3300049584 | Ga0501068_0486212 | Ga0501068_0486212_59_400 | 113 |
| 271 | 3300049585 | Ga0501069_0093060 | Ga0501069_0093060_164_505 | 113 |
| 272 | 3300049585 | Ga0501069_0210813 | Ga0501069_0210813_586_927 | 113 |
| 273 | 3300049586 | Ga0501070_0012006 | Ga0501070_0012006_4623_4964 | 113 |
| 274 | 3300049586 | Ga0501070_0016597 | Ga0501070_0016597_3457_3798 | 113 |
| 275 | 3300049586 | Ga0501070_0045944 | Ga0501070_0045944_2463_2804 | 113 |
| 276 | 3300049586 | Ga0501070_0057750 | Ga0501070_0057750_688_1029 | 113 |
| 277 | 3300049586 | Ga0501070_0075785 | Ga0501070_0075785_628_969 | 113 |
| 278 | 3300049586 | Ga0501070_0604916 | Ga0501070_0604916_410_751 | 113 |
| 279 | 3300049587 | Ga0501071_0116255 | Ga0501071_0116255_968_1309 | 113 |
| 280 | 3300049588 | Ga0501072_0051958 | Ga0501072_0051958_1058_1399 | 113 |
| 281 | 3300049588 | Ga0501072_0169336 | Ga0501072_0169336_203_544 | 113 |
| 282 | 3300049589 | Ga0501073_0005996 | Ga0501073_0005996_6588_6929 | 113 |
| 283 | 3300049589 | Ga0501073_0064834 | Ga0501073_0064834_1379_1720 | 113 |
| 284 | 3300049590 | Ga0501074_0019707 | Ga0501074_0019707_2248_2589 | 113 |
| 285 | 3300049590 | Ga0501074_0083323 | Ga0501074_0083323_215_556 | 113 |
| 286 | 3300049590 | Ga0501074_0183906 | Ga0501074_0183906_1077_1418 | 113 |
| 287 | 3300049591 | Ga0501075_0637749 | Ga0501075_0637749_115_456 | 113 |
| 288 | 3300049592 | Ga0501076_0133297 | Ga0501076_0133297_25_366 | 113 |
| 289 | 3300049741 | Ga0501079_0037272 | Ga0501079_0037272_2163_2504 | 113 |
| 290 | 3300049742 | Ga0501080_0001467 | Ga0501080_0001467_2433_2774 | 113 |
| 291 | 3300049742 | Ga0501080_0066497 | Ga0501080_0066497_799_1140 | 113 |
| 292 | 3300049742 | Ga0501080_0090333 | Ga0501080_0090333_2466_2807 | 113 |
| 293 | 3300049742 | Ga0501080_0137157 | Ga0501080_0137157_1220_1561 | 113 |
| 294 | 3300049744 | Ga0501083_0009826 | Ga0501083_0009826_2405_2746 | 113 |
| 295 | 3300049744 | Ga0501083_0066516 | Ga0501083_0066516_686_1027 | 113 |
| 296 | 3300049822 | Ga0501035_0052529 | Ga0501035_0052529_2328_2669 | 113 |
| 297 | 3300049822 | Ga0501035_0074968 | Ga0501035_0074968_781_1122 | 113 |
| 298 | 3300049822 | Ga0501035_0128726 | Ga0501035_0128726_1402_1743 | 113 |
| 299 | 3300049822 | Ga0501035_0405438 | Ga0501035_0405438_174_515 | 113 |
| 300 | 3300049822 | Ga0501035_1263840 | Ga0501035_1263840_168_509 | 113 |
| 301 | 3300049823 | Ga0501044_0002823 | Ga0501044_0002823_2362_2703 | 113 |
| 302 | 3300049823 | Ga0501044_0038058 | Ga0501044_0038058_3993_4334 | 113 |
| 303 | 3300049823 | Ga0501044_0173293 | Ga0501044_0173293_218_559 | 113 |
| 304 | 3300049823 | Ga0501044_0243942 | Ga0501044_0243942_526_867 | 113 |
| 305 | 3300049823 | Ga0501044_0625621 | Ga0501044_0625621_190_531 | 113 |
| 306 | 3300049823 | Ga0501044_1188973 | Ga0501044_1188973_158_499 | 113 |
| 307 | 3300049824 | Ga0501045_0466841 | Ga0501045_0466841_159_500 | 113 |
| 308 | 3300050507 | nmdc:mga05p37_6013_c1 | nmdc:mga05p37_6013_c1_7192_7533 | 113 |
| 309 | 3300050507 | nmdc:mga05p37_87679_c1 | nmdc:mga05p37_87679_c1_1765_2106 | 113 |
| 310 | 3300050508 | nmdc:mga09592_2783_c1 | nmdc:mga09592_2783_c1_1023_1364 | 113 |
| 311 | 3300050509 | nmdc:mga0qj67_1876_c1 | nmdc:mga0qj67_1876_c1_12290_12631 | 113 |
| 312 | 3300050510 | nmdc:mga06r32_22491_c1 | nmdc:mga06r32_22491_c1_4072_4413 | 113 |
| 313 | 3300050511 | nmdc:mga08y16_12040_c1 | nmdc:mga08y16_12040_c1_1954_2295 | 113 |
| 314 | 3300050512 | nmdc:mga0n895_1539_c1 | nmdc:mga0n895_1539_c1_9417_9758 | 113 |
| 315 | 3300050512 | nmdc:mga0n895_436410_c1 | nmdc:mga0n895_436410_c1_599_940 | 113 |
| 316 | 3300050512 | nmdc:mga0n895_5922_c1 | nmdc:mga0n895_5922_c1_2709_3050 | 113 |
| 317 | 3300050512 | nmdc:mga0n895_97038_c1 | nmdc:mga0n895_97038_c1_1650_1991 | 113 |
| 318 | 3300050513 | nmdc:mga0rr50_383255_c1 | nmdc:mga0rr50_383255_c1_134_475 | 113 |
| 319 | 3300050513 | nmdc:mga0rr50_505582_c1 | nmdc:mga0rr50_505582_c1_516_857 | 113 |
| 320 | 3300050513 | nmdc:mga0rr50_72220_c1 | nmdc:mga0rr50_72220_c1_217_558 | 113 |
| 321 | 3300050515 | nmdc:mga0a205_1056427_c1 | nmdc:mga0a205_1056427_c1_98_439 | 113 |
| 322 | 3300050515 | nmdc:mga0a205_34744_c1 | nmdc:mga0a205_34744_c1_2544_2885 | 113 |
| 323 | 3300050515 | nmdc:mga0a205_46035_c1 | nmdc:mga0a205_46035_c1_1399_1740 | 113 |
| 324 | 3300053085 | Ga0495619_0025754 | Ga0495619_0025754_1156_1497 | 113 |
| 325 | 3300054114 | Ga0501084_0098435 | Ga0501084_0098435_182_523 | 113 |
| 326 | 3300054114 | Ga0501084_0667190 | Ga0501084_0667190_394_735 | 113 |
| 327 | 3300060353 | Ga0501082_0064261 | Ga0501082_0064261_2199_2540 | 113 |
| 328 | 3300005327 | Ga0070658_10003716 | Ga0070658_100037164 | 114 |
| 329 | 3300005336 | Ga0070680_100013055 | Ga0070680_1000130553 | 114 |
| 330 | 3300005458 | Ga0070681_10261025 | Ga0070681_102610252 | 114 |
| 331 | 3300005530 | Ga0070679_100332100 | Ga0070679_1003321001 | 114 |
| 332 | 3300005563 | Ga0068855_100082168 | Ga0068855_1000821685 | 114 |
| 333 | 3300005578 | Ga0068854_100056497 | Ga0068854_1000564973 | 114 |
| 334 | 3300009093 | Ga0105240_10293420 | Ga0105240_102934203 | 114 |
| 335 | 3300013100 | Ga0157373_11393197 | Ga0157373_113931972 | 114 |
| 336 | 3300013104 | Ga0157370_10055478 | Ga0157370_100554782 | 114 |
| 337 | 3300013104 | Ga0157370_10843988 | Ga0157370_108439882 | 114 |
| 338 | 3300020082 | Ga0206353_10336741 | Ga0206353_103367412 | 114 |
| 339 | 3300021384 | Ga0213876_10225361 | Ga0213876_102253613 | 114 |
| 340 | 3300025912 | Ga0207707_10059583 | Ga0207707_100595834 | 114 |
| 341 | 3300025917 | Ga0207660_10223267 | Ga0207660_102232673 | 114 |
| 342 | 3300025919 | Ga0207657_10019627 | Ga0207657_100196273 | 114 |
| 343 | 3300025921 | Ga0207652_10069144 | Ga0207652_100691443 | 114 |
| 344 | 3300025949 | Ga0207667_10121124 | Ga0207667_101211242 | 114 |
| 345 | 3300025981 | Ga0207640_10076366 | Ga0207640_100763663 | 114 |
| 346 | 3300031711 | Ga0265314_10004264 | Ga0265314_1000426411 | 114 |
| 347 | 3300031901 | Ga0307406_10475704 | Ga0307406_104757042 | 114 |
| 348 | 3300032002 | Ga0307416_101198459 | Ga0307416_1011984592 | 114 |
| 349 | 3300032126 | Ga0307415_100480274 | Ga0307415_1004802742 | 114 |
| 350 | 3300035084 | Ga0373928_0068112 | Ga0373928_0068112_63_407 | 114 |
| 351 | 3300035085 | Ga0373929_0211754 | Ga0373929_0211754_175_519 | 114 |
| 352 | 3300035724 | Ga0373933_0526669 | Ga0373933_0526669_386_730 | 114 |
| 353 | 3300036401 | Ga0373937_1397703 | Ga0373937_1397703_197_541 | 114 |
| 354 | 3300038443 | Ga0395901_1308869 | Ga0395901_1308869_261_605 | 114 |
| 355 | 3300039437 | Ga0436365_0566814 | Ga0436365_0566814_567_920 | 114 |
| 356 | 3300039437 | Ga0436365_1828125 | Ga0436365_1828125_2002_2346 | 114 |
| 357 | 3300048905 | Ga0496102_0068715 | Ga0496102_0068715_2759_3103 | 114 |
| 358 | 3300049569 | Ga0501032_0688659 | Ga0501032_0688659_69_413 | 114 |
| 359 | 3300049571 | Ga0501034_0173889 | Ga0501034_0173889_312_656 | 114 |
| 360 | 3300049573 | Ga0501037_0152168 | Ga0501037_0152168_176_520 | 114 |
| 361 | 3300049574 | Ga0501038_0134370 | Ga0501038_0134370_715_1059 | 114 |
| 362 | 3300049581 | Ga0501047_0314369 | Ga0501047_0314369_137_481 | 114 |
| 363 | 3300049585 | Ga0501069_0045493 | Ga0501069_0045493_1981_2325 | 114 |
| 364 | 3300049585 | Ga0501069_0640647 | Ga0501069_0640647_164_508 | 114 |
| 365 | 3300049586 | Ga0501070_0061415 | Ga0501070_0061415_1062_1406 | 114 |
| 366 | 3300049589 | Ga0501073_0021522 | Ga0501073_0021522_2770_3114 | 114 |
| 367 | 3300049589 | Ga0501073_0397268 | Ga0501073_0397268_271_615 | 114 |
| 368 | 3300049590 | Ga0501074_0355580 | Ga0501074_0355580_159_503 | 114 |
| 369 | 3300049593 | Ga0501077_0831454 | Ga0501077_0831454_50_394 | 114 |
| 370 | 3300049741 | Ga0501079_0290426 | Ga0501079_0290426_741_1085 | 114 |
| 371 | 3300049741 | Ga0501079_1321314 | Ga0501079_1321314_155_499 | 114 |
| 372 | 3300049742 | Ga0501080_0100594 | Ga0501080_0100594_2143_2487 | 114 |
| 373 | 3300049744 | Ga0501083_0028469 | Ga0501083_0028469_2275_2619 | 114 |
| 374 | 3300049744 | Ga0501083_0388204 | Ga0501083_0388204_221_565 | 114 |
| 375 | 3300049822 | Ga0501035_0177424 | Ga0501035_0177424_1233_1577 | 114 |
| 376 | 3300049823 | Ga0501044_0197490 | Ga0501044_0197490_316_660 | 114 |
| 377 | 3300049823 | Ga0501044_0928257 | Ga0501044_0928257_217_561 | 114 |
| 378 | 3300054114 | Ga0501084_0422737 | Ga0501084_0422737_16_360 | 114 |
| 379 | 3300060353 | Ga0501082_0019802 | Ga0501082_0019802_809_1153 | 114 |
| 380 | 3300060353 | Ga0501082_0626427 | Ga0501082_0626427_184_528 | 114 |
| 381 | 2162886011 | MRS1b_contig_285774 | MRS1b_0766.00002840 | 115 |
| 382 | 2162886012 | MBSR1b_contig_13052938 | MBSR1b_0617.00000150 | 115 |
| 383 | 2162886012 | MBSR1b_contig_1596674 | MBSR1b_0904.00000530 | 115 |
| 384 | 2209111006 | 2214628271 | 2213659716 | 115 |
| 385 | 3300000042 | ARSoilYngRDRAFT_c00203 | ARSoilYngRDRAFT_002034 | 115 |
| 386 | 3300000043 | ARcpr5yngRDRAFT_c000031 | ARcpr5yngRDRAFT_0000319 | 115 |
| 387 | 3300000044 | ARSoilOldRDRAFT_c000027 | ARSoilOldRDRAFT_00002725 | 115 |
| 388 | 3300000045 | ARCol0oldRDRAFT_c00076 | ARCol0oldRDRAFT_000766 | 115 |
| 389 | 3300000652 | ARCol0yngRDRAFT_1000016 | ARCol0yngRDRAFT_100001625 | 115 |
| 390 | 3300001976 | JGI24752J21851_1013836 | JGI24752J21851_10138361 | 115 |
| 391 | 3300001977 | JGI24746J21847_1000923 | JGI24746J21847_10009234 | 115 |
| 392 | 3300001978 | JGI24747J21853_1007884 | JGI24747J21853_10078843 | 115 |
| 393 | 3300001979 | JGI24740J21852_10054506 | JGI24740J21852_100545063 | 115 |
| 394 | 3300001989 | JGI24739J22299_10040565 | JGI24739J22299_100405653 | 115 |
| 395 | 3300001990 | JGI24737J22298_10002170 | JGI24737J22298_100021708 | 115 |
| 396 | 3300001990 | JGI24737J22298_10008902 | JGI24737J22298_100089023 | 115 |
| 397 | 3300001990 | JGI24737J22298_10011120 | JGI24737J22298_100111202 | 115 |
| 398 | 3300001990 | JGI24737J22298_10012710 | JGI24737J22298_100127102 | 115 |
| 399 | 3300001991 | JGI24743J22301_10004801 | JGI24743J22301_100048013 | 115 |
| 400 | 3300002070 | JGI24750J21931_1001342 | JGI24750J21931_10013424 | 115 |
| 401 | 3300002073 | JGI24745J21846_1000152 | JGI24745J21846_10001524 | 115 |
| 402 | 3300002074 | JGI24748J21848_1002289 | JGI24748J21848_10022893 | 115 |
| 403 | 3300002075 | JGI24738J21930_10000909 | JGI24738J21930_100009097 | 115 |
| 404 | 3300002076 | JGI24749J21850_1007700 | JGI24749J21850_10077003 | 115 |
| 405 | 3300002077 | JGI24744J21845_10002614 | JGI24744J21845_100026143 | 115 |
| 406 | 3300002077 | JGI24744J21845_10002742 | JGI24744J21845_100027423 | 115 |
| 407 | 3300002126 | JGI24035J26624_1000140 | JGI24035J26624_10001403 | 115 |
| 408 | 3300002155 | JGI24033J26618_1000697 | JGI24033J26618_10006975 | 115 |
| 409 | 3300002239 | JGI24034J26672_10000370 | JGI24034J26672_100003707 | 115 |
| 410 | 3300002244 | JGI24742J22300_10021793 | JGI24742J22300_100217932 | 115 |
| 411 | 3300002459 | JGI24751J29686_10025837 | JGI24751J29686_100258373 | 115 |
| 412 | 3300002459 | JGI24751J29686_10052399 | JGI24751J29686_100523991 | 115 |
| 413 | 3300003214 | JGI25165J46597_1054094 | JGI25165J46597_10540941 | 115 |
| 414 | 3300005277 | Ga0065716_1002003 | Ga0065716_10020032 | 115 |
| 415 | 3300005288 | Ga0065714_10229778 | Ga0065714_102297782 | 115 |
| 416 | 3300005288 | Ga0065714_10366413 | Ga0065714_103664132 | 115 |
| 417 | 3300005289 | Ga0065704_10004924 | Ga0065704_100049248 | 115 |
| 418 | 3300005290 | Ga0065712_10004249 | Ga0065712_100042494 | 115 |
| 419 | 3300005290 | Ga0065712_10069903 | Ga0065712_100699035 | 115 |
| 420 | 3300005290 | Ga0065712_10084253 | Ga0065712_100842532 | 115 |
| 421 | 3300005293 | Ga0065715_10005783 | Ga0065715_100057834 | 115 |
| 422 | 3300005293 | Ga0065715_10090726 | Ga0065715_100907262 | 115 |
| 423 | 3300005293 | Ga0065715_10193889 | Ga0065715_101938893 | 115 |
| 424 | 3300005293 | Ga0065715_10638147 | Ga0065715_106381471 | 115 |
| 425 | 3300005295 | Ga0065707_10182513 | Ga0065707_101825131 | 115 |
| 426 | 3300005327 | Ga0070658_10090733 | Ga0070658_100907333 | 115 |
| 427 | 3300005328 | Ga0070676_10650819 | Ga0070676_106508191 | 115 |
| 428 | 3300005329 | Ga0070683_100016231 | Ga0070683_1000162317 | 115 |
| 429 | 3300005330 | Ga0070690_100000972 | Ga0070690_10000097216 | 115 |
| 430 | 3300005330 | Ga0070690_100031108 | Ga0070690_1000311083 | 115 |
| 431 | 3300005330 | Ga0070690_100111001 | Ga0070690_1001110011 | 115 |
| 432 | 3300005330 | Ga0070690_100360277 | Ga0070690_1003602771 | 115 |
| 433 | 3300005331 | Ga0070670_100043184 | Ga0070670_1000431843 | 115 |
| 434 | 3300005331 | Ga0070670_100318698 | Ga0070670_1003186982 | 115 |
| 435 | 3300005333 | Ga0070677_10489080 | Ga0070677_104890801 | 115 |
| 436 | 3300005334 | Ga0068869_100028165 | Ga0068869_1000281655 | 115 |
| 437 | 3300005334 | Ga0068869_101212690 | Ga0068869_1012126901 | 115 |
| 438 | 3300005335 | Ga0070666_10029587 | Ga0070666_100295872 | 115 |
| 439 | 3300005335 | Ga0070666_10065487 | Ga0070666_100654873 | 115 |
| 440 | 3300005335 | Ga0070666_10131394 | Ga0070666_101313943 | 115 |
| 441 | 3300005336 | Ga0070680_100072254 | Ga0070680_1000722543 | 115 |
| 442 | 3300005336 | Ga0070680_100266293 | Ga0070680_1002662933 | 115 |
| 443 | 3300005336 | Ga0070680_100424387 | Ga0070680_1004243872 | 115 |
| 444 | 3300005336 | Ga0070680_101492006 | Ga0070680_1014920061 | 115 |
| 445 | 3300005337 | Ga0070682_100022243 | Ga0070682_1000222434 | 115 |
| 446 | 3300005337 | Ga0070682_100065660 | Ga0070682_1000656603 | 115 |
| 447 | 3300005337 | Ga0070682_100500616 | Ga0070682_1005006162 | 115 |
| 448 | 3300005337 | Ga0070682_101670143 | Ga0070682_1016701431 | 115 |
| 449 | 3300005338 | Ga0068868_100000287 | Ga0068868_10000028713 | 115 |
| 450 | 3300005338 | Ga0068868_100843474 | Ga0068868_1008434742 | 115 |
| 451 | 3300005339 | Ga0070660_100011348 | Ga0070660_1000113487 | 115 |
| 452 | 3300005339 | Ga0070660_100095616 | Ga0070660_1000956163 | 115 |
| 453 | 3300005339 | Ga0070660_100165868 | Ga0070660_1001658682 | 115 |
| 454 | 3300005340 | Ga0070689_100009382 | Ga0070689_1000093827 | 115 |
| 455 | 3300005340 | Ga0070689_100028894 | Ga0070689_1000288943 | 115 |
| 456 | 3300005340 | Ga0070689_100069911 | Ga0070689_1000699111 | 115 |
| 457 | 3300005341 | Ga0070691_10007546 | Ga0070691_100075466 | 115 |
| 458 | 3300005341 | Ga0070691_10050476 | Ga0070691_100504763 | 115 |
| 459 | 3300005341 | Ga0070691_10112563 | Ga0070691_101125632 | 115 |
| 460 | 3300005343 | Ga0070687_100006226 | Ga0070687_1000062263 | 115 |
| 461 | 3300005343 | Ga0070687_100038674 | Ga0070687_1000386742 | 115 |
| 462 | 3300005344 | Ga0070661_100014754 | Ga0070661_1000147543 | 115 |
| 463 | 3300005344 | Ga0070661_100483606 | Ga0070661_1004836062 | 115 |
| 464 | 3300005344 | Ga0070661_100558317 | Ga0070661_1005583171 | 115 |
| 465 | 3300005344 | Ga0070661_101897387 | Ga0070661_1018973871 | 115 |
| 466 | 3300005345 | Ga0070692_10003049 | Ga0070692_100030493 | 115 |
| 467 | 3300005345 | Ga0070692_10010883 | Ga0070692_100108832 | 115 |
| 468 | 3300005347 | Ga0070668_100072639 | Ga0070668_1000726393 | 115 |
| 469 | 3300005353 | Ga0070669_100005691 | Ga0070669_10000569111 | 115 |
| 470 | 3300005353 | Ga0070669_100018258 | Ga0070669_1000182584 | 115 |
| 471 | 3300005354 | Ga0070675_100051571 | Ga0070675_1000515713 | 115 |
| 472 | 3300005355 | Ga0070671_100033279 | Ga0070671_1000332793 | 115 |
| 473 | 3300005355 | Ga0070671_100103035 | Ga0070671_1001030353 | 115 |
| 474 | 3300005355 | Ga0070671_100355244 | Ga0070671_1003552443 | 115 |
| 475 | 3300005356 | Ga0070674_100056194 | Ga0070674_1000561942 | 115 |
| 476 | 3300005356 | Ga0070674_100716276 | Ga0070674_1007162761 | 115 |
| 477 | 3300005364 | Ga0070673_100014645 | Ga0070673_1000146453 | 115 |
| 478 | 3300005364 | Ga0070673_100483252 | Ga0070673_1004832522 | 115 |
| 479 | 3300005365 | Ga0070688_100001436 | Ga0070688_1000014364 | 115 |
| 480 | 3300005365 | Ga0070688_100008580 | Ga0070688_1000085805 | 115 |
| 481 | 3300005365 | Ga0070688_100205308 | Ga0070688_1002053082 | 115 |
| 482 | 3300005366 | Ga0070659_100015882 | Ga0070659_1000158824 | 115 |
| 483 | 3300005366 | Ga0070659_100059083 | Ga0070659_1000590833 | 115 |
| 484 | 3300005367 | Ga0070667_100009541 | Ga0070667_1000095413 | 115 |
| 485 | 3300005367 | Ga0070667_100060283 | Ga0070667_1000602834 | 115 |
| 486 | 3300005367 | Ga0070667_100074742 | Ga0070667_1000747423 | 115 |
| 487 | 3300005367 | Ga0070667_101421973 | Ga0070667_1014219731 | 115 |
| 488 | 3300005406 | Ga0070703_10010153 | Ga0070703_100101533 | 115 |
| 489 | 3300005406 | Ga0070703_10145990 | Ga0070703_101459902 | 115 |
| 490 | 3300005434 | Ga0070709_10029359 | Ga0070709_100293593 | 115 |
| 491 | 3300005435 | Ga0070714_100039918 | Ga0070714_1000399184 | 115 |
| 492 | 3300005436 | Ga0070713_100045425 | Ga0070713_1000454252 | 115 |
| 493 | 3300005436 | Ga0070713_100125089 | Ga0070713_1001250893 | 115 |
| 494 | 3300005437 | Ga0070710_10015364 | Ga0070710_100153647 | 115 |
| 495 | 3300005437 | Ga0070710_10030570 | Ga0070710_100305703 | 115 |
| 496 | 3300005438 | Ga0070701_10001244 | Ga0070701_100012447 | 115 |
| 497 | 3300005438 | Ga0070701_10253876 | Ga0070701_102538761 | 115 |
| 498 | 3300005439 | Ga0070711_100019451 | Ga0070711_1000194513 | 115 |
| 499 | 3300005439 | Ga0070711_100030277 | Ga0070711_1000302773 | 115 |
| 500 | 3300005440 | Ga0070705_100414548 | Ga0070705_1004145482 | 115 |
| 501 | 3300005441 | Ga0070700_100014256 | Ga0070700_1000142564 | 115 |
| 502 | 3300005444 | Ga0070694_100003715 | Ga0070694_1000037157 | 115 |
| 503 | 3300005444 | Ga0070694_100057360 | Ga0070694_1000573603 | 115 |
| 504 | 3300005444 | Ga0070694_101723693 | Ga0070694_1017236932 | 115 |
| 505 | 3300005445 | Ga0070708_100196674 | Ga0070708_1001966741 | 115 |
| 506 | 3300005455 | Ga0070663_100007417 | Ga0070663_1000074178 | 115 |
| 507 | 3300005455 | Ga0070663_100022554 | Ga0070663_1000225543 | 115 |
| 508 | 3300005455 | Ga0070663_100084684 | Ga0070663_1000846843 | 115 |
| 509 | 3300005456 | Ga0070678_100004742 | Ga0070678_1000047427 | 115 |
| 510 | 3300005456 | Ga0070678_100119811 | Ga0070678_1001198113 | 115 |
| 511 | 3300005457 | Ga0070662_100003647 | Ga0070662_1000036473 | 115 |
| 512 | 3300005457 | Ga0070662_100040160 | Ga0070662_1000401603 | 115 |
| 513 | 3300005457 | Ga0070662_100222516 | Ga0070662_1002225162 | 115 |
| 514 | 3300005457 | Ga0070662_100652425 | Ga0070662_1006524252 | 115 |
| 515 | 3300005458 | Ga0070681_10018191 | Ga0070681_100181918 | 115 |
| 516 | 3300005458 | Ga0070681_10061315 | Ga0070681_100613154 | 115 |
| 517 | 3300005458 | Ga0070681_10236909 | Ga0070681_102369093 | 115 |
| 518 | 3300005459 | Ga0068867_100029242 | Ga0068867_1000292423 | 115 |
| 519 | 3300005466 | Ga0070685_10001963 | Ga0070685_100019633 | 115 |
| 520 | 3300005466 | Ga0070685_11377201 | Ga0070685_113772012 | 115 |
| 521 | 3300005467 | Ga0070706_100990111 | Ga0070706_1009901112 | 115 |
| 522 | 3300005468 | Ga0070707_100210734 | Ga0070707_1002107342 | 115 |
| 523 | 3300005471 | Ga0070698_100594422 | Ga0070698_1005944222 | 115 |
| 524 | 3300005518 | Ga0070699_100400899 | Ga0070699_1004008991 | 115 |
| 525 | 3300005530 | Ga0070679_100109176 | Ga0070679_1001091762 | 115 |
| 526 | 3300005530 | Ga0070679_100276893 | Ga0070679_1002768933 | 115 |
| 527 | 3300005530 | Ga0070679_100786135 | Ga0070679_1007861352 | 115 |
| 528 | 3300005530 | Ga0070679_101486148 | Ga0070679_1014861481 | 115 |
| 529 | 3300005535 | Ga0070684_100075913 | Ga0070684_1000759132 | 115 |
| 530 | 3300005535 | Ga0070684_100267070 | Ga0070684_1002670702 | 115 |
| 531 | 3300005539 | Ga0068853_100033477 | Ga0068853_1000334775 | 115 |
| 532 | 3300005539 | Ga0068853_100053869 | Ga0068853_1000538693 | 115 |
| 533 | 3300005539 | Ga0068853_100808694 | Ga0068853_1008086942 | 115 |
| 534 | 3300005539 | Ga0068853_101827818 | Ga0068853_1018278181 | 115 |
| 535 | 3300005543 | Ga0070672_100008973 | Ga0070672_1000089739 | 115 |
| 536 | 3300005543 | Ga0070672_100267355 | Ga0070672_1002673552 | 115 |
| 537 | 3300005544 | Ga0070686_100031841 | Ga0070686_1000318413 | 115 |
| 538 | 3300005544 | Ga0070686_100038220 | Ga0070686_1000382202 | 115 |
| 539 | 3300005544 | Ga0070686_100157183 | Ga0070686_1001571833 | 115 |
| 540 | 3300005545 | Ga0070695_100035975 | Ga0070695_1000359753 | 115 |
| 541 | 3300005545 | Ga0070695_100312777 | Ga0070695_1003127773 | 115 |
| 542 | 3300005545 | Ga0070695_100357507 | Ga0070695_1003575072 | 115 |
| 543 | 3300005546 | Ga0070696_100006672 | Ga0070696_1000066723 | 115 |
| 544 | 3300005546 | Ga0070696_100012420 | Ga0070696_1000124203 | 115 |
| 545 | 3300005546 | Ga0070696_100110438 | Ga0070696_1001104383 | 115 |
| 546 | 3300005546 | Ga0070696_100200076 | Ga0070696_1002000762 | 115 |
| 547 | 3300005547 | Ga0070693_100003566 | Ga0070693_1000035663 | 115 |
| 548 | 3300005547 | Ga0070693_100076865 | Ga0070693_1000768653 | 115 |
| 549 | 3300005547 | Ga0070693_100363275 | Ga0070693_1003632752 | 115 |
| 550 | 3300005547 | Ga0070693_100962907 | Ga0070693_1009629072 | 115 |
| 551 | 3300005547 | Ga0070693_101347088 | Ga0070693_1013470881 | 115 |
| 552 | 3300005548 | Ga0070665_100014185 | Ga0070665_1000141857 | 115 |
| 553 | 3300005548 | Ga0070665_101573946 | Ga0070665_1015739462 | 115 |
| 554 | 3300005549 | Ga0070704_100003927 | Ga0070704_1000039274 | 115 |
| 555 | 3300005563 | Ga0068855_100031527 | Ga0068855_1000315273 | 115 |
| 556 | 3300005563 | Ga0068855_100476596 | Ga0068855_1004765962 | 115 |
| 557 | 3300005564 | Ga0070664_100022768 | Ga0070664_1000227683 | 115 |
| 558 | 3300005564 | Ga0070664_100071700 | Ga0070664_1000717004 | 115 |
| 559 | 3300005564 | Ga0070664_100090054 | Ga0070664_1000900543 | 115 |
| 560 | 3300005564 | Ga0070664_100598642 | Ga0070664_1005986422 | 115 |
| 561 | 3300005564 | Ga0070664_100867217 | Ga0070664_1008672172 | 115 |
| 562 | 3300005577 | Ga0068857_100006630 | Ga0068857_1000066304 | 115 |
| 563 | 3300005577 | Ga0068857_100124888 | Ga0068857_1001248882 | 115 |
| 564 | 3300005578 | Ga0068854_100519143 | Ga0068854_1005191432 | 115 |
| 565 | 3300005578 | Ga0068854_101354872 | Ga0068854_1013548722 | 115 |
| 566 | 3300005614 | Ga0068856_100037685 | Ga0068856_1000376853 | 115 |
| 567 | 3300005614 | Ga0068856_100067110 | Ga0068856_1000671103 | 115 |
| 568 | 3300005614 | Ga0068856_100753658 | Ga0068856_1007536582 | 115 |
| 569 | 3300005615 | Ga0070702_100135159 | Ga0070702_1001351592 | 115 |
| 570 | 3300005615 | Ga0070702_100274712 | Ga0070702_1002747122 | 115 |
| 571 | 3300005616 | Ga0068852_100010452 | Ga0068852_1000104524 | 115 |
| 572 | 3300005616 | Ga0068852_100332252 | Ga0068852_1003322522 | 115 |
| 573 | 3300005617 | Ga0068859_100054633 | Ga0068859_1000546333 | 115 |
| 574 | 3300005617 | Ga0068859_100079592 | Ga0068859_1000795923 | 115 |
| 575 | 3300005618 | Ga0068864_100026602 | Ga0068864_1000266024 | 115 |
| 576 | 3300005618 | Ga0068864_100502107 | Ga0068864_1005021072 | 115 |
| 577 | 3300005718 | Ga0068866_10007526 | Ga0068866_100075264 | 115 |
| 578 | 3300005718 | Ga0068866_10328552 | Ga0068866_103285522 | 115 |
| 579 | 3300005719 | Ga0068861_100007303 | Ga0068861_1000073034 | 115 |
| 580 | 3300005719 | Ga0068861_100070066 | Ga0068861_1000700662 | 115 |
| 581 | 3300005834 | Ga0068851_10298156 | Ga0068851_102981563 | 115 |
| 582 | 3300005834 | Ga0068851_10589823 | Ga0068851_105898232 | 115 |
| 583 | 3300005840 | Ga0068870_10007593 | Ga0068870_100075934 | 115 |
| 584 | 3300005841 | Ga0068863_100580920 | Ga0068863_1005809203 | 115 |
| 585 | 3300005841 | Ga0068863_101309895 | Ga0068863_1013098952 | 115 |
| 586 | 3300005842 | Ga0068858_100064184 | Ga0068858_1000641844 | 115 |
| 587 | 3300005842 | Ga0068858_100926117 | Ga0068858_1009261172 | 115 |
| 588 | 3300005843 | Ga0068860_100015452 | Ga0068860_1000154523 | 115 |
| 589 | 3300005843 | Ga0068860_100028463 | Ga0068860_1000284633 | 115 |
| 590 | 3300005843 | Ga0068860_100320286 | Ga0068860_1003202863 | 115 |
| 591 | 3300005844 | Ga0068862_100015822 | Ga0068862_1000158227 | 115 |
| 592 | 3300005844 | Ga0068862_100025065 | Ga0068862_1000250653 | 115 |
| 593 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009219 | 115 |
| 594 | 3300006028 | Ga0070717_10056737 | Ga0070717_100567372 | 115 |
| 595 | 3300006028 | Ga0070717_10063805 | Ga0070717_100638053 | 115 |
| 596 | 3300006048 | Ga0075363_100073902 | Ga0075363_1000739022 | 115 |
| 597 | 3300006058 | Ga0075432_10103079 | Ga0075432_101030792 | 115 |
| 598 | 3300006163 | Ga0070715_10011857 | Ga0070715_100118572 | 115 |
| 599 | 3300006163 | Ga0070715_10495614 | Ga0070715_104956142 | 115 |
| 600 | 3300006173 | Ga0070716_100406354 | Ga0070716_1004063542 | 115 |
| 601 | 3300006175 | Ga0070712_100315604 | Ga0070712_1003156043 | 115 |
| 602 | 3300006175 | Ga0070712_100381749 | Ga0070712_1003817492 | 115 |
| 603 | 3300006175 | Ga0070712_101613176 | Ga0070712_1016131762 | 115 |
| 604 | 3300006178 | Ga0075367_10063419 | Ga0075367_100634193 | 115 |
| 605 | 3300006178 | Ga0075367_10906292 | Ga0075367_109062921 | 115 |
| 606 | 3300006237 | Ga0097621_100000616 | Ga0097621_1000006162 | 115 |
| 607 | 3300006237 | Ga0097621_100008744 | Ga0097621_1000087443 | 115 |
| 608 | 3300006353 | Ga0075370_10532323 | Ga0075370_105323231 | 115 |
| 609 | 3300006358 | Ga0068871_100000922 | Ga0068871_10000092219 | 115 |
| 610 | 3300006358 | Ga0068871_100027615 | Ga0068871_1000276153 | 115 |
| 611 | 3300006852 | Ga0075433_10005782 | Ga0075433_100057827 | 115 |
| 612 | 3300006852 | Ga0075433_10214493 | Ga0075433_102144932 | 115 |
| 613 | 3300006871 | Ga0075434_100001367 | Ga0075434_10000136719 | 115 |
| 614 | 3300006881 | Ga0068865_100006916 | Ga0068865_1000069163 | 115 |
| 615 | 3300006881 | Ga0068865_100076762 | Ga0068865_1000767624 | 115 |
| 616 | 3300006881 | Ga0068865_100133440 | Ga0068865_1001334403 | 115 |
| 617 | 3300006914 | Ga0075436_100502389 | Ga0075436_1005023892 | 115 |
| 618 | 3300006931 | Ga0097620_100054629 | Ga0097620_1000546293 | 115 |
| 619 | 3300006931 | Ga0097620_100079594 | Ga0097620_1000795943 | 115 |
| 620 | 3300007076 | Ga0075435_100068616 | Ga0075435_1000686164 | 115 |
| 621 | 3300007076 | Ga0075435_100334541 | Ga0075435_1003345413 | 115 |
| 622 | 3300009036 | Ga0105244_10018443 | Ga0105244_100184433 | 115 |
| 623 | 3300009093 | Ga0105240_10223606 | Ga0105240_102236063 | 115 |
| 624 | 3300009093 | Ga0105240_10654969 | Ga0105240_106549691 | 115 |
| 625 | 3300009094 | Ga0111539_10013373 | Ga0111539_100133734 | 115 |
| 626 | 3300009094 | Ga0111539_10053737 | Ga0111539_100537373 | 115 |
| 627 | 3300009098 | Ga0105245_10004252 | Ga0105245_1000425213 | 115 |
| 628 | 3300009098 | Ga0105245_10148592 | Ga0105245_101485923 | 115 |
| 629 | 3300009098 | Ga0105245_10197571 | Ga0105245_101975712 | 115 |
| 630 | 3300009098 | Ga0105245_10240994 | Ga0105245_102409943 | 115 |
| 631 | 3300009101 | Ga0105247_10043793 | Ga0105247_100437933 | 115 |
| 632 | 3300009101 | Ga0105247_10072953 | Ga0105247_100729532 | 115 |
| 633 | 3300009101 | Ga0105247_10094973 | Ga0105247_100949733 | 115 |
| 634 | 3300009101 | Ga0105247_10111925 | Ga0105247_101119253 | 115 |
| 635 | 3300009147 | Ga0114129_11197944 | Ga0114129_111979441 | 115 |
| 636 | 3300009148 | Ga0105243_10018577 | Ga0105243_100185778 | 115 |
| 637 | 3300009148 | Ga0105243_10019863 | Ga0105243_100198634 | 115 |
| 638 | 3300009148 | Ga0105243_10111305 | Ga0105243_101113052 | 115 |
| 639 | 3300009174 | Ga0105241_10021402 | Ga0105241_100214025 | 115 |
| 640 | 3300009174 | Ga0105241_10212299 | Ga0105241_102122992 | 115 |
| 641 | 3300009176 | Ga0105242_10045458 | Ga0105242_100454584 | 115 |
| 642 | 3300009176 | Ga0105242_10177129 | Ga0105242_101771292 | 115 |
| 643 | 3300009177 | Ga0105248_10034642 | Ga0105248_100346423 | 115 |
| 644 | 3300009177 | Ga0105248_10035800 | Ga0105248_100358005 | 115 |
| 645 | 3300009177 | Ga0105248_10110124 | Ga0105248_101101242 | 115 |
| 646 | 3300009545 | Ga0105237_10008357 | Ga0105237_1000835714 | 115 |
| 647 | 3300009545 | Ga0105237_10035386 | Ga0105237_100353863 | 115 |
| 648 | 3300009551 | Ga0105238_10197036 | Ga0105238_101970363 | 115 |
| 649 | 3300009553 | Ga0105249_10029412 | Ga0105249_100294123 | 115 |
| 650 | 3300009553 | Ga0105249_10155472 | Ga0105249_101554723 | 115 |
| 651 | 3300009553 | Ga0105249_10351895 | Ga0105249_103518952 | 115 |
| 652 | 3300010375 | Ga0105239_10025073 | Ga0105239_100250733 | 115 |
| 653 | 3300010375 | Ga0105239_10100256 | Ga0105239_101002563 | 115 |
| 654 | 3300010375 | Ga0105239_10519024 | Ga0105239_105190242 | 115 |
| 655 | 3300010375 | Ga0105239_12056114 | Ga0105239_120561142 | 115 |
| 656 | 3300010375 | Ga0105239_12551558 | Ga0105239_125515582 | 115 |
| 657 | 3300011119 | Ga0105246_10259260 | Ga0105246_102592602 | 115 |
| 658 | 3300011119 | Ga0105246_10287281 | Ga0105246_102872812 | 115 |
| 659 | 3300011119 | Ga0105246_10703456 | Ga0105246_107034562 | 115 |
| 660 | 3300012476 | Ga0157344_1003072 | Ga0157344_10030722 | 115 |
| 661 | 3300012478 | Ga0157328_1004315 | Ga0157328_10043152 | 115 |
| 662 | 3300012481 | Ga0157320_1000803 | Ga0157320_10008032 | 115 |
| 663 | 3300012494 | Ga0157341_1016513 | Ga0157341_10165132 | 115 |
| 664 | 3300012502 | Ga0157347_1060145 | Ga0157347_10601451 | 115 |
| 665 | 3300012515 | Ga0157338_1000546 | Ga0157338_10005462 | 115 |
| 666 | 3300013100 | Ga0157373_10007606 | Ga0157373_100076063 | 115 |
| 667 | 3300013100 | Ga0157373_10886556 | Ga0157373_108865562 | 115 |
| 668 | 3300013102 | Ga0157371_10038816 | Ga0157371_100388163 | 115 |
| 669 | 3300013104 | Ga0157370_10032359 | Ga0157370_100323595 | 115 |
| 670 | 3300013105 | Ga0157369_10196398 | Ga0157369_101963982 | 115 |
| 671 | 3300013105 | Ga0157369_10584456 | Ga0157369_105844562 | 115 |
| 672 | 3300013296 | Ga0157374_10015848 | Ga0157374_100158488 | 115 |
| 673 | 3300013296 | Ga0157374_10164647 | Ga0157374_101646471 | 115 |
| 674 | 3300013296 | Ga0157374_10933225 | Ga0157374_109332251 | 115 |
| 675 | 3300013297 | Ga0157378_10007970 | Ga0157378_100079703 | 115 |
| 676 | 3300013297 | Ga0157378_10429633 | Ga0157378_104296333 | 115 |
| 677 | 3300013297 | Ga0157378_12902846 | Ga0157378_129028462 | 115 |
| 678 | 3300013306 | Ga0163162_10014117 | Ga0163162_100141174 | 115 |
| 679 | 3300013306 | Ga0163162_10048102 | Ga0163162_100481023 | 115 |
| 680 | 3300013306 | Ga0163162_10087113 | Ga0163162_100871133 | 115 |
| 681 | 3300013307 | Ga0157372_12011138 | Ga0157372_120111382 | 115 |
| 682 | 3300013308 | Ga0157375_10017624 | Ga0157375_100176247 | 115 |
| 683 | 3300013308 | Ga0157375_10060051 | Ga0157375_100600513 | 115 |
| 684 | 3300013308 | Ga0157375_10281074 | Ga0157375_102810743 | 115 |
| 685 | 3300014325 | Ga0163163_10001820 | Ga0163163_100018204 | 115 |
| 686 | 3300014325 | Ga0163163_12469721 | Ga0163163_124697212 | 115 |
| 687 | 3300014326 | Ga0157380_10009315 | Ga0157380_100093158 | 115 |
| 688 | 3300014326 | Ga0157380_10140795 | Ga0157380_101407953 | 115 |
| 689 | 3300014326 | Ga0157380_12613610 | Ga0157380_126136101 | 115 |
| 690 | 3300014745 | Ga0157377_10004131 | Ga0157377_100041318 | 115 |
| 691 | 3300014745 | Ga0157377_10154484 | Ga0157377_101544842 | 115 |
| 692 | 3300014968 | Ga0157379_10001178 | Ga0157379_100011783 | 115 |
| 693 | 3300014968 | Ga0157379_10118428 | Ga0157379_101184284 | 115 |
| 694 | 3300014968 | Ga0157379_10330904 | Ga0157379_103309042 | 115 |
| 695 | 3300014968 | Ga0157379_10485136 | Ga0157379_104851362 | 115 |
| 696 | 3300014969 | Ga0157376_10007479 | Ga0157376_1000747910 | 115 |
| 697 | 3300014969 | Ga0157376_10067889 | Ga0157376_100678894 | 115 |
| 698 | 3300014969 | Ga0157376_11216154 | Ga0157376_112161542 | 115 |
| 699 | 3300017792 | Ga0163161_10006785 | Ga0163161_100067857 | 115 |
| 700 | 3300017792 | Ga0163161_10118150 | Ga0163161_101181503 | 115 |
| 701 | 3300017792 | Ga0163161_10646958 | Ga0163161_106469581 | 115 |
| 702 | 3300025261 | Ga0209233_1026909 | Ga0209233_10269093 | 115 |
| 703 | 3300025271 | Ga0207666_1000090 | Ga0207666_10000903 | 115 |
| 704 | 3300025271 | Ga0207666_1012978 | Ga0207666_10129782 | 115 |
| 705 | 3300025290 | Ga0207673_1000112 | Ga0207673_10001122 | 115 |
| 706 | 3300025315 | Ga0207697_10000579 | Ga0207697_1000057921 | 115 |
| 707 | 3300025315 | Ga0207697_10007823 | Ga0207697_100078233 | 115 |
| 708 | 3300025728 | Ga0207655_1172023 | Ga0207655_11720232 | 115 |
| 709 | 3300025885 | Ga0207653_10002769 | Ga0207653_100027695 | 115 |
| 710 | 3300025893 | Ga0207682_10008278 | Ga0207682_100082783 | 115 |
| 711 | 3300025898 | Ga0207692_10035418 | Ga0207692_100354183 | 115 |
| 712 | 3300025898 | Ga0207692_10666300 | Ga0207692_106663002 | 115 |
| 713 | 3300025899 | Ga0207642_10051826 | Ga0207642_100518263 | 115 |
| 714 | 3300025899 | Ga0207642_10205855 | Ga0207642_102058553 | 115 |
| 715 | 3300025899 | Ga0207642_10918754 | Ga0207642_109187542 | 115 |
| 716 | 3300025900 | Ga0207710_10025350 | Ga0207710_100253502 | 115 |
| 717 | 3300025900 | Ga0207710_10035930 | Ga0207710_100359302 | 115 |
| 718 | 3300025901 | Ga0207688_10001006 | Ga0207688_100010064 | 115 |
| 719 | 3300025901 | Ga0207688_10047793 | Ga0207688_100477933 | 115 |
| 720 | 3300025903 | Ga0207680_10045487 | Ga0207680_100454873 | 115 |
| 721 | 3300025903 | Ga0207680_10142652 | Ga0207680_101426522 | 115 |
| 722 | 3300025903 | Ga0207680_10150354 | Ga0207680_101503542 | 115 |
| 723 | 3300025903 | Ga0207680_11173183 | Ga0207680_111731832 | 115 |
| 724 | 3300025904 | Ga0207647_10025960 | Ga0207647_100259603 | 115 |
| 725 | 3300025904 | Ga0207647_10125642 | Ga0207647_101256421 | 115 |
| 726 | 3300025905 | Ga0207685_10091124 | Ga0207685_100911242 | 115 |
| 727 | 3300025906 | Ga0207699_10090706 | Ga0207699_100907062 | 115 |
| 728 | 3300025907 | Ga0207645_10001020 | Ga0207645_1000102023 | 115 |
| 729 | 3300025907 | Ga0207645_10118774 | Ga0207645_101187743 | 115 |
| 730 | 3300025908 | Ga0207643_10000523 | Ga0207643_1000052323 | 115 |
| 731 | 3300025909 | Ga0207705_10658128 | Ga0207705_106581282 | 115 |
| 732 | 3300025910 | Ga0207684_10245846 | Ga0207684_102458462 | 115 |
| 733 | 3300025911 | Ga0207654_10047157 | Ga0207654_100471573 | 115 |
| 734 | 3300025912 | Ga0207707_10018497 | Ga0207707_100184973 | 115 |
| 735 | 3300025912 | Ga0207707_10046164 | Ga0207707_100461642 | 115 |
| 736 | 3300025912 | Ga0207707_10061465 | Ga0207707_100614654 | 115 |
| 737 | 3300025913 | Ga0207695_10321834 | Ga0207695_103218343 | 115 |
| 738 | 3300025913 | Ga0207695_10361672 | Ga0207695_103616722 | 115 |
| 739 | 3300025914 | Ga0207671_10702584 | Ga0207671_107025841 | 115 |
| 740 | 3300025915 | Ga0207693_10053468 | Ga0207693_100534682 | 115 |
| 741 | 3300025915 | Ga0207693_10242740 | Ga0207693_102427402 | 115 |
| 742 | 3300025916 | Ga0207663_10056960 | Ga0207663_100569603 | 115 |
| 743 | 3300025916 | Ga0207663_10109844 | Ga0207663_101098443 | 115 |
| 744 | 3300025917 | Ga0207660_10014892 | Ga0207660_100148924 | 115 |
| 745 | 3300025917 | Ga0207660_10072595 | Ga0207660_100725953 | 115 |
| 746 | 3300025917 | Ga0207660_10154346 | Ga0207660_101543462 | 115 |
| 747 | 3300025917 | Ga0207660_10349925 | Ga0207660_103499252 | 115 |
| 748 | 3300025918 | Ga0207662_10002710 | Ga0207662_100027107 | 115 |
| 749 | 3300025918 | Ga0207662_10045130 | Ga0207662_100451303 | 115 |
| 750 | 3300025919 | Ga0207657_10005692 | Ga0207657_100056923 | 115 |
| 751 | 3300025919 | Ga0207657_10218444 | Ga0207657_102184441 | 115 |
| 752 | 3300025919 | Ga0207657_10346682 | Ga0207657_103466823 | 115 |
| 753 | 3300025919 | Ga0207657_10784052 | Ga0207657_107840522 | 115 |
| 754 | 3300025920 | Ga0207649_10004225 | Ga0207649_100042252 | 115 |
| 755 | 3300025920 | Ga0207649_10414858 | Ga0207649_104148582 | 115 |
| 756 | 3300025921 | Ga0207652_10018458 | Ga0207652_100184583 | 115 |
| 757 | 3300025921 | Ga0207652_10169410 | Ga0207652_101694102 | 115 |
| 758 | 3300025921 | Ga0207652_10180024 | Ga0207652_101800242 | 115 |
| 759 | 3300025921 | Ga0207652_10187627 | Ga0207652_101876272 | 115 |
| 760 | 3300025921 | Ga0207652_10238457 | Ga0207652_102384572 | 115 |
| 761 | 3300025923 | Ga0207681_10004280 | Ga0207681_100042806 | 115 |
| 762 | 3300025923 | Ga0207681_10048111 | Ga0207681_100481113 | 115 |
| 763 | 3300025924 | Ga0207694_10170903 | Ga0207694_101709032 | 115 |
| 764 | 3300025925 | Ga0207650_10003662 | Ga0207650_100036627 | 115 |
| 765 | 3300025925 | Ga0207650_10107215 | Ga0207650_101072152 | 115 |
| 766 | 3300025926 | Ga0207659_10002130 | Ga0207659_1000213010 | 115 |
| 767 | 3300025926 | Ga0207659_10266340 | Ga0207659_102663402 | 115 |
| 768 | 3300025926 | Ga0207659_11261056 | Ga0207659_112610561 | 115 |
| 769 | 3300025927 | Ga0207687_10010078 | Ga0207687_100100783 | 115 |
| 770 | 3300025927 | Ga0207687_10051449 | Ga0207687_100514493 | 115 |
| 771 | 3300025928 | Ga0207700_10051330 | Ga0207700_100513303 | 115 |
| 772 | 3300025928 | Ga0207700_10107794 | Ga0207700_101077942 | 115 |
| 773 | 3300025929 | Ga0207664_10014304 | Ga0207664_100143043 | 115 |
| 774 | 3300025931 | Ga0207644_10006560 | Ga0207644_100065605 | 115 |
| 775 | 3300025931 | Ga0207644_10417776 | Ga0207644_104177763 | 115 |
| 776 | 3300025932 | Ga0207690_10003881 | Ga0207690_100038818 | 115 |
| 777 | 3300025932 | Ga0207690_10077141 | Ga0207690_100771413 | 115 |
| 778 | 3300025932 | Ga0207690_10082766 | Ga0207690_100827663 | 115 |
| 779 | 3300025933 | Ga0207706_10004561 | Ga0207706_1000456116 | 115 |
| 780 | 3300025933 | Ga0207706_10057842 | Ga0207706_100578423 | 115 |
| 781 | 3300025933 | Ga0207706_10118814 | Ga0207706_101188143 | 115 |
| 782 | 3300025934 | Ga0207686_10002841 | Ga0207686_100028417 | 115 |
| 783 | 3300025934 | Ga0207686_10032302 | Ga0207686_100323023 | 115 |
| 784 | 3300025934 | Ga0207686_10075927 | Ga0207686_100759273 | 115 |
| 785 | 3300025935 | Ga0207709_10003952 | Ga0207709_100039523 | 115 |
| 786 | 3300025935 | Ga0207709_10476299 | Ga0207709_104762992 | 115 |
| 787 | 3300025936 | Ga0207670_10020819 | Ga0207670_100208195 | 115 |
| 788 | 3300025936 | Ga0207670_10348513 | Ga0207670_103485132 | 115 |
| 789 | 3300025937 | Ga0207669_10000737 | Ga0207669_100007374 | 115 |
| 790 | 3300025937 | Ga0207669_10052926 | Ga0207669_100529263 | 115 |
| 791 | 3300025938 | Ga0207704_10209749 | Ga0207704_102097492 | 115 |
| 792 | 3300025939 | Ga0207665_10381703 | Ga0207665_103817032 | 115 |
| 793 | 3300025939 | Ga0207665_10434307 | Ga0207665_104343072 | 115 |
| 794 | 3300025940 | Ga0207691_10004854 | Ga0207691_1000485416 | 115 |
| 795 | 3300025941 | Ga0207711_10073214 | Ga0207711_100732143 | 115 |
| 796 | 3300025941 | Ga0207711_10127495 | Ga0207711_101274953 | 115 |
| 797 | 3300025941 | Ga0207711_10129249 | Ga0207711_101292492 | 115 |
| 798 | 3300025942 | Ga0207689_10001399 | Ga0207689_1000139924 | 115 |
| 799 | 3300025942 | Ga0207689_10516693 | Ga0207689_105166932 | 115 |
| 800 | 3300025944 | Ga0207661_12143474 | Ga0207661_121434742 | 115 |
| 801 | 3300025945 | Ga0207679_10000829 | Ga0207679_1000082919 | 115 |
| 802 | 3300025945 | Ga0207679_10071037 | Ga0207679_100710372 | 115 |
| 803 | 3300025945 | Ga0207679_10364537 | Ga0207679_103645372 | 115 |
| 804 | 3300025945 | Ga0207679_10440271 | Ga0207679_104402712 | 115 |
| 805 | 3300025945 | Ga0207679_10463020 | Ga0207679_104630203 | 115 |
| 806 | 3300025949 | Ga0207667_10057202 | Ga0207667_100572025 | 115 |
| 807 | 3300025949 | Ga0207667_10934397 | Ga0207667_109343972 | 115 |
| 808 | 3300025960 | Ga0207651_10006082 | Ga0207651_100060822 | 115 |
| 809 | 3300025960 | Ga0207651_10111984 | Ga0207651_101119843 | 115 |
| 810 | 3300025960 | Ga0207651_10147297 | Ga0207651_101472972 | 115 |
| 811 | 3300025961 | Ga0207712_10052478 | Ga0207712_100524782 | 115 |
| 812 | 3300025961 | Ga0207712_10180598 | Ga0207712_101805982 | 115 |
| 813 | 3300025961 | Ga0207712_10576067 | Ga0207712_105760672 | 115 |
| 814 | 3300025972 | Ga0207668_10002780 | Ga0207668_1000278010 | 115 |
| 815 | 3300025972 | Ga0207668_10059050 | Ga0207668_100590503 | 115 |
| 816 | 3300025981 | Ga0207640_10003641 | Ga0207640_100036413 | 115 |
| 817 | 3300025981 | Ga0207640_10855539 | Ga0207640_108555392 | 115 |
| 818 | 3300025986 | Ga0207658_10014267 | Ga0207658_100142673 | 115 |
| 819 | 3300025986 | Ga0207658_10652374 | Ga0207658_106523742 | 115 |
| 820 | 3300025986 | Ga0207658_10889762 | Ga0207658_108897622 | 115 |
| 821 | 3300026023 | Ga0207677_10092877 | Ga0207677_100928772 | 115 |
| 822 | 3300026023 | Ga0207677_10936077 | Ga0207677_109360772 | 115 |
| 823 | 3300026035 | Ga0207703_10005080 | Ga0207703_100050809 | 115 |
| 824 | 3300026041 | Ga0207639_10036135 | Ga0207639_100361354 | 115 |
| 825 | 3300026041 | Ga0207639_10065082 | Ga0207639_100650823 | 115 |
| 826 | 3300026067 | Ga0207678_10001694 | Ga0207678_1000169420 | 115 |
| 827 | 3300026067 | Ga0207678_10109778 | Ga0207678_101097783 | 115 |
| 828 | 3300026067 | Ga0207678_10120447 | Ga0207678_101204473 | 115 |
| 829 | 3300026075 | Ga0207708_10003453 | Ga0207708_100034533 | 115 |
| 830 | 3300026075 | Ga0207708_10022048 | Ga0207708_100220486 | 115 |
| 831 | 3300026078 | Ga0207702_10010469 | Ga0207702_100104696 | 115 |
| 832 | 3300026078 | Ga0207702_10613610 | Ga0207702_106136101 | 115 |
| 833 | 3300026089 | Ga0207648_10002393 | Ga0207648_100023933 | 115 |
| 834 | 3300026089 | Ga0207648_10050827 | Ga0207648_100508274 | 115 |
| 835 | 3300026095 | Ga0207676_10005110 | Ga0207676_100051107 | 115 |
| 836 | 3300026095 | Ga0207676_11007531 | Ga0207676_110075312 | 115 |
| 837 | 3300026116 | Ga0207674_10058986 | Ga0207674_100589863 | 115 |
| 838 | 3300026116 | Ga0207674_10832128 | Ga0207674_108321282 | 115 |
| 839 | 3300026118 | Ga0207675_100001715 | Ga0207675_10000171520 | 115 |
| 840 | 3300026118 | Ga0207675_100057767 | Ga0207675_1000577672 | 115 |
| 841 | 3300026118 | Ga0207675_100236665 | Ga0207675_1002366652 | 115 |
| 842 | 3300026121 | Ga0207683_10001190 | Ga0207683_1000119020 | 115 |
| 843 | 3300026121 | Ga0207683_10013747 | Ga0207683_1001374710 | 115 |
| 844 | 3300027543 | Ga0209999_1036586 | Ga0209999_10365862 | 115 |
| 845 | 3300027552 | Ga0209982_1004172 | Ga0209982_10041723 | 115 |
| 846 | 3300027614 | Ga0209970_1016555 | Ga0209970_10165553 | 115 |
| 847 | 3300027617 | Ga0210002_1000122 | Ga0210002_10001222 | 115 |
| 848 | 3300027665 | Ga0209983_1017838 | Ga0209983_10178382 | 115 |
| 849 | 3300027682 | Ga0209971_1009205 | Ga0209971_10092053 | 115 |
| 850 | 3300027695 | Ga0209966_1000667 | Ga0209966_10006673 | 115 |
| 851 | 3300027717 | Ga0209998_10001805 | Ga0209998_100018056 | 115 |
| 852 | 3300027717 | Ga0209998_10007762 | Ga0209998_100077622 | 115 |
| 853 | 3300027876 | Ga0209974_10000486 | Ga0209974_1000048614 | 115 |
| 854 | 3300027876 | Ga0209974_10036353 | Ga0209974_100363533 | 115 |
| 855 | 3300027907 | Ga0207428_10001434 | Ga0207428_100014348 | 115 |
| 856 | 3300027907 | Ga0207428_10019935 | Ga0207428_100199356 | 115 |
| 857 | 3300028379 | Ga0268266_10016607 | Ga0268266_100166076 | 115 |
| 858 | 3300028379 | Ga0268266_11861489 | Ga0268266_118614892 | 115 |
| 859 | 3300028380 | Ga0268265_10068406 | Ga0268265_100684062 | 115 |
| 860 | 3300028380 | Ga0268265_10430445 | Ga0268265_104304452 | 115 |
| 861 | 3300028381 | Ga0268264_10009868 | Ga0268264_100098682 | 115 |
| 862 | 3300028381 | Ga0268264_10037830 | Ga0268264_100378303 | 115 |
| 863 | 3300028577 | Ga0265318_10187235 | Ga0265318_101872351 | 115 |
| 864 | 3300028800 | Ga0265338_10134384 | Ga0265338_101343842 | 115 |
| 865 | 3300031235 | Ga0265330_10020395 | Ga0265330_100203955 | 115 |
| 866 | 3300031241 | Ga0265325_10000048 | Ga0265325_1000004885 | 115 |
| 867 | 3300031241 | Ga0265325_10025252 | Ga0265325_100252523 | 115 |
| 868 | 3300031241 | Ga0265325_10048132 | Ga0265325_100481323 | 115 |
| 869 | 3300031247 | Ga0265340_10237127 | Ga0265340_102371272 | 115 |
| 870 | 3300031249 | Ga0265339_10150552 | Ga0265339_101505522 | 115 |
| 871 | 3300031250 | Ga0265331_10009513 | Ga0265331_100095138 | 115 |
| 872 | 3300031344 | Ga0265316_10200564 | Ga0265316_102005643 | 115 |
| 873 | 3300031344 | Ga0265316_10258928 | Ga0265316_102589282 | 115 |
| 874 | 3300031595 | Ga0265313_10028748 | Ga0265313_100287482 | 115 |
| 875 | 3300031595 | Ga0265313_10139333 | Ga0265313_101393332 | 115 |
| 876 | 3300031665 | Ga0316575_10024682 | Ga0316575_100246823 | 115 |
| 877 | 3300031711 | Ga0265314_10005957 | Ga0265314_100059575 | 115 |
| 878 | 3300034816 | Ga0373930_0015286 | Ga0373930_0015286_979_1326 | 115 |
| 879 | 3300034816 | Ga0373930_0033680 | Ga0373930_0033680_19_366 | 115 |
| 880 | 3300034816 | Ga0373930_0038718 | Ga0373930_0038718_458_805 | 115 |
| 881 | 3300034817 | Ga0373948_0000410 | Ga0373948_0000410_4259_4606 | 115 |
| 882 | 3300034817 | Ga0373948_0217720 | Ga0373948_0217720_108_455 | 115 |
| 883 | 3300034818 | Ga0373950_0000808 | Ga0373950_0000808_3455_3802 | 115 |
| 884 | 3300034819 | Ga0373958_0001617 | Ga0373958_0001617_2486_2833 | 115 |
| 885 | 3300034819 | Ga0373958_0004911 | Ga0373958_0004911_1112_1459 | 115 |
| 886 | 3300034819 | Ga0373958_0080361 | Ga0373958_0080361_195_542 | 115 |
| 887 | 3300034957 | Ga0373938_0000681 | Ga0373938_0000681_4378_4725 | 115 |
| 888 | 3300035083 | Ga0373926_0065910 | Ga0373926_0065910_357_704 | 115 |
| 889 | 3300035084 | Ga0373928_0004171 | Ga0373928_0004171_1558_1905 | 115 |
| 890 | 3300035084 | Ga0373928_0005886 | Ga0373928_0005886_13_360 | 115 |
| 891 | 3300035085 | Ga0373929_0001045 | Ga0373929_0001045_2893_3240 | 115 |
| 892 | 3300035085 | Ga0373929_0015912 | Ga0373929_0015912_992_1339 | 115 |
| 893 | 3300035086 | Ga0373934_0068557 | Ga0373934_0068557_536_883 | 115 |
| 894 | 3300035086 | Ga0373934_0071466 | Ga0373934_0071466_51_398 | 115 |
| 895 | 3300035086 | Ga0373934_0168069 | Ga0373934_0168069_153_500 | 115 |
| 896 | 3300035088 | Ga0373940_0000034 | Ga0373940_0000034_7436_7783 | 115 |
| 897 | 3300035088 | Ga0373940_0001993 | Ga0373940_0001993_935_1282 | 115 |
| 898 | 3300035089 | Ga0373944_0019469 | Ga0373944_0019469_587_934 | 115 |
| 899 | 3300035090 | Ga0373949_0001494 | Ga0373949_0001494_2127_2474 | 115 |
| 900 | 3300035090 | Ga0373949_0023580 | Ga0373949_0023580_694_1041 | 115 |
| 901 | 3300035090 | Ga0373949_0040187 | Ga0373949_0040187_223_570 | 115 |
| 902 | 3300035090 | Ga0373949_0268000 | Ga0373949_0268000_33_380 | 115 |
| 903 | 3300035091 | Ga0373951_0006726 | Ga0373951_0006726_457_804 | 115 |
| 904 | 3300035091 | Ga0373951_0019160 | Ga0373951_0019160_1139_1486 | 115 |
| 905 | 3300035092 | Ga0373952_0000499 | Ga0373952_0000499_2386_2733 | 115 |
| 906 | 3300035092 | Ga0373952_0026576 | Ga0373952_0026576_82_429 | 115 |
| 907 | 3300035111 | Ga0373923_0035431 | Ga0373923_0035431_1025_1372 | 115 |
| 908 | 3300035111 | Ga0373923_0127098 | Ga0373923_0127098_364_711 | 115 |
| 909 | 3300035111 | Ga0373923_0181010 | Ga0373923_0181010_258_605 | 115 |
| 910 | 3300035112 | Ga0373932_0000153 | Ga0373932_0000153_14686_15033 | 115 |
| 911 | 3300035112 | Ga0373932_0003391 | Ga0373932_0003391_1905_2252 | 115 |
| 912 | 3300035114 | Ga0373939_0000182 | Ga0373939_0000182_14799_15146 | 115 |
| 913 | 3300035114 | Ga0373939_0001329 | Ga0373939_0001329_2802_3149 | 115 |
| 914 | 3300035114 | Ga0373939_0143332 | Ga0373939_0143332_429_776 | 115 |
| 915 | 3300035115 | Ga0373941_0000351 | Ga0373941_0000351_2272_2619 | 115 |
| 916 | 3300035115 | Ga0373941_0064242 | Ga0373941_0064242_727_1074 | 115 |
| 917 | 3300035116 | Ga0373945_0107321 | Ga0373945_0107321_59_406 | 115 |
| 918 | 3300035117 | Ga0373953_0010294 | Ga0373953_0010294_1350_1697 | 115 |
| 919 | 3300035118 | Ga0373954_0027838 | Ga0373954_0027838_290_637 | 115 |
| 920 | 3300035118 | Ga0373954_0253155 | Ga0373954_0253155_114_461 | 115 |
| 921 | 3300035119 | Ga0373956_0007365 | Ga0373956_0007365_2231_2578 | 115 |
| 922 | 3300035119 | Ga0373956_0022400 | Ga0373956_0022400_944_1291 | 115 |
| 923 | 3300035119 | Ga0373956_0123625 | Ga0373956_0123625_249_596 | 115 |
| 924 | 3300035119 | Ga0373956_0156836 | Ga0373956_0156836_252_599 | 115 |
| 925 | 3300035120 | Ga0373957_0031423 | Ga0373957_0031423_336_683 | 115 |
| 926 | 3300035120 | Ga0373957_0054574 | Ga0373957_0054574_454_801 | 115 |
| 927 | 3300035120 | Ga0373957_0147804 | Ga0373957_0147804_378_725 | 115 |
| 928 | 3300035121 | Ga0373960_0000322 | Ga0373960_0000322_6093_6440 | 115 |
| 929 | 3300035121 | Ga0373960_0062962 | Ga0373960_0062962_223_570 | 115 |
| 930 | 3300035170 | Ga0373943_0935381 | Ga0373943_0935381_118_465 | 115 |
| 931 | 3300035171 | Ga0373946_0007767 | Ga0373946_0007767_3362_3709 | 115 |
| 932 | 3300035172 | Ga0373955_0003725 | Ga0373955_0003725_2552_2899 | 115 |
| 933 | 3300035172 | Ga0373955_0009409 | Ga0373955_0009409_1109_1456 | 115 |
| 934 | 3300035172 | Ga0373955_0036131 | Ga0373955_0036131_1149_1496 | 115 |
| 935 | 3300035172 | Ga0373955_0672880 | Ga0373955_0672880_48_395 | 115 |
| 936 | 3300035172 | Ga0373955_0807047 | Ga0373955_0807047_73_420 | 115 |
| 937 | 3300035207 | Ga0373942_0000405 | Ga0373942_0000405_6475_6822 | 115 |
| 938 | 3300035207 | Ga0373942_0015907 | Ga0373942_0015907_826_1173 | 115 |
| 939 | 3300035241 | Ga0373961_0001013 | Ga0373961_0001013_2241_2588 | 115 |
| 940 | 3300035241 | Ga0373961_0048773 | Ga0373961_0048773_67_414 | 115 |
| 941 | 3300035241 | Ga0373961_0304116 | Ga0373961_0304116_222_569 | 115 |
| 942 | 3300035242 | Ga0373962_0001641 | Ga0373962_0001641_674_1021 | 115 |
| 943 | 3300035242 | Ga0373962_0001705 | Ga0373962_0001705_223_570 | 115 |
| 944 | 3300035410 | Ga0373924_0008230 | Ga0373924_0008230_694_1041 | 115 |
| 945 | 3300035410 | Ga0373924_0196540 | Ga0373924_0196540_90_437 | 115 |
| 946 | 3300035691 | Ga0373931_0046111 | Ga0373931_0046111_577_924 | 115 |
| 947 | 3300035691 | Ga0373931_0242259 | Ga0373931_0242259_289_636 | 115 |
| 948 | 3300035691 | Ga0373931_1061369 | Ga0373931_1061369_155_502 | 115 |
| 949 | 3300035692 | Ga0373935_0124050 | Ga0373935_0124050_304_651 | 115 |
| 950 | 3300035695 | Ga0373927_0032885 | Ga0373927_0032885_880_1227 | 115 |
| 951 | 3300035724 | Ga0373933_0004422 | Ga0373933_0004422_4959_5306 | 115 |
| 952 | 3300035724 | Ga0373933_0066670 | Ga0373933_0066670_1399_1746 | 115 |
| 953 | 3300035724 | Ga0373933_0070080 | Ga0373933_0070080_1576_1923 | 115 |
| 954 | 3300035725 | Ga0373947_0677090 | Ga0373947_0677090_13_360 | 115 |
| 955 | 3300036401 | Ga0373937_0014903 | Ga0373937_0014903_2409_2756 | 115 |
| 956 | 3300036401 | Ga0373937_0017492 | Ga0373937_0017492_4581_4928 | 115 |
| 957 | 3300036401 | Ga0373937_0048364 | Ga0373937_0048364_2476_2823 | 115 |
| 958 | 3300036401 | Ga0373937_0150711 | Ga0373937_0150711_1009_1356 | 115 |
| 959 | 3300036647 | Ga0316582_0316671 | Ga0316582_0316671_168_515 | 115 |
| 960 | 3300037068 | Ga0373925_0134404 | Ga0373925_0134404_1342_1689 | 115 |
| 961 | 3300037068 | Ga0373925_1225309 | Ga0373925_1225309_121_468 | 115 |
| 962 | 3300041408 | Ga0439453_0111251 | Ga0439453_0111251_66_413 | 115 |
| 963 | 3300042439 | Ga0439464_0032655 | Ga0439464_0032655_109_456 | 115 |
| 964 | 3300042876 | Ga0451577_0158113 | Ga0451577_0158113_276_623 | 115 |
| 965 | 3300042993 | Ga0439440_0021628 | Ga0439440_0021628_954_1301 | 115 |
| 966 | 3300044712 | Ga0453684_0605479 | Ga0453684_0605479_488_835 | 115 |
| 967 | 3300045051 | Ga0451576_0173408 | Ga0451576_0173408_801_1148 | 115 |
| 968 | 3300046454 | Ga0495592_0001176 | Ga0495592_0001176_1951_2298 | 115 |
| 969 | 3300046454 | Ga0495592_0136082 | Ga0495592_0136082_1077_1424 | 115 |
| 970 | 3300046455 | Ga0495603_0233395 | Ga0495603_0233395_272_619 | 115 |
| 971 | 3300046459 | Ga0495629_0038860 | Ga0495629_0038860_1078_1425 | 115 |
| 972 | 3300046460 | Ga0495638_0155149 | Ga0495638_0155149_273_620 | 115 |
| 973 | 3300046461 | Ga0495641_0238020 | Ga0495641_0238020_195_542 | 115 |
| 974 | 3300046462 | Ga0495651_0000921 | Ga0495651_0000921_2172_2519 | 115 |
| 975 | 3300046462 | Ga0495651_0112899 | Ga0495651_0112899_77_424 | 115 |
| 976 | 3300046463 | Ga0495653_0001436 | Ga0495653_0001436_8791_9138 | 115 |
| 977 | 3300046463 | Ga0495653_0114518 | Ga0495653_0114518_461_808 | 115 |
| 978 | 3300046463 | Ga0495653_0251071 | Ga0495653_0251071_545_892 | 115 |
| 979 | 3300046472 | Ga0495580_0377888 | Ga0495580_0377888_211_558 | 115 |
| 980 | 3300046473 | Ga0495582_0077819 | Ga0495582_0077819_625_972 | 115 |
| 981 | 3300046475 | Ga0495639_0168167 | Ga0495639_0168167_595_942 | 115 |
| 982 | 3300046475 | Ga0495639_0258397 | Ga0495639_0258397_228_575 | 115 |
| 983 | 3300046476 | Ga0495662_0070535 | Ga0495662_0070535_736_1083 | 115 |
| 984 | 3300046477 | Ga0495664_0027048 | Ga0495664_0027048_1741_2088 | 115 |
| 985 | 3300046477 | Ga0495664_0070680 | Ga0495664_0070680_1664_2011 | 115 |
| 986 | 3300046499 | Ga0495594_0169787 | Ga0495594_0169787_874_1221 | 115 |
| 987 | 3300046511 | Ga0495608_0001582 | Ga0495608_0001582_8472_8819 | 115 |
| 988 | 3300046511 | Ga0495608_0113647 | Ga0495608_0113647_236_583 | 115 |
| 989 | 3300046514 | Ga0495618_0033958 | Ga0495618_0033958_1487_1834 | 115 |
| 990 | 3300046516 | Ga0495628_0012601 | Ga0495628_0012601_3481_3828 | 115 |
| 991 | 3300046516 | Ga0495628_0201686 | Ga0495628_0201686_75_422 | 115 |
| 992 | 3300046517 | Ga0495630_0178246 | Ga0495630_0178246_911_1258 | 115 |
| 993 | 3300046517 | Ga0495630_0821357 | Ga0495630_0821357_130_477 | 115 |
| 994 | 3300046523 | Ga0495644_0197672 | Ga0495644_0197672_28_375 | 115 |
| 995 | 3300046526 | Ga0495666_0216948 | Ga0495666_0216948_36_383 | 115 |
| 996 | 3300046529 | Ga0495652_0117918 | Ga0495652_0117918_1214_1561 | 115 |
| 997 | 3300046529 | Ga0495652_0252975 | Ga0495652_0252975_55_402 | 115 |
| 998 | 3300046531 | Ga0495665_0035534 | Ga0495665_0035534_1141_1488 | 115 |
| 999 | 3300046531 | Ga0495665_0397386 | Ga0495665_0397386_222_569 | 115 |
| 1000 | 3300046533 | Ga0495640_0047836 | Ga0495640_0047836_902_1249 | 115 |
| 1001 | 3300046533 | Ga0495640_0387326 | Ga0495640_0387326_387_734 | 115 |
| 1002 | 3300046535 | Ga0495586_0012264 | Ga0495586_0012264_1494_1841 | 115 |
| 1003 | 3300046536 | Ga0495587_0008788 | Ga0495587_0008788_4524_4871 | 115 |
| 1004 | 3300046536 | Ga0495587_0067974 | Ga0495587_0067974_247_594 | 115 |
| 1005 | 3300046536 | Ga0495587_0184009 | Ga0495587_0184009_52_399 | 115 |
| 1006 | 3300046536 | Ga0495587_0236508 | Ga0495587_0236508_72_419 | 115 |
| 1007 | 3300046543 | Ga0495645_0062076 | Ga0495645_0062076_947_1294 | 115 |
| 1008 | 3300046543 | Ga0495645_0103777 | Ga0495645_0103777_724_1071 | 115 |
| 1009 | 3300046543 | Ga0495645_0700649 | Ga0495645_0700649_50_397 | 115 |
| 1010 | 3300046559 | Ga0495667_0076608 | Ga0495667_0076608_510_857 | 115 |
| 1011 | 3300046559 | Ga0495667_0081908 | Ga0495667_0081908_1208_1555 | 115 |
| 1012 | 3300046559 | Ga0495667_0117346 | Ga0495667_0117346_1072_1419 | 115 |
| 1013 | 3300046642 | Ga0495634_0055078 | Ga0495634_0055078_838_1185 | 115 |
| 1014 | 3300046663 | Ga0495635_0007233 | Ga0495635_0007233_3050_3397 | 115 |
| 1015 | 3300046663 | Ga0495635_0062421 | Ga0495635_0062421_985_1332 | 115 |
| 1016 | 3300046663 | Ga0495635_0104544 | Ga0495635_0104544_416_763 | 115 |
| 1017 | 3300046663 | Ga0495635_0132807 | Ga0495635_0132807_231_578 | 115 |
| 1018 | 3300046663 | Ga0495635_0156761 | Ga0495635_0156761_443_790 | 115 |
| 1019 | 3300046674 | Ga0495588_0683567 | Ga0495588_0683567_145_492 | 115 |
| 1020 | 3300046675 | Ga0495657_0005844 | Ga0495657_0005844_2936_3283 | 115 |
| 1021 | 3300046675 | Ga0495657_0191333 | Ga0495657_0191333_36_383 | 115 |
| 1022 | 3300046678 | Ga0495599_0006246 | Ga0495599_0006246_999_1346 | 115 |
| 1023 | 3300046678 | Ga0495599_0020143 | Ga0495599_0020143_2146_2493 | 115 |
| 1024 | 3300046679 | Ga0495623_0005873 | Ga0495623_0005873_6025_6372 | 115 |
| 1025 | 3300046679 | Ga0495623_0050706 | Ga0495623_0050706_423_770 | 115 |
| 1026 | 3300046680 | Ga0495646_0171435 | Ga0495646_0171435_324_671 | 115 |
| 1027 | 3300046681 | Ga0495647_0187987 | Ga0495647_0187987_426_773 | 115 |
| 1028 | 3300046683 | Ga0495658_0086285 | Ga0495658_0086285_490_837 | 115 |
| 1029 | 3300046689 | Ga0495613_0856238 | Ga0495613_0856238_126_473 | 115 |
| 1030 | 3300046690 | Ga0495624_0470836 | Ga0495624_0470836_197_544 | 115 |
| 1031 | 3300046809 | Ga0495600_0071447 | Ga0495600_0071447_1484_1831 | 115 |
| 1032 | 3300046809 | Ga0495600_0108162 | Ga0495600_0108162_1097_1444 | 115 |
| 1033 | 3300046809 | Ga0495600_0202556 | Ga0495600_0202556_188_535 | 115 |
| 1034 | 3300046809 | Ga0495600_0296046 | Ga0495600_0296046_432_779 | 115 |
| 1035 | 3300047315 | Ga0495581_0298574 | Ga0495581_0298574_521_868 | 115 |
| 1036 | 3300047315 | Ga0495581_0331754 | Ga0495581_0331754_504_851 | 115 |
| 1037 | 3300047317 | Ga0495604_0005412 | Ga0495604_0005412_1439_1786 | 115 |
| 1038 | 3300047317 | Ga0495604_0018521 | Ga0495604_0018521_569_916 | 115 |
| 1039 | 3300047317 | Ga0495604_0034540 | Ga0495604_0034540_3541_3888 | 115 |
| 1040 | 3300047317 | Ga0495604_0109429 | Ga0495604_0109429_1422_1769 | 115 |
| 1041 | 3300047319 | Ga0495674_0012552 | Ga0495674_0012552_6685_7032 | 115 |
| 1042 | 3300047319 | Ga0495674_0044171 | Ga0495674_0044171_972_1319 | 115 |
| 1043 | 3300047319 | Ga0495674_0092176 | Ga0495674_0092176_2227_2574 | 115 |
| 1044 | 3300047322 | Ga0495680_0013950 | Ga0495680_0013950_5544_5891 | 115 |
| 1045 | 3300047322 | Ga0495680_0175710 | Ga0495680_0175710_32_379 | 115 |
| 1046 | 3300047322 | Ga0495680_0176720 | Ga0495680_0176720_410_757 | 115 |
| 1047 | 3300047322 | Ga0495680_0711110 | Ga0495680_0711110_177_524 | 115 |
| 1048 | 3300047444 | Ga0495675_0002919 | Ga0495675_0002919_6685_7032 | 115 |
| 1049 | 3300047444 | Ga0495675_0029357 | Ga0495675_0029357_2049_2396 | 115 |
| 1050 | 3300047444 | Ga0495675_0254488 | Ga0495675_0254488_668_1015 | 115 |
| 1051 | 3300047673 | Ga0495593_0083148 | Ga0495593_0083148_475_822 | 115 |
| 1052 | 3300048088 | Ga0495602_0000618 | Ga0495602_0000618_13224_13571 | 115 |
| 1053 | 3300048088 | Ga0495602_0010978 | Ga0495602_0010978_7906_8253 | 115 |
| 1054 | 3300048088 | Ga0495602_0362367 | Ga0495602_0362367_569_916 | 115 |
| 1055 | 3300048089 | Ga0495614_0211586 | Ga0495614_0211586_153_500 | 115 |
| 1056 | 3300048091 | Ga0495626_0406313 | Ga0495626_0406313_62_409 | 115 |
| 1057 | 3300048903 | Ga0496100_0008731 | Ga0496100_0008731_1151_1498 | 115 |
| 1058 | 3300048903 | Ga0496100_0011005 | Ga0496100_0011005_2472_2819 | 115 |
| 1059 | 3300048904 | Ga0496101_0193177 | Ga0496101_0193177_340_687 | 115 |
| 1060 | 3300048904 | Ga0496101_0244250 | Ga0496101_0244250_889_1236 | 115 |
| 1061 | 3300048904 | Ga0496101_0424264 | Ga0496101_0424264_634_981 | 115 |
| 1062 | 3300048904 | Ga0496101_0594558 | Ga0496101_0594558_137_484 | 115 |
| 1063 | 3300048905 | Ga0496102_0009606 | Ga0496102_0009606_4152_4499 | 115 |
| 1064 | 3300048905 | Ga0496102_1519250 | Ga0496102_1519250_126_473 | 115 |
| 1065 | 3300048906 | Ga0496103_0006551 | Ga0496103_0006551_1943_2290 | 115 |
| 1066 | 3300048906 | Ga0496103_0043635 | Ga0496103_0043635_1310_1657 | 115 |
| 1067 | 3300048906 | Ga0496103_0258265 | Ga0496103_0258265_260_607 | 115 |
| 1068 | 3300048907 | Ga0496104_0000196 | Ga0496104_0000196_27286_27633 | 115 |
| 1069 | 3300048907 | Ga0496104_0003411 | Ga0496104_0003411_2782_3129 | 115 |
| 1070 | 3300048907 | Ga0496104_0178276 | Ga0496104_0178276_456_803 | 115 |
| 1071 | 3300048907 | Ga0496104_0584238 | Ga0496104_0584238_602_949 | 115 |
| 1072 | 3300048908 | Ga0496105_0004873 | Ga0496105_0004873_9189_9536 | 115 |
| 1073 | 3300048908 | Ga0496105_0029068 | Ga0496105_0029068_811_1158 | 115 |
| 1074 | 3300048908 | Ga0496105_0654904 | Ga0496105_0654904_381_728 | 115 |
| 1075 | 3300048909 | Ga0496106_0024841 | Ga0496106_0024841_2313_2660 | 115 |
| 1076 | 3300048909 | Ga0496106_0127514 | Ga0496106_0127514_743_1090 | 115 |
| 1077 | 3300048909 | Ga0496106_0143308 | Ga0496106_0143308_1310_1657 | 115 |
| 1078 | 3300048909 | Ga0496106_0308063 | Ga0496106_0308063_833_1180 | 115 |
| 1079 | 3300048910 | Ga0496107_0043706 | Ga0496107_0043706_1034_1381 | 115 |
| 1080 | 3300048910 | Ga0496107_0154684 | Ga0496107_0154684_669_1016 | 115 |
| 1081 | 3300048910 | Ga0496107_0187453 | Ga0496107_0187453_628_975 | 115 |
| 1082 | 3300048911 | Ga0496108_0008566 | Ga0496108_0008566_2419_2766 | 115 |
| 1083 | 3300048911 | Ga0496108_0243278 | Ga0496108_0243278_427_774 | 115 |
| 1084 | 3300048911 | Ga0496108_0383956 | Ga0496108_0383956_70_417 | 115 |
| 1085 | 3300048912 | Ga0496109_0001554 | Ga0496109_0001554_2709_3056 | 115 |
| 1086 | 3300048912 | Ga0496109_0037839 | Ga0496109_0037839_2793_3140 | 115 |
| 1087 | 3300048913 | Ga0496110_0072383 | Ga0496110_0072383_1301_1648 | 115 |
| 1088 | 3300048913 | Ga0496110_0084321 | Ga0496110_0084321_1402_1749 | 115 |
| 1089 | 3300048913 | Ga0496110_0234794 | Ga0496110_0234794_601_948 | 115 |
| 1090 | 3300048913 | Ga0496110_0325880 | Ga0496110_0325880_976_1323 | 115 |
| 1091 | 3300048914 | Ga0496111_0035114 | Ga0496111_0035114_2151_2498 | 115 |
| 1092 | 3300048914 | Ga0496111_0199812 | Ga0496111_0199812_288_635 | 115 |
| 1093 | 3300048914 | Ga0496111_0236609 | Ga0496111_0236609_71_418 | 115 |
| 1094 | 3300048915 | Ga0496112_0003337 | Ga0496112_0003337_4997_5344 | 115 |
| 1095 | 3300048915 | Ga0496112_0158741 | Ga0496112_0158741_1171_1518 | 115 |
| 1096 | 3300048915 | Ga0496112_1430576 | Ga0496112_1430576_243_590 | 115 |
| 1097 | 3300048916 | Ga0496113_0007502 | Ga0496113_0007502_876_1223 | 115 |
| 1098 | 3300048916 | Ga0496113_0015368 | Ga0496113_0015368_825_1172 | 115 |
| 1099 | 3300048916 | Ga0496113_0236829 | Ga0496113_0236829_231_578 | 115 |
| 1100 | 3300048916 | Ga0496113_0572547 | Ga0496113_0572547_295_642 | 115 |
| 1101 | 3300048917 | Ga0496114_0001741 | Ga0496114_0001741_1869_2216 | 115 |
| 1102 | 3300048917 | Ga0496114_0012467 | Ga0496114_0012467_3569_3916 | 115 |
| 1103 | 3300048917 | Ga0496114_1480879 | Ga0496114_1480879_107_454 | 115 |
| 1104 | 3300048918 | Ga0496115_0032793 | Ga0496115_0032793_3487_3834 | 115 |
| 1105 | 3300048918 | Ga0496115_0034934 | Ga0496115_0034934_1183_1530 | 115 |
| 1106 | 3300048918 | Ga0496115_0265424 | Ga0496115_0265424_659_1006 | 115 |
| 1107 | 3300048918 | Ga0496115_0280790 | Ga0496115_0280790_613_960 | 115 |
| 1108 | 3300049569 | Ga0501032_0079968 | Ga0501032_0079968_98_445 | 115 |
| 1109 | 3300049570 | Ga0501033_0025887 | Ga0501033_0025887_2221_2568 | 115 |
| 1110 | 3300049570 | Ga0501033_0307675 | Ga0501033_0307675_232_579 | 115 |
| 1111 | 3300049571 | Ga0501034_0101694 | Ga0501034_0101694_1850_2197 | 115 |
| 1112 | 3300049571 | Ga0501034_0210555 | Ga0501034_0210555_728_1075 | 115 |
| 1113 | 3300049571 | Ga0501034_1379156 | Ga0501034_1379156_106_453 | 115 |
| 1114 | 3300049572 | Ga0501036_0002829 | Ga0501036_0002829_1731_2078 | 115 |
| 1115 | 3300049572 | Ga0501036_0235077 | Ga0501036_0235077_78_425 | 115 |
| 1116 | 3300049573 | Ga0501037_0032091 | Ga0501037_0032091_2595_2942 | 115 |
| 1117 | 3300049574 | Ga0501038_0028917 | Ga0501038_0028917_3244_3591 | 115 |
| 1118 | 3300049574 | Ga0501038_0157122 | Ga0501038_0157122_1349_1696 | 115 |
| 1119 | 3300049575 | Ga0501039_0048297 | Ga0501039_0048297_721_1068 | 115 |
| 1120 | 3300049578 | Ga0501042_0266195 | Ga0501042_0266195_713_1060 | 115 |
| 1121 | 3300049579 | Ga0501043_0059802 | Ga0501043_0059802_462_809 | 115 |
| 1122 | 3300049579 | Ga0501043_0080522 | Ga0501043_0080522_2059_2406 | 115 |
| 1123 | 3300049579 | Ga0501043_0094350 | Ga0501043_0094350_236_583 | 115 |
| 1124 | 3300049580 | Ga0501046_0022166 | Ga0501046_0022166_4592_4939 | 115 |
| 1125 | 3300049581 | Ga0501047_0900222 | Ga0501047_0900222_250_597 | 115 |
| 1126 | 3300049582 | Ga0501048_0009262 | Ga0501048_0009262_4994_5341 | 115 |
| 1127 | 3300049582 | Ga0501048_0663350 | Ga0501048_0663350_352_699 | 115 |
| 1128 | 3300049583 | Ga0501067_0009519 | Ga0501067_0009519_4485_4832 | 115 |
| 1129 | 3300049584 | Ga0501068_0283780 | Ga0501068_0283780_697_1044 | 115 |
| 1130 | 3300049585 | Ga0501069_0001900 | Ga0501069_0001900_5164_5511 | 115 |
| 1131 | 3300049586 | Ga0501070_0016439 | Ga0501070_0016439_3245_3592 | 115 |
| 1132 | 3300049586 | Ga0501070_0207323 | Ga0501070_0207323_289_636 | 115 |
| 1133 | 3300049587 | Ga0501071_0020855 | Ga0501071_0020855_2192_2539 | 115 |
| 1134 | 3300049587 | Ga0501071_0280001 | Ga0501071_0280001_94_441 | 115 |
| 1135 | 3300049590 | Ga0501074_0023154 | Ga0501074_0023154_2058_2405 | 115 |
| 1136 | 3300049592 | Ga0501076_0020689 | Ga0501076_0020689_886_1233 | 115 |
| 1137 | 3300049592 | Ga0501076_0106186 | Ga0501076_0106186_1555_1902 | 115 |
| 1138 | 3300049593 | Ga0501077_0260823 | Ga0501077_0260823_264_611 | 115 |
| 1139 | 3300049741 | Ga0501079_0098737 | Ga0501079_0098737_152_499 | 115 |
| 1140 | 3300049742 | Ga0501080_0078531 | Ga0501080_0078531_207_554 | 115 |
| 1141 | 3300049743 | Ga0501081_0576892 | Ga0501081_0576892_476_823 | 115 |
| 1142 | 3300049744 | Ga0501083_0001750 | Ga0501083_0001750_2852_3199 | 115 |
| 1143 | 3300049744 | Ga0501083_0146385 | Ga0501083_0146385_376_723 | 115 |
| 1144 | 3300049744 | Ga0501083_0423787 | Ga0501083_0423787_17_367 | 115 |
| 1145 | 3300049744 | Ga0501083_0611721 | Ga0501083_0611721_212_559 | 115 |
| 1146 | 3300049822 | Ga0501035_0046577 | Ga0501035_0046577_799_1146 | 115 |
| 1147 | 3300049822 | Ga0501035_0398300 | Ga0501035_0398300_353_700 | 115 |
| 1148 | 3300049822 | Ga0501035_0526792 | Ga0501035_0526792_82_429 | 115 |
| 1149 | 3300049823 | Ga0501044_0000822 | Ga0501044_0000822_237_584 | 115 |
| 1150 | 3300049823 | Ga0501044_0190872 | Ga0501044_0190872_1594_1941 | 115 |
| 1151 | 3300049823 | Ga0501044_0873711 | Ga0501044_0873711_380_727 | 115 |
| 1152 | 3300050490 | nmdc:mga03n38_493697_c1 | nmdc:mga03n38_493697_c1_105_452 | 115 |
| 1153 | 3300050494 | nmdc:mga06z11_20872_c1 | nmdc:mga06z11_20872_c1_99_446 | 115 |
| 1154 | 3300050494 | nmdc:mga06z11_832525_c1 | nmdc:mga06z11_832525_c1_37_384 | 115 |
| 1155 | 3300050511 | nmdc:mga08y16_1034470_c1 | nmdc:mga08y16_1034470_c1_71_418 | 115 |
| 1156 | 3300050511 | nmdc:mga08y16_2031_c1 | nmdc:mga08y16_2031_c1_20098_20445 | 115 |
| 1157 | 3300050512 | nmdc:mga0n895_51388_c1 | nmdc:mga0n895_51388_c1_1142_1489 | 115 |
| 1158 | 3300050513 | nmdc:mga0rr50_164488_c1 | nmdc:mga0rr50_164488_c1_734_1081 | 115 |
| 1159 | 3300050513 | nmdc:mga0rr50_321712_c1 | nmdc:mga0rr50_321712_c1_315_662 | 115 |
| 1160 | 3300050514 | nmdc:mga08x19_915456_c1 | nmdc:mga08x19_915456_c1_133_480 | 115 |
| 1161 | 3300050515 | nmdc:mga0a205_185748_c1 | nmdc:mga0a205_185748_c1_679_1026 | 115 |
| 1162 | 3300050515 | nmdc:mga0a205_232147_c1 | nmdc:mga0a205_232147_c1_975_1322 | 115 |
| 1163 | 3300053077 | Ga0495601_0000456 | Ga0495601_0000456_15433_15780 | 115 |
| 1164 | 3300053077 | Ga0495601_0000507 | Ga0495601_0000507_15057_15404 | 115 |
| 1165 | 3300053077 | Ga0495601_0009329 | Ga0495601_0009329_4403_4750 | 115 |
| 1166 | 3300053077 | Ga0495601_0012444 | Ga0495601_0012444_3924_4271 | 115 |
| 1167 | 3300053077 | Ga0495601_0101803 | Ga0495601_0101803_290_637 | 115 |
| 1168 | 3300053078 | Ga0495612_0005524 | Ga0495612_0005524_724_1071 | 115 |
| 1169 | 3300053078 | Ga0495612_0007164 | Ga0495612_0007164_1077_1424 | 115 |
| 1170 | 3300053078 | Ga0495612_0107037 | Ga0495612_0107037_616_963 | 115 |
| 1171 | 3300053084 | Ga0495595_0000513 | Ga0495595_0000513_11634_11981 | 115 |
| 1172 | 3300053084 | Ga0495595_0001524 | Ga0495595_0001524_1957_2304 | 115 |
| 1173 | 3300053085 | Ga0495619_0000043 | Ga0495619_0000043_72315_72662 | 115 |
| 1174 | 3300053085 | Ga0495619_0000551 | Ga0495619_0000551_4584_4931 | 115 |
| 1175 | 3300053085 | Ga0495619_0002087 | Ga0495619_0002087_9325_9672 | 115 |
| 1176 | 3300053085 | Ga0495619_0032006 | Ga0495619_0032006_2155_2502 | 115 |
| 1177 | 3300053085 | Ga0495619_0109308 | Ga0495619_0109308_408_755 | 115 |
| 1178 | 3300053085 | Ga0495619_0241111 | Ga0495619_0241111_144_491 | 115 |
| 1179 | 3300053087 | Ga0500643_002121 | Ga0500643_002121_7517_7864 | 115 |
| 1180 | 3300053093 | Ga0500651_0041727 | Ga0500651_0041727_966_1313 | 115 |
| 1181 | 3300053093 | Ga0500651_0113892 | Ga0500651_0113892_339_686 | 115 |
| 1182 | 3300053093 | Ga0500651_0667351 | Ga0500651_0667351_65_412 | 115 |
| 1183 | 3300053094 | Ga0500566_0086671 | Ga0500566_0086671_165_512 | 115 |
| 1184 | 3300053098 | Ga0500650_0140675 | Ga0500650_0140675_666_1013 | 115 |
| 1185 | 3300053118 | Ga0500594_0062053 | Ga0500594_0062053_321_668 | 115 |
| 1186 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_367371_367718 | 115 |
| 1187 | 3300053126 | Ga0500621_211535 | Ga0500621_211535_126_473 | 115 |
| 1188 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_444089_444436 | 115 |
| 1189 | 3300053153 | Ga0500616_0117024 | Ga0500616_0117024_886_1233 | 115 |
| 1190 | 3300053730 | Ga0500645_000568 | Ga0500645_000568_9091_9438 | 115 |
| 1191 | 3300053730 | Ga0500645_017683 | Ga0500645_017683_1816_2163 | 115 |
| 1192 | 3300054114 | Ga0501084_0486821 | Ga0501084_0486821_77_424 | 115 |
| 1193 | 3300060353 | Ga0501082_0052191 | Ga0501082_0052191_1868_2215 | 115 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZBN7_5_59_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.7656 | 79 | 103 | 1.10.10.60 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.4041 | 58 | 113 | 1.10.3470.10 |
| af_A1ZBN7_5_59_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.3819 | 79 | 103 | 1.10.10.60 |
| af_I1MBG1_11_158_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.2592 | 35 | 115 | 1.50.40.10 |
| af_F1QU05_1_268_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2421 | 1 | 112 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6STS4-F1-model_v4 | AzlD domain-containing protein | 0.9525 | 10 | 112 |
GO:0016020
|
| AF-A0A0Q5H729-F1-model_v4 | Branched-chain amino acid transport | 0.9372 | 8 | 112 |
GO:0016020
|
| AF-A0A8B2NN41-F1-model_v4 | Branched-chain amino acid transport | 0.9322 | 2 | 113 |
GO:0016020
|
| AF-A0A8A7D2M3-F1-model_v4 | deleted | 0.9177 | 14 | 112 |
|
| AF-A0A068T988-F1-model_v4 | Branched-chain amino acid transport | 0.9138 | 5 | 112 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar