F491468
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1191 | 836 | 735 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0247511|Ga0496125_0247511_35_1114 |
| Length | 359 |
| Sequence | MRMARPGEGTARNNGRYFAKSQADFDGSKKIDHIGTMGGILHMKRFASTGIAVVLALAFATTAHAEDKKKLAFVVNGASDFWKAAEAGVKAAAAELPKYDLTLKYPEQSAAAIQIRLMDDLVAAGYAGIMVSAVDPKTESDALNRIGKQVALFTTDSDAPKTSRIAYIGSSNTDAGKQAGQLVLKAMPNGGKCMGFVGLLGADNAKERIDGVKETIKGSKVELVDVRGDDIDQTRAKRNVEDTLTAHPEIDCMVGFYSYNTPRIYEALKEAGKLGKIKIIGFDEDPITLGGVKEGTISGTVVQQPYEWGYQGMKDMAKYLEGDKSWVPGNGLLIVPTKIIDTSNVDAFWAELKKRQGKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 2 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 15 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 16 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 17 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 18 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 19 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 20 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 21 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 22 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 23 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 24 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 25 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 26 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 27 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 28 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 29 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 30 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 31 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 32 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 33 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 34 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 35 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 36 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 37 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 38 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 39 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 40 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 41 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 42 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 43 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 44 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 45 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 46 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 47 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 48 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 49 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 50 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 51 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 52 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 53 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 54 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 55 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 56 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 57 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 58 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 59 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 60 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 61 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 62 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 63 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 64 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 65 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 66 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 67 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 68 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 69 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 70 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 71 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 72 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 73 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 74 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 75 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 76 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 77 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 78 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 79 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 80 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 81 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 82 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 83 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 84 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 85 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 86 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 87 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 88 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 89 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 90 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 91 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 92 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 93 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 94 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 95 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 96 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 97 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 98 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 99 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 100 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 101 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 102 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 103 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 104 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 105 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 106 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 107 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 108 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 109 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 110 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 111 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 112 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 113 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 114 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 115 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 116 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 117 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 118 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 119 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 120 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 121 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 122 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 123 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 124 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 125 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 126 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 127 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 128 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 129 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 130 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 131 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 132 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 133 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 134 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 135 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 136 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 137 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 138 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 139 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 140 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 141 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 142 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 143 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 144 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 145 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 146 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 147 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 148 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 149 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 150 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 151 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 152 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 153 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 154 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 155 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 156 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 157 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 158 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 159 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 160 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 161 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 162 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 163 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 164 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 165 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 166 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 167 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 168 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 169 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 170 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 171 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 172 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 173 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 174 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 175 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 176 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 177 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 178 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 179 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 180 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 181 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 182 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 183 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 184 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 185 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 186 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 187 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 188 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 189 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 190 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 191 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 192 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 193 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 194 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 195 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 196 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 197 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 198 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 199 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 200 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 201 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 202 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 203 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 204 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 205 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 206 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 207 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 208 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 209 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 210 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 211 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 212 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 213 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 214 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 215 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 216 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 217 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 218 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 219 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 220 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 221 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 222 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 223 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 224 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 225 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 226 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 227 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 228 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 229 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 230 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 231 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 232 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 233 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 234 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 235 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 236 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 237 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 238 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 239 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 240 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 241 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 242 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 243 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 244 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 245 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 246 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 247 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 248 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 249 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 250 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 251 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 252 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 253 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 254 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 255 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 256 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 257 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 258 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 259 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 260 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 261 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 262 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 263 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 264 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 265 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 266 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 267 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 268 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 269 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 270 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 271 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 272 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 273 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 274 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 275 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 276 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 277 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 278 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 279 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 280 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 281 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 282 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 283 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 284 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 285 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 286 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 287 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 288 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 289 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 290 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 291 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 292 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 293 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 294 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 295 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 296 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 297 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 298 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 299 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 300 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 301 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 302 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 303 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 304 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 305 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 306 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 307 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 308 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 309 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 310 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 311 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 312 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 313 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 314 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 315 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 316 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 317 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 318 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 319 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 320 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 321 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 322 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 323 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 324 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 325 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 326 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 327 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 328 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 329 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 330 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 331 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 332 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 333 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 334 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 335 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 336 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 337 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 338 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 339 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 340 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 341 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 342 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 343 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 344 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 345 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 346 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 347 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 348 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 349 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 350 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 351 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 352 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 353 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 354 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 355 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 356 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 357 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 358 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 359 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 360 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 361 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 362 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 363 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 364 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 365 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 366 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 367 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 368 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 369 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 370 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 371 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 372 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 373 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 374 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 375 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 376 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 377 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 378 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 379 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 380 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 381 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 382 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 383 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 384 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 385 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 386 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 387 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 388 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 389 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 390 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 391 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 392 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 393 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 394 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 395 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 396 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 397 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 398 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 399 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 400 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 401 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 402 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 403 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 404 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 405 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 406 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 407 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 408 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 409 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 410 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 411 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 412 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 413 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 414 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 415 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 416 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 417 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 418 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 419 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 420 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 421 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 422 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 423 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 424 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 425 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 426 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 427 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 428 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 429 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 430 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 431 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 432 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 433 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 434 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 435 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 436 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 437 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 438 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 439 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 440 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 441 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 442 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 443 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 444 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 445 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 446 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 447 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 448 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 449 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 450 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 451 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 452 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 453 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 454 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 456 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 457 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 458 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 459 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 460 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 461 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 462 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 463 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 464 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 465 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 466 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 467 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 468 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 469 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 470 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 471 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 472 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 474 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 475 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 476 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 477 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 478 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 479 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 480 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 481 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 482 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 483 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 484 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 485 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 486 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 487 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 488 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 489 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 490 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 491 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 492 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 493 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 494 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 495 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 496 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 497 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 498 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 499 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 500 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 501 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 502 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 504 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 505 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 506 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 507 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 508 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 510 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 511 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 512 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 514 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 515 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 517 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 518 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 519 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 520 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 521 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 522 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 523 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 525 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 526 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 527 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 528 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 529 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 530 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 531 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 532 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 533 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 534 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 535 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 536 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 537 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 538 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 539 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 542 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 543 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 544 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 545 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 546 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 547 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 548 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 549 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 550 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 551 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 552 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 553 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 554 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 555 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 556 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 558 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 560 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 561 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 562 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 564 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 566 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 613 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 617 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 618 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 619 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 620 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 621 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 622 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 623 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 624 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 625 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 626 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 627 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 628 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 629 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 630 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 631 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 632 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 633 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 634 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 635 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 636 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 637 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 638 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 639 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 640 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 641 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 642 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 643 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 644 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 645 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 646 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 647 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 648 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 649 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 650 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 651 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 652 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 653 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 654 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 655 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 656 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 657 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 658 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 659 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 660 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 661 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 662 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 682 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 683 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 684 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 685 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 686 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 687 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 688 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 689 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 690 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 691 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 692 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 693 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 694 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 695 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 696 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 697 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 698 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 699 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 700 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 701 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 702 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 703 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 704 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 705 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 706 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 707 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 708 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 709 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 712 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 713 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 714 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 715 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 716 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 717 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 718 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 719 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 720 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 721 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 722 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 723 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 724 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 725 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 726 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 727 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 728 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 729 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 730 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 731 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 732 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 733 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 734 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 735 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 736 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 737 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 738 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 739 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 740 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 741 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 742 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 743 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 744 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 745 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 746 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 747 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 749 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 750 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 751 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 752 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 753 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 754 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 755 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 756 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 757 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 758 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 759 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 760 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 761 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 762 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 763 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 764 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 765 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 766 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 767 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 768 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 769 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 770 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 771 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 772 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 773 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 774 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 775 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 776 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 777 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 778 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 779 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 780 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 781 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 782 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 783 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 784 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 785 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 786 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 787 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 788 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 789 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 790 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 791 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 792 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 793 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 794 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 795 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 796 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 797 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 798 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 799 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 800 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 801 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 802 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 803 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 804 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 805 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 806 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 807 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 808 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 809 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 810 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 811 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 812 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 813 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 814 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 815 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 816 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 817 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 818 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 819 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 820 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 821 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 822 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 823 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 824 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 825 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 826 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 827 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 828 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 829 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 830 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 831 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 832 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 833 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 834 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 835 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 836 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.11 |
| Metatranscriptomes | 2.6 |
| Isolates | 38.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.2 |
| Nodule | 31.65 |
| Rhizoplane | 3.27 |
| Rhizosphere | 39.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1005229 | 3300002705 | Bacteria | 3794 |
| 2 | JGI25162J39368_1000720 | 3300002737 | Bacteria | 22796 |
| 3 | JGI25158J39367_1000130 | 3300002739 | Bacteria | 17693 |
| 4 | JGI25157J39369_1000647 | 3300002741 | Bacteria | 19446 |
| 5 | JGI25152J39213_1000768 | 3300002773 | Bacteria | 16180 |
| 6 | JGI25152J39213_1001049 | 3300002773 | Bacteria | 13127 |
| 7 | JGI25159J45721_1003170 | 3300002987 | Bacteria | 5903 |
| 8 | JGI25151J46595_10001716 | 3300003187 | Bacteria | 14302 |
| 9 | JGI25406J46586_10005327 | 3300003203 | Bacteria | 5968 |
| 10 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 11 | JGI25165J46597_1000556 | 3300003214 | Bacteria | 33944 |
| 12 | JGI25153J46596_10000019 | 3300003215 | Bacteria | 260291 |
| 13 | JGI25153J46596_10000532 | 3300003215 | Bacteria | 23955 |
| 14 | JGI25153J46596_10001241 | 3300003215 | Bacteria | 15387 |
| 15 | JGI25153J46596_10002978 | 3300003215 | Bacteria | 9583 |
| 16 | JGI25153J46596_10012294 | 3300003215 | Bacteria | 3707 |
| 17 | Ga0006770J48903_1028616 | 3300003305 | Bacteria | 1181 |
| 18 | rootH1_10147757 | 3300003323 | Bacteria | 1416 |
| 19 | JGI25160J50197_1006047 | 3300003354 | Bacteria | 4950 |
| 20 | JGI25161J50226_1000188 | 3300003374 | Bacteria | 40533 |
| 21 | Ga0055542_1000814 | 3300003762 | Bacteria | 22783 |
| 22 | Ga0055542_1004745 | 3300003762 | Bacteria | 3205 |
| 23 | Ga0055529_1001740 | 3300003763 | Bacteria | 5451 |
| 24 | Ga0055526_1001352 | 3300003771 | Bacteria | 17533 |
| 25 | Ga0055526_1001382 | 3300003771 | Bacteria | 17334 |
| 26 | Ga0055526_1001442 | 3300003771 | Bacteria | 16915 |
| 27 | Ga0055524_1001040 | 3300003775 | Bacteria | 17129 |
| 28 | Ga0055524_1008223 | 3300003775 | Bacteria | 4353 |
| 29 | Ga0055524_1009824 | 3300003775 | Bacteria | 3856 |
| 30 | Ga0055528_1000223 | 3300003790 | Bacteria | 47567 |
| 31 | Ga0055528_1000597 | 3300003790 | Bacteria | 27186 |
| 32 | Ga0055528_1023366 | 3300003790 | Bacteria | 1889 |
| 33 | Ga0055540_1000096 | 3300003792 | Bacteria | 96969 |
| 34 | Ga0055540_1011814 | 3300003792 | Bacteria | 2787 |
| 35 | Ga0055540_1017010 | 3300003792 | Bacteria | 2044 |
| 36 | Ga0055531_10009724 | 3300003794 | Bacteria | 4882 |
| 37 | Ga0055543_1000565 | 3300004625 | Bacteria | 20587 |
| 38 | Ga0055543_1000877 | 3300004625 | Bacteria | 14325 |
| 39 | Ga0065165_1007005 | 3300005262 | Bacteria | 5689 |
| 40 | Ga0065165_1044198 | 3300005262 | Bacteria | 1304 |
| 41 | Ga0065715_10130442 | 3300005293 | Bacteria | 2026 |
| 42 | Ga0065707_10025624 | 3300005295 | Bacteria | 1257 |
| 43 | Ga0065707_10123094 | 3300005295 | Bacteria | 2073 |
| 44 | Ga0070658_10096397 | 3300005327 | Bacteria | 2442 |
| 45 | Ga0070683_100020044 | 3300005329 | Bacteria | 5947 |
| 46 | Ga0070670_100041442 | 3300005331 | Bacteria | 3958 |
| 47 | Ga0068869_100204935 | 3300005334 | Bacteria | 1557 |
| 48 | Ga0070666_10035449 | 3300005335 | Bacteria | 3309 |
| 49 | Ga0070680_100170515 | 3300005336 | Bacteria | 1831 |
| 50 | Ga0068868_100093007 | 3300005338 | Bacteria | 2431 |
| 51 | Ga0070660_100060221 | 3300005339 | Bacteria | 2946 |
| 52 | Ga0070689_100227559 | 3300005340 | Bacteria | 1532 |
| 53 | Ga0070661_100007453 | 3300005344 | Bacteria | 7544 |
| 54 | Ga0070661_100131145 | 3300005344 | Bacteria | 1882 |
| 55 | Ga0070669_100010408 | 3300005353 | Bacteria | 6605 |
| 56 | Ga0070669_100091611 | 3300005353 | Bacteria | 2280 |
| 57 | Ga0070671_100031375 | 3300005355 | Bacteria | 4389 |
| 58 | Ga0070674_100013636 | 3300005356 | Bacteria | 5030 |
| 59 | Ga0070674_100105019 | 3300005356 | Bacteria | 2065 |
| 60 | Ga0070674_100232836 | 3300005356 | Bacteria | 1438 |
| 61 | Ga0070673_100065909 | 3300005364 | Bacteria | 2891 |
| 62 | Ga0070688_100086727 | 3300005365 | Bacteria | 2037 |
| 63 | Ga0070659_100193883 | 3300005366 | Bacteria | 1671 |
| 64 | Ga0070659_100203165 | 3300005366 | Bacteria | 1631 |
| 65 | Ga0070667_100370994 | 3300005367 | Bacteria | 1298 |
| 66 | Ga0070709_10016514 | 3300005434 | Bacteria | 4217 |
| 67 | Ga0070709_10182199 | 3300005434 | Bacteria | 1476 |
| 68 | Ga0070714_100053890 | 3300005435 | Bacteria | 3435 |
| 69 | Ga0070713_100003623 | 3300005436 | Bacteria | 10218 |
| 70 | Ga0070713_100200583 | 3300005436 | Bacteria | 1802 |
| 71 | Ga0070710_10002003 | 3300005437 | Bacteria | 9651 |
| 72 | Ga0070710_10002252 | 3300005437 | Bacteria | 9121 |
| 73 | Ga0070711_100002848 | 3300005439 | Bacteria | 9946 |
| 74 | Ga0070711_100016056 | 3300005439 | Bacteria | 4747 |
| 75 | Ga0070711_100102967 | 3300005439 | Bacteria | 2080 |
| 76 | Ga0070708_100164201 | 3300005445 | Bacteria | 2071 |
| 77 | Ga0070663_100004006 | 3300005455 | Bacteria | 8591 |
| 78 | Ga0070663_100161983 | 3300005455 | Bacteria | 1722 |
| 79 | Ga0070678_100045677 | 3300005456 | Bacteria | 3135 |
| 80 | Ga0070678_100150904 | 3300005456 | Bacteria | 1872 |
| 81 | Ga0070681_10154050 | 3300005458 | Bacteria | 2224 |
| 82 | Ga0068867_100151672 | 3300005459 | Bacteria | 1821 |
| 83 | Ga0070706_100178845 | 3300005467 | Bacteria | 1980 |
| 84 | Ga0070707_100014813 | 3300005468 | Bacteria | 7309 |
| 85 | Ga0070699_100206785 | 3300005518 | Bacteria | 1747 |
| 86 | Ga0070684_100416955 | 3300005535 | Bacteria | 1239 |
| 87 | Ga0070697_100193233 | 3300005536 | Bacteria | 1728 |
| 88 | Ga0068853_100012626 | 3300005539 | Bacteria | 6875 |
| 89 | Ga0068853_100266363 | 3300005539 | Bacteria | 1577 |
| 90 | Ga0070672_100010038 | 3300005543 | Bacteria | 6553 |
| 91 | Ga0070696_100211437 | 3300005546 | Bacteria | 1452 |
| 92 | Ga0070665_100003622 | 3300005548 | Bacteria | 16361 |
| 93 | Ga0070665_100047733 | 3300005548 | Bacteria | 4297 |
| 94 | Ga0068855_100228884 | 3300005563 | Bacteria | 2083 |
| 95 | Ga0070664_100140515 | 3300005564 | Bacteria | 2126 |
| 96 | Ga0068854_100048142 | 3300005578 | Bacteria | 3040 |
| 97 | Ga0068854_100060919 | 3300005578 | Bacteria | 2732 |
| 98 | Ga0068852_100002424 | 3300005616 | Bacteria | 12841 |
| 99 | Ga0068859_100310691 | 3300005617 | Bacteria | 1670 |
| 100 | Ga0068859_100482653 | 3300005617 | Bacteria | 1335 |
| 101 | Ga0068864_100195359 | 3300005618 | Bacteria | 1856 |
| 102 | Ga0068866_10121366 | 3300005718 | Bacteria | 1473 |
| 103 | Ga0068861_100024979 | 3300005719 | Bacteria | 4327 |
| 104 | Ga0068851_10017949 | 3300005834 | Bacteria | 3406 |
| 105 | Ga0068851_10063179 | 3300005834 | Bacteria | 1901 |
| 106 | Ga0068870_10200506 | 3300005840 | Bacteria | 1210 |
| 107 | Ga0068863_100245804 | 3300005841 | Bacteria | 1728 |
| 108 | Ga0068858_100169534 | 3300005842 | Bacteria | 2058 |
| 109 | Ga0068860_100000222 | 3300005843 | Bacteria | 88724 |
| 110 | Ga0068862_100005467 | 3300005844 | Bacteria | 10619 |
| 111 | Ga0068862_100491611 | 3300005844 | Bacteria | 1163 |
| 112 | Ga0081455_10036412 | 3300005937 | Bacteria | 4382 |
| 113 | Ga0081455_10068812 | 3300005937 | Bacteria | 2946 |
| 114 | Ga0081538_10116406 | 3300005981 | Bacteria | 1297 |
| 115 | Ga0081540_1021073 | 3300005983 | Bacteria | 3897 |
| 116 | Ga0081540_1027016 | 3300005983 | Bacteria | 3262 |
| 117 | Ga0081539_10000493 | 3300005985 | Bacteria | 83122 |
| 118 | Ga0081539_10002462 | 3300005985 | Bacteria | 26092 |
| 119 | Ga0081539_10064079 | 3300005985 | Bacteria | 2002 |
| 120 | Ga0075365_10031255 | 3300006038 | Bacteria | 3415 |
| 121 | Ga0075365_10042674 | 3300006038 | Bacteria | 2966 |
| 122 | Ga0075365_10044243 | 3300006038 | Bacteria | 2916 |
| 123 | Ga0075365_10059257 | 3300006038 | Bacteria | 2551 |
| 124 | Ga0075365_10074530 | 3300006038 | Bacteria | 2289 |
| 125 | Ga0075365_10118475 | 3300006038 | Bacteria | 1825 |
| 126 | Ga0075368_10010975 | 3300006042 | Bacteria | 3288 |
| 127 | Ga0075368_10012328 | 3300006042 | Bacteria | 3122 |
| 128 | Ga0075368_10013231 | 3300006042 | Bacteria | 3027 |
| 129 | Ga0075368_10025686 | 3300006042 | Bacteria | 2260 |
| 130 | Ga0075368_10059575 | 3300006042 | Bacteria | 1527 |
| 131 | Ga0075363_100003916 | 3300006048 | Bacteria | 6424 |
| 132 | Ga0075363_100039272 | 3300006048 | Bacteria | 2491 |
| 133 | Ga0075364_10025226 | 3300006051 | Bacteria | 3783 |
| 134 | Ga0075364_10065112 | 3300006051 | Bacteria | 2392 |
| 135 | Ga0075364_10078436 | 3300006051 | Bacteria | 2182 |
| 136 | Ga0070716_100004863 | 3300006173 | Bacteria | 6459 |
| 137 | Ga0070716_100072012 | 3300006173 | Bacteria | 2034 |
| 138 | Ga0070712_100004279 | 3300006175 | Bacteria | 8789 |
| 139 | Ga0075362_10004305 | 3300006177 | Bacteria | 5091 |
| 140 | Ga0075362_10014495 | 3300006177 | Bacteria | 3183 |
| 141 | Ga0075362_10026475 | 3300006177 | Bacteria | 2477 |
| 142 | Ga0075362_10031420 | 3300006177 | Bacteria | 2298 |
| 143 | Ga0075362_10031982 | 3300006177 | Bacteria | 2280 |
| 144 | Ga0075362_10035658 | 3300006177 | Bacteria | 2173 |
| 145 | Ga0075367_10001159 | 3300006178 | Bacteria | 11010 |
| 146 | Ga0075367_10003642 | 3300006178 | Bacteria | 7387 |
| 147 | Ga0075367_10011213 | 3300006178 | Bacteria | 4732 |
| 148 | Ga0075367_10034536 | 3300006178 | Bacteria | 2922 |
| 149 | Ga0075367_10125092 | 3300006178 | Bacteria | 1586 |
| 150 | Ga0075369_10001463 | 3300006186 | Bacteria | 8057 |
| 151 | Ga0075369_10003778 | 3300006186 | Bacteria | 5540 |
| 152 | Ga0075369_10040088 | 3300006186 | Bacteria | 2001 |
| 153 | Ga0075369_10047733 | 3300006186 | Bacteria | 1847 |
| 154 | Ga0075366_10003365 | 3300006195 | Bacteria | 8419 |
| 155 | Ga0075366_10003595 | 3300006195 | Bacteria | 8208 |
| 156 | Ga0075366_10015675 | 3300006195 | Bacteria | 4349 |
| 157 | Ga0075366_10145028 | 3300006195 | Bacteria | 1436 |
| 158 | Ga0097621_100168579 | 3300006237 | Bacteria | 1886 |
| 159 | Ga0075370_10014844 | 3300006353 | Bacteria | 4160 |
| 160 | Ga0075370_10040346 | 3300006353 | Bacteria | 2633 |
| 161 | Ga0075370_10084754 | 3300006353 | Bacteria | 1824 |
| 162 | Ga0075370_10132401 | 3300006353 | Bacteria | 1455 |
| 163 | Ga0075428_100017029 | 3300006844 | Bacteria | 8029 |
| 164 | Ga0075431_100319425 | 3300006847 | Bacteria | 1566 |
| 165 | Ga0075429_100475113 | 3300006880 | Bacteria | 1095 |
| 166 | Ga0068865_100022831 | 3300006881 | Bacteria | 4088 |
| 167 | Ga0097620_100310667 | 3300006931 | Bacteria | 1670 |
| 168 | Ga0097620_100482673 | 3300006931 | Bacteria | 1335 |
| 169 | Ga0099794_10003764 | 3300007265 | Bacteria | 5848 |
| 170 | Ga0099794_10015072 | 3300007265 | Bacteria | 3404 |
| 171 | Ga0099795_10004356 | 3300007788 | Bacteria | 3642 |
| 172 | Ga0099795_10070125 | 3300007788 | Bacteria | 1320 |
| 173 | Ga0105240_10000290 | 3300009093 | Bacteria | 97921 |
| 174 | Ga0105240_10006715 | 3300009093 | Bacteria | 16854 |
| 175 | Ga0105240_10142684 | 3300009093 | Bacteria | 2862 |
| 176 | Ga0105240_10339086 | 3300009093 | Bacteria | 1708 |
| 177 | Ga0111539_10000090 | 3300009094 | Bacteria | 94888 |
| 178 | Ga0105245_10100008 | 3300009098 | Bacteria | 2682 |
| 179 | Ga0105245_10350916 | 3300009098 | Bacteria | 1462 |
| 180 | Ga0105247_10025586 | 3300009101 | Bacteria | 3561 |
| 181 | Ga0114129_10119161 | 3300009147 | Bacteria | 3636 |
| 182 | Ga0114129_10211874 | 3300009147 | Bacteria | 2619 |
| 183 | Ga0114129_10289767 | 3300009147 | Bacteria | 2185 |
| 184 | Ga0105243_10046915 | 3300009148 | Bacteria | 3400 |
| 185 | Ga0105243_10171096 | 3300009148 | Bacteria | 1881 |
| 186 | Ga0105243_10329851 | 3300009148 | Bacteria | 1393 |
| 187 | Ga0105243_10630792 | 3300009148 | Bacteria | 1036 |
| 188 | Ga0105241_10189324 | 3300009174 | Bacteria | 1712 |
| 189 | Ga0105242_10609960 | 3300009176 | Bacteria | 1055 |
| 190 | Ga0105248_10023698 | 3300009177 | Bacteria | 6821 |
| 191 | Ga0105248_10043670 | 3300009177 | Bacteria | 5027 |
| 192 | Ga0105248_10071086 | 3300009177 | Bacteria | 3908 |
| 193 | Ga0105248_10395955 | 3300009177 | Bacteria | 1555 |
| 194 | Ga0105237_10003793 | 3300009545 | Bacteria | 17765 |
| 195 | Ga0105237_10007155 | 3300009545 | Bacteria | 12259 |
| 196 | Ga0105237_10021498 | 3300009545 | Bacteria | 6632 |
| 197 | Ga0105237_10057919 | 3300009545 | Bacteria | 3877 |
| 198 | Ga0105237_10269275 | 3300009545 | Bacteria | 1706 |
| 199 | Ga0105238_10001985 | 3300009551 | Bacteria | 20609 |
| 200 | Ga0105238_10024769 | 3300009551 | Bacteria | 6116 |
| 201 | Ga0105238_10060977 | 3300009551 | Bacteria | 3775 |
| 202 | Ga0105238_10107581 | 3300009551 | Bacteria | 2770 |
| 203 | Ga0123341_1000005 | 3300009765 | Bacteria | 150422 |
| 204 | Ga0105239_10000202 | 3300010375 | Bacteria | 87257 |
| 205 | Ga0105239_10017591 | 3300010375 | Bacteria | 7906 |
| 206 | Ga0105239_10030771 | 3300010375 | Bacteria | 5903 |
| 207 | Ga0105239_10049592 | 3300010375 | Bacteria | 4603 |
| 208 | Ga0105239_10235850 | 3300010375 | Bacteria | 2053 |
| 209 | Ga0105239_10417617 | 3300010375 | Bacteria | 1519 |
| 210 | Ga0105246_10014291 | 3300011119 | Bacteria | 4992 |
| 211 | Ga0157371_10228244 | 3300013102 | Bacteria | 1338 |
| 212 | Ga0157370_10003913 | 3300013104 | Bacteria | 17346 |
| 213 | Ga0157370_10085287 | 3300013104 | Bacteria | 2967 |
| 214 | Ga0157370_10150196 | 3300013104 | Bacteria | 2168 |
| 215 | Ga0157369_10228695 | 3300013105 | Bacteria | 1945 |
| 216 | Ga0157369_10252267 | 3300013105 | Bacteria | 1841 |
| 217 | Ga0157374_10204808 | 3300013296 | Bacteria | 1933 |
| 218 | Ga0157374_10421124 | 3300013296 | Bacteria | 1334 |
| 219 | Ga0157378_10086860 | 3300013297 | Bacteria | 2836 |
| 220 | Ga0157378_10177796 | 3300013297 | Bacteria | 2000 |
| 221 | Ga0157378_10326226 | 3300013297 | Bacteria | 1493 |
| 222 | Ga0163162_10042418 | 3300013306 | Bacteria | 4554 |
| 223 | Ga0163162_10485796 | 3300013306 | Bacteria | 1366 |
| 224 | Ga0157375_10198245 | 3300013308 | Bacteria | 2163 |
| 225 | Ga0163163_10015338 | 3300014325 | Bacteria | 7082 |
| 226 | Ga0163163_10445410 | 3300014325 | Bacteria | 1355 |
| 227 | Ga0157380_10005965 | 3300014326 | Bacteria | 8523 |
| 228 | Ga0182008_10118060 | 3300014497 | Unclassified | 1317 |
| 229 | Ga0157379_10367279 | 3300014968 | Bacteria | 1319 |
| 230 | Ga0157376_10099848 | 3300014969 | Bacteria | 2533 |
| 231 | Ga0182007_10005402 | 3300015262 | Bacteria | 5615 |
| 232 | Ga0182007_10030581 | 3300015262 | Bacteria | 1839 |
| 233 | Ga0182005_1001606 | 3300015265 | Bacteria | 8858 |
| 234 | Ga0182005_1009555 | 3300015265 | Bacteria | 2819 |
| 235 | Ga0184601_102729 | 3300019183 | Bacteria | 1341 |
| 236 | Ga0184603_136826 | 3300019192 | Bacteria | 1332 |
| 237 | Ga0206352_10850575 | 3300020078 | Bacteria | 1103 |
| 238 | Ga0206354_11218913 | 3300020081 | Bacteria | 1131 |
| 239 | Ga0206353_10827906 | 3300020082 | Bacteria | 1686 |
| 240 | Ga0213876_10001735 | 3300021384 | Bacteria | 13237 |
| 241 | Ga0213871_10036607 | 3300021441 | Bacteria | 1302 |
| 242 | Ga0209436_100007 | 3300025208 | Bacteria | 149841 |
| 243 | Ga0209672_104215 | 3300025228 | Bacteria | 2725 |
| 244 | Ga0209437_100104 | 3300025233 | Bacteria | 220736 |
| 245 | Ga0207425_1001067 | 3300025245 | Bacteria | 12520 |
| 246 | Ga0207425_1008858 | 3300025245 | Bacteria | 2541 |
| 247 | Ga0209026_1000151 | 3300025250 | Bacteria | 110338 |
| 248 | Ga0209677_100613 | 3300025253 | Bacteria | 19117 |
| 249 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 250 | Ga0209148_1000319 | 3300025254 | Bacteria | 67129 |
| 251 | Ga0209759_1000350 | 3300025256 | Bacteria | 60056 |
| 252 | Ga0209129_1000615 | 3300025258 | Bacteria | 24007 |
| 253 | Ga0209129_1002198 | 3300025258 | Bacteria | 9804 |
| 254 | Ga0209129_1004197 | 3300025258 | Bacteria | 5786 |
| 255 | Ga0209233_1000150 | 3300025261 | Bacteria | 179401 |
| 256 | Ga0209233_1000279 | 3300025261 | Bacteria | 70977 |
| 257 | Ga0209233_1000334 | 3300025261 | Bacteria | 48025 |
| 258 | Ga0209233_1005165 | 3300025261 | Bacteria | 4361 |
| 259 | Ga0209233_1008548 | 3300025261 | Bacteria | 3161 |
| 260 | Ga0209455_1000085 | 3300025272 | Bacteria | 247601 |
| 261 | Ga0209455_1000782 | 3300025272 | Bacteria | 17766 |
| 262 | Ga0209673_1000162 | 3300025273 | Bacteria | 139078 |
| 263 | Ga0209673_1000452 | 3300025273 | Bacteria | 69726 |
| 264 | Ga0209673_1009347 | 3300025273 | Bacteria | 4259 |
| 265 | Ga0209673_1010927 | 3300025273 | Bacteria | 3786 |
| 266 | Ga0209673_1021868 | 3300025273 | Bacteria | 2223 |
| 267 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 268 | Ga0209130_1010486 | 3300025284 | Bacteria | 2547 |
| 269 | Ga0209025_1003516 | 3300025294 | Bacteria | 14707 |
| 270 | Ga0209025_1040913 | 3300025294 | Bacteria | 1995 |
| 271 | Ga0209564_1000215 | 3300025295 | Bacteria | 132838 |
| 272 | Ga0209564_1001754 | 3300025295 | Bacteria | 20252 |
| 273 | Ga0209564_1001771 | 3300025295 | Bacteria | 20044 |
| 274 | Ga0209564_1001922 | 3300025295 | Bacteria | 18544 |
| 275 | Ga0209564_1013613 | 3300025295 | Bacteria | 3436 |
| 276 | Ga0209564_1023985 | 3300025295 | Bacteria | 2098 |
| 277 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 278 | Ga0209758_1001042 | 3300025297 | Bacteria | 36337 |
| 279 | Ga0209758_1001171 | 3300025297 | Bacteria | 33282 |
| 280 | Ga0209758_1001256 | 3300025297 | Bacteria | 31393 |
| 281 | Ga0209758_1021846 | 3300025297 | Bacteria | 2963 |
| 282 | Ga0209758_1024684 | 3300025297 | Bacteria | 2670 |
| 283 | Ga0209050_1002710 | 3300025298 | Bacteria | 14381 |
| 284 | Ga0209050_1024882 | 3300025298 | Bacteria | 2056 |
| 285 | Ga0209256_1000155 | 3300025299 | Bacteria | 144379 |
| 286 | Ga0209256_1002089 | 3300025299 | Bacteria | 17515 |
| 287 | Ga0209256_1006482 | 3300025299 | Bacteria | 6162 |
| 288 | Ga0209256_1011321 | 3300025299 | Bacteria | 3584 |
| 289 | Ga0209256_1011950 | 3300025299 | Bacteria | 3400 |
| 290 | Ga0209256_1012861 | 3300025299 | Bacteria | 3155 |
| 291 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 292 | Ga0207426_1001182 | 3300025302 | Bacteria | 23333 |
| 293 | Ga0207426_1001839 | 3300025302 | Bacteria | 15628 |
| 294 | Ga0207426_1010086 | 3300025302 | Bacteria | 3691 |
| 295 | Ga0209051_1000027 | 3300025303 | Bacteria | 412172 |
| 296 | Ga0209051_1001530 | 3300025303 | Bacteria | 19255 |
| 297 | Ga0209051_1001728 | 3300025303 | Bacteria | 17443 |
| 298 | Ga0209051_1018027 | 3300025303 | Bacteria | 3139 |
| 299 | Ga0209257_1000688 | 3300025304 | Bacteria | 52564 |
| 300 | Ga0209257_1008589 | 3300025304 | Bacteria | 5749 |
| 301 | Ga0209257_1019503 | 3300025304 | Bacteria | 2550 |
| 302 | Ga0209257_1022512 | 3300025304 | Bacteria | 2246 |
| 303 | Ga0207656_10043269 | 3300025321 | Bacteria | 1920 |
| 304 | Ga0207692_10015312 | 3300025898 | Bacteria | 3371 |
| 305 | Ga0207692_10113444 | 3300025898 | Bacteria | 1506 |
| 306 | Ga0207642_10059885 | 3300025899 | Bacteria | 1763 |
| 307 | Ga0207710_10008547 | 3300025900 | Bacteria | 4316 |
| 308 | Ga0207710_10031014 | 3300025900 | Bacteria | 2335 |
| 309 | Ga0207680_10060191 | 3300025903 | Bacteria | 2310 |
| 310 | Ga0207647_10013298 | 3300025904 | Bacteria | 5711 |
| 311 | Ga0207647_10016597 | 3300025904 | Bacteria | 5022 |
| 312 | Ga0207705_10077465 | 3300025909 | Bacteria | 2419 |
| 313 | Ga0207707_10110064 | 3300025912 | Bacteria | 2407 |
| 314 | Ga0207695_10000240 | 3300025913 | Bacteria | 143196 |
| 315 | Ga0207695_10000385 | 3300025913 | Bacteria | 99958 |
| 316 | Ga0207671_10000330 | 3300025914 | Bacteria | 69591 |
| 317 | Ga0207671_10006330 | 3300025914 | Bacteria | 10568 |
| 318 | Ga0207671_10029225 | 3300025914 | Bacteria | 4117 |
| 319 | Ga0207671_10073351 | 3300025914 | Bacteria | 2556 |
| 320 | Ga0207671_10088965 | 3300025914 | Bacteria | 2324 |
| 321 | Ga0207671_10103227 | 3300025914 | Bacteria | 2162 |
| 322 | Ga0207671_10163717 | 3300025914 | Bacteria | 1723 |
| 323 | Ga0207693_10075397 | 3300025915 | Bacteria | 2641 |
| 324 | Ga0207693_10089265 | 3300025915 | Bacteria | 2416 |
| 325 | Ga0207693_10239912 | 3300025915 | Bacteria | 1423 |
| 326 | Ga0207663_10004509 | 3300025916 | Bacteria | 6932 |
| 327 | Ga0207663_10056556 | 3300025916 | Bacteria | 2467 |
| 328 | Ga0207663_10371263 | 3300025916 | Bacteria | 1088 |
| 329 | Ga0207660_10153172 | 3300025917 | Bacteria | 1773 |
| 330 | Ga0207657_10049709 | 3300025919 | Bacteria | 3651 |
| 331 | Ga0207657_10064375 | 3300025919 | Bacteria | 3129 |
| 332 | Ga0207657_10129494 | 3300025919 | Bacteria | 2070 |
| 333 | Ga0207649_10130300 | 3300025920 | Bacteria | 1707 |
| 334 | Ga0207646_10034839 | 3300025922 | Bacteria | 4551 |
| 335 | Ga0207681_10009281 | 3300025923 | Bacteria | 6008 |
| 336 | Ga0207681_10052346 | 3300025923 | Bacteria | 2768 |
| 337 | Ga0207694_10366286 | 3300025924 | Bacteria | 1195 |
| 338 | Ga0207650_10041328 | 3300025925 | Bacteria | 3378 |
| 339 | Ga0207700_10165257 | 3300025928 | Bacteria | 1841 |
| 340 | Ga0207664_10064463 | 3300025929 | Bacteria | 2930 |
| 341 | Ga0207690_10269122 | 3300025932 | Bacteria | 1323 |
| 342 | Ga0207709_10133835 | 3300025935 | Bacteria | 1693 |
| 343 | Ga0207669_10102384 | 3300025937 | Bacteria | 1897 |
| 344 | Ga0207669_10163669 | 3300025937 | Bacteria | 1575 |
| 345 | Ga0207704_10106103 | 3300025938 | Bacteria | 1886 |
| 346 | Ga0207665_10001825 | 3300025939 | Bacteria | 14343 |
| 347 | Ga0207665_10102598 | 3300025939 | Bacteria | 1999 |
| 348 | Ga0207691_10009789 | 3300025940 | Bacteria | 9202 |
| 349 | Ga0207691_10056550 | 3300025940 | Bacteria | 3573 |
| 350 | Ga0207711_10110547 | 3300025941 | Bacteria | 2444 |
| 351 | Ga0207711_10303238 | 3300025941 | Bacteria | 1473 |
| 352 | Ga0207689_10450365 | 3300025942 | Bacteria | 1076 |
| 353 | Ga0207679_10423269 | 3300025945 | Bacteria | 1176 |
| 354 | Ga0207667_10165181 | 3300025949 | Bacteria | 2276 |
| 355 | Ga0207667_10180081 | 3300025949 | Bacteria | 2170 |
| 356 | Ga0207668_10040495 | 3300025972 | Bacteria | 3144 |
| 357 | Ga0207640_10201813 | 3300025981 | Bacteria | 1508 |
| 358 | Ga0207703_10172066 | 3300026035 | Bacteria | 1906 |
| 359 | Ga0207639_10058895 | 3300026041 | Bacteria | 2956 |
| 360 | Ga0207678_10015900 | 3300026067 | Bacteria | 6611 |
| 361 | Ga0207678_10165220 | 3300026067 | Bacteria | 1890 |
| 362 | Ga0207678_10244711 | 3300026067 | Bacteria | 1536 |
| 363 | Ga0207641_10356092 | 3300026088 | Bacteria | 1396 |
| 364 | Ga0207648_10160608 | 3300026089 | Bacteria | 1985 |
| 365 | Ga0207648_10228259 | 3300026089 | Bacteria | 1656 |
| 366 | Ga0207648_10257773 | 3300026089 | Unclassified | 1556 |
| 367 | Ga0207674_10059422 | 3300026116 | Bacteria | 3869 |
| 368 | Ga0207675_100004709 | 3300026118 | Bacteria | 13132 |
| 369 | Ga0207675_100025107 | 3300026118 | Bacteria | 5547 |
| 370 | Ga0207683_10210635 | 3300026121 | Bacteria | 1769 |
| 371 | Ga0207698_10021751 | 3300026142 | Bacteria | 4442 |
| 372 | Ga0207698_10354842 | 3300026142 | Bacteria | 1386 |
| 373 | Ga0209371_1004496 | 3300027312 | Bacteria | 6024 |
| 374 | Ga0209588_1025509 | 3300027671 | Bacteria | 1871 |
| 375 | Ga0209813_10001150 | 3300027866 | Bacteria | 5900 |
| 376 | Ga0209813_10003148 | 3300027866 | Bacteria | 3839 |
| 377 | Ga0209813_10010745 | 3300027866 | Bacteria | 2376 |
| 378 | Ga0207428_10000055 | 3300027907 | Bacteria | 166460 |
| 379 | Ga0207428_10113973 | 3300027907 | Bacteria | 2078 |
| 380 | Ga0268266_10026011 | 3300028379 | Bacteria | 4978 |
| 381 | Ga0268266_10174378 | 3300028379 | Bacteria | 1954 |
| 382 | Ga0268265_10011716 | 3300028380 | Bacteria | 5929 |
| 383 | Ga0268265_10056785 | 3300028380 | Bacteria | 2980 |
| 384 | Ga0268265_10389859 | 3300028380 | Bacteria | 1284 |
| 385 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 386 | Ga0268264_10403514 | 3300028381 | Bacteria | 1314 |
| 387 | Ga0265334_10029187 | 3300028573 | Bacteria | 2212 |
| 388 | Ga0265318_10010306 | 3300028577 | Bacteria | 4075 |
| 389 | Ga0307517_10124952 | 3300028786 | Bacteria | 1882 |
| 390 | Ga0307515_10000130 | 3300028794 | Bacteria | 179263 |
| 391 | Ga0268256_1003212 | 3300030500 | Bacteria | 7564 |
| 392 | Ga0265762_1011286 | 3300030760 | Bacteria | 1598 |
| 393 | Ga0265766_1001931 | 3300030863 | Bacteria | 1105 |
| 394 | Ga0265340_10000971 | 3300031247 | Bacteria | 16372 |
| 395 | Ga0265340_10018541 | 3300031247 | Bacteria | 3589 |
| 396 | Ga0265340_10069267 | 3300031247 | Bacteria | 1674 |
| 397 | Ga0265339_10010789 | 3300031249 | Bacteria | 5654 |
| 398 | Ga0265316_10007442 | 3300031344 | Bacteria | 10321 |
| 399 | Ga0307513_10099286 | 3300031456 | Bacteria | 2940 |
| 400 | Ga0265313_10000254 | 3300031595 | Bacteria | 58277 |
| 401 | Ga0265313_10004260 | 3300031595 | Bacteria | 11087 |
| 402 | Ga0265313_10039042 | 3300031595 | Bacteria | 2358 |
| 403 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 404 | Ga0265314_10004387 | 3300031711 | Bacteria | 13118 |
| 405 | Ga0265314_10141718 | 3300031711 | Bacteria | 1485 |
| 406 | Ga0265342_10004447 | 3300031712 | Bacteria | 11040 |
| 407 | Ga0307516_10001267 | 3300031730 | Bacteria | 35137 |
| 408 | Ga0307516_10076661 | 3300031730 | Bacteria | 3195 |
| 409 | Ga0307516_10261571 | 3300031730 | Bacteria | 1420 |
| 410 | Ga0307413_10167933 | 3300031824 | Bacteria | 1549 |
| 411 | Ga0307413_10264124 | 3300031824 | Bacteria | 1285 |
| 412 | Ga0307410_10086811 | 3300031852 | Bacteria | 2211 |
| 413 | Ga0307409_100060489 | 3300031995 | Bacteria | 2954 |
| 414 | Ga0307409_100091435 | 3300031995 | Bacteria | 2494 |
| 415 | Ga0316215_1004751 | 3300033544 | Bacteria | 1303 |
| 416 | Ga0373954_0131140 | 3300035118 | Bacteria | 1220 |
| 417 | Ga0373954_0134235 | 3300035118 | Bacteria | 1206 |
| 418 | Ga0373935_0165401 | 3300035692 | Bacteria | 1510 |
| 419 | Ga0373927_0001752 | 3300035695 | Bacteria | 16195 |
| 420 | Ga0373947_0072796 | 3300035725 | Bacteria | 2111 |
| 421 | Ga0373925_0003065 | 3300037068 | Bacteria | 13132 |
| 422 | Ga0373925_0115012 | 3300037068 | Bacteria | 2083 |
| 423 | Ga0373925_0222432 | 3300037068 | Bacteria | 1507 |
| 424 | Ga0373925_0231346 | 3300037068 | Bacteria | 1478 |
| 425 | Ga0395899_0114225 | 3300037312 | Bacteria | 1939 |
| 426 | Ga0395900_0001158 | 3300037418 | Bacteria | 33053 |
| 427 | Ga0395900_0010027 | 3300037418 | Bacteria | 9694 |
| 428 | Ga0395900_0132046 | 3300037418 | Bacteria | 2559 |
| 429 | Ga0395898_0005716 | 3300037466 | Bacteria | 13400 |
| 430 | Ga0395898_0010237 | 3300037466 | Bacteria | 9819 |
| 431 | Ga0395898_0364031 | 3300037466 | Bacteria | 1379 |
| 432 | Ga0395905_0000478 | 3300037471 | Bacteria | 55284 |
| 433 | Ga0395901_0004964 | 3300038443 | Bacteria | 13425 |
| 434 | Ga0395901_0005295 | 3300038443 | Bacteria | 13040 |
| 435 | Ga0395901_0012394 | 3300038443 | Bacteria | 8650 |
| 436 | Ga0395901_0036575 | 3300038443 | Bacteria | 5076 |
| 437 | Ga0395901_0042818 | 3300038443 | Bacteria | 4696 |
| 438 | Ga0436365_0162634 | 3300039437 | Bacteria | 18491 |
| 439 | Ga0436360_0760710 | 3300039438 | Bacteria | 1029 |
| 440 | Ga0436363_1164297 | 3300039450 | Bacteria | 3420 |
| 441 | Ga0451798_1089163 | 3300041458 | Bacteria | 2547 |
| 442 | Ga0451837_1818733 | 3300041494 | Bacteria | 1281 |
| 443 | Ga0451851_0704329 | 3300041507 | Bacteria | 2086 |
| 444 | Ga0451855_1946060 | 3300041511 | Bacteria | 1186 |
| 445 | Ga0451577_0007468 | 3300042876 | Bacteria | 10736 |
| 446 | Ga0466972_0052203 | 3300044658 | Bacteria | 1971 |
| 447 | Ga0466966_0057270 | 3300044684 | Bacteria | 2464 |
| 448 | Ga0453684_0254476 | 3300044712 | Bacteria | 2015 |
| 449 | Ga0466970_0000026 | 3300044765 | Bacteria | 56864 |
| 450 | Ga0466957_0119907 | 3300044842 | Bacteria | 1676 |
| 451 | Ga0466960_0061505 | 3300044901 | Bacteria | 1844 |
| 452 | Ga0466959_0019373 | 3300045049 | Bacteria | 5004 |
| 453 | Ga0466959_0092639 | 3300045049 | Bacteria | 2169 |
| 454 | Ga0466967_0046981 | 3300045976 | Bacteria | 3762 |
| 455 | Ga0466967_0156765 | 3300045976 | Bacteria | 2133 |
| 456 | Ga0495603_0008597 | 3300046455 | Bacteria | 6171 |
| 457 | Ga0495638_0012275 | 3300046460 | Bacteria | 5877 |
| 458 | Ga0495582_0120262 | 3300046473 | Bacteria | 1480 |
| 459 | Ga0495605_0031146 | 3300046474 | Bacteria | 2727 |
| 460 | Ga0495585_0028964 | 3300046492 | Bacteria | 3156 |
| 461 | Ga0495607_0078152 | 3300046501 | Bacteria | 1826 |
| 462 | Ga0495606_0002343 | 3300046507 | Bacteria | 22289 |
| 463 | Ga0495606_0010989 | 3300046507 | Bacteria | 7437 |
| 464 | Ga0495610_0039352 | 3300046512 | Bacteria | 2392 |
| 465 | Ga0495610_0097720 | 3300046512 | Bacteria | 1320 |
| 466 | Ga0495616_0024859 | 3300046513 | Bacteria | 3207 |
| 467 | Ga0495620_0037677 | 3300046515 | Bacteria | 2151 |
| 468 | Ga0495643_0004861 | 3300046522 | Bacteria | 9252 |
| 469 | Ga0495643_0017660 | 3300046522 | Bacteria | 4165 |
| 470 | Ga0495597_0012984 | 3300046542 | Bacteria | 4000 |
| 471 | Ga0495625_0324259 | 3300046660 | Bacteria | 980 |
| 472 | Ga0495649_0208911 | 3300046694 | Bacteria | 1012 |
| 473 | Ga0495660_0084364 | 3300046810 | Bacteria | 1661 |
| 474 | Ga0495660_0117147 | 3300046810 | Bacteria | 1352 |
| 475 | Ga0495674_0035848 | 3300047319 | Bacteria | 4472 |
| 476 | Ga0495683_0071753 | 3300047323 | Bacteria | 1699 |
| 477 | Ga0495687_010319 | 3300047443 | Bacteria | 5129 |
| 478 | Ga0495687_013121 | 3300047443 | Bacteria | 4339 |
| 479 | Ga0495686_0145678 | 3300047472 | Bacteria | 1394 |
| 480 | Ga0496100_0016060 | 3300048903 | Bacteria | 4387 |
| 481 | Ga0496101_0024546 | 3300048904 | Bacteria | 4173 |
| 482 | Ga0496101_0042329 | 3300048904 | Bacteria | 3251 |
| 483 | Ga0496102_0003841 | 3300048905 | Bacteria | 12715 |
| 484 | Ga0496102_0009946 | 3300048905 | Bacteria | 8180 |
| 485 | Ga0496102_0012863 | 3300048905 | Bacteria | 7244 |
| 486 | Ga0496103_0002355 | 3300048906 | Bacteria | 11921 |
| 487 | Ga0496103_0002871 | 3300048906 | Bacteria | 10700 |
| 488 | Ga0496104_0013027 | 3300048907 | Bacteria | 7489 |
| 489 | Ga0496104_0214045 | 3300048907 | Bacteria | 1839 |
| 490 | Ga0496104_0473628 | 3300048907 | Bacteria | 1164 |
| 491 | Ga0496105_0081471 | 3300048908 | Bacteria | 2673 |
| 492 | Ga0496106_0001650 | 3300048909 | Bacteria | 16749 |
| 493 | Ga0496106_0009323 | 3300048909 | Bacteria | 7256 |
| 494 | Ga0496106_0236306 | 3300048909 | Bacteria | 1460 |
| 495 | Ga0496107_0080835 | 3300048910 | Bacteria | 2370 |
| 496 | Ga0496108_0009837 | 3300048911 | Bacteria | 7749 |
| 497 | Ga0496108_0029866 | 3300048911 | Bacteria | 4517 |
| 498 | Ga0496109_0035954 | 3300048912 | Bacteria | 4471 |
| 499 | Ga0496109_0147425 | 3300048912 | Bacteria | 2202 |
| 500 | Ga0496110_0020049 | 3300048913 | Bacteria | 5638 |
| 501 | Ga0496110_0024288 | 3300048913 | Bacteria | 5164 |
| 502 | Ga0496111_0014645 | 3300048914 | Bacteria | 5362 |
| 503 | Ga0496111_0079066 | 3300048914 | Bacteria | 2399 |
| 504 | Ga0496111_0253118 | 3300048914 | Bacteria | 1307 |
| 505 | Ga0496112_0005447 | 3300048915 | Bacteria | 11010 |
| 506 | Ga0496112_0017000 | 3300048915 | Bacteria | 6827 |
| 507 | Ga0496112_0113433 | 3300048915 | Bacteria | 2681 |
| 508 | Ga0496112_0402383 | 3300048915 | Bacteria | 1309 |
| 509 | Ga0496113_0001431 | 3300048916 | Bacteria | 13249 |
| 510 | Ga0496113_0009073 | 3300048916 | Bacteria | 6517 |
| 511 | Ga0496113_0023688 | 3300048916 | Bacteria | 4356 |
| 512 | Ga0496113_0125615 | 3300048916 | Bacteria | 2009 |
| 513 | Ga0496114_0325412 | 3300048917 | Bacteria | 1359 |
| 514 | Ga0496115_0025840 | 3300048918 | Bacteria | 4577 |
| 515 | Ga0496115_0312510 | 3300048918 | Bacteria | 1287 |
| 516 | Ga0496116_0110626 | 3300048919 | Bacteria | 1615 |
| 517 | Ga0496116_0113437 | 3300048919 | Bacteria | 1586 |
| 518 | Ga0496116_0122478 | 3300048919 | Bacteria | 1502 |
| 519 | Ga0496117_0001433 | 3300048920 | Bacteria | 34426 |
| 520 | Ga0496117_0107500 | 3300048920 | Bacteria | 1747 |
| 521 | Ga0496118_0001911 | 3300048921 | Bacteria | 29639 |
| 522 | Ga0496118_0005110 | 3300048921 | Bacteria | 15080 |
| 523 | Ga0496118_0036254 | 3300048921 | Bacteria | 3990 |
| 524 | Ga0496118_0068163 | 3300048921 | Bacteria | 2586 |
| 525 | Ga0496119_0014020 | 3300048922 | Bacteria | 6315 |
| 526 | Ga0496119_0032690 | 3300048922 | Bacteria | 3464 |
| 527 | Ga0496119_0105548 | 3300048922 | Bacteria | 1573 |
| 528 | Ga0496120_0000724 | 3300048923 | Bacteria | 48314 |
| 529 | Ga0496121_0000084 | 3300048924 | Bacteria | 225942 |
| 530 | Ga0496121_0004222 | 3300048924 | Bacteria | 19585 |
| 531 | Ga0496121_0006122 | 3300048924 | Bacteria | 15119 |
| 532 | Ga0496121_0146502 | 3300048924 | Bacteria | 1744 |
| 533 | Ga0496122_0008494 | 3300048925 | Bacteria | 11059 |
| 534 | Ga0496122_0009487 | 3300048925 | Bacteria | 10244 |
| 535 | Ga0496122_0074571 | 3300048925 | Bacteria | 2400 |
| 536 | Ga0496123_0005298 | 3300048926 | Bacteria | 13060 |
| 537 | Ga0496123_0024648 | 3300048926 | Bacteria | 4565 |
| 538 | Ga0496124_0002457 | 3300048927 | Bacteria | 24235 |
| 539 | Ga0496124_0014760 | 3300048927 | Bacteria | 7539 |
| 540 | Ga0496124_0019235 | 3300048927 | Bacteria | 6365 |
| 541 | Ga0496124_0020155 | 3300048927 | Bacteria | 6173 |
| 542 | Ga0496124_0118451 | 3300048927 | Bacteria | 2120 |
| 543 | Ga0496124_0306567 | 3300048927 | Bacteria | 1144 |
| 544 | Ga0496125_0000090 | 3300048928 | Bacteria | 214433 |
| 545 | Ga0496125_0000402 | 3300048928 | Bacteria | 80919 |
| 546 | Ga0496125_0002371 | 3300048928 | Bacteria | 24617 |
| 547 | Ga0496125_0062164 | 3300048928 | Bacteria | 2989 |
| 548 | Ga0496125_0247511 | 3300048928 | Bacteria | 1127 |
| 549 | Ga0496126_0004444 | 3300048929 | Bacteria | 16767 |
| 550 | Ga0496126_0090325 | 3300048929 | Bacteria | 2695 |
| 551 | Ga0496126_0251956 | 3300048929 | Bacteria | 1471 |
| 552 | Ga0501031_0000060 | 3300049568 | Bacteria | 58759 |
| 553 | Ga0501032_0000081 | 3300049569 | Bacteria | 82613 |
| 554 | Ga0501032_0016881 | 3300049569 | Bacteria | 5131 |
| 555 | Ga0501032_0033118 | 3300049569 | Bacteria | 3542 |
| 556 | Ga0501032_0033309 | 3300049569 | Bacteria | 3530 |
| 557 | Ga0501032_0139031 | 3300049569 | Bacteria | 1600 |
| 558 | Ga0501032_0155114 | 3300049569 | Bacteria | 1505 |
| 559 | Ga0501033_0002397 | 3300049570 | Bacteria | 15958 |
| 560 | Ga0501033_0006361 | 3300049570 | Bacteria | 9254 |
| 561 | Ga0501033_0027644 | 3300049570 | Bacteria | 4265 |
| 562 | Ga0501034_0000186 | 3300049571 | Bacteria | 116500 |
| 563 | Ga0501034_0001552 | 3300049571 | Bacteria | 30135 |
| 564 | Ga0501034_0014015 | 3300049571 | Bacteria | 8253 |
| 565 | Ga0501034_0033148 | 3300049571 | Bacteria | 5242 |
| 566 | Ga0501034_0037176 | 3300049571 | Bacteria | 4930 |
| 567 | Ga0501034_0098571 | 3300049571 | Bacteria | 2918 |
| 568 | Ga0501034_0141505 | 3300049571 | Bacteria | 2385 |
| 569 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 570 | Ga0501036_0157879 | 3300049572 | Bacteria | 1913 |
| 571 | Ga0501037_0000095 | 3300049573 | Bacteria | 82641 |
| 572 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 573 | Ga0501038_0001456 | 3300049574 | Bacteria | 21753 |
| 574 | Ga0501038_0019997 | 3300049574 | Bacteria | 6026 |
| 575 | Ga0501038_0055794 | 3300049574 | Bacteria | 3393 |
| 576 | Ga0501038_0118802 | 3300049574 | Bacteria | 2182 |
| 577 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 578 | Ga0501039_0037330 | 3300049575 | Bacteria | 3749 |
| 579 | Ga0501039_0498912 | 3300049575 | Bacteria | 956 |
| 580 | Ga0501043_0010365 | 3300049579 | Bacteria | 7305 |
| 581 | Ga0501043_0117417 | 3300049579 | Bacteria | 2087 |
| 582 | Ga0501043_0140082 | 3300049579 | Bacteria | 1894 |
| 583 | Ga0501043_0155333 | 3300049579 | Bacteria | 1789 |
| 584 | Ga0501046_0036115 | 3300049580 | Bacteria | 3978 |
| 585 | Ga0501047_0011842 | 3300049581 | Bacteria | 8248 |
| 586 | Ga0501047_0012272 | 3300049581 | Bacteria | 8108 |
| 587 | Ga0501047_0016456 | 3300049581 | Bacteria | 7060 |
| 588 | Ga0501047_0064797 | 3300049581 | Bacteria | 3524 |
| 589 | Ga0501047_0065947 | 3300049581 | Bacteria | 3489 |
| 590 | Ga0501047_0230352 | 3300049581 | Bacteria | 1706 |
| 591 | Ga0501047_0272245 | 3300049581 | Bacteria | 1539 |
| 592 | Ga0501048_0015893 | 3300049582 | Bacteria | 5552 |
| 593 | Ga0501067_0068486 | 3300049583 | Bacteria | 1965 |
| 594 | Ga0501067_0165859 | 3300049583 | Bacteria | 1230 |
| 595 | Ga0501068_0012242 | 3300049584 | Bacteria | 4853 |
| 596 | Ga0501068_0041832 | 3300049584 | Bacteria | 2754 |
| 597 | Ga0501068_0063514 | 3300049584 | Bacteria | 2246 |
| 598 | Ga0501070_0013944 | 3300049586 | Bacteria | 6766 |
| 599 | Ga0501070_0017670 | 3300049586 | Bacteria | 5988 |
| 600 | Ga0501070_0018522 | 3300049586 | Bacteria | 5841 |
| 601 | Ga0501070_0023604 | 3300049586 | Bacteria | 5153 |
| 602 | Ga0501070_0033368 | 3300049586 | Bacteria | 4308 |
| 603 | Ga0501070_0061639 | 3300049586 | Bacteria | 3107 |
| 604 | Ga0501070_0124481 | 3300049586 | Bacteria | 2131 |
| 605 | Ga0501071_0067882 | 3300049587 | Bacteria | 2594 |
| 606 | Ga0501071_0071517 | 3300049587 | Bacteria | 2529 |
| 607 | Ga0501072_0059018 | 3300049588 | Bacteria | 3025 |
| 608 | Ga0501072_0163415 | 3300049588 | Bacteria | 1776 |
| 609 | Ga0501073_0034948 | 3300049589 | Bacteria | 3574 |
| 610 | Ga0501073_0049137 | 3300049589 | Bacteria | 2958 |
| 611 | Ga0501073_0073127 | 3300049589 | Bacteria | 2387 |
| 612 | Ga0501073_0131566 | 3300049589 | Bacteria | 1734 |
| 613 | Ga0501074_0002793 | 3300049590 | Bacteria | 12217 |
| 614 | Ga0501074_0146520 | 3300049590 | Bacteria | 1688 |
| 615 | Ga0501075_0026762 | 3300049591 | Bacteria | 4249 |
| 616 | Ga0501080_0052386 | 3300049742 | Bacteria | 3798 |
| 617 | Ga0501080_0088117 | 3300049742 | Bacteria | 2883 |
| 618 | Ga0501080_0108142 | 3300049742 | Bacteria | 2577 |
| 619 | Ga0501080_0134156 | 3300049742 | Bacteria | 2292 |
| 620 | Ga0501081_0164357 | 3300049743 | Bacteria | 1600 |
| 621 | Ga0501081_0355059 | 3300049743 | Bacteria | 1081 |
| 622 | Ga0501081_0461962 | 3300049743 | Bacteria | 944 |
| 623 | Ga0501083_0009431 | 3300049744 | Bacteria | 6896 |
| 624 | Ga0501083_0014473 | 3300049744 | Bacteria | 5516 |
| 625 | Ga0501083_0033110 | 3300049744 | Bacteria | 3540 |
| 626 | Ga0501035_0000022 | 3300049822 | Bacteria | 208622 |
| 627 | Ga0501035_0002943 | 3300049822 | Bacteria | 16388 |
| 628 | Ga0501035_0068774 | 3300049822 | Bacteria | 3139 |
| 629 | Ga0501035_0101480 | 3300049822 | Bacteria | 2525 |
| 630 | Ga0501035_0119146 | 3300049822 | Bacteria | 2309 |
| 631 | Ga0501035_0151609 | 3300049822 | Bacteria | 2011 |
| 632 | Ga0501035_0169006 | 3300049822 | Bacteria | 1890 |
| 633 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 634 | Ga0501044_0025354 | 3300049823 | Bacteria | 6284 |
| 635 | Ga0501044_0064575 | 3300049823 | Bacteria | 3736 |
| 636 | Ga0501044_0097977 | 3300049823 | Bacteria | 2952 |
| 637 | Ga0501044_0101816 | 3300049823 | Bacteria | 2889 |
| 638 | Ga0501044_0175462 | 3300049823 | Bacteria | 2112 |
| 639 | Ga0501044_0244539 | 3300049823 | Bacteria | 1737 |
| 640 | Ga0501044_0253472 | 3300049823 | Bacteria | 1700 |
| 641 | Ga0501045_0027119 | 3300049824 | Bacteria | 4125 |
| 642 | nmdc:mga03683_15897_c1 | 3300050489 | Bacteria | 2818 |
| 643 | nmdc:mga03n38_33657_c1 | 3300050490 | Bacteria | 2182 |
| 644 | nmdc:mga00v17_159718_c1 | 3300050491 | Bacteria | 1450 |
| 645 | nmdc:mga00v17_23610_c1 | 3300050491 | Bacteria | 3558 |
| 646 | nmdc:mga00v17_29553_c1 | 3300050491 | Bacteria | 3217 |
| 647 | nmdc:mga0yw44_20507_c1 | 3300050492 | Bacteria | 3669 |
| 648 | nmdc:mga0yw44_228581_c1 | 3300050492 | Bacteria | 1235 |
| 649 | nmdc:mga0yw44_23076_c1 | 3300050492 | Bacteria | 3501 |
| 650 | nmdc:mga0yw44_233095_c1 | 3300050492 | Bacteria | 1222 |
| 651 | nmdc:mga0yw44_59994_c1 | 3300050492 | Bacteria | 2329 |
| 652 | nmdc:mga0yw44_9280_c1 | 3300050492 | Bacteria | 4960 |
| 653 | nmdc:mga0k408_117412_c1 | 3300050493 | Bacteria | 1574 |
| 654 | nmdc:mga0k408_155967_c1 | 3300050493 | Bacteria | 1360 |
| 655 | nmdc:mga0k408_16319_c1 | 3300050493 | Bacteria | 4120 |
| 656 | nmdc:mga06z11_174272_c1 | 3300050494 | Bacteria | 1237 |
| 657 | nmdc:mga06z11_39270_c1 | 3300050494 | Bacteria | 2355 |
| 658 | nmdc:mga06z11_87494_c1 | 3300050494 | Bacteria | 1685 |
| 659 | nmdc:mga04h51_50121_c1 | 3300050495 | Bacteria | 1398 |
| 660 | nmdc:mga04h51_8376_c1 | 3300050495 | Bacteria | 2766 |
| 661 | nmdc:mga07m45_384_c1 | 3300050496 | Bacteria | 2609 |
| 662 | nmdc:mga07m45_87393_c1 | 3300050496 | Bacteria | 1784 |
| 663 | nmdc:mga05p37_421409_c1 | 3300050507 | Bacteria | 1553 |
| 664 | nmdc:mga05p37_76481_c1 | 3300050507 | Bacteria | 4121 |
| 665 | nmdc:mga05p37_99311_c1 | 3300050507 | Bacteria | 3585 |
| 666 | nmdc:mga09592_40750_c1 | 3300050508 | Bacteria | 3902 |
| 667 | nmdc:mga09592_434725_c1 | 3300050508 | Bacteria | 1133 |
| 668 | nmdc:mga08y16_220760_c1 | 3300050511 | Bacteria | 1962 |
| 669 | nmdc:mga08y16_595_c1 | 3300050511 | Bacteria | 33721 |
| 670 | nmdc:mga0sz30_399_c1 | 3300050516 | Bacteria | 16539 |
| 671 | nmdc:mga0sz30_4720_c1 | 3300050516 | Bacteria | 4949 |
| 672 | nmdc:mga0sz30_52329_c1 | 3300050516 | Bacteria | 1733 |
| 673 | Ga0500635_0016036 | 3300053080 | Bacteria | 2222 |
| 674 | Ga0495595_0038192 | 3300053084 | Bacteria | 2187 |
| 675 | Ga0500578_0033481 | 3300053086 | Bacteria | 3302 |
| 676 | Ga0500643_016011 | 3300053087 | Bacteria | 2556 |
| 677 | Ga0500583_0080745 | 3300053092 | Bacteria | 1571 |
| 678 | Ga0500651_0000471 | 3300053093 | Bacteria | 21218 |
| 679 | Ga0500651_0068130 | 3300053093 | Bacteria | 2216 |
| 680 | Ga0500566_0109799 | 3300053094 | Bacteria | 1501 |
| 681 | Ga0500641_0004986 | 3300053096 | Bacteria | 4708 |
| 682 | Ga0500555_013088 | 3300053103 | Bacteria | 2391 |
| 683 | Ga0500569_052581 | 3300053109 | Bacteria | 1233 |
| 684 | Ga0500595_000277 | 3300053119 | Bacteria | 33985 |
| 685 | Ga0500595_000905 | 3300053119 | Bacteria | 16915 |
| 686 | Ga0500595_012013 | 3300053119 | Bacteria | 3361 |
| 687 | Ga0500618_001303 | 3300053125 | Bacteria | 11433 |
| 688 | Ga0500642_0001772 | 3300053130 | Bacteria | 6224 |
| 689 | Ga0500658_0001900 | 3300053134 | Bacteria | 8191 |
| 690 | Ga0500559_0002749 | 3300053136 | Bacteria | 8925 |
| 691 | Ga0500559_0050552 | 3300053136 | Bacteria | 1834 |
| 692 | Ga0500568_0056575 | 3300053139 | Bacteria | 1528 |
| 693 | Ga0500573_0014843 | 3300053140 | Bacteria | 4411 |
| 694 | Ga0500577_0018251 | 3300053142 | Bacteria | 2252 |
| 695 | Ga0500588_0044329 | 3300053146 | Bacteria | 1356 |
| 696 | Ga0500616_0008785 | 3300053153 | Bacteria | 6222 |
| 697 | Ga0500616_0009068 | 3300053153 | Bacteria | 6088 |
| 698 | Ga0500616_0025202 | 3300053153 | Bacteria | 3300 |
| 699 | Ga0500616_0051254 | 3300053153 | Bacteria | 2175 |
| 700 | Ga0500620_000073 | 3300053155 | Bacteria | 19157 |
| 701 | Ga0500627_0105783 | 3300053158 | Bacteria | 1265 |
| 702 | Ga0500639_053700 | 3300053163 | Bacteria | 2096 |
| 703 | Ga0500636_0020080 | 3300053177 | Bacteria | 3952 |
| 704 | Ga0500636_0037374 | 3300053177 | Bacteria | 2873 |
| 705 | Ga0500609_001196 | 3300053731 | Bacteria | 3853 |
| 706 | Ga0500596_003347 | 3300053735 | Bacteria | 3061 |
| 707 | Ga0501084_0045867 | 3300054114 | Bacteria | 3659 |
| 708 | Ga0501084_0047315 | 3300054114 | Bacteria | 3603 |
| 709 | Ga0501084_0104318 | 3300054114 | Bacteria | 2381 |
| 710 | Ga0587084_011383 | 3300059477 | Bacteria | 1184 |
| 711 | Ga0587093_009592 | 3300059478 | Bacteria | 1128 |
| 712 | Ga0587070_009462 | 3300059491 | Bacteria | 1409 |
| 713 | Ga0587082_008725 | 3300059504 | Bacteria | 1422 |
| 714 | Ga0587085_014050 | 3300059506 | Bacteria | 1124 |
| 715 | Ga0587089_006418 | 3300059509 | Bacteria | 1364 |
| 716 | Ga0587091_025449 | 3300059511 | Bacteria | 1070 |
| 717 | Ga0587092_009489 | 3300059512 | Bacteria | 1309 |
| 718 | Ga0587098_004952 | 3300059604 | Bacteria | 1283 |
| 719 | Ga0587109_009900 | 3300059624 | Bacteria | 1509 |
| 720 | Ga0587109_017360 | 3300059624 | Bacteria | 1245 |
| 721 | Ga0587062_005828 | 3300059639 | Bacteria | 1377 |
| 722 | Ga0587067_013055 | 3300059640 | Bacteria | 1308 |
| 723 | Ga0587072_016002 | 3300059643 | Bacteria | 1280 |
| 724 | Ga0587072_019423 | 3300059643 | Bacteria | 1189 |
| 725 | Ga0587075_013073 | 3300059644 | Bacteria | 1137 |
| 726 | Ga0587076_016012 | 3300059645 | Bacteria | 1178 |
| 727 | Ga0587102_003382 | 3300059649 | Bacteria | 1295 |
| 728 | Ga0587107_009843 | 3300059652 | Bacteria | 1138 |
| 729 | Ga0587110_004555 | 3300059654 | Bacteria | 1212 |
| 730 | Ga0587118_02616 | 3300059657 | Bacteria | 1176 |
| 731 | Ga0587119_008385 | 3300059658 | Bacteria | 1136 |
| 732 | Ga0587071_020586 | 3300060344 | Bacteria | 1203 |
| 733 | Ga0501082_0015983 | 3300060353 | Bacteria | 6455 |
| 734 | Ga0501082_0037827 | 3300060353 | Bacteria | 4161 |
| 735 | Ga0501082_0390206 | 3300060353 | Bacteria | 1215 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0062164 | Ga0496125_0062164_1888_2799 | 288 |
| 2 | 3300025914 | Ga0207671_10029225 | Ga0207671_100292253 | 290 |
| 3 | 3300005546 | Ga0070696_100211437 | Ga0070696_1002114372 | 296 |
| 4 | 3300009147 | Ga0114129_10211874 | Ga0114129_102118742 | 296 |
| 5 | 3300025915 | Ga0207693_10239912 | Ga0207693_102399122 | 296 |
| 6 | 3300035118 | Ga0373954_0134235 | Ga0373954_0134235_229_1119 | 296 |
| 7 | 3300050507 | nmdc:mga05p37_421409_c1 | nmdc:mga05p37_421409_c1_300_1250 | 296 |
| 8 | 3300049743 | Ga0501081_0461962 | Ga0501081_0461962_10_903 | 297 |
| 9 | 3300003762 | Ga0055542_1004745 | Ga0055542_10047452 | 298 |
| 10 | 3300005331 | Ga0070670_100041442 | Ga0070670_1000414423 | 298 |
| 11 | 3300005335 | Ga0070666_10035449 | Ga0070666_100354492 | 298 |
| 12 | 3300005338 | Ga0068868_100093007 | Ga0068868_1000930072 | 298 |
| 13 | 3300005355 | Ga0070671_100031375 | Ga0070671_1000313752 | 298 |
| 14 | 3300005455 | Ga0070663_100004006 | Ga0070663_1000040063 | 298 |
| 15 | 3300005539 | Ga0068853_100266363 | Ga0068853_1002663632 | 298 |
| 16 | 3300005578 | Ga0068854_100048142 | Ga0068854_1000481423 | 298 |
| 17 | 3300005616 | Ga0068852_100002424 | Ga0068852_1000024248 | 298 |
| 18 | 3300005617 | Ga0068859_100310691 | Ga0068859_1003106912 | 298 |
| 19 | 3300005844 | Ga0068862_100491611 | Ga0068862_1004916111 | 298 |
| 20 | 3300006038 | Ga0075365_10074530 | Ga0075365_100745303 | 298 |
| 21 | 3300006042 | Ga0075368_10013231 | Ga0075368_100132312 | 298 |
| 22 | 3300006048 | Ga0075363_100039272 | Ga0075363_1000392722 | 298 |
| 23 | 3300006051 | Ga0075364_10078436 | Ga0075364_100784361 | 298 |
| 24 | 3300006177 | Ga0075362_10035658 | Ga0075362_100356583 | 298 |
| 25 | 3300006178 | Ga0075367_10003642 | Ga0075367_100036427 | 298 |
| 26 | 3300006186 | Ga0075369_10040088 | Ga0075369_100400881 | 298 |
| 27 | 3300006195 | Ga0075366_10015675 | Ga0075366_100156752 | 298 |
| 28 | 3300006353 | Ga0075370_10084754 | Ga0075370_100847542 | 298 |
| 29 | 3300006931 | Ga0097620_100310667 | Ga0097620_1003106672 | 298 |
| 30 | 3300009093 | Ga0105240_10006715 | Ga0105240_1000671511 | 298 |
| 31 | 3300009093 | Ga0105240_10142684 | Ga0105240_101426842 | 298 |
| 32 | 3300009101 | Ga0105247_10025586 | Ga0105247_100255863 | 298 |
| 33 | 3300009174 | Ga0105241_10189324 | Ga0105241_101893241 | 298 |
| 34 | 3300009177 | Ga0105248_10023698 | Ga0105248_100236985 | 298 |
| 35 | 3300009545 | Ga0105237_10007155 | Ga0105237_100071551 | 298 |
| 36 | 3300010375 | Ga0105239_10030771 | Ga0105239_100307714 | 298 |
| 37 | 3300011119 | Ga0105246_10014291 | Ga0105246_100142913 | 298 |
| 38 | 3300013297 | Ga0157378_10086860 | Ga0157378_100868602 | 298 |
| 39 | 3300014325 | Ga0163163_10015338 | Ga0163163_100153385 | 298 |
| 40 | 3300014968 | Ga0157379_10367279 | Ga0157379_103672792 | 298 |
| 41 | 3300025254 | Ga0209148_1000319 | Ga0209148_100031949 | 298 |
| 42 | 3300025261 | Ga0209233_1005165 | Ga0209233_10051652 | 298 |
| 43 | 3300025272 | Ga0209455_1000782 | Ga0209455_100078210 | 298 |
| 44 | 3300025304 | Ga0209257_1022512 | Ga0209257_10225121 | 298 |
| 45 | 3300025900 | Ga0207710_10008547 | Ga0207710_100085473 | 298 |
| 46 | 3300025903 | Ga0207680_10060191 | Ga0207680_100601911 | 298 |
| 47 | 3300025904 | Ga0207647_10013298 | Ga0207647_100132982 | 298 |
| 48 | 3300025913 | Ga0207695_10000240 | Ga0207695_1000024044 | 298 |
| 49 | 3300025914 | Ga0207671_10006330 | Ga0207671_100063304 | 298 |
| 50 | 3300025924 | Ga0207694_10366286 | Ga0207694_103662861 | 298 |
| 51 | 3300025925 | Ga0207650_10041328 | Ga0207650_100413283 | 298 |
| 52 | 3300025941 | Ga0207711_10110547 | Ga0207711_101105471 | 298 |
| 53 | 3300025949 | Ga0207667_10165181 | Ga0207667_101651812 | 298 |
| 54 | 3300025981 | Ga0207640_10201813 | Ga0207640_102018131 | 298 |
| 55 | 3300026041 | Ga0207639_10058895 | Ga0207639_100588952 | 298 |
| 56 | 3300026067 | Ga0207678_10015900 | Ga0207678_100159002 | 298 |
| 57 | 3300026142 | Ga0207698_10021751 | Ga0207698_100217514 | 298 |
| 58 | 3300027866 | Ga0209813_10001150 | Ga0209813_100011501 | 298 |
| 59 | 3300028380 | Ga0268265_10389859 | Ga0268265_103898592 | 298 |
| 60 | 3300046474 | Ga0495605_0031146 | Ga0495605_0031146_1465_2418 | 298 |
| 61 | 3300046512 | Ga0495610_0039352 | Ga0495610_0039352_142_1095 | 298 |
| 62 | 3300046513 | Ga0495616_0024859 | Ga0495616_0024859_2195_3148 | 298 |
| 63 | 3300046522 | Ga0495643_0004861 | Ga0495643_0004861_321_1274 | 298 |
| 64 | 3300046542 | Ga0495597_0012984 | Ga0495597_0012984_2780_3733 | 298 |
| 65 | 3300047323 | Ga0495683_0071753 | Ga0495683_0071753_312_1265 | 298 |
| 66 | 3300047443 | Ga0495687_013121 | Ga0495687_013121_681_1634 | 298 |
| 67 | 3300048903 | Ga0496100_0016060 | Ga0496100_0016060_1266_2219 | 298 |
| 68 | 3300048904 | Ga0496101_0024546 | Ga0496101_0024546_336_1289 | 298 |
| 69 | 3300048905 | Ga0496102_0012863 | Ga0496102_0012863_198_1151 | 298 |
| 70 | 3300048906 | Ga0496103_0002871 | Ga0496103_0002871_5684_6637 | 298 |
| 71 | 3300048907 | Ga0496104_0013027 | Ga0496104_0013027_3821_4774 | 298 |
| 72 | 3300048909 | Ga0496106_0236306 | Ga0496106_0236306_234_1187 | 298 |
| 73 | 3300048911 | Ga0496108_0029866 | Ga0496108_0029866_2165_3118 | 298 |
| 74 | 3300048912 | Ga0496109_0035954 | Ga0496109_0035954_2805_3758 | 298 |
| 75 | 3300048913 | Ga0496110_0020049 | Ga0496110_0020049_4397_5350 | 298 |
| 76 | 3300048914 | Ga0496111_0079066 | Ga0496111_0079066_843_1796 | 298 |
| 77 | 3300048915 | Ga0496112_0005447 | Ga0496112_0005447_8125_9078 | 298 |
| 78 | 3300048916 | Ga0496113_0009073 | Ga0496113_0009073_2162_3115 | 298 |
| 79 | 3300048918 | Ga0496115_0312510 | Ga0496115_0312510_230_1183 | 298 |
| 80 | 3300048919 | Ga0496116_0113437 | Ga0496116_0113437_549_1502 | 298 |
| 81 | 3300048920 | Ga0496117_0107500 | Ga0496117_0107500_451_1404 | 298 |
| 82 | 3300048921 | Ga0496118_0068163 | Ga0496118_0068163_1431_2384 | 298 |
| 83 | 3300048922 | Ga0496119_0014020 | Ga0496119_0014020_55_1008 | 298 |
| 84 | 3300048925 | Ga0496122_0074571 | Ga0496122_0074571_620_1573 | 298 |
| 85 | 3300048927 | Ga0496124_0020155 | Ga0496124_0020155_3216_4169 | 298 |
| 86 | 3300050490 | nmdc:mga03n38_33657_c1 | nmdc:mga03n38_33657_c1_637_1590 | 298 |
| 87 | 3300050491 | nmdc:mga00v17_29553_c1 | nmdc:mga00v17_29553_c1_1939_2892 | 298 |
| 88 | 3300050492 | nmdc:mga0yw44_9280_c1 | nmdc:mga0yw44_9280_c1_2703_3656 | 298 |
| 89 | 3300050493 | nmdc:mga0k408_16319_c1 | nmdc:mga0k408_16319_c1_2729_3682 | 298 |
| 90 | 3300050495 | nmdc:mga04h51_8376_c1 | nmdc:mga04h51_8376_c1_1734_2687 | 298 |
| 91 | 3300059511 | Ga0587091_025449 | Ga0587091_025449_40_993 | 298 |
| 92 | 3300059649 | Ga0587102_003382 | Ga0587102_003382_276_1229 | 298 |
| 93 | 3300031456 | Ga0307513_10099286 | Ga0307513_100992863 | 299 |
| 94 | 3300005434 | Ga0070709_10016514 | Ga0070709_100165142 | 301 |
| 95 | 3300005436 | Ga0070713_100003623 | Ga0070713_1000036237 | 301 |
| 96 | 3300005437 | Ga0070710_10002252 | Ga0070710_100022523 | 301 |
| 97 | 3300005439 | Ga0070711_100016056 | Ga0070711_1000160565 | 301 |
| 98 | 3300025898 | Ga0207692_10113444 | Ga0207692_101134442 | 301 |
| 99 | 3300025915 | Ga0207693_10075397 | Ga0207693_100753972 | 301 |
| 100 | 3300025916 | Ga0207663_10056556 | Ga0207663_100565562 | 301 |
| 101 | 3300025939 | Ga0207665_10102598 | Ga0207665_101025982 | 301 |
| 102 | 3300039438 | Ga0436360_0760710 | Ga0436360_0760710_34_942 | 301 |
| 103 | 3300048929 | Ga0496126_0090325 | Ga0496126_0090325_750_1703 | 301 |
| 104 | 3300005336 | Ga0070680_100170515 | Ga0070680_1001705152 | 302 |
| 105 | 3300005983 | Ga0081540_1021073 | Ga0081540_10210732 | 302 |
| 106 | 3300025917 | Ga0207660_10153172 | Ga0207660_101531722 | 302 |
| 107 | 3300049579 | Ga0501043_0117417 | Ga0501043_0117417_933_1880 | 303 |
| 108 | 3300049586 | Ga0501070_0023604 | Ga0501070_0023604_903_1850 | 303 |
| 109 | 3300049822 | Ga0501035_0119146 | Ga0501035_0119146_1327_2274 | 303 |
| 110 | 3300009177 | Ga0105248_10395955 | Ga0105248_103959551 | 304 |
| 111 | 3300037418 | Ga0395900_0001158 | Ga0395900_0001158_4080_5045 | 304 |
| 112 | 3300037466 | Ga0395898_0005716 | Ga0395898_0005716_2685_3650 | 304 |
| 113 | 3300038443 | Ga0395901_0042818 | Ga0395901_0042818_2281_3246 | 304 |
| 114 | 3300048924 | Ga0496121_0146502 | Ga0496121_0146502_59_973 | 304 |
| 115 | 3300005356 | Ga0070674_100232836 | Ga0070674_1002328361 | 305 |
| 116 | 3300005539 | Ga0068853_100012626 | Ga0068853_1000126266 | 305 |
| 117 | 3300005563 | Ga0068855_100228884 | Ga0068855_1002288842 | 305 |
| 118 | 3300005834 | Ga0068851_10063179 | Ga0068851_100631792 | 305 |
| 119 | 3300009093 | Ga0105240_10339086 | Ga0105240_103390862 | 305 |
| 120 | 3300009545 | Ga0105237_10021498 | Ga0105237_100214986 | 305 |
| 121 | 3300009551 | Ga0105238_10001985 | Ga0105238_100019856 | 305 |
| 122 | 3300010375 | Ga0105239_10049592 | Ga0105239_100495922 | 305 |
| 123 | 3300014969 | Ga0157376_10099848 | Ga0157376_100998482 | 305 |
| 124 | 3300025297 | Ga0209758_1024684 | Ga0209758_10246842 | 305 |
| 125 | 3300025904 | Ga0207647_10016597 | Ga0207647_100165972 | 305 |
| 126 | 3300025914 | Ga0207671_10088965 | Ga0207671_100889652 | 305 |
| 127 | 3300025949 | Ga0207667_10180081 | Ga0207667_101800812 | 305 |
| 128 | 3300048914 | Ga0496111_0253118 | Ga0496111_0253118_57_1019 | 305 |
| 129 | 3300048926 | Ga0496123_0024648 | Ga0496123_0024648_15_932 | 305 |
| 130 | 3300059509 | Ga0587089_006418 | Ga0587089_006418_212_1174 | 305 |
| 131 | 3300059512 | Ga0587092_009489 | Ga0587092_009489_152_1114 | 305 |
| 132 | 3300059624 | Ga0587109_009900 | Ga0587109_009900_283_1245 | 305 |
| 133 | 3300059644 | Ga0587075_013073 | Ga0587075_013073_116_1078 | 305 |
| 134 | 3300059654 | Ga0587110_004555 | Ga0587110_004555_196_1158 | 305 |
| 135 | 3300059657 | Ga0587118_02616 | Ga0587118_02616_55_1017 | 305 |
| 136 | 3300003215 | JGI25153J46596_10000019 | JGI25153J46596_10000019142 | 306 |
| 137 | 3300003794 | Ga0055531_10009724 | Ga0055531_100097247 | 306 |
| 138 | 3300005365 | Ga0070688_100086727 | Ga0070688_1000867272 | 306 |
| 139 | 3300005435 | Ga0070714_100053890 | Ga0070714_1000538902 | 306 |
| 140 | 3300005437 | Ga0070710_10002003 | Ga0070710_100020032 | 306 |
| 141 | 3300005439 | Ga0070711_100002848 | Ga0070711_1000028485 | 306 |
| 142 | 3300005439 | Ga0070711_100102967 | Ga0070711_1001029672 | 306 |
| 143 | 3300005618 | Ga0068864_100195359 | Ga0068864_1001953592 | 306 |
| 144 | 3300006042 | Ga0075368_10010975 | Ga0075368_100109753 | 306 |
| 145 | 3300006173 | Ga0070716_100004863 | Ga0070716_1000048634 | 306 |
| 146 | 3300006173 | Ga0070716_100072012 | Ga0070716_1000720123 | 306 |
| 147 | 3300006237 | Ga0097621_100168579 | Ga0097621_1001685793 | 306 |
| 148 | 3300009177 | Ga0105248_10043670 | Ga0105248_100436702 | 306 |
| 149 | 3300009545 | Ga0105237_10057919 | Ga0105237_100579193 | 306 |
| 150 | 3300009551 | Ga0105238_10107581 | Ga0105238_101075812 | 306 |
| 151 | 3300010375 | Ga0105239_10017591 | Ga0105239_100175912 | 306 |
| 152 | 3300013306 | Ga0163162_10042418 | Ga0163162_100424184 | 306 |
| 153 | 3300013308 | Ga0157375_10198245 | Ga0157375_101982452 | 306 |
| 154 | 3300025297 | Ga0209758_1000028 | Ga0209758_1000028342 | 306 |
| 155 | 3300025298 | Ga0209050_1024882 | Ga0209050_10248822 | 306 |
| 156 | 3300025304 | Ga0209257_1000688 | Ga0209257_100068823 | 306 |
| 157 | 3300025898 | Ga0207692_10015312 | Ga0207692_100153121 | 306 |
| 158 | 3300025899 | Ga0207642_10059885 | Ga0207642_100598851 | 306 |
| 159 | 3300025914 | Ga0207671_10103227 | Ga0207671_101032272 | 306 |
| 160 | 3300025916 | Ga0207663_10004509 | Ga0207663_100045093 | 306 |
| 161 | 3300025916 | Ga0207663_10371263 | Ga0207663_103712631 | 306 |
| 162 | 3300025928 | Ga0207700_10165257 | Ga0207700_101652572 | 306 |
| 163 | 3300025929 | Ga0207664_10064463 | Ga0207664_100644632 | 306 |
| 164 | 3300025939 | Ga0207665_10001825 | Ga0207665_100018254 | 306 |
| 165 | 3300026142 | Ga0207698_10354842 | Ga0207698_103548422 | 306 |
| 166 | 3300028381 | Ga0268264_10403514 | Ga0268264_104035142 | 306 |
| 167 | 3300035118 | Ga0373954_0131140 | Ga0373954_0131140_12_965 | 306 |
| 168 | 3300035725 | Ga0373947_0072796 | Ga0373947_0072796_219_1169 | 306 |
| 169 | 3300037068 | Ga0373925_0115012 | Ga0373925_0115012_716_1666 | 306 |
| 170 | 3300037068 | Ga0373925_0222432 | Ga0373925_0222432_344_1297 | 306 |
| 171 | 3300046660 | Ga0495625_0324259 | Ga0495625_0324259_18_968 | 306 |
| 172 | 3300046694 | Ga0495649_0208911 | Ga0495649_0208911_15_965 | 306 |
| 173 | 3300047319 | Ga0495674_0035848 | Ga0495674_0035848_847_1800 | 306 |
| 174 | 3300048904 | Ga0496101_0042329 | Ga0496101_0042329_501_1451 | 306 |
| 175 | 3300048905 | Ga0496102_0009946 | Ga0496102_0009946_1336_2286 | 306 |
| 176 | 3300048908 | Ga0496105_0081471 | Ga0496105_0081471_519_1469 | 306 |
| 177 | 3300048909 | Ga0496106_0009323 | Ga0496106_0009323_5293_6243 | 306 |
| 178 | 3300048910 | Ga0496107_0080835 | Ga0496107_0080835_656_1606 | 306 |
| 179 | 3300048911 | Ga0496108_0009837 | Ga0496108_0009837_76_1026 | 306 |
| 180 | 3300048912 | Ga0496109_0147425 | Ga0496109_0147425_1221_2171 | 306 |
| 181 | 3300048913 | Ga0496110_0024288 | Ga0496110_0024288_76_1026 | 306 |
| 182 | 3300048914 | Ga0496111_0014645 | Ga0496111_0014645_529_1479 | 306 |
| 183 | 3300048915 | Ga0496112_0017000 | Ga0496112_0017000_3966_4916 | 306 |
| 184 | 3300048916 | Ga0496113_0001431 | Ga0496113_0001431_2763_3713 | 306 |
| 185 | 3300048918 | Ga0496115_0025840 | Ga0496115_0025840_358_1308 | 306 |
| 186 | 3300049569 | Ga0501032_0155114 | Ga0501032_0155114_288_1238 | 306 |
| 187 | 3300049581 | Ga0501047_0012272 | Ga0501047_0012272_1142_2092 | 306 |
| 188 | 3300049584 | Ga0501068_0012242 | Ga0501068_0012242_98_1048 | 306 |
| 189 | 3300049586 | Ga0501070_0018522 | Ga0501070_0018522_782_1711 | 306 |
| 190 | 3300049743 | Ga0501081_0355059 | Ga0501081_0355059_93_1031 | 306 |
| 191 | 3300049744 | Ga0501083_0014473 | Ga0501083_0014473_1562_2512 | 306 |
| 192 | 3300049823 | Ga0501044_0097977 | Ga0501044_0097977_452_1402 | 306 |
| 193 | 3300050492 | nmdc:mga0yw44_23076_c1 | nmdc:mga0yw44_23076_c1_1074_2036 | 306 |
| 194 | 3300053084 | Ga0495595_0038192 | Ga0495595_0038192_692_1642 | 306 |
| 195 | 3300053093 | Ga0500651_0068130 | Ga0500651_0068130_1241_2191 | 306 |
| 196 | 3300053103 | Ga0500555_013088 | Ga0500555_013088_1388_2338 | 306 |
| 197 | 3300053130 | Ga0500642_0001772 | Ga0500642_0001772_3978_4928 | 306 |
| 198 | 3300053142 | Ga0500577_0018251 | Ga0500577_0018251_62_1012 | 306 |
| 199 | 3300053146 | Ga0500588_0044329 | Ga0500588_0044329_52_1002 | 306 |
| 200 | 3300053153 | Ga0500616_0008785 | Ga0500616_0008785_5233_6183 | 306 |
| 201 | 3300053731 | Ga0500609_001196 | Ga0500609_001196_1872_2822 | 306 |
| 202 | 3300060353 | Ga0501082_0015983 | Ga0501082_0015983_3575_4525 | 306 |
| 203 | 3300060353 | Ga0501082_0390206 | Ga0501082_0390206_29_967 | 306 |
| 204 | 3300005985 | Ga0081539_10064079 | Ga0081539_100640792 | 307 |
| 205 | 3300007265 | Ga0099794_10003764 | Ga0099794_100037642 | 307 |
| 206 | 3300007788 | Ga0099795_10004356 | Ga0099795_100043563 | 307 |
| 207 | 3300027671 | Ga0209588_1025509 | Ga0209588_10255092 | 307 |
| 208 | 3300049571 | Ga0501034_0014015 | Ga0501034_0014015_1313_2236 | 307 |
| 209 | 3300049574 | Ga0501038_0001456 | Ga0501038_0001456_10814_11737 | 307 |
| 210 | 3300049575 | Ga0501039_0498912 | Ga0501039_0498912_11_934 | 307 |
| 211 | 3300049579 | Ga0501043_0155333 | Ga0501043_0155333_160_1083 | 307 |
| 212 | 3300049586 | Ga0501070_0013944 | Ga0501070_0013944_1687_2610 | 307 |
| 213 | 3300049589 | Ga0501073_0034948 | Ga0501073_0034948_2096_3019 | 307 |
| 214 | 3300049590 | Ga0501074_0002793 | Ga0501074_0002793_9996_10919 | 307 |
| 215 | 3300049742 | Ga0501080_0052386 | Ga0501080_0052386_1622_2545 | 307 |
| 216 | 3300049822 | Ga0501035_0002943 | Ga0501035_0002943_1986_2909 | 307 |
| 217 | 3300049823 | Ga0501044_0025354 | Ga0501044_0025354_1044_1967 | 307 |
| 218 | 3300053139 | Ga0500568_0056575 | Ga0500568_0056575_144_1094 | 307 |
| 219 | 3300060353 | Ga0501082_0037827 | Ga0501082_0037827_1103_2026 | 307 |
| 220 | iso_pu_bacteria | 2687453392 | 2688595819 | 307 |
| 221 | iso_pu_bacteria | 2838022645 | 2838025280 | 307 |
| 222 | 3300005841 | Ga0068863_100245804 | Ga0068863_1002458042 | 308 |
| 223 | 3300006038 | Ga0075365_10042674 | Ga0075365_100426742 | 308 |
| 224 | 3300006038 | Ga0075365_10118475 | Ga0075365_101184752 | 308 |
| 225 | 3300006051 | Ga0075364_10025226 | Ga0075364_100252263 | 308 |
| 226 | 3300006177 | Ga0075362_10031420 | Ga0075362_100314202 | 308 |
| 227 | 3300006178 | Ga0075367_10011213 | Ga0075367_100112132 | 308 |
| 228 | 3300006186 | Ga0075369_10003778 | Ga0075369_100037782 | 308 |
| 229 | 3300006195 | Ga0075366_10003365 | Ga0075366_100033656 | 308 |
| 230 | 3300006844 | Ga0075428_100017029 | Ga0075428_1000170293 | 308 |
| 231 | 3300006847 | Ga0075431_100319425 | Ga0075431_1003194251 | 308 |
| 232 | 3300006880 | Ga0075429_100475113 | Ga0075429_1004751131 | 308 |
| 233 | 3300009147 | Ga0114129_10119161 | Ga0114129_101191612 | 308 |
| 234 | 3300026088 | Ga0207641_10356092 | Ga0207641_103560922 | 308 |
| 235 | 3300048916 | Ga0496113_0125615 | Ga0496113_0125615_12_941 | 308 |
| 236 | 3300050489 | nmdc:mga03683_15897_c1 | nmdc:mga03683_15897_c1_1070_2017 | 308 |
| 237 | 3300050491 | nmdc:mga00v17_23610_c1 | nmdc:mga00v17_23610_c1_302_1249 | 308 |
| 238 | 3300050492 | nmdc:mga0yw44_228581_c1 | nmdc:mga0yw44_228581_c1_17_964 | 308 |
| 239 | 3300050492 | nmdc:mga0yw44_233095_c1 | nmdc:mga0yw44_233095_c1_182_1135 | 308 |
| 240 | 3300050494 | nmdc:mga06z11_174272_c1 | nmdc:mga06z11_174272_c1_157_1110 | 308 |
| 241 | 3300050507 | nmdc:mga05p37_76481_c1 | nmdc:mga05p37_76481_c1_1799_2746 | 308 |
| 242 | 3300050508 | nmdc:mga09592_434725_c1 | nmdc:mga09592_434725_c1_69_1016 | 308 |
| 243 | 3300050516 | nmdc:mga0sz30_4720_c1 | nmdc:mga0sz30_4720_c1_1222_2169 | 308 |
| 244 | 3300045049 | Ga0466959_0019373 | Ga0466959_0019373_137_1090 | 309 |
| 245 | iso_pu_bacteria | 2919679072 | 2919680338 | 310 |
| 246 | 3300053119 | Ga0500595_000277 | Ga0500595_000277_29811_30761 | 311 |
| 247 | 3300053153 | Ga0500616_0009068 | Ga0500616_0009068_2816_3751 | 311 |
| 248 | iso_pu_bacteria | 2996336353 | 2996337932 | 311 |
| 249 | 3300048915 | Ga0496112_0402383 | Ga0496112_0402383_345_1298 | 312 |
| 250 | 3300049569 | Ga0501032_0016881 | Ga0501032_0016881_272_1219 | 312 |
| 251 | 3300049571 | Ga0501034_0033148 | Ga0501034_0033148_2672_3619 | 312 |
| 252 | 3300049571 | Ga0501034_0037176 | Ga0501034_0037176_3679_4617 | 312 |
| 253 | 3300049572 | Ga0501036_0157879 | Ga0501036_0157879_737_1687 | 312 |
| 254 | 3300049574 | Ga0501038_0019997 | Ga0501038_0019997_2707_3654 | 312 |
| 255 | 3300049581 | Ga0501047_0011842 | Ga0501047_0011842_172_1119 | 312 |
| 256 | 3300049581 | Ga0501047_0064797 | Ga0501047_0064797_2501_3448 | 312 |
| 257 | 3300049583 | Ga0501067_0068486 | Ga0501067_0068486_924_1871 | 312 |
| 258 | 3300049586 | Ga0501070_0033368 | Ga0501070_0033368_2901_3848 | 312 |
| 259 | 3300049586 | Ga0501070_0061639 | Ga0501070_0061639_659_1606 | 312 |
| 260 | 3300049587 | Ga0501071_0071517 | Ga0501071_0071517_1493_2449 | 312 |
| 261 | 3300049590 | Ga0501074_0146520 | Ga0501074_0146520_647_1594 | 312 |
| 262 | 3300049591 | Ga0501075_0026762 | Ga0501075_0026762_2308_3258 | 312 |
| 263 | 3300049742 | Ga0501080_0108142 | Ga0501080_0108142_474_1421 | 312 |
| 264 | 3300049822 | Ga0501035_0101480 | Ga0501035_0101480_1338_2288 | 312 |
| 265 | 3300049822 | Ga0501035_0151609 | Ga0501035_0151609_893_1840 | 312 |
| 266 | 3300050492 | nmdc:mga0yw44_20507_c1 | nmdc:mga0yw44_20507_c1_1669_2610 | 312 |
| 267 | 3300053136 | Ga0500559_0002749 | Ga0500559_0002749_2482_3420 | 312 |
| 268 | 3300053140 | Ga0500573_0014843 | Ga0500573_0014843_230_1168 | 312 |
| 269 | 3300053163 | Ga0500639_053700 | Ga0500639_053700_310_1248 | 312 |
| 270 | 3300053177 | Ga0500636_0020080 | Ga0500636_0020080_660_1598 | 312 |
| 271 | 3300053735 | Ga0500596_003347 | Ga0500596_003347_1722_2660 | 312 |
| 272 | 3300054114 | Ga0501084_0047315 | Ga0501084_0047315_2001_2951 | 312 |
| 273 | iso_pu_bacteria | 2889914905 | 2889918055 | 312 |
| 274 | 3300005983 | Ga0081540_1027016 | Ga0081540_10270163 | 313 |
| 275 | 3300048907 | Ga0496104_0473628 | Ga0496104_0473628_61_1002 | 313 |
| 276 | 3300048922 | Ga0496119_0105548 | Ga0496119_0105548_342_1286 | 313 |
| 277 | 3300049587 | Ga0501071_0067882 | Ga0501071_0067882_1287_2228 | 313 |
| 278 | 3300059477 | Ga0587084_011383 | Ga0587084_011383_69_1013 | 313 |
| 279 | 3300059491 | Ga0587070_009462 | Ga0587070_009462_161_1105 | 313 |
| 280 | 3300059506 | Ga0587085_014050 | Ga0587085_014050_145_1089 | 313 |
| 281 | 3300059624 | Ga0587109_017360 | Ga0587109_017360_149_1093 | 313 |
| 282 | 3300059639 | Ga0587062_005828 | Ga0587062_005828_274_1218 | 313 |
| 283 | 3300059643 | Ga0587072_019423 | Ga0587072_019423_144_1088 | 313 |
| 284 | 3300059645 | Ga0587076_016012 | Ga0587076_016012_91_1035 | 313 |
| 285 | 3300059652 | Ga0587107_009843 | Ga0587107_009843_36_980 | 313 |
| 286 | iso_pu_bacteria | 2513237094 | 2513643122 | 313 |
| 287 | iso_pu_bacteria | 2513237104 | 2513715195 | 313 |
| 288 | iso_pu_bacteria | 2513237141 | 2513889600 | 313 |
| 289 | iso_pu_bacteria | 2617270741 | 2617378803 | 313 |
| 290 | iso_pu_bacteria | 2824679649 | 2824681220 | 313 |
| 291 | iso_pu_bacteria | 2824732956 | 2824734705 | 313 |
| 292 | iso_pu_bacteria | 2824746037 | 2824747777 | 313 |
| 293 | iso_pu_bacteria | 2844315083 | 2844317213 | 313 |
| 294 | iso_pu_bacteria | 2885366525 | 2885367317 | 313 |
| 295 | iso_pu_bacteria | 2903727486 | 2903735196 | 313 |
| 296 | iso_pu_bacteria | 2906602504 | 2906607604 | 313 |
| 297 | iso_pu_bacteria | 2908775508 | 2908778151 | 313 |
| 298 | iso_pu_bacteria | 2922393267 | 2922399443 | 313 |
| 299 | iso_pu_bacteria | 2941531003 | 2941535054 | 313 |
| 300 | iso_pu_bacteria | 3005483717 | 3005488648 | 313 |
| 301 | iso_pu_bacteria | 3005587118 | 3005594736 | 313 |
| 302 | iso_pu_bacteria | 3005718088 | 3005720321 | 313 |
| 303 | iso_pu_bacteria | 8006926726 | 8006927426 | 313 |
| 304 | iso_pu_bacteria | 8056967851 | 8056976246 | 313 |
| 305 | 3300005293 | Ga0065715_10130442 | Ga0065715_101304422 | 314 |
| 306 | 3300005295 | Ga0065707_10123094 | Ga0065707_101230941 | 314 |
| 307 | 3300005327 | Ga0070658_10096397 | Ga0070658_100963972 | 314 |
| 308 | 3300005339 | Ga0070660_100060221 | Ga0070660_1000602213 | 314 |
| 309 | 3300005353 | Ga0070669_100010408 | Ga0070669_1000104082 | 314 |
| 310 | 3300005356 | Ga0070674_100013636 | Ga0070674_1000136363 | 314 |
| 311 | 3300005364 | Ga0070673_100065909 | Ga0070673_1000659091 | 314 |
| 312 | 3300005366 | Ga0070659_100193883 | Ga0070659_1001938831 | 314 |
| 313 | 3300005459 | Ga0068867_100151672 | Ga0068867_1001516721 | 314 |
| 314 | 3300005543 | Ga0070672_100010038 | Ga0070672_1000100382 | 314 |
| 315 | 3300009148 | Ga0105243_10630792 | Ga0105243_106307921 | 314 |
| 316 | 3300010375 | Ga0105239_10235850 | Ga0105239_102358502 | 314 |
| 317 | 3300013296 | Ga0157374_10421124 | Ga0157374_104211241 | 314 |
| 318 | 3300013297 | Ga0157378_10177796 | Ga0157378_101777962 | 314 |
| 319 | 3300014497 | Ga0182008_10118060 | Ga0182008_101180602 | 314 |
| 320 | 3300025919 | Ga0207657_10064375 | Ga0207657_100643753 | 314 |
| 321 | 3300025923 | Ga0207681_10009281 | Ga0207681_100092814 | 314 |
| 322 | 3300025923 | Ga0207681_10052346 | Ga0207681_100523462 | 314 |
| 323 | 3300025932 | Ga0207690_10269122 | Ga0207690_102691221 | 314 |
| 324 | 3300025940 | Ga0207691_10009789 | Ga0207691_100097896 | 314 |
| 325 | 3300025940 | Ga0207691_10056550 | Ga0207691_100565503 | 314 |
| 326 | 3300025945 | Ga0207679_10423269 | Ga0207679_104232691 | 314 |
| 327 | 3300026089 | Ga0207648_10228259 | Ga0207648_102282591 | 314 |
| 328 | 3300026089 | Ga0207648_10257773 | Ga0207648_102577732 | 314 |
| 329 | 3300026118 | Ga0207675_100004709 | Ga0207675_1000047093 | 314 |
| 330 | 3300027907 | Ga0207428_10113973 | Ga0207428_101139732 | 314 |
| 331 | 3300028380 | Ga0268265_10011716 | Ga0268265_100117162 | 314 |
| 332 | 3300042876 | Ga0451577_0007468 | Ga0451577_0007468_578_1528 | 314 |
| 333 | 3300044712 | Ga0453684_0254476 | Ga0453684_0254476_596_1546 | 314 |
| 334 | 3300044901 | Ga0466960_0061505 | Ga0466960_0061505_183_1130 | 314 |
| 335 | 3300050508 | nmdc:mga09592_40750_c1 | nmdc:mga09592_40750_c1_1929_2879 | 314 |
| 336 | 3300053087 | Ga0500643_016011 | Ga0500643_016011_419_1414 | 314 |
| 337 | 3300053119 | Ga0500595_012013 | Ga0500595_012013_1399_2346 | 314 |
| 338 | 3300059658 | Ga0587119_008385 | Ga0587119_008385_108_1055 | 314 |
| 339 | iso_pu_bacteria | 2582581316 | 2585335511 | 314 |
| 340 | iso_pu_bacteria | 2615840698 | 2616557421 | 314 |
| 341 | iso_pu_bacteria | 2617270742 | 2617386466 | 314 |
| 342 | iso_pu_bacteria | 2842482326 | 2842488623 | 314 |
| 343 | iso_pu_bacteria | 8005682033 | 8005687233 | 314 |
| 344 | 3300003203 | JGI25406J46586_10005327 | JGI25406J46586_100053273 | 315 |
| 345 | 3300003305 | Ga0006770J48903_1028616 | Ga0006770J48903_10286161 | 315 |
| 346 | 3300005334 | Ga0068869_100204935 | Ga0068869_1002049351 | 315 |
| 347 | 3300005344 | Ga0070661_100007453 | Ga0070661_1000074537 | 315 |
| 348 | 3300005535 | Ga0070684_100416955 | Ga0070684_1004169551 | 315 |
| 349 | 3300005985 | Ga0081539_10002462 | Ga0081539_1000246222 | 315 |
| 350 | 3300006042 | Ga0075368_10059575 | Ga0075368_100595753 | 315 |
| 351 | 3300006048 | Ga0075363_100003916 | Ga0075363_1000039165 | 315 |
| 352 | 3300006177 | Ga0075362_10031982 | Ga0075362_100319822 | 315 |
| 353 | 3300009545 | Ga0105237_10269275 | Ga0105237_102692752 | 315 |
| 354 | 3300025914 | Ga0207671_10163717 | Ga0207671_101637172 | 315 |
| 355 | 3300025942 | Ga0207689_10450365 | Ga0207689_104503651 | 315 |
| 356 | 3300027866 | Ga0209813_10003148 | Ga0209813_100031483 | 315 |
| 357 | 3300028577 | Ga0265318_10010306 | Ga0265318_100103062 | 315 |
| 358 | 3300028794 | Ga0307515_10000130 | Ga0307515_1000013086 | 315 |
| 359 | 3300031247 | Ga0265340_10000971 | Ga0265340_100009712 | 315 |
| 360 | 3300031249 | Ga0265339_10010789 | Ga0265339_100107892 | 315 |
| 361 | 3300031344 | Ga0265316_10007442 | Ga0265316_100074429 | 315 |
| 362 | 3300031595 | Ga0265313_10000254 | Ga0265313_1000025454 | 315 |
| 363 | 3300031595 | Ga0265313_10039042 | Ga0265313_100390422 | 315 |
| 364 | 3300031711 | Ga0265314_10004387 | Ga0265314_1000438711 | 315 |
| 365 | 3300031711 | Ga0265314_10141718 | Ga0265314_101417182 | 315 |
| 366 | 3300031712 | Ga0265342_10004447 | Ga0265342_100044473 | 315 |
| 367 | 3300031730 | Ga0307516_10076661 | Ga0307516_100766612 | 315 |
| 368 | 3300031824 | Ga0307413_10264124 | Ga0307413_102641241 | 315 |
| 369 | 3300031995 | Ga0307409_100091435 | Ga0307409_1000914352 | 315 |
| 370 | 3300045976 | Ga0466967_0046981 | Ga0466967_0046981_126_1079 | 315 |
| 371 | 3300049569 | Ga0501032_0033309 | Ga0501032_0033309_272_1222 | 315 |
| 372 | 3300049570 | Ga0501033_0027644 | Ga0501033_0027644_1243_2193 | 315 |
| 373 | 3300049575 | Ga0501039_0037330 | Ga0501039_0037330_1987_2937 | 315 |
| 374 | 3300049580 | Ga0501046_0036115 | Ga0501046_0036115_2104_3054 | 315 |
| 375 | 3300049581 | Ga0501047_0230352 | Ga0501047_0230352_565_1521 | 315 |
| 376 | 3300049586 | Ga0501070_0124481 | Ga0501070_0124481_480_1427 | 315 |
| 377 | 3300049589 | Ga0501073_0131566 | Ga0501073_0131566_743_1699 | 315 |
| 378 | 3300049744 | Ga0501083_0009431 | Ga0501083_0009431_4506_5456 | 315 |
| 379 | 3300049744 | Ga0501083_0033110 | Ga0501083_0033110_1474_2421 | 315 |
| 380 | 3300049822 | Ga0501035_0169006 | Ga0501035_0169006_727_1674 | 315 |
| 381 | 3300049823 | Ga0501044_0244539 | Ga0501044_0244539_682_1629 | 315 |
| 382 | 3300049823 | Ga0501044_0253472 | Ga0501044_0253472_690_1640 | 315 |
| 383 | 3300050491 | nmdc:mga00v17_159718_c1 | nmdc:mga00v17_159718_c1_467_1417 | 315 |
| 384 | 3300050495 | nmdc:mga04h51_50121_c1 | nmdc:mga04h51_50121_c1_80_1033 | 315 |
| 385 | 3300053086 | Ga0500578_0033481 | Ga0500578_0033481_1668_2615 | 315 |
| 386 | 3300053092 | Ga0500583_0080745 | Ga0500583_0080745_482_1432 | 315 |
| 387 | 3300053153 | Ga0500616_0025202 | Ga0500616_0025202_336_1286 | 315 |
| 388 | 3300053158 | Ga0500627_0105783 | Ga0500627_0105783_154_1107 | 315 |
| 389 | 3300054114 | Ga0501084_0045867 | Ga0501084_0045867_1467_2417 | 315 |
| 390 | iso_pu_bacteria | 2513237164 | 2514038741 | 315 |
| 391 | iso_pu_bacteria | 2513237351 | 2514586811 | 315 |
| 392 | iso_pu_bacteria | 2765235802 | 2765468683 | 315 |
| 393 | iso_pu_bacteria | 2839993093 | 2839995411 | 315 |
| 394 | iso_pu_bacteria | 2904578770 | 2904581266 | 315 |
| 395 | iso_pu_bacteria | 2919119836 | 2919122505 | 315 |
| 396 | 3300005295 | Ga0065707_10025624 | Ga0065707_100256241 | 316 |
| 397 | 3300005329 | Ga0070683_100020044 | Ga0070683_1000200443 | 316 |
| 398 | 3300005340 | Ga0070689_100227559 | Ga0070689_1002275592 | 316 |
| 399 | 3300005344 | Ga0070661_100131145 | Ga0070661_1001311452 | 316 |
| 400 | 3300005356 | Ga0070674_100105019 | Ga0070674_1001050192 | 316 |
| 401 | 3300005366 | Ga0070659_100203165 | Ga0070659_1002031652 | 316 |
| 402 | 3300005434 | Ga0070709_10182199 | Ga0070709_101821992 | 316 |
| 403 | 3300005436 | Ga0070713_100200583 | Ga0070713_1002005832 | 316 |
| 404 | 3300005445 | Ga0070708_100164201 | Ga0070708_1001642012 | 316 |
| 405 | 3300005456 | Ga0070678_100045677 | Ga0070678_1000456773 | 316 |
| 406 | 3300005458 | Ga0070681_10154050 | Ga0070681_101540503 | 316 |
| 407 | 3300005467 | Ga0070706_100178845 | Ga0070706_1001788452 | 316 |
| 408 | 3300005468 | Ga0070707_100014813 | Ga0070707_1000148134 | 316 |
| 409 | 3300005518 | Ga0070699_100206785 | Ga0070699_1002067852 | 316 |
| 410 | 3300005536 | Ga0070697_100193233 | Ga0070697_1001932332 | 316 |
| 411 | 3300005548 | Ga0070665_100003622 | Ga0070665_10000362212 | 316 |
| 412 | 3300005548 | Ga0070665_100047733 | Ga0070665_1000477333 | 316 |
| 413 | 3300005564 | Ga0070664_100140515 | Ga0070664_1001405152 | 316 |
| 414 | 3300005617 | Ga0068859_100482653 | Ga0068859_1004826531 | 316 |
| 415 | 3300005718 | Ga0068866_10121366 | Ga0068866_101213662 | 316 |
| 416 | 3300005719 | Ga0068861_100024979 | Ga0068861_1000249793 | 316 |
| 417 | 3300005840 | Ga0068870_10200506 | Ga0068870_102005062 | 316 |
| 418 | 3300005842 | Ga0068858_100169534 | Ga0068858_1001695343 | 316 |
| 419 | 3300005843 | Ga0068860_100000222 | Ga0068860_10000022254 | 316 |
| 420 | 3300005844 | Ga0068862_100005467 | Ga0068862_10000546711 | 316 |
| 421 | 3300005937 | Ga0081455_10036412 | Ga0081455_100364124 | 316 |
| 422 | 3300005981 | Ga0081538_10116406 | Ga0081538_101164062 | 316 |
| 423 | 3300005985 | Ga0081539_10000493 | Ga0081539_1000049356 | 316 |
| 424 | 3300006038 | Ga0075365_10031255 | Ga0075365_100312552 | 316 |
| 425 | 3300006175 | Ga0070712_100004279 | Ga0070712_1000042799 | 316 |
| 426 | 3300006177 | Ga0075362_10004305 | Ga0075362_100043053 | 316 |
| 427 | 3300006186 | Ga0075369_10001463 | Ga0075369_100014637 | 316 |
| 428 | 3300006195 | Ga0075366_10145028 | Ga0075366_101450281 | 316 |
| 429 | 3300006881 | Ga0068865_100022831 | Ga0068865_1000228314 | 316 |
| 430 | 3300006931 | Ga0097620_100482673 | Ga0097620_1004826731 | 316 |
| 431 | 3300007265 | Ga0099794_10015072 | Ga0099794_100150722 | 316 |
| 432 | 3300007788 | Ga0099795_10070125 | Ga0099795_100701251 | 316 |
| 433 | 3300009094 | Ga0111539_10000090 | Ga0111539_1000009035 | 316 |
| 434 | 3300009098 | Ga0105245_10350916 | Ga0105245_103509162 | 316 |
| 435 | 3300009147 | Ga0114129_10289767 | Ga0114129_102897672 | 316 |
| 436 | 3300009148 | Ga0105243_10046915 | Ga0105243_100469152 | 316 |
| 437 | 3300009148 | Ga0105243_10329851 | Ga0105243_103298512 | 316 |
| 438 | 3300009176 | Ga0105242_10609960 | Ga0105242_106099601 | 316 |
| 439 | 3300009551 | Ga0105238_10024769 | Ga0105238_100247693 | 316 |
| 440 | 3300009551 | Ga0105238_10060977 | Ga0105238_100609772 | 316 |
| 441 | 3300010375 | Ga0105239_10417617 | Ga0105239_104176172 | 316 |
| 442 | 3300013102 | Ga0157371_10228244 | Ga0157371_102282442 | 316 |
| 443 | 3300013104 | Ga0157370_10085287 | Ga0157370_100852872 | 316 |
| 444 | 3300013105 | Ga0157369_10228695 | Ga0157369_102286951 | 316 |
| 445 | 3300013297 | Ga0157378_10326226 | Ga0157378_103262261 | 316 |
| 446 | 3300014326 | Ga0157380_10005965 | Ga0157380_100059652 | 316 |
| 447 | 3300019183 | Ga0184601_102729 | Ga0184601_1027291 | 316 |
| 448 | 3300019192 | Ga0184603_136826 | Ga0184603_1368261 | 316 |
| 449 | 3300020078 | Ga0206352_10850575 | Ga0206352_108505751 | 316 |
| 450 | 3300020081 | Ga0206354_11218913 | Ga0206354_112189131 | 316 |
| 451 | 3300020082 | Ga0206353_10827906 | Ga0206353_108279062 | 316 |
| 452 | 3300021384 | Ga0213876_10001735 | Ga0213876_100017359 | 316 |
| 453 | 3300021441 | Ga0213871_10036607 | Ga0213871_100366071 | 316 |
| 454 | 3300025297 | Ga0209758_1001042 | Ga0209758_10010429 | 316 |
| 455 | 3300025302 | Ga0207426_1010086 | Ga0207426_10100862 | 316 |
| 456 | 3300025900 | Ga0207710_10031014 | Ga0207710_100310142 | 316 |
| 457 | 3300025912 | Ga0207707_10110064 | Ga0207707_101100642 | 316 |
| 458 | 3300025914 | Ga0207671_10073351 | Ga0207671_100733512 | 316 |
| 459 | 3300025915 | Ga0207693_10089265 | Ga0207693_100892651 | 316 |
| 460 | 3300025919 | Ga0207657_10129494 | Ga0207657_101294942 | 316 |
| 461 | 3300025920 | Ga0207649_10130300 | Ga0207649_101303002 | 316 |
| 462 | 3300025922 | Ga0207646_10034839 | Ga0207646_100348391 | 316 |
| 463 | 3300025937 | Ga0207669_10102384 | Ga0207669_101023842 | 316 |
| 464 | 3300025937 | Ga0207669_10163669 | Ga0207669_101636691 | 316 |
| 465 | 3300025938 | Ga0207704_10106103 | Ga0207704_101061031 | 316 |
| 466 | 3300025972 | Ga0207668_10040495 | Ga0207668_100404953 | 316 |
| 467 | 3300026035 | Ga0207703_10172066 | Ga0207703_101720662 | 316 |
| 468 | 3300026067 | Ga0207678_10244711 | Ga0207678_102447111 | 316 |
| 469 | 3300026116 | Ga0207674_10059422 | Ga0207674_100594222 | 316 |
| 470 | 3300026118 | Ga0207675_100025107 | Ga0207675_1000251074 | 316 |
| 471 | 3300026121 | Ga0207683_10210635 | Ga0207683_102106352 | 316 |
| 472 | 3300027907 | Ga0207428_10000055 | Ga0207428_1000005511 | 316 |
| 473 | 3300028379 | Ga0268266_10026011 | Ga0268266_100260113 | 316 |
| 474 | 3300028380 | Ga0268265_10056785 | Ga0268265_100567852 | 316 |
| 475 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042153 | 316 |
| 476 | 3300028573 | Ga0265334_10029187 | Ga0265334_100291872 | 316 |
| 477 | 3300028786 | Ga0307517_10124952 | Ga0307517_101249522 | 316 |
| 478 | 3300030760 | Ga0265762_1011286 | Ga0265762_10112862 | 316 |
| 479 | 3300030863 | Ga0265766_1001931 | Ga0265766_10019311 | 316 |
| 480 | 3300031247 | Ga0265340_10018541 | Ga0265340_100185415 | 316 |
| 481 | 3300031247 | Ga0265340_10069267 | Ga0265340_100692672 | 316 |
| 482 | 3300031595 | Ga0265313_10004260 | Ga0265313_100042602 | 316 |
| 483 | 3300031616 | Ga0307508_10000019 | Ga0307508_10000019169 | 316 |
| 484 | 3300031730 | Ga0307516_10001267 | Ga0307516_100012677 | 316 |
| 485 | 3300031730 | Ga0307516_10261571 | Ga0307516_102615712 | 316 |
| 486 | 3300031824 | Ga0307413_10167933 | Ga0307413_101679331 | 316 |
| 487 | 3300031852 | Ga0307410_10086811 | Ga0307410_100868112 | 316 |
| 488 | 3300031995 | Ga0307409_100060489 | Ga0307409_1000604892 | 316 |
| 489 | 3300033544 | Ga0316215_1004751 | Ga0316215_10047512 | 316 |
| 490 | 3300037068 | Ga0373925_0231346 | Ga0373925_0231346_234_1187 | 316 |
| 491 | 3300037312 | Ga0395899_0114225 | Ga0395899_0114225_568_1521 | 316 |
| 492 | 3300037418 | Ga0395900_0010027 | Ga0395900_0010027_3359_4318 | 316 |
| 493 | 3300037466 | Ga0395898_0010237 | Ga0395898_0010237_658_1617 | 316 |
| 494 | 3300037466 | Ga0395898_0364031 | Ga0395898_0364031_60_1013 | 316 |
| 495 | 3300038443 | Ga0395901_0004964 | Ga0395901_0004964_2080_3039 | 316 |
| 496 | 3300038443 | Ga0395901_0005295 | Ga0395901_0005295_9444_10397 | 316 |
| 497 | 3300039437 | Ga0436365_0162634 | Ga0436365_0162634_10266_11336 | 316 |
| 498 | 3300039450 | Ga0436363_1164297 | Ga0436363_1164297_39_992 | 316 |
| 499 | 3300044684 | Ga0466966_0057270 | Ga0466966_0057270_1466_2416 | 316 |
| 500 | 3300044842 | Ga0466957_0119907 | Ga0466957_0119907_259_1212 | 316 |
| 501 | 3300045049 | Ga0466959_0092639 | Ga0466959_0092639_989_1939 | 316 |
| 502 | 3300045976 | Ga0466967_0156765 | Ga0466967_0156765_921_1874 | 316 |
| 503 | 3300046455 | Ga0495603_0008597 | Ga0495603_0008597_1432_2382 | 316 |
| 504 | 3300046473 | Ga0495582_0120262 | Ga0495582_0120262_52_1002 | 316 |
| 505 | 3300048909 | Ga0496106_0001650 | Ga0496106_0001650_5269_6219 | 316 |
| 506 | 3300048919 | Ga0496116_0122478 | Ga0496116_0122478_216_1166 | 316 |
| 507 | 3300048921 | Ga0496118_0005110 | Ga0496118_0005110_5234_6184 | 316 |
| 508 | 3300048921 | Ga0496118_0036254 | Ga0496118_0036254_2880_3830 | 316 |
| 509 | 3300048922 | Ga0496119_0032690 | Ga0496119_0032690_1972_2922 | 316 |
| 510 | 3300048924 | Ga0496121_0004222 | Ga0496121_0004222_7689_8639 | 316 |
| 511 | 3300048924 | Ga0496121_0006122 | Ga0496121_0006122_3621_4571 | 316 |
| 512 | 3300048927 | Ga0496124_0002457 | Ga0496124_0002457_12895_13845 | 316 |
| 513 | 3300048927 | Ga0496124_0306567 | Ga0496124_0306567_170_1120 | 316 |
| 514 | 3300048928 | Ga0496125_0000090 | Ga0496125_0000090_186158_187108 | 316 |
| 515 | 3300048928 | Ga0496125_0002371 | Ga0496125_0002371_23618_24568 | 316 |
| 516 | 3300048928 | Ga0496125_0247511 | Ga0496125_0247511_35_1114 | 316 |
| 517 | 3300048929 | Ga0496126_0004444 | Ga0496126_0004444_10532_11482 | 316 |
| 518 | 3300048929 | Ga0496126_0251956 | Ga0496126_0251956_473_1426 | 316 |
| 519 | 3300049569 | Ga0501032_0139031 | Ga0501032_0139031_445_1404 | 316 |
| 520 | 3300049571 | Ga0501034_0001552 | Ga0501034_0001552_2224_3177 | 316 |
| 521 | 3300049571 | Ga0501034_0098571 | Ga0501034_0098571_567_1526 | 316 |
| 522 | 3300049571 | Ga0501034_0141505 | Ga0501034_0141505_1422_2375 | 316 |
| 523 | 3300049574 | Ga0501038_0055794 | Ga0501038_0055794_77_1030 | 316 |
| 524 | 3300049581 | Ga0501047_0272245 | Ga0501047_0272245_564_1517 | 316 |
| 525 | 3300049583 | Ga0501067_0165859 | Ga0501067_0165859_205_1155 | 316 |
| 526 | 3300049584 | Ga0501068_0063514 | Ga0501068_0063514_853_1806 | 316 |
| 527 | 3300049588 | Ga0501072_0163415 | Ga0501072_0163415_709_1662 | 316 |
| 528 | 3300049589 | Ga0501073_0049137 | Ga0501073_0049137_1359_2309 | 316 |
| 529 | 3300049742 | Ga0501080_0134156 | Ga0501080_0134156_1261_2211 | 316 |
| 530 | 3300049743 | Ga0501081_0164357 | Ga0501081_0164357_541_1494 | 316 |
| 531 | 3300049823 | Ga0501044_0101816 | Ga0501044_0101816_457_1416 | 316 |
| 532 | 3300049823 | Ga0501044_0175462 | Ga0501044_0175462_1058_2008 | 316 |
| 533 | 3300050493 | nmdc:mga0k408_117412_c1 | nmdc:mga0k408_117412_c1_273_1226 | 316 |
| 534 | 3300050493 | nmdc:mga0k408_155967_c1 | nmdc:mga0k408_155967_c1_346_1299 | 316 |
| 535 | 3300050507 | nmdc:mga05p37_99311_c1 | nmdc:mga05p37_99311_c1_68_1021 | 316 |
| 536 | 3300050511 | nmdc:mga08y16_220760_c1 | nmdc:mga08y16_220760_c1_454_1407 | 316 |
| 537 | 3300050511 | nmdc:mga08y16_595_c1 | nmdc:mga08y16_595_c1_4404_5360 | 316 |
| 538 | 3300050516 | nmdc:mga0sz30_399_c1 | nmdc:mga0sz30_399_c1_4973_5926 | 316 |
| 539 | 3300053080 | Ga0500635_0016036 | Ga0500635_0016036_1137_2087 | 316 |
| 540 | 3300053093 | Ga0500651_0000471 | Ga0500651_0000471_18570_19520 | 316 |
| 541 | 3300053094 | Ga0500566_0109799 | Ga0500566_0109799_441_1391 | 316 |
| 542 | 3300053096 | Ga0500641_0004986 | Ga0500641_0004986_2758_3711 | 316 |
| 543 | 3300053119 | Ga0500595_000905 | Ga0500595_000905_5514_6464 | 316 |
| 544 | 3300053177 | Ga0500636_0037374 | Ga0500636_0037374_1719_2681 | 316 |
| 545 | 3300054114 | Ga0501084_0104318 | Ga0501084_0104318_1376_2329 | 316 |
| 546 | 3300059640 | Ga0587067_013055 | Ga0587067_013055_221_1174 | 316 |
| 547 | iso_pu_bacteria | 2508501123 | 2509114009 | 316 |
| 548 | iso_pu_bacteria | 2508501127 | 2509140768 | 316 |
| 549 | iso_pu_bacteria | 2509276018 | 2509368565 | 316 |
| 550 | iso_pu_bacteria | 2509276021 | 2509391040 | 316 |
| 551 | iso_pu_bacteria | 2509276022 | 2509393510 | 316 |
| 552 | iso_pu_bacteria | 2509276033 | 2509441786 | 316 |
| 553 | iso_pu_bacteria | 2510065019 | 2510133095 | 316 |
| 554 | iso_pu_bacteria | 2510065059 | 2510314846 | 316 |
| 555 | iso_pu_bacteria | 2510461076 | 2510894457 | 316 |
| 556 | iso_pu_bacteria | 2510461076 | 2510899483 | 316 |
| 557 | iso_pu_bacteria | 2512875016 | 2512934035 | 316 |
| 558 | iso_pu_bacteria | 2512875024 | 2512962299 | 316 |
| 559 | iso_pu_bacteria | 2513237084 | 2513569822 | 316 |
| 560 | iso_pu_bacteria | 2513237085 | 2513575101 | 316 |
| 561 | iso_pu_bacteria | 2513237090 | 2513610670 | 316 |
| 562 | iso_pu_bacteria | 2513237093 | 2513635565 | 316 |
| 563 | iso_pu_bacteria | 2513237103 | 2513713497 | 316 |
| 564 | iso_pu_bacteria | 2513237162 | 2514021898 | 316 |
| 565 | iso_pu_bacteria | 2513237305 | 2514418256 | 316 |
| 566 | iso_pu_bacteria | 2515075009 | 2515112054 | 316 |
| 567 | iso_pu_bacteria | 2515154113 | 2515635525 | 316 |
| 568 | iso_pu_bacteria | 2515154114 | 2515644993 | 316 |
| 569 | iso_pu_bacteria | 2515154116 | 2515660137 | 316 |
| 570 | iso_pu_bacteria | 2515154134 | 2515738787 | 316 |
| 571 | iso_pu_bacteria | 2516653077 | 2517035787 | 316 |
| 572 | iso_pu_bacteria | 2516653085 | 2517076187 | 316 |
| 573 | iso_pu_bacteria | 2517093000 | 2517094932 | 316 |
| 574 | iso_pu_bacteria | 2517287029 | 2517406578 | 316 |
| 575 | iso_pu_bacteria | 2519899620 | 2520378189 | 316 |
| 576 | iso_pu_bacteria | 2529292951 | 2530648514 | 316 |
| 577 | iso_pu_bacteria | 2534681796 | 2535520089 | 316 |
| 578 | iso_pu_bacteria | 2582581294 | 2585203849 | 316 |
| 579 | iso_pu_bacteria | 2582581308 | 2585278039 | 316 |
| 580 | iso_pu_bacteria | 2582581315 | 2585328346 | 316 |
| 581 | iso_pu_bacteria | 2585427526 | 2585528347 | 316 |
| 582 | iso_pu_bacteria | 2585427527 | 2585536959 | 316 |
| 583 | iso_pu_bacteria | 2585427528 | 2585539036 | 316 |
| 584 | iso_pu_bacteria | 2585427530 | 2585554595 | 316 |
| 585 | iso_pu_bacteria | 2585427593 | 2585836986 | 316 |
| 586 | iso_pu_bacteria | 2588253730 | 2588520148 | 316 |
| 587 | iso_pu_bacteria | 2597489875 | 2597810372 | 316 |
| 588 | iso_pu_bacteria | 2599185301 | 2599935271 | 316 |
| 589 | iso_pu_bacteria | 2615840626 | 2616309039 | 316 |
| 590 | iso_pu_bacteria | 2643221595 | 2643983754 | 316 |
| 591 | iso_pu_bacteria | 2643221627 | 2644155887 | 316 |
| 592 | iso_pu_bacteria | 2643221634 | 2644194915 | 316 |
| 593 | iso_pu_bacteria | 2643221643 | 2644242170 | 316 |
| 594 | iso_pu_bacteria | 2693429783 | 2694627987 | 316 |
| 595 | iso_pu_bacteria | 2693429784 | 2694636236 | 316 |
| 596 | iso_pu_bacteria | 2718217882 | 2719184708 | 316 |
| 597 | iso_pu_bacteria | 2718217927 | 2719389273 | 316 |
| 598 | iso_pu_bacteria | 2718218009 | 2719728728 | 316 |
| 599 | iso_pu_bacteria | 2718218363 | 2721144419 | 316 |
| 600 | iso_pu_bacteria | 2718218365 | 2721156367 | 316 |
| 601 | iso_pu_bacteria | 2718218366 | 2721161789 | 316 |
| 602 | iso_pu_bacteria | 2718218423 | 2721402038 | 316 |
| 603 | iso_pu_bacteria | 2721755514 | 2722842934 | 316 |
| 604 | iso_pu_bacteria | 2721755686 | 2723573035 | 316 |
| 605 | iso_pu_bacteria | 2721755809 | 2724035871 | 316 |
| 606 | iso_pu_bacteria | 2721755810 | 2724041753 | 316 |
| 607 | iso_pu_bacteria | 2724679232 | 2725952814 | 316 |
| 608 | iso_pu_bacteria | 2728369365 | 2730160823 | 316 |
| 609 | iso_pu_bacteria | 2728369397 | 2730295900 | 316 |
| 610 | iso_pu_bacteria | 2738541333 | 2739033471 | 316 |
| 611 | iso_pu_bacteria | 2756170246 | 2756674916 | 316 |
| 612 | iso_pu_bacteria | 2765235942 | 2766062962 | 316 |
| 613 | iso_pu_bacteria | 2791355123 | 2792747015 | 316 |
| 614 | iso_pu_bacteria | 2791355259 | 2793312881 | 316 |
| 615 | iso_pu_bacteria | 2791355260 | 2793323762 | 316 |
| 616 | iso_pu_bacteria | 2791355263 | 2793344429 | 316 |
| 617 | iso_pu_bacteria | 2791355264 | 2793345599 | 316 |
| 618 | iso_pu_bacteria | 2791355266 | 2793363680 | 316 |
| 619 | iso_pu_bacteria | 2791355267 | 2793370383 | 316 |
| 620 | iso_pu_bacteria | 2802429633 | 2806045017 | 316 |
| 621 | iso_pu_bacteria | 2802429634 | 2806056232 | 316 |
| 622 | iso_pu_bacteria | 2802429635 | 2806063342 | 316 |
| 623 | iso_pu_bacteria | 2802429636 | 2806065844 | 316 |
| 624 | iso_pu_bacteria | 2802429637 | 2806077654 | 316 |
| 625 | iso_pu_bacteria | 2818991453 | 2819643992 | 316 |
| 626 | iso_pu_bacteria | 2838035591 | 2838036435 | 316 |
| 627 | iso_pu_bacteria | 2838042994 | 2838044280 | 316 |
| 628 | iso_pu_bacteria | 2838686498 | 2838689261 | 316 |
| 629 | iso_pu_bacteria | 2838729681 | 2838730609 | 316 |
| 630 | iso_pu_bacteria | 2838742623 | 2838743550 | 316 |
| 631 | iso_pu_bacteria | 2841734538 | 2841736240 | 316 |
| 632 | iso_pu_bacteria | 2841851746 | 2841854774 | 316 |
| 633 | iso_pu_bacteria | 2841864319 | 2841865622 | 316 |
| 634 | iso_pu_bacteria | 2842110456 | 2842110712 | 316 |
| 635 | iso_pu_bacteria | 2842156927 | 2842157637 | 316 |
| 636 | iso_pu_bacteria | 2842163707 | 2842164831 | 316 |
| 637 | iso_pu_bacteria | 2842180545 | 2842180778 | 316 |
| 638 | iso_pu_bacteria | 2842198810 | 2842200846 | 316 |
| 639 | iso_pu_bacteria | 2842217011 | 2842222924 | 316 |
| 640 | iso_pu_bacteria | 2842229732 | 2842231164 | 316 |
| 641 | iso_pu_bacteria | 2842243621 | 2842244729 | 316 |
| 642 | iso_pu_bacteria | 2842257432 | 2842258542 | 316 |
| 643 | iso_pu_bacteria | 2842271015 | 2842273281 | 316 |
| 644 | iso_pu_bacteria | 2842304105 | 2842310057 | 316 |
| 645 | iso_pu_bacteria | 2842341865 | 2842345552 | 316 |
| 646 | iso_pu_bacteria | 2842363717 | 2842363849 | 316 |
| 647 | iso_pu_bacteria | 2842395702 | 2842397221 | 316 |
| 648 | iso_pu_bacteria | 2844002411 | 2844003602 | 316 |
| 649 | iso_pu_bacteria | 2844009547 | 2844010628 | 316 |
| 650 | iso_pu_bacteria | 2844454524 | 2844459384 | 316 |
| 651 | iso_pu_bacteria | 2847670302 | 2847673339 | 316 |
| 652 | iso_pu_bacteria | 2856314179 | 2856319192 | 316 |
| 653 | iso_pu_bacteria | 2856320880 | 2856322274 | 316 |
| 654 | iso_pu_bacteria | 2856328259 | 2856332695 | 316 |
| 655 | iso_pu_bacteria | 2856334872 | 2856340682 | 316 |
| 656 | iso_pu_bacteria | 2856342000 | 2856342924 | 316 |
| 657 | iso_pu_bacteria | 2856349417 | 2856351752 | 316 |
| 658 | iso_pu_bacteria | 2856356410 | 2856360929 | 316 |
| 659 | iso_pu_bacteria | 2856364286 | 2856369987 | 316 |
| 660 | iso_pu_bacteria | 2857349434 | 2857352819 | 316 |
| 661 | iso_pu_bacteria | 2857516855 | 2857518501 | 316 |
| 662 | iso_pu_bacteria | 2869162929 | 2869165362 | 316 |
| 663 | iso_pu_bacteria | 2869169390 | 2869172482 | 316 |
| 664 | iso_pu_bacteria | 2869234852 | 2869239579 | 316 |
| 665 | iso_pu_bacteria | 2869242130 | 2869245161 | 316 |
| 666 | iso_pu_bacteria | 2869249662 | 2869255874 | 316 |
| 667 | iso_pu_bacteria | 2869256925 | 2869257110 | 316 |
| 668 | iso_pu_bacteria | 2869264136 | 2869264909 | 316 |
| 669 | iso_pu_bacteria | 2869271264 | 2869271392 | 316 |
| 670 | iso_pu_bacteria | 2869278585 | 2869284630 | 316 |
| 671 | iso_pu_bacteria | 2869285874 | 2869290794 | 316 |
| 672 | iso_pu_bacteria | 2871429161 | 2871433076 | 316 |
| 673 | iso_pu_bacteria | 2871435913 | 2871436781 | 316 |
| 674 | iso_pu_bacteria | 2871444079 | 2871447603 | 316 |
| 675 | iso_pu_bacteria | 2871451962 | 2871458526 | 316 |
| 676 | iso_pu_bacteria | 2871459585 | 2871466010 | 316 |
| 677 | iso_pu_bacteria | 2871466892 | 2871474160 | 316 |
| 678 | iso_pu_bacteria | 2871474448 | 2871481261 | 316 |
| 679 | iso_pu_bacteria | 2871481445 | 2871486932 | 316 |
| 680 | iso_pu_bacteria | 2871488783 | 2871489631 | 316 |
| 681 | iso_pu_bacteria | 2871495908 | 2871502278 | 316 |
| 682 | iso_pu_bacteria | 2874102143 | 2874106073 | 316 |
| 683 | iso_pu_bacteria | 2874109183 | 2874116091 | 316 |
| 684 | iso_pu_bacteria | 2874116593 | 2874118221 | 316 |
| 685 | iso_pu_bacteria | 2874123672 | 2874124218 | 316 |
| 686 | iso_pu_bacteria | 2874131515 | 2874135248 | 316 |
| 687 | iso_pu_bacteria | 2874139085 | 2874143051 | 316 |
| 688 | iso_pu_bacteria | 2874146452 | 2874153763 | 316 |
| 689 | iso_pu_bacteria | 2874155637 | 2874161028 | 316 |
| 690 | iso_pu_bacteria | 2874162495 | 2874168317 | 316 |
| 691 | iso_pu_bacteria | 2874168670 | 2874172235 | 316 |
| 692 | iso_pu_bacteria | 2876363079 | 2876363707 | 316 |
| 693 | iso_pu_bacteria | 2876369609 | 2876376079 | 316 |
| 694 | iso_pu_bacteria | 2876377896 | 2876382817 | 316 |
| 695 | iso_pu_bacteria | 2876386047 | 2876386069 | 316 |
| 696 | iso_pu_bacteria | 2876392853 | 2876397156 | 316 |
| 697 | iso_pu_bacteria | 2876399893 | 2876403769 | 316 |
| 698 | iso_pu_bacteria | 2876406927 | 2876408016 | 316 |
| 699 | iso_pu_bacteria | 2876413966 | 2876419068 | 316 |
| 700 | iso_pu_bacteria | 2876420981 | 2876425443 | 316 |
| 701 | iso_pu_bacteria | 2878035449 | 2878039581 | 316 |
| 702 | iso_pu_bacteria | 2878730984 | 2878736025 | 316 |
| 703 | iso_pu_bacteria | 2878738818 | 2878740881 | 316 |
| 704 | iso_pu_bacteria | 2878745973 | 2878750689 | 316 |
| 705 | iso_pu_bacteria | 2878753008 | 2878754333 | 316 |
| 706 | iso_pu_bacteria | 2878760144 | 2878766169 | 316 |
| 707 | iso_pu_bacteria | 2878767105 | 2878773370 | 316 |
| 708 | iso_pu_bacteria | 2878774303 | 2878778226 | 316 |
| 709 | iso_pu_bacteria | 2878781027 | 2878784575 | 316 |
| 710 | iso_pu_bacteria | 2881147464 | 2881148074 | 316 |
| 711 | iso_pu_bacteria | 2881155292 | 2881159167 | 316 |
| 712 | iso_pu_bacteria | 2881161766 | 2881164865 | 316 |
| 713 | iso_pu_bacteria | 2881853255 | 2881858352 | 316 |
| 714 | iso_pu_bacteria | 2881861095 | 2881862150 | 316 |
| 715 | iso_pu_bacteria | 2882632389 | 2882634601 | 316 |
| 716 | iso_pu_bacteria | 2882912400 | 2882914437 | 316 |
| 717 | iso_pu_bacteria | 2885305155 | 2885306740 | 316 |
| 718 | iso_pu_bacteria | 2885312484 | 2885314295 | 316 |
| 719 | iso_pu_bacteria | 2885318864 | 2885323655 | 316 |
| 720 | iso_pu_bacteria | 2885326080 | 2885328522 | 316 |
| 721 | iso_pu_bacteria | 2885334103 | 2885340175 | 316 |
| 722 | iso_pu_bacteria | 2885342637 | 2885344001 | 316 |
| 723 | iso_pu_bacteria | 2885350715 | 2885352338 | 316 |
| 724 | iso_pu_bacteria | 2888337043 | 2888343256 | 316 |
| 725 | iso_pu_bacteria | 2888343758 | 2888344200 | 316 |
| 726 | iso_pu_bacteria | 2888350351 | 2888353050 | 316 |
| 727 | iso_pu_bacteria | 2889010040 | 2889014795 | 316 |
| 728 | iso_pu_bacteria | 2889016732 | 2889020120 | 316 |
| 729 | iso_pu_bacteria | 2903448605 | 2903454208 | 316 |
| 730 | iso_pu_bacteria | 2903492973 | 2903496296 | 316 |
| 731 | iso_pu_bacteria | 2903492973 | 2903497352 | 316 |
| 732 | iso_pu_bacteria | 2903513507 | 2903519215 | 316 |
| 733 | iso_pu_bacteria | 2903521522 | 2903523232 | 316 |
| 734 | iso_pu_bacteria | 2903528002 | 2903529271 | 316 |
| 735 | iso_pu_bacteria | 2903540706 | 2903547215 | 316 |
| 736 | iso_pu_bacteria | 2904659560 | 2904663910 | 316 |
| 737 | iso_pu_bacteria | 2906308376 | 2906313614 | 316 |
| 738 | iso_pu_bacteria | 2906321335 | 2906326323 | 316 |
| 739 | iso_pu_bacteria | 2906328253 | 2906334288 | 316 |
| 740 | iso_pu_bacteria | 2906354277 | 2906354464 | 316 |
| 741 | iso_pu_bacteria | 2906363423 | 2906369738 | 316 |
| 742 | iso_pu_bacteria | 2906370794 | 2906372854 | 316 |
| 743 | iso_pu_bacteria | 2906378014 | 2906378290 | 316 |
| 744 | iso_pu_bacteria | 2906386501 | 2906388681 | 316 |
| 745 | iso_pu_bacteria | 2906393657 | 2906395178 | 316 |
| 746 | iso_pu_bacteria | 2906401398 | 2906407713 | 316 |
| 747 | iso_pu_bacteria | 2906408224 | 2906409238 | 316 |
| 748 | iso_pu_bacteria | 2906414383 | 2906419264 | 316 |
| 749 | iso_pu_bacteria | 2906427513 | 2906434559 | 316 |
| 750 | iso_pu_bacteria | 2922130491 | 2922136537 | 316 |
| 751 | iso_pu_bacteria | 2922151315 | 2922155288 | 316 |
| 752 | iso_pu_bacteria | 2922158528 | 2922162536 | 316 |
| 753 | iso_pu_bacteria | 2922172374 | 2922174369 | 316 |
| 754 | iso_pu_bacteria | 2922178524 | 2922183243 | 316 |
| 755 | iso_pu_bacteria | 2922185730 | 2922193614 | 316 |
| 756 | iso_pu_bacteria | 2924710171 | 2924714226 | 316 |
| 757 | iso_pu_bacteria | 2924718760 | 2924723401 | 316 |
| 758 | iso_pu_bacteria | 2924726620 | 2924728907 | 316 |
| 759 | iso_pu_bacteria | 2924733363 | 2924736490 | 316 |
| 760 | iso_pu_bacteria | 2924741084 | 2924741481 | 316 |
| 761 | iso_pu_bacteria | 2924748358 | 2924748613 | 316 |
| 762 | iso_pu_bacteria | 2924754689 | 2924755403 | 316 |
| 763 | iso_pu_bacteria | 2924762789 | 2924765626 | 316 |
| 764 | iso_pu_bacteria | 2924776078 | 2924778482 | 316 |
| 765 | iso_pu_bacteria | 2924784321 | 2924785662 | 316 |
| 766 | iso_pu_bacteria | 2933570622 | 2933576582 | 316 |
| 767 | iso_pu_bacteria | 2933586486 | 2933586738 | 316 |
| 768 | iso_pu_bacteria | 2935901341 | 2935904523 | 316 |
| 769 | iso_pu_bacteria | 2936367885 | 2936372950 | 316 |
| 770 | iso_pu_bacteria | 2936375103 | 2936381105 | 316 |
| 771 | iso_pu_bacteria | 2936381700 | 2936384444 | 316 |
| 772 | iso_pu_bacteria | 2937813078 | 2937820081 | 316 |
| 773 | iso_pu_bacteria | 2937822353 | 2937826481 | 316 |
| 774 | iso_pu_bacteria | 2937836603 | 2937843171 | 316 |
| 775 | iso_pu_bacteria | 2937848649 | 2937849524 | 316 |
| 776 | iso_pu_bacteria | 2937861824 | 2937868337 | 316 |
| 777 | iso_pu_bacteria | 2937868953 | 2937876570 | 316 |
| 778 | iso_pu_bacteria | 2937877337 | 2937879963 | 316 |
| 779 | iso_pu_bacteria | 2937891427 | 2937891783 | 316 |
| 780 | iso_pu_bacteria | 2937972304 | 2937980001 | 316 |
| 781 | iso_pu_bacteria | 2937994558 | 2938001078 | 316 |
| 782 | iso_pu_bacteria | 2938014810 | 2938020132 | 316 |
| 783 | iso_pu_bacteria | 2958034702 | 2958041514 | 316 |
| 784 | iso_pu_bacteria | 2958041894 | 2958042490 | 316 |
| 785 | iso_pu_bacteria | 2958064165 | 2958069506 | 316 |
| 786 | iso_pu_bacteria | 2958071322 | 2958077201 | 316 |
| 787 | iso_pu_bacteria | 2958084443 | 2958086027 | 316 |
| 788 | iso_pu_bacteria | 2958092219 | 2958096463 | 316 |
| 789 | iso_pu_bacteria | 2958100919 | 2958101971 | 316 |
| 790 | iso_pu_bacteria | 2958108152 | 2958108179 | 316 |
| 791 | iso_pu_bacteria | 2958115193 | 2958119269 | 316 |
| 792 | iso_pu_bacteria | 2958122699 | 2958123232 | 316 |
| 793 | iso_pu_bacteria | 2958130278 | 2958135194 | 316 |
| 794 | iso_pu_bacteria | 2958137437 | 2958140021 | 316 |
| 795 | iso_pu_bacteria | 2958144490 | 2958148567 | 316 |
| 796 | iso_pu_bacteria | 2958158011 | 2958159884 | 316 |
| 797 | iso_pu_bacteria | 2958165035 | 2958171344 | 316 |
| 798 | iso_pu_bacteria | 2958172287 | 2958178943 | 316 |
| 799 | iso_pu_bacteria | 2958179912 | 2958184223 | 316 |
| 800 | iso_pu_bacteria | 2961077736 | 2961082278 | 316 |
| 801 | iso_pu_bacteria | 2961114664 | 2961118950 | 316 |
| 802 | iso_pu_bacteria | 2961127735 | 2961134095 | 316 |
| 803 | iso_pu_bacteria | 2961136820 | 2961138679 | 316 |
| 804 | iso_pu_bacteria | 2961163497 | 2961169785 | 316 |
| 805 | iso_pu_bacteria | 2961170736 | 2961176387 | 316 |
| 806 | iso_pu_bacteria | 2961183825 | 2961190689 | 316 |
| 807 | iso_pu_bacteria | 2963644680 | 2963645167 | 316 |
| 808 | iso_pu_bacteria | 2965018300 | 2965024545 | 316 |
| 809 | iso_pu_bacteria | 2965025482 | 2965030144 | 316 |
| 810 | iso_pu_bacteria | 2965032056 | 2965036574 | 316 |
| 811 | iso_pu_bacteria | 2965040258 | 2965042355 | 316 |
| 812 | iso_pu_bacteria | 2965047637 | 2965054251 | 316 |
| 813 | iso_pu_bacteria | 2965062239 | 2965065184 | 316 |
| 814 | iso_pu_bacteria | 2965089291 | 2965096583 | 316 |
| 815 | iso_pu_bacteria | 2965102966 | 2965110846 | 316 |
| 816 | iso_pu_bacteria | 2965110997 | 2965112097 | 316 |
| 817 | iso_pu_bacteria | 2965119406 | 2965127218 | 316 |
| 818 | iso_pu_bacteria | 2967996073 | 2967996695 | 316 |
| 819 | iso_pu_bacteria | 2968003550 | 2968004757 | 316 |
| 820 | iso_pu_bacteria | 2968016561 | 2968023035 | 316 |
| 821 | iso_pu_bacteria | 2968083720 | 2968089934 | 316 |
| 822 | iso_pu_bacteria | 2968091066 | 2968093700 | 316 |
| 823 | iso_pu_bacteria | 2968097103 | 2968098530 | 316 |
| 824 | iso_pu_bacteria | 2968110612 | 2968115049 | 316 |
| 825 | iso_pu_bacteria | 2968117919 | 2968122774 | 316 |
| 826 | iso_pu_bacteria | 2968128360 | 2968133867 | 316 |
| 827 | iso_pu_bacteria | 2968138860 | 2968143829 | 316 |
| 828 | iso_pu_bacteria | 2968171901 | 2968178177 | 316 |
| 829 | iso_pu_bacteria | 2970469710 | 2970475619 | 316 |
| 830 | iso_pu_bacteria | 2970489779 | 2970492413 | 316 |
| 831 | iso_pu_bacteria | 2970503327 | 2970509058 | 316 |
| 832 | iso_pu_bacteria | 2970510686 | 2970511269 | 316 |
| 833 | iso_pu_bacteria | 2970524798 | 2970525909 | 316 |
| 834 | iso_pu_bacteria | 2970532167 | 2970536428 | 316 |
| 835 | iso_pu_bacteria | 2970540015 | 2970545641 | 316 |
| 836 | iso_pu_bacteria | 2970547951 | 2970550154 | 316 |
| 837 | iso_pu_bacteria | 2970554993 | 2970561023 | 316 |
| 838 | iso_pu_bacteria | 2970593180 | 2970599242 | 316 |
| 839 | iso_pu_bacteria | 2970619444 | 2970622076 | 316 |
| 840 | iso_pu_bacteria | 2970627176 | 2970633255 | 316 |
| 841 | iso_pu_bacteria | 2977821940 | 2977823547 | 316 |
| 842 | iso_pu_bacteria | 2977843712 | 2977850375 | 316 |
| 843 | iso_pu_bacteria | 2977851361 | 2977855221 | 316 |
| 844 | iso_pu_bacteria | 2977858184 | 2977863405 | 316 |
| 845 | iso_pu_bacteria | 2977864932 | 2977871677 | 316 |
| 846 | iso_pu_bacteria | 2977872689 | 2977873767 | 316 |
| 847 | iso_pu_bacteria | 2977898635 | 2977906580 | 316 |
| 848 | iso_pu_bacteria | 2977907340 | 2977909267 | 316 |
| 849 | iso_pu_bacteria | 2977915119 | 2977917039 | 316 |
| 850 | iso_pu_bacteria | 2977922695 | 2977925681 | 316 |
| 851 | iso_pu_bacteria | 2977935797 | 2977938218 | 316 |
| 852 | iso_pu_bacteria | 2977942078 | 2977943459 | 316 |
| 853 | iso_pu_bacteria | 2977950692 | 2977954505 | 316 |
| 854 | iso_pu_bacteria | 2977957713 | 2977957964 | 316 |
| 855 | iso_pu_bacteria | 2977971508 | 2977975316 | 316 |
| 856 | iso_pu_bacteria | 2977986579 | 2977989259 | 316 |
| 857 | iso_pu_bacteria | 2979710463 | 2979713679 | 316 |
| 858 | iso_pu_bacteria | 2979742915 | 2979750181 | 316 |
| 859 | iso_pu_bacteria | 2979764755 | 2979765821 | 316 |
| 860 | iso_pu_bacteria | 2979772303 | 2979773211 | 316 |
| 861 | iso_pu_bacteria | 2979779861 | 2979781778 | 316 |
| 862 | iso_pu_bacteria | 2979793036 | 2979797007 | 316 |
| 863 | iso_pu_bacteria | 2979808191 | 2979813737 | 316 |
| 864 | iso_pu_bacteria | 2980125574 | 2980127614 | 316 |
| 865 | iso_pu_bacteria | 2987636660 | 2987641411 | 316 |
| 866 | iso_pu_bacteria | 2987645492 | 2987648147 | 316 |
| 867 | iso_pu_bacteria | 2987652177 | 2987656396 | 316 |
| 868 | iso_pu_bacteria | 2987659509 | 2987666009 | 316 |
| 869 | iso_pu_bacteria | 2987666974 | 2987669371 | 316 |
| 870 | iso_pu_bacteria | 2987673487 | 2987675693 | 316 |
| 871 | iso_pu_bacteria | 2996341866 | 2996342451 | 316 |
| 872 | iso_pu_bacteria | 2996348954 | 2996355771 | 316 |
| 873 | iso_pu_bacteria | 2996386984 | 2996390524 | 316 |
| 874 | iso_pu_bacteria | 2996887358 | 2996893073 | 316 |
| 875 | iso_pu_bacteria | 2996893221 | 2996897512 | 316 |
| 876 | iso_pu_bacteria | 3000135777 | 3000137264 | 316 |
| 877 | iso_pu_bacteria | 3004167301 | 3004173087 | 316 |
| 878 | iso_pu_bacteria | 3004188549 | 3004195032 | 316 |
| 879 | iso_pu_bacteria | 3004195979 | 3004197112 | 316 |
| 880 | iso_pu_bacteria | 3004203850 | 3004210221 | 316 |
| 881 | iso_pu_bacteria | 3004211236 | 3004217216 | 316 |
| 882 | iso_pu_bacteria | 3004218560 | 3004220518 | 316 |
| 883 | iso_pu_bacteria | 3004232784 | 3004234562 | 316 |
| 884 | iso_pu_bacteria | 3004239961 | 3004243188 | 316 |
| 885 | iso_pu_bacteria | 3004248173 | 3004253949 | 316 |
| 886 | iso_pu_bacteria | 3004268573 | 3004274186 | 316 |
| 887 | iso_pu_bacteria | 3004275668 | 3004282197 | 316 |
| 888 | iso_pu_bacteria | 3004334049 | 3004337550 | 316 |
| 889 | iso_pu_bacteria | 637000159 | 637077185 | 316 |
| 890 | iso_pu_bacteria | 639633055 | 639648329 | 316 |
| 891 | iso_pu_bacteria | 649633066 | 649870386 | 316 |
| 892 | iso_pu_bacteria | 8004300914 | 8004302690 | 316 |
| 893 | iso_pu_bacteria | 8004361976 | 8004366122 | 316 |
| 894 | iso_pu_bacteria | 8004374579 | 8004375909 | 316 |
| 895 | iso_pu_bacteria | 8004387939 | 8004393083 | 316 |
| 896 | iso_pu_bacteria | 8004395343 | 8004399900 | 316 |
| 897 | iso_pu_bacteria | 8004633249 | 8004638419 | 316 |
| 898 | iso_pu_bacteria | 8004640170 | 8004641579 | 316 |
| 899 | iso_pu_bacteria | 8004695233 | 8004701016 | 316 |
| 900 | iso_pu_bacteria | 8004703790 | 8004706853 | 316 |
| 901 | iso_pu_bacteria | 8004714634 | 8004719870 | 316 |
| 902 | iso_pu_bacteria | 8004727605 | 8004728947 | 316 |
| 903 | iso_pu_bacteria | 8005275841 | 8005277615 | 316 |
| 904 | iso_pu_bacteria | 8005307578 | 8005314310 | 316 |
| 905 | iso_pu_bacteria | 8005321885 | 8005327600 | 316 |
| 906 | iso_pu_bacteria | 8005376324 | 8005378971 | 316 |
| 907 | iso_pu_bacteria | 8005460587 | 8005462713 | 316 |
| 908 | iso_pu_bacteria | 8005542996 | 8005547826 | 316 |
| 909 | iso_pu_bacteria | 8005556819 | 8005557944 | 316 |
| 910 | iso_pu_bacteria | 8005563573 | 8005569118 | 316 |
| 911 | iso_pu_bacteria | 8005570704 | 8005576128 | 316 |
| 912 | iso_pu_bacteria | 8005695170 | 8005697849 | 316 |
| 913 | iso_pu_bacteria | 8018163183 | 8018168277 | 316 |
| 914 | iso_pu_bacteria | 8018176218 | 8018180483 | 316 |
| 915 | iso_pu_bacteria | 8023680758 | 8023681128 | 316 |
| 916 | iso_pu_bacteria | 8024479707 | 8024485931 | 316 |
| 917 | iso_pu_bacteria | 8055617313 | 8055617723 | 316 |
| 918 | iso_pu_bacteria | 8056375014 | 8056377842 | 316 |
| 919 | iso_pu_bacteria | 8057874678 | 8057875293 | 316 |
| 920 | 3300038443 | Ga0395901_0012394 | Ga0395901_0012394_986_1939 | 317 |
| 921 | iso_pu_bacteria | 2510917030 | 2511195001 | 317 |
| 922 | iso_pu_bacteria | 2513237088 | 2513594930 | 317 |
| 923 | iso_pu_bacteria | 2513237138 | 2513867253 | 317 |
| 924 | iso_pu_bacteria | 2582581298 | 2585226315 | 317 |
| 925 | iso_pu_bacteria | 2582581867 | 2585401896 | 317 |
| 926 | iso_pu_bacteria | 2585427529 | 2585548765 | 317 |
| 927 | iso_pu_bacteria | 2585427590 | 2585820311 | 317 |
| 928 | iso_pu_bacteria | 2718217997 | 2719667075 | 317 |
| 929 | iso_pu_bacteria | 2718218199 | 2720493495 | 317 |
| 930 | iso_pu_bacteria | 2718218232 | 2720614952 | 317 |
| 931 | iso_pu_bacteria | 2718218233 | 2720621724 | 317 |
| 932 | iso_pu_bacteria | 2718218235 | 2720633054 | 317 |
| 933 | iso_pu_bacteria | 2718218269 | 2720776778 | 317 |
| 934 | iso_pu_bacteria | 2721755556 | 2723028367 | 317 |
| 935 | iso_pu_bacteria | 2721755684 | 2723561994 | 317 |
| 936 | iso_pu_bacteria | 2721755685 | 2723568626 | 317 |
| 937 | iso_pu_bacteria | 2721755819 | 2724091385 | 317 |
| 938 | iso_pu_bacteria | 2721755822 | 2724105891 | 317 |
| 939 | iso_pu_bacteria | 2721755823 | 2724111716 | 317 |
| 940 | iso_pu_bacteria | 2728369352 | 2730109303 | 317 |
| 941 | iso_pu_bacteria | 2791355261 | 2793331610 | 317 |
| 942 | iso_pu_bacteria | 2838016132 | 2838022451 | 317 |
| 943 | iso_pu_bacteria | 2838048938 | 2838054533 | 317 |
| 944 | iso_pu_bacteria | 2838061910 | 2838068317 | 317 |
| 945 | iso_pu_bacteria | 2838068647 | 2838074644 | 317 |
| 946 | iso_pu_bacteria | 2842264693 | 2842270856 | 317 |
| 947 | iso_pu_bacteria | 2842311132 | 2842317350 | 317 |
| 948 | iso_pu_bacteria | 2842422224 | 2842428250 | 317 |
| 949 | iso_pu_bacteria | 2842428310 | 2842434739 | 317 |
| 950 | iso_pu_bacteria | 2842434925 | 2842441099 | 317 |
| 951 | iso_pu_bacteria | 2842441272 | 2842447717 | 317 |
| 952 | iso_pu_bacteria | 2842447887 | 2842454402 | 317 |
| 953 | iso_pu_bacteria | 2842462802 | 2842469100 | 317 |
| 954 | iso_pu_bacteria | 2842469257 | 2842475646 | 317 |
| 955 | iso_pu_bacteria | 2842495871 | 2842501401 | 317 |
| 956 | iso_pu_bacteria | 2923556063 | 2923558618 | 317 |
| 957 | iso_pu_bacteria | 2933599457 | 2933605099 | 317 |
| 958 | iso_pu_bacteria | 3003930520 | 3003930691 | 317 |
| 959 | iso_pu_bacteria | 3005445848 | 3005452087 | 317 |
| 960 | iso_pu_bacteria | 8005282627 | 8005286972 | 317 |
| 961 | iso_pu_bacteria | 8005395548 | 8005399379 | 317 |
| 962 | iso_pu_bacteria | 8005430974 | 8005435454 | 317 |
| 963 | iso_pu_bacteria | 8005497431 | 8005501816 | 317 |
| 964 | iso_pu_bacteria | 8005619151 | 8005623170 | 317 |
| 965 | iso_pu_bacteria | 8005626139 | 8005629002 | 317 |
| 966 | iso_pu_bacteria | 8005668836 | 8005673239 | 317 |
| 967 | 3300002737 | JGI25162J39368_1000720 | JGI25162J39368_100072020 | 318 |
| 968 | 3300003214 | JGI25165J46597_1000556 | JGI25165J46597_10005567 | 318 |
| 969 | 3300003323 | rootH1_10147757 | rootH1_101477571 | 318 |
| 970 | 3300009098 | Ga0105245_10100008 | Ga0105245_101000082 | 318 |
| 971 | 3300025228 | Ga0209672_104215 | Ga0209672_1042151 | 318 |
| 972 | 3300025233 | Ga0209437_100104 | Ga0209437_100104159 | 318 |
| 973 | 3300025261 | Ga0209233_1000279 | Ga0209233_100027938 | 318 |
| 974 | 3300025284 | Ga0209130_1010486 | Ga0209130_10104861 | 318 |
| 975 | 3300027312 | Ga0209371_1004496 | Ga0209371_10044966 | 318 |
| 976 | 3300030500 | Ga0268256_1003212 | Ga0268256_10032128 | 318 |
| 977 | 3300044765 | Ga0466970_0000026 | Ga0466970_0000026_31629_32585 | 318 |
| 978 | 3300046460 | Ga0495638_0012275 | Ga0495638_0012275_2317_3291 | 318 |
| 979 | 3300053125 | Ga0500618_001303 | Ga0500618_001303_8902_9858 | 318 |
| 980 | 3300053136 | Ga0500559_0050552 | Ga0500559_0050552_339_1298 | 319 |
| 981 | 3300002705 | JGI25156J39149_1005229 | JGI25156J39149_10052292 | 320 |
| 982 | 3300002739 | JGI25158J39367_1000130 | JGI25158J39367_100013011 | 320 |
| 983 | 3300002741 | JGI25157J39369_1000647 | JGI25157J39369_100064720 | 320 |
| 984 | 3300002773 | JGI25152J39213_1000768 | JGI25152J39213_10007685 | 320 |
| 985 | 3300002773 | JGI25152J39213_1001049 | JGI25152J39213_10010497 | 320 |
| 986 | 3300002987 | JGI25159J45721_1003170 | JGI25159J45721_10031702 | 320 |
| 987 | 3300003187 | JGI25151J46595_10001716 | JGI25151J46595_100017169 | 320 |
| 988 | 3300003214 | JGI25165J46597_1000078 | JGI25165J46597_1000078119 | 320 |
| 989 | 3300003215 | JGI25153J46596_10000532 | JGI25153J46596_100005325 | 320 |
| 990 | 3300003215 | JGI25153J46596_10001241 | JGI25153J46596_1000124110 | 320 |
| 991 | 3300003215 | JGI25153J46596_10002978 | JGI25153J46596_100029784 | 320 |
| 992 | 3300003215 | JGI25153J46596_10012294 | JGI25153J46596_100122943 | 320 |
| 993 | 3300003354 | JGI25160J50197_1006047 | JGI25160J50197_10060475 | 320 |
| 994 | 3300003374 | JGI25161J50226_1000188 | JGI25161J50226_10001887 | 320 |
| 995 | 3300003762 | Ga0055542_1000814 | Ga0055542_100081411 | 320 |
| 996 | 3300003763 | Ga0055529_1001740 | Ga0055529_10017403 | 320 |
| 997 | 3300003771 | Ga0055526_1001352 | Ga0055526_100135211 | 320 |
| 998 | 3300003771 | Ga0055526_1001382 | Ga0055526_10013827 | 320 |
| 999 | 3300003771 | Ga0055526_1001442 | Ga0055526_100144216 | 320 |
| 1000 | 3300003775 | Ga0055524_1001040 | Ga0055524_100104016 | 320 |
| 1001 | 3300003775 | Ga0055524_1008223 | Ga0055524_10082233 | 320 |
| 1002 | 3300003775 | Ga0055524_1009824 | Ga0055524_10098241 | 320 |
| 1003 | 3300003790 | Ga0055528_1000223 | Ga0055528_100022337 | 320 |
| 1004 | 3300003790 | Ga0055528_1000597 | Ga0055528_100059727 | 320 |
| 1005 | 3300003790 | Ga0055528_1023366 | Ga0055528_10233662 | 320 |
| 1006 | 3300003792 | Ga0055540_1000096 | Ga0055540_100009641 | 320 |
| 1007 | 3300003792 | Ga0055540_1011814 | Ga0055540_10118141 | 320 |
| 1008 | 3300003792 | Ga0055540_1017010 | Ga0055540_10170102 | 320 |
| 1009 | 3300004625 | Ga0055543_1000565 | Ga0055543_100056512 | 320 |
| 1010 | 3300004625 | Ga0055543_1000877 | Ga0055543_10008779 | 320 |
| 1011 | 3300005262 | Ga0065165_1007005 | Ga0065165_10070056 | 320 |
| 1012 | 3300005262 | Ga0065165_1044198 | Ga0065165_10441981 | 320 |
| 1013 | 3300005353 | Ga0070669_100091611 | Ga0070669_1000916112 | 320 |
| 1014 | 3300005367 | Ga0070667_100370994 | Ga0070667_1003709941 | 320 |
| 1015 | 3300005455 | Ga0070663_100161983 | Ga0070663_1001619831 | 320 |
| 1016 | 3300005456 | Ga0070678_100150904 | Ga0070678_1001509042 | 320 |
| 1017 | 3300005578 | Ga0068854_100060919 | Ga0068854_1000609192 | 320 |
| 1018 | 3300005834 | Ga0068851_10017949 | Ga0068851_100179491 | 320 |
| 1019 | 3300005937 | Ga0081455_10068812 | Ga0081455_100688123 | 320 |
| 1020 | 3300006038 | Ga0075365_10044243 | Ga0075365_100442432 | 320 |
| 1021 | 3300006038 | Ga0075365_10059257 | Ga0075365_100592573 | 320 |
| 1022 | 3300006042 | Ga0075368_10012328 | Ga0075368_100123282 | 320 |
| 1023 | 3300006042 | Ga0075368_10025686 | Ga0075368_100256861 | 320 |
| 1024 | 3300006051 | Ga0075364_10065112 | Ga0075364_100651122 | 320 |
| 1025 | 3300006177 | Ga0075362_10014495 | Ga0075362_100144951 | 320 |
| 1026 | 3300006177 | Ga0075362_10026475 | Ga0075362_100264752 | 320 |
| 1027 | 3300006178 | Ga0075367_10001159 | Ga0075367_100011592 | 320 |
| 1028 | 3300006178 | Ga0075367_10034536 | Ga0075367_100345362 | 320 |
| 1029 | 3300006178 | Ga0075367_10125092 | Ga0075367_101250921 | 320 |
| 1030 | 3300006186 | Ga0075369_10047733 | Ga0075369_100477332 | 320 |
| 1031 | 3300006195 | Ga0075366_10003595 | Ga0075366_100035957 | 320 |
| 1032 | 3300006353 | Ga0075370_10014844 | Ga0075370_100148443 | 320 |
| 1033 | 3300006353 | Ga0075370_10040346 | Ga0075370_100403462 | 320 |
| 1034 | 3300006353 | Ga0075370_10132401 | Ga0075370_101324011 | 320 |
| 1035 | 3300009093 | Ga0105240_10000290 | Ga0105240_1000029046 | 320 |
| 1036 | 3300009148 | Ga0105243_10171096 | Ga0105243_101710962 | 320 |
| 1037 | 3300009177 | Ga0105248_10071086 | Ga0105248_100710862 | 320 |
| 1038 | 3300009545 | Ga0105237_10003793 | Ga0105237_100037933 | 320 |
| 1039 | 3300009765 | Ga0123341_1000005 | Ga0123341_1000005143 | 320 |
| 1040 | 3300010375 | Ga0105239_10000202 | Ga0105239_1000020241 | 320 |
| 1041 | 3300013104 | Ga0157370_10003913 | Ga0157370_1000391314 | 320 |
| 1042 | 3300013104 | Ga0157370_10150196 | Ga0157370_101501961 | 320 |
| 1043 | 3300013105 | Ga0157369_10252267 | Ga0157369_102522671 | 320 |
| 1044 | 3300013296 | Ga0157374_10204808 | Ga0157374_102048081 | 320 |
| 1045 | 3300013306 | Ga0163162_10485796 | Ga0163162_104857961 | 320 |
| 1046 | 3300014325 | Ga0163163_10445410 | Ga0163163_104454101 | 320 |
| 1047 | 3300015262 | Ga0182007_10005402 | Ga0182007_100054023 | 320 |
| 1048 | 3300015262 | Ga0182007_10030581 | Ga0182007_100305812 | 320 |
| 1049 | 3300015265 | Ga0182005_1001606 | Ga0182005_10016067 | 320 |
| 1050 | 3300015265 | Ga0182005_1009555 | Ga0182005_10095552 | 320 |
| 1051 | 3300025208 | Ga0209436_100007 | Ga0209436_1000077 | 320 |
| 1052 | 3300025245 | Ga0207425_1001067 | Ga0207425_100106714 | 320 |
| 1053 | 3300025245 | Ga0207425_1008858 | Ga0207425_10088581 | 320 |
| 1054 | 3300025250 | Ga0209026_1000151 | Ga0209026_100015156 | 320 |
| 1055 | 3300025253 | Ga0209677_100613 | Ga0209677_1006133 | 320 |
| 1056 | 3300025254 | Ga0209148_1000032 | Ga0209148_1000032511 | 320 |
| 1057 | 3300025256 | Ga0209759_1000350 | Ga0209759_100035062 | 320 |
| 1058 | 3300025258 | Ga0209129_1000615 | Ga0209129_10006155 | 320 |
| 1059 | 3300025258 | Ga0209129_1002198 | Ga0209129_10021989 | 320 |
| 1060 | 3300025258 | Ga0209129_1004197 | Ga0209129_10041972 | 320 |
| 1061 | 3300025261 | Ga0209233_1000150 | Ga0209233_100015063 | 320 |
| 1062 | 3300025261 | Ga0209233_1000334 | Ga0209233_100033410 | 320 |
| 1063 | 3300025261 | Ga0209233_1008548 | Ga0209233_10085482 | 320 |
| 1064 | 3300025272 | Ga0209455_1000085 | Ga0209455_1000085161 | 320 |
| 1065 | 3300025273 | Ga0209673_1000162 | Ga0209673_100016216 | 320 |
| 1066 | 3300025273 | Ga0209673_1000452 | Ga0209673_100045227 | 320 |
| 1067 | 3300025273 | Ga0209673_1009347 | Ga0209673_10093471 | 320 |
| 1068 | 3300025273 | Ga0209673_1010927 | Ga0209673_10109272 | 320 |
| 1069 | 3300025273 | Ga0209673_1021868 | Ga0209673_10218682 | 320 |
| 1070 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001763 | 320 |
| 1071 | 3300025294 | Ga0209025_1003516 | Ga0209025_100351610 | 320 |
| 1072 | 3300025294 | Ga0209025_1040913 | Ga0209025_10409132 | 320 |
| 1073 | 3300025295 | Ga0209564_1000215 | Ga0209564_100021570 | 320 |
| 1074 | 3300025295 | Ga0209564_1001754 | Ga0209564_100175416 | 320 |
| 1075 | 3300025295 | Ga0209564_1001771 | Ga0209564_100177110 | 320 |
| 1076 | 3300025295 | Ga0209564_1001922 | Ga0209564_100192217 | 320 |
| 1077 | 3300025295 | Ga0209564_1013613 | Ga0209564_10136133 | 320 |
| 1078 | 3300025295 | Ga0209564_1023985 | Ga0209564_10239851 | 320 |
| 1079 | 3300025297 | Ga0209758_1001171 | Ga0209758_100117110 | 320 |
| 1080 | 3300025297 | Ga0209758_1001256 | Ga0209758_10012565 | 320 |
| 1081 | 3300025297 | Ga0209758_1021846 | Ga0209758_10218461 | 320 |
| 1082 | 3300025298 | Ga0209050_1002710 | Ga0209050_10027108 | 320 |
| 1083 | 3300025299 | Ga0209256_1000155 | Ga0209256_100015546 | 320 |
| 1084 | 3300025299 | Ga0209256_1002089 | Ga0209256_100208916 | 320 |
| 1085 | 3300025299 | Ga0209256_1006482 | Ga0209256_10064823 | 320 |
| 1086 | 3300025299 | Ga0209256_1011321 | Ga0209256_10113212 | 320 |
| 1087 | 3300025299 | Ga0209256_1011950 | Ga0209256_10119503 | 320 |
| 1088 | 3300025299 | Ga0209256_1012861 | Ga0209256_10128612 | 320 |
| 1089 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045372 | 320 |
| 1090 | 3300025302 | Ga0207426_1001182 | Ga0207426_100118219 | 320 |
| 1091 | 3300025302 | Ga0207426_1001839 | Ga0207426_100183913 | 320 |
| 1092 | 3300025303 | Ga0209051_1000027 | Ga0209051_1000027121 | 320 |
| 1093 | 3300025303 | Ga0209051_1001530 | Ga0209051_10015303 | 320 |
| 1094 | 3300025303 | Ga0209051_1001728 | Ga0209051_100172812 | 320 |
| 1095 | 3300025303 | Ga0209051_1018027 | Ga0209051_10180272 | 320 |
| 1096 | 3300025304 | Ga0209257_1008589 | Ga0209257_10085894 | 320 |
| 1097 | 3300025304 | Ga0209257_1019503 | Ga0209257_10195032 | 320 |
| 1098 | 3300025321 | Ga0207656_10043269 | Ga0207656_100432691 | 320 |
| 1099 | 3300025909 | Ga0207705_10077465 | Ga0207705_100774652 | 320 |
| 1100 | 3300025913 | Ga0207695_10000385 | Ga0207695_1000038540 | 320 |
| 1101 | 3300025914 | Ga0207671_10000330 | Ga0207671_1000033049 | 320 |
| 1102 | 3300025919 | Ga0207657_10049709 | Ga0207657_100497092 | 320 |
| 1103 | 3300025935 | Ga0207709_10133835 | Ga0207709_101338352 | 320 |
| 1104 | 3300025941 | Ga0207711_10303238 | Ga0207711_103032381 | 320 |
| 1105 | 3300026067 | Ga0207678_10165220 | Ga0207678_101652202 | 320 |
| 1106 | 3300026089 | Ga0207648_10160608 | Ga0207648_101606081 | 320 |
| 1107 | 3300027866 | Ga0209813_10010745 | Ga0209813_100107452 | 320 |
| 1108 | 3300028379 | Ga0268266_10174378 | Ga0268266_101743781 | 320 |
| 1109 | 3300035692 | Ga0373935_0165401 | Ga0373935_0165401_219_1181 | 320 |
| 1110 | 3300035695 | Ga0373927_0001752 | Ga0373927_0001752_6501_7463 | 320 |
| 1111 | 3300037068 | Ga0373925_0003065 | Ga0373925_0003065_9888_10850 | 320 |
| 1112 | 3300037418 | Ga0395900_0132046 | Ga0395900_0132046_1490_2452 | 320 |
| 1113 | 3300037471 | Ga0395905_0000478 | Ga0395905_0000478_35973_36935 | 320 |
| 1114 | 3300038443 | Ga0395901_0036575 | Ga0395901_0036575_2592_3554 | 320 |
| 1115 | 3300041458 | Ga0451798_1089163 | Ga0451798_1089163_166_1128 | 320 |
| 1116 | 3300041494 | Ga0451837_1818733 | Ga0451837_1818733_59_1021 | 320 |
| 1117 | 3300041507 | Ga0451851_0704329 | Ga0451851_0704329_1015_1977 | 320 |
| 1118 | 3300041511 | Ga0451855_1946060 | Ga0451855_1946060_98_1060 | 320 |
| 1119 | 3300044658 | Ga0466972_0052203 | Ga0466972_0052203_345_1307 | 320 |
| 1120 | 3300046492 | Ga0495585_0028964 | Ga0495585_0028964_1952_2914 | 320 |
| 1121 | 3300046501 | Ga0495607_0078152 | Ga0495607_0078152_470_1432 | 320 |
| 1122 | 3300046507 | Ga0495606_0002343 | Ga0495606_0002343_7636_8598 | 320 |
| 1123 | 3300046507 | Ga0495606_0010989 | Ga0495606_0010989_1714_2676 | 320 |
| 1124 | 3300046512 | Ga0495610_0097720 | Ga0495610_0097720_229_1191 | 320 |
| 1125 | 3300046515 | Ga0495620_0037677 | Ga0495620_0037677_963_1925 | 320 |
| 1126 | 3300046522 | Ga0495643_0017660 | Ga0495643_0017660_325_1287 | 320 |
| 1127 | 3300046810 | Ga0495660_0084364 | Ga0495660_0084364_346_1308 | 320 |
| 1128 | 3300046810 | Ga0495660_0117147 | Ga0495660_0117147_53_1015 | 320 |
| 1129 | 3300047443 | Ga0495687_010319 | Ga0495687_010319_1676_2638 | 320 |
| 1130 | 3300047472 | Ga0495686_0145678 | Ga0495686_0145678_171_1133 | 320 |
| 1131 | 3300048905 | Ga0496102_0003841 | Ga0496102_0003841_1180_2142 | 320 |
| 1132 | 3300048906 | Ga0496103_0002355 | Ga0496103_0002355_10948_11910 | 320 |
| 1133 | 3300048907 | Ga0496104_0214045 | Ga0496104_0214045_176_1138 | 320 |
| 1134 | 3300048915 | Ga0496112_0113433 | Ga0496112_0113433_1471_2433 | 320 |
| 1135 | 3300048916 | Ga0496113_0023688 | Ga0496113_0023688_1822_2784 | 320 |
| 1136 | 3300048917 | Ga0496114_0325412 | Ga0496114_0325412_61_1023 | 320 |
| 1137 | 3300048919 | Ga0496116_0110626 | Ga0496116_0110626_21_983 | 320 |
| 1138 | 3300048920 | Ga0496117_0001433 | Ga0496117_0001433_23058_24020 | 320 |
| 1139 | 3300048921 | Ga0496118_0001911 | Ga0496118_0001911_23058_24020 | 320 |
| 1140 | 3300048923 | Ga0496120_0000724 | Ga0496120_0000724_44191_45153 | 320 |
| 1141 | 3300048924 | Ga0496121_0000084 | Ga0496121_0000084_163827_164789 | 320 |
| 1142 | 3300048925 | Ga0496122_0008494 | Ga0496122_0008494_548_1510 | 320 |
| 1143 | 3300048925 | Ga0496122_0009487 | Ga0496122_0009487_4473_5435 | 320 |
| 1144 | 3300048926 | Ga0496123_0005298 | Ga0496123_0005298_3899_4861 | 320 |
| 1145 | 3300048927 | Ga0496124_0014760 | Ga0496124_0014760_859_1824 | 320 |
| 1146 | 3300048927 | Ga0496124_0019235 | Ga0496124_0019235_866_1828 | 320 |
| 1147 | 3300048927 | Ga0496124_0118451 | Ga0496124_0118451_165_1127 | 320 |
| 1148 | 3300048928 | Ga0496125_0000402 | Ga0496125_0000402_15543_16505 | 320 |
| 1149 | 3300049568 | Ga0501031_0000060 | Ga0501031_0000060_4020_4982 | 320 |
| 1150 | 3300049569 | Ga0501032_0000081 | Ga0501032_0000081_77347_78309 | 320 |
| 1151 | 3300049569 | Ga0501032_0033118 | Ga0501032_0033118_455_1417 | 320 |
| 1152 | 3300049570 | Ga0501033_0002397 | Ga0501033_0002397_13637_14599 | 320 |
| 1153 | 3300049570 | Ga0501033_0006361 | Ga0501033_0006361_3988_4950 | 320 |
| 1154 | 3300049571 | Ga0501034_0000186 | Ga0501034_0000186_4323_5285 | 320 |
| 1155 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_180933_181895 | 320 |
| 1156 | 3300049573 | Ga0501037_0000095 | Ga0501037_0000095_77375_78337 | 320 |
| 1157 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_84574_85536 | 320 |
| 1158 | 3300049574 | Ga0501038_0118802 | Ga0501038_0118802_503_1465 | 320 |
| 1159 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_262977_263939 | 320 |
| 1160 | 3300049579 | Ga0501043_0010365 | Ga0501043_0010365_3933_4895 | 320 |
| 1161 | 3300049579 | Ga0501043_0140082 | Ga0501043_0140082_455_1417 | 320 |
| 1162 | 3300049581 | Ga0501047_0016456 | Ga0501047_0016456_1802_2764 | 320 |
| 1163 | 3300049581 | Ga0501047_0065947 | Ga0501047_0065947_2050_3012 | 320 |
| 1164 | 3300049582 | Ga0501048_0015893 | Ga0501048_0015893_579_1541 | 320 |
| 1165 | 3300049584 | Ga0501068_0041832 | Ga0501068_0041832_1035_1997 | 320 |
| 1166 | 3300049586 | Ga0501070_0017670 | Ga0501070_0017670_99_1061 | 320 |
| 1167 | 3300049588 | Ga0501072_0059018 | Ga0501072_0059018_630_1592 | 320 |
| 1168 | 3300049589 | Ga0501073_0073127 | Ga0501073_0073127_736_1698 | 320 |
| 1169 | 3300049742 | Ga0501080_0088117 | Ga0501080_0088117_237_1199 | 320 |
| 1170 | 3300049822 | Ga0501035_0000022 | Ga0501035_0000022_3966_4928 | 320 |
| 1171 | 3300049822 | Ga0501035_0068774 | Ga0501035_0068774_718_1680 | 320 |
| 1172 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_111214_112176 | 320 |
| 1173 | 3300049823 | Ga0501044_0064575 | Ga0501044_0064575_1609_2571 | 320 |
| 1174 | 3300049824 | Ga0501045_0027119 | Ga0501045_0027119_1456_2418 | 320 |
| 1175 | 3300050492 | nmdc:mga0yw44_59994_c1 | nmdc:mga0yw44_59994_c1_794_1756 | 320 |
| 1176 | 3300050494 | nmdc:mga06z11_39270_c1 | nmdc:mga06z11_39270_c1_518_1480 | 320 |
| 1177 | 3300050494 | nmdc:mga06z11_87494_c1 | nmdc:mga06z11_87494_c1_71_1033 | 320 |
| 1178 | 3300050496 | nmdc:mga07m45_384_c1 | nmdc:mga07m45_384_c1_203_1165 | 320 |
| 1179 | 3300050496 | nmdc:mga07m45_87393_c1 | nmdc:mga07m45_87393_c1_477_1439 | 320 |
| 1180 | 3300050516 | nmdc:mga0sz30_52329_c1 | nmdc:mga0sz30_52329_c1_237_1199 | 320 |
| 1181 | 3300053109 | Ga0500569_052581 | Ga0500569_052581_48_1010 | 320 |
| 1182 | 3300053134 | Ga0500658_0001900 | Ga0500658_0001900_438_1400 | 320 |
| 1183 | 3300053153 | Ga0500616_0051254 | Ga0500616_0051254_107_1069 | 320 |
| 1184 | 3300053155 | Ga0500620_000073 | Ga0500620_000073_10462_11424 | 320 |
| 1185 | 3300059478 | Ga0587093_009592 | Ga0587093_009592_63_1025 | 320 |
| 1186 | 3300059504 | Ga0587082_008725 | Ga0587082_008725_106_1068 | 320 |
| 1187 | 3300059604 | Ga0587098_004952 | Ga0587098_004952_205_1167 | 320 |
| 1188 | 3300059643 | Ga0587072_016002 | Ga0587072_016002_101_1063 | 320 |
| 1189 | 3300060344 | Ga0587071_020586 | Ga0587071_020586_192_1154 | 320 |
| 1190 | iso_pu_bacteria | 2599185170 | 2599416317 | 320 |
| 1191 | iso_pu_bacteria | 8005382845 | 8005386420 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00532
Peripla_BP_1
Periplasmic binding proteins and sugar binding domain of LacI family
68
284
0.79
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g1w-assembly1.cif.gz_B | crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans | 0.9256 | 29 | 310 |
| 3g1w-assembly1.cif.gz_A | crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans | 0.9074 | 31 | 310 |
| 6sw4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9056 | 30 | 310 |
| 3g1w-assembly1.cif.gz_B | crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans | 0.8981 | 29 | 310 |
| 1tm2-assembly1.cif.gz_A | crystal structure of the apo form of the salmonella typhimurium ai-2 receptor lsrb | 0.8936 | 31 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qvcB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9069 | 32 | 132 | 3.40.50.2300 |
| 4wutA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9061 | 134 | 262 | 3.40.50.2300 |
| 5ibqA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9037 | 134 | 308 | 3.40.50.2300 |
| 5dteD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9037 | 131 | 310 | 3.40.50.2300 |
| 4rxtA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9018 | 134 | 264 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6JXN6-F1-model_v4 | Substrate-binding domain-containing protein | 0.9376 | 30 | 313 |
GO:0007165
GO:0016020 |
| AF-A0A6C1QXF3-F1-model_v4 | Sugar ABC transporter substrate-binding protein | 0.9282 | 41 | 314 |
GO:0005886
GO:0030246 GO:0030313 |
| AF-A0A7X6ZUB6-F1-model_v4 | Substrate-binding domain-containing protein | 0.9254 | 28 | 314 |
GO:0004888
GO:0006935 GO:0007165 GO:0016020 |
| AF-A0A7X7HH16-F1-model_v4 | deleted | 0.9199 | 30 | 310 |
|
| AF-A0A436H095-F1-model_v4 | deleted | 0.9137 | 131 | 311 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar