F491468

General Info

Members Datasets Scaffolds Average Seq Length
1191 836 735 314

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0247511|Ga0496125_0247511_35_1114
Length 359
Sequence MRMARPGEGTARNNGRYFAKSQADFDGSKKIDHIGTMGGILHMKRFASTGIAVVLALAFATTAHAEDKKKLAFVVNGASDFWKAAEAGVKAAAAELPKYDLTLKYPEQSAAAIQIRLMDDLVAAGYAGIMVSAVDPKTESDALNRIGKQVALFTTDSDAPKTSRIAYIGSSNTDAGKQAGQLVLKAMPNGGKCMGFVGLLGADNAKERIDGVKETIKGSKVELVDVRGDDIDQTRAKRNVEDTLTAHPEIDCMVGFYSYNTPRIYEALKEAGKLGKIKIIGFDEDPITLGGVKEGTISGTVVQQPYEWGYQGMKDMAKYLEGDKSWVPGNGLLIVPTKIIDTSNVDAFWAELKKRQGKS

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
25 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
29 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
32 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
33 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
34 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
35 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
36 2519899620 Rhizobium sp. Pop5 Isolate Nodule
37 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
38 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
39 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
40 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
41 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
42 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
43 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
44 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
45 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
46 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
47 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
48 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
49 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
50 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
51 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
52 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
53 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
54 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
55 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
56 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
57 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
58 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
59 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
60 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
61 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
62 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
63 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
64 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
65 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
66 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
67 2718217882 Rhizobium sp. N741 Isolate Nodule
68 2718217927 Rhizobium sp. N324 Isolate Nodule
69 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
70 2718218009 Rhizobium sp. N561 Isolate Nodule
71 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
72 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
73 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
74 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
75 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
76 2718218363 Rhizobium sp. N113 Isolate Nodule
77 2718218365 Rhizobium sp. N731 Isolate Nodule
78 2718218366 Rhizobium sp. N621 Isolate Nodule
79 2718218423 Rhizobium sp. N941 Isolate Nodule
80 2721755514 Rhizobium sp. N6212 Isolate Nodule
81 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
82 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
83 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
84 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
88 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
89 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
90 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
91 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
92 2728369365 Rhizobium sp. N1341 Isolate Nodule
93 2728369397 Rhizobium sp. N1314 Isolate Nodule
94 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
95 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
96 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
97 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
98 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
99 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
100 2791355260 Rhizobium sp. L9 Isolate Nodule
101 2791355261 Rhizobium sp. J15 Isolate Nodule
102 2791355263 Rhizobium chutanense C5 Isolate Nodule
103 2791355264 Rhizobium sp. S9 Isolate Nodule
104 2791355266 Rhizobium sp. L43 Isolate Nodule
105 2791355267 Rhizobium sp. L18 Isolate Nodule
106 2802429633 Rhizobium anhuiense J3 Isolate Nodule
107 2802429634 Rhizobium anhuiense S10 Isolate Nodule
108 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
109 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
110 2802429637 Rhizobium anhuiense C15 Isolate Nodule
111 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
112 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
113 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
114 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
115 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
116 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
117 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
118 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
119 2838048938 Rhizobium pisi 27/80 Isolate Nodule
120 2838061910 Rhizobium phaseoli L15 Isolate Nodule
121 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
122 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
123 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
124 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
125 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
126 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
127 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
128 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
129 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
130 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
131 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
132 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
133 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
134 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
135 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
136 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
137 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
138 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
139 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
140 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
141 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
142 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
143 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
144 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
145 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
146 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
147 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
148 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
149 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
150 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
151 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
152 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
153 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
154 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
155 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
156 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
157 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
158 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
159 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
160 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
161 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
162 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
163 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
164 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
165 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
166 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
167 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
168 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
169 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
170 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
171 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
172 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
173 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
174 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
175 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
176 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
177 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
178 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
179 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
180 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
181 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
182 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
183 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
184 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
185 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
186 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
187 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
188 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
189 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
190 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
191 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
192 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
193 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
194 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
195 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
196 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
197 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
198 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
199 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
200 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
201 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
202 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
203 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
204 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
205 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
206 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
207 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
208 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
209 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
210 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
211 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
212 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
213 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
214 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
215 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
216 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
217 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
218 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
219 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
220 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
221 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
222 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
223 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
224 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
225 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
226 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
227 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
228 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
229 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
230 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
231 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
232 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
233 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
234 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
235 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
236 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
237 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
238 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
239 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
240 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
241 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
242 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
243 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
244 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
245 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
246 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
247 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
248 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
249 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
250 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
251 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
252 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
253 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
254 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
255 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
256 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
257 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
258 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
259 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
260 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
261 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
262 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
263 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
264 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
265 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
266 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
267 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
268 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
269 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
270 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
271 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
272 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
273 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
274 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
275 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
276 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
277 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
278 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
279 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
280 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
281 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
282 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
283 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
284 2933599457 Rhizobium phaseoli M3 Isolate Nodule
285 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
286 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
287 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
288 2936381700 Rhizobium chutanense C16 Isolate Unclassified
289 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
290 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
291 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
292 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
293 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
294 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
295 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
296 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
297 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
298 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
299 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
300 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
301 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
302 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
303 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
304 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
305 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
306 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
307 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
308 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
309 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
310 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
311 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
312 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
313 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
314 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
315 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
316 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
317 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
318 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
319 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
320 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
321 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
322 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
323 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
324 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
325 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
326 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
327 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
328 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
329 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
330 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
331 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
332 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
333 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
334 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
335 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
336 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
337 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
338 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
339 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
340 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
341 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
342 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
343 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
344 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
345 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
346 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
347 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
348 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
349 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
350 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
351 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
352 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
353 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
354 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
355 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
356 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
357 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
358 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
359 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
360 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
361 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
362 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
363 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
364 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
365 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
366 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
367 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
368 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
369 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
370 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
371 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
372 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
373 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
374 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
375 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
376 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
377 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
378 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
379 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
380 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
381 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
382 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
383 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
384 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
385 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
386 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
387 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
388 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
389 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
390 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
391 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
392 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
393 2996887358 Rhizobium sp. R711 Isolate Nodule
394 2996893221 Rhizobium sp. R635 Isolate Nodule
395 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
396 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
397 3004167301 Mesorhizobium loti 582 Isolate Unclassified
398 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
399 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
400 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
401 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
402 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
403 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
404 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
405 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
406 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
407 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
408 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
409 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
410 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
411 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
412 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
413 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
414 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
415 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
416 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
417 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
418 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
419 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
420 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
421 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
422 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
423 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
424 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
425 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
426 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
427 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
428 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
429 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
430 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
431 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
432 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
433 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
434 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
435 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
436 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
437 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
438 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
439 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
440 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
441 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
442 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
443 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
444 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
445 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
446 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
447 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
448 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
449 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
450 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
451 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
452 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
453 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
454 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
455 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
456 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
457 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
458 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
459 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
460 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
461 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
462 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
463 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
464 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
465 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
466 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
467 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
468 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
469 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
470 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
471 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
472 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
473 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
474 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
475 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
476 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
477 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
478 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
479 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
480 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
481 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
482 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
483 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
484 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
485 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
486 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
487 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
488 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
489 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
490 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
491 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
492 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
493 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
494 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
495 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
496 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
497 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
498 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
499 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
500 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
501 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
502 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
503 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
504 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
505 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
506 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
507 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
508 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
509 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
510 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
511 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
512 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
513 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
514 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
515 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
516 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
517 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
518 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
519 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
520 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
521 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
522 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
523 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
524 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
525 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
526 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
527 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
528 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
529 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
530 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
531 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
532 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
533 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
534 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
535 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
536 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
537 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
538 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
539 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
542 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
543 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
544 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
545 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
546 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
547 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
548 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
549 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
550 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
551 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
552 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
554 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
555 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
556 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
558 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
559 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
560 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
561 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
562 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
564 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
565 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
566 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
601 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
602 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
610 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
612 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
613 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
615 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
616 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
617 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
618 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
619 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
620 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
621 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
624 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
625 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
626 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
627 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
628 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
629 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
630 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
631 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
632 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
633 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
634 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
635 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
636 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
637 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
638 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
639 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
640 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
641 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
642 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
643 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
644 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
645 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
646 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
647 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
648 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
649 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
650 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
651 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
652 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
653 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
654 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
655 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
656 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
657 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
658 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
659 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
660 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
661 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
662 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
663 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
664 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
665 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
666 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
667 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
668 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
669 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
670 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
671 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
672 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
673 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
674 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
675 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
676 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
677 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
678 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
679 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
680 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
681 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
682 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
683 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
684 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
685 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
686 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
687 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
688 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
689 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
690 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
691 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
692 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
693 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
694 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
695 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
696 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
697 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
698 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
699 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
700 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
701 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
702 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
703 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
704 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
705 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
706 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
707 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
708 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
711 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
712 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
713 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
714 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
715 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
716 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
717 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
720 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
721 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
722 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
723 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
724 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
725 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
726 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
727 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
728 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
729 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
730 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
731 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
732 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
733 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
734 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
735 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
736 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
737 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
738 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
739 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
740 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
741 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
742 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
743 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
744 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
745 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
746 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
747 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
748 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
749 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
750 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
751 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
752 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
753 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
754 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
755 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
756 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
757 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
758 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
759 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
760 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
761 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
762 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
763 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
764 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
765 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
766 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
767 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
768 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
769 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
770 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
771 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
772 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
773 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
775 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
779 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
780 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
781 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
782 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
784 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
785 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
786 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
787 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
788 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
789 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
795 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
796 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
797 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
798 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
799 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
800 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
801 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
802 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
803 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
804 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
805 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
806 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
807 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
808 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
809 8005275841 Rhizobium sp. N4311 Isolate Nodule
810 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
811 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
812 8005321885 Rhizobium sp. R72 Isolate Nodule
813 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
814 8005382845 Rhizobium sp. R634 Isolate Nodule
815 8005395548 Rhizobium sp. R339 Isolate Nodule
816 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
817 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
818 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
819 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
820 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
821 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
822 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
823 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
824 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
825 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
826 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
827 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
828 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
829 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
830 8018176218 Rhizobium sp. N122 Isolate Nodule
831 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
832 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
833 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
834 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
835 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
836 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.11
Metatranscriptomes 2.6
Isolates 38.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.2
Nodule 31.65
Rhizoplane 3.27
Rhizosphere 39.29
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1005229 3300002705 Bacteria 3794
2 JGI25162J39368_1000720 3300002737 Bacteria 22796
3 JGI25158J39367_1000130 3300002739 Bacteria 17693
4 JGI25157J39369_1000647 3300002741 Bacteria 19446
5 JGI25152J39213_1000768 3300002773 Bacteria 16180
6 JGI25152J39213_1001049 3300002773 Bacteria 13127
7 JGI25159J45721_1003170 3300002987 Bacteria 5903
8 JGI25151J46595_10001716 3300003187 Bacteria 14302
9 JGI25406J46586_10005327 3300003203 Bacteria 5968
10 JGI25165J46597_1000078 3300003214 Bacteria 179320
11 JGI25165J46597_1000556 3300003214 Bacteria 33944
12 JGI25153J46596_10000019 3300003215 Bacteria 260291
13 JGI25153J46596_10000532 3300003215 Bacteria 23955
14 JGI25153J46596_10001241 3300003215 Bacteria 15387
15 JGI25153J46596_10002978 3300003215 Bacteria 9583
16 JGI25153J46596_10012294 3300003215 Bacteria 3707
17 Ga0006770J48903_1028616 3300003305 Bacteria 1181
18 rootH1_10147757 3300003323 Bacteria 1416
19 JGI25160J50197_1006047 3300003354 Bacteria 4950
20 JGI25161J50226_1000188 3300003374 Bacteria 40533
21 Ga0055542_1000814 3300003762 Bacteria 22783
22 Ga0055542_1004745 3300003762 Bacteria 3205
23 Ga0055529_1001740 3300003763 Bacteria 5451
24 Ga0055526_1001352 3300003771 Bacteria 17533
25 Ga0055526_1001382 3300003771 Bacteria 17334
26 Ga0055526_1001442 3300003771 Bacteria 16915
27 Ga0055524_1001040 3300003775 Bacteria 17129
28 Ga0055524_1008223 3300003775 Bacteria 4353
29 Ga0055524_1009824 3300003775 Bacteria 3856
30 Ga0055528_1000223 3300003790 Bacteria 47567
31 Ga0055528_1000597 3300003790 Bacteria 27186
32 Ga0055528_1023366 3300003790 Bacteria 1889
33 Ga0055540_1000096 3300003792 Bacteria 96969
34 Ga0055540_1011814 3300003792 Bacteria 2787
35 Ga0055540_1017010 3300003792 Bacteria 2044
36 Ga0055531_10009724 3300003794 Bacteria 4882
37 Ga0055543_1000565 3300004625 Bacteria 20587
38 Ga0055543_1000877 3300004625 Bacteria 14325
39 Ga0065165_1007005 3300005262 Bacteria 5689
40 Ga0065165_1044198 3300005262 Bacteria 1304
41 Ga0065715_10130442 3300005293 Bacteria 2026
42 Ga0065707_10025624 3300005295 Bacteria 1257
43 Ga0065707_10123094 3300005295 Bacteria 2073
44 Ga0070658_10096397 3300005327 Bacteria 2442
45 Ga0070683_100020044 3300005329 Bacteria 5947
46 Ga0070670_100041442 3300005331 Bacteria 3958
47 Ga0068869_100204935 3300005334 Bacteria 1557
48 Ga0070666_10035449 3300005335 Bacteria 3309
49 Ga0070680_100170515 3300005336 Bacteria 1831
50 Ga0068868_100093007 3300005338 Bacteria 2431
51 Ga0070660_100060221 3300005339 Bacteria 2946
52 Ga0070689_100227559 3300005340 Bacteria 1532
53 Ga0070661_100007453 3300005344 Bacteria 7544
54 Ga0070661_100131145 3300005344 Bacteria 1882
55 Ga0070669_100010408 3300005353 Bacteria 6605
56 Ga0070669_100091611 3300005353 Bacteria 2280
57 Ga0070671_100031375 3300005355 Bacteria 4389
58 Ga0070674_100013636 3300005356 Bacteria 5030
59 Ga0070674_100105019 3300005356 Bacteria 2065
60 Ga0070674_100232836 3300005356 Bacteria 1438
61 Ga0070673_100065909 3300005364 Bacteria 2891
62 Ga0070688_100086727 3300005365 Bacteria 2037
63 Ga0070659_100193883 3300005366 Bacteria 1671
64 Ga0070659_100203165 3300005366 Bacteria 1631
65 Ga0070667_100370994 3300005367 Bacteria 1298
66 Ga0070709_10016514 3300005434 Bacteria 4217
67 Ga0070709_10182199 3300005434 Bacteria 1476
68 Ga0070714_100053890 3300005435 Bacteria 3435
69 Ga0070713_100003623 3300005436 Bacteria 10218
70 Ga0070713_100200583 3300005436 Bacteria 1802
71 Ga0070710_10002003 3300005437 Bacteria 9651
72 Ga0070710_10002252 3300005437 Bacteria 9121
73 Ga0070711_100002848 3300005439 Bacteria 9946
74 Ga0070711_100016056 3300005439 Bacteria 4747
75 Ga0070711_100102967 3300005439 Bacteria 2080
76 Ga0070708_100164201 3300005445 Bacteria 2071
77 Ga0070663_100004006 3300005455 Bacteria 8591
78 Ga0070663_100161983 3300005455 Bacteria 1722
79 Ga0070678_100045677 3300005456 Bacteria 3135
80 Ga0070678_100150904 3300005456 Bacteria 1872
81 Ga0070681_10154050 3300005458 Bacteria 2224
82 Ga0068867_100151672 3300005459 Bacteria 1821
83 Ga0070706_100178845 3300005467 Bacteria 1980
84 Ga0070707_100014813 3300005468 Bacteria 7309
85 Ga0070699_100206785 3300005518 Bacteria 1747
86 Ga0070684_100416955 3300005535 Bacteria 1239
87 Ga0070697_100193233 3300005536 Bacteria 1728
88 Ga0068853_100012626 3300005539 Bacteria 6875
89 Ga0068853_100266363 3300005539 Bacteria 1577
90 Ga0070672_100010038 3300005543 Bacteria 6553
91 Ga0070696_100211437 3300005546 Bacteria 1452
92 Ga0070665_100003622 3300005548 Bacteria 16361
93 Ga0070665_100047733 3300005548 Bacteria 4297
94 Ga0068855_100228884 3300005563 Bacteria 2083
95 Ga0070664_100140515 3300005564 Bacteria 2126
96 Ga0068854_100048142 3300005578 Bacteria 3040
97 Ga0068854_100060919 3300005578 Bacteria 2732
98 Ga0068852_100002424 3300005616 Bacteria 12841
99 Ga0068859_100310691 3300005617 Bacteria 1670
100 Ga0068859_100482653 3300005617 Bacteria 1335
101 Ga0068864_100195359 3300005618 Bacteria 1856
102 Ga0068866_10121366 3300005718 Bacteria 1473
103 Ga0068861_100024979 3300005719 Bacteria 4327
104 Ga0068851_10017949 3300005834 Bacteria 3406
105 Ga0068851_10063179 3300005834 Bacteria 1901
106 Ga0068870_10200506 3300005840 Bacteria 1210
107 Ga0068863_100245804 3300005841 Bacteria 1728
108 Ga0068858_100169534 3300005842 Bacteria 2058
109 Ga0068860_100000222 3300005843 Bacteria 88724
110 Ga0068862_100005467 3300005844 Bacteria 10619
111 Ga0068862_100491611 3300005844 Bacteria 1163
112 Ga0081455_10036412 3300005937 Bacteria 4382
113 Ga0081455_10068812 3300005937 Bacteria 2946
114 Ga0081538_10116406 3300005981 Bacteria 1297
115 Ga0081540_1021073 3300005983 Bacteria 3897
116 Ga0081540_1027016 3300005983 Bacteria 3262
117 Ga0081539_10000493 3300005985 Bacteria 83122
118 Ga0081539_10002462 3300005985 Bacteria 26092
119 Ga0081539_10064079 3300005985 Bacteria 2002
120 Ga0075365_10031255 3300006038 Bacteria 3415
121 Ga0075365_10042674 3300006038 Bacteria 2966
122 Ga0075365_10044243 3300006038 Bacteria 2916
123 Ga0075365_10059257 3300006038 Bacteria 2551
124 Ga0075365_10074530 3300006038 Bacteria 2289
125 Ga0075365_10118475 3300006038 Bacteria 1825
126 Ga0075368_10010975 3300006042 Bacteria 3288
127 Ga0075368_10012328 3300006042 Bacteria 3122
128 Ga0075368_10013231 3300006042 Bacteria 3027
129 Ga0075368_10025686 3300006042 Bacteria 2260
130 Ga0075368_10059575 3300006042 Bacteria 1527
131 Ga0075363_100003916 3300006048 Bacteria 6424
132 Ga0075363_100039272 3300006048 Bacteria 2491
133 Ga0075364_10025226 3300006051 Bacteria 3783
134 Ga0075364_10065112 3300006051 Bacteria 2392
135 Ga0075364_10078436 3300006051 Bacteria 2182
136 Ga0070716_100004863 3300006173 Bacteria 6459
137 Ga0070716_100072012 3300006173 Bacteria 2034
138 Ga0070712_100004279 3300006175 Bacteria 8789
139 Ga0075362_10004305 3300006177 Bacteria 5091
140 Ga0075362_10014495 3300006177 Bacteria 3183
141 Ga0075362_10026475 3300006177 Bacteria 2477
142 Ga0075362_10031420 3300006177 Bacteria 2298
143 Ga0075362_10031982 3300006177 Bacteria 2280
144 Ga0075362_10035658 3300006177 Bacteria 2173
145 Ga0075367_10001159 3300006178 Bacteria 11010
146 Ga0075367_10003642 3300006178 Bacteria 7387
147 Ga0075367_10011213 3300006178 Bacteria 4732
148 Ga0075367_10034536 3300006178 Bacteria 2922
149 Ga0075367_10125092 3300006178 Bacteria 1586
150 Ga0075369_10001463 3300006186 Bacteria 8057
151 Ga0075369_10003778 3300006186 Bacteria 5540
152 Ga0075369_10040088 3300006186 Bacteria 2001
153 Ga0075369_10047733 3300006186 Bacteria 1847
154 Ga0075366_10003365 3300006195 Bacteria 8419
155 Ga0075366_10003595 3300006195 Bacteria 8208
156 Ga0075366_10015675 3300006195 Bacteria 4349
157 Ga0075366_10145028 3300006195 Bacteria 1436
158 Ga0097621_100168579 3300006237 Bacteria 1886
159 Ga0075370_10014844 3300006353 Bacteria 4160
160 Ga0075370_10040346 3300006353 Bacteria 2633
161 Ga0075370_10084754 3300006353 Bacteria 1824
162 Ga0075370_10132401 3300006353 Bacteria 1455
163 Ga0075428_100017029 3300006844 Bacteria 8029
164 Ga0075431_100319425 3300006847 Bacteria 1566
165 Ga0075429_100475113 3300006880 Bacteria 1095
166 Ga0068865_100022831 3300006881 Bacteria 4088
167 Ga0097620_100310667 3300006931 Bacteria 1670
168 Ga0097620_100482673 3300006931 Bacteria 1335
169 Ga0099794_10003764 3300007265 Bacteria 5848
170 Ga0099794_10015072 3300007265 Bacteria 3404
171 Ga0099795_10004356 3300007788 Bacteria 3642
172 Ga0099795_10070125 3300007788 Bacteria 1320
173 Ga0105240_10000290 3300009093 Bacteria 97921
174 Ga0105240_10006715 3300009093 Bacteria 16854
175 Ga0105240_10142684 3300009093 Bacteria 2862
176 Ga0105240_10339086 3300009093 Bacteria 1708
177 Ga0111539_10000090 3300009094 Bacteria 94888
178 Ga0105245_10100008 3300009098 Bacteria 2682
179 Ga0105245_10350916 3300009098 Bacteria 1462
180 Ga0105247_10025586 3300009101 Bacteria 3561
181 Ga0114129_10119161 3300009147 Bacteria 3636
182 Ga0114129_10211874 3300009147 Bacteria 2619
183 Ga0114129_10289767 3300009147 Bacteria 2185
184 Ga0105243_10046915 3300009148 Bacteria 3400
185 Ga0105243_10171096 3300009148 Bacteria 1881
186 Ga0105243_10329851 3300009148 Bacteria 1393
187 Ga0105243_10630792 3300009148 Bacteria 1036
188 Ga0105241_10189324 3300009174 Bacteria 1712
189 Ga0105242_10609960 3300009176 Bacteria 1055
190 Ga0105248_10023698 3300009177 Bacteria 6821
191 Ga0105248_10043670 3300009177 Bacteria 5027
192 Ga0105248_10071086 3300009177 Bacteria 3908
193 Ga0105248_10395955 3300009177 Bacteria 1555
194 Ga0105237_10003793 3300009545 Bacteria 17765
195 Ga0105237_10007155 3300009545 Bacteria 12259
196 Ga0105237_10021498 3300009545 Bacteria 6632
197 Ga0105237_10057919 3300009545 Bacteria 3877
198 Ga0105237_10269275 3300009545 Bacteria 1706
199 Ga0105238_10001985 3300009551 Bacteria 20609
200 Ga0105238_10024769 3300009551 Bacteria 6116
201 Ga0105238_10060977 3300009551 Bacteria 3775
202 Ga0105238_10107581 3300009551 Bacteria 2770
203 Ga0123341_1000005 3300009765 Bacteria 150422
204 Ga0105239_10000202 3300010375 Bacteria 87257
205 Ga0105239_10017591 3300010375 Bacteria 7906
206 Ga0105239_10030771 3300010375 Bacteria 5903
207 Ga0105239_10049592 3300010375 Bacteria 4603
208 Ga0105239_10235850 3300010375 Bacteria 2053
209 Ga0105239_10417617 3300010375 Bacteria 1519
210 Ga0105246_10014291 3300011119 Bacteria 4992
211 Ga0157371_10228244 3300013102 Bacteria 1338
212 Ga0157370_10003913 3300013104 Bacteria 17346
213 Ga0157370_10085287 3300013104 Bacteria 2967
214 Ga0157370_10150196 3300013104 Bacteria 2168
215 Ga0157369_10228695 3300013105 Bacteria 1945
216 Ga0157369_10252267 3300013105 Bacteria 1841
217 Ga0157374_10204808 3300013296 Bacteria 1933
218 Ga0157374_10421124 3300013296 Bacteria 1334
219 Ga0157378_10086860 3300013297 Bacteria 2836
220 Ga0157378_10177796 3300013297 Bacteria 2000
221 Ga0157378_10326226 3300013297 Bacteria 1493
222 Ga0163162_10042418 3300013306 Bacteria 4554
223 Ga0163162_10485796 3300013306 Bacteria 1366
224 Ga0157375_10198245 3300013308 Bacteria 2163
225 Ga0163163_10015338 3300014325 Bacteria 7082
226 Ga0163163_10445410 3300014325 Bacteria 1355
227 Ga0157380_10005965 3300014326 Bacteria 8523
228 Ga0182008_10118060 3300014497 Unclassified 1317
229 Ga0157379_10367279 3300014968 Bacteria 1319
230 Ga0157376_10099848 3300014969 Bacteria 2533
231 Ga0182007_10005402 3300015262 Bacteria 5615
232 Ga0182007_10030581 3300015262 Bacteria 1839
233 Ga0182005_1001606 3300015265 Bacteria 8858
234 Ga0182005_1009555 3300015265 Bacteria 2819
235 Ga0184601_102729 3300019183 Bacteria 1341
236 Ga0184603_136826 3300019192 Bacteria 1332
237 Ga0206352_10850575 3300020078 Bacteria 1103
238 Ga0206354_11218913 3300020081 Bacteria 1131
239 Ga0206353_10827906 3300020082 Bacteria 1686
240 Ga0213876_10001735 3300021384 Bacteria 13237
241 Ga0213871_10036607 3300021441 Bacteria 1302
242 Ga0209436_100007 3300025208 Bacteria 149841
243 Ga0209672_104215 3300025228 Bacteria 2725
244 Ga0209437_100104 3300025233 Bacteria 220736
245 Ga0207425_1001067 3300025245 Bacteria 12520
246 Ga0207425_1008858 3300025245 Bacteria 2541
247 Ga0209026_1000151 3300025250 Bacteria 110338
248 Ga0209677_100613 3300025253 Bacteria 19117
249 Ga0209148_1000032 3300025254 Bacteria 557660
250 Ga0209148_1000319 3300025254 Bacteria 67129
251 Ga0209759_1000350 3300025256 Bacteria 60056
252 Ga0209129_1000615 3300025258 Bacteria 24007
253 Ga0209129_1002198 3300025258 Bacteria 9804
254 Ga0209129_1004197 3300025258 Bacteria 5786
255 Ga0209233_1000150 3300025261 Bacteria 179401
256 Ga0209233_1000279 3300025261 Bacteria 70977
257 Ga0209233_1000334 3300025261 Bacteria 48025
258 Ga0209233_1005165 3300025261 Bacteria 4361
259 Ga0209233_1008548 3300025261 Bacteria 3161
260 Ga0209455_1000085 3300025272 Bacteria 247601
261 Ga0209455_1000782 3300025272 Bacteria 17766
262 Ga0209673_1000162 3300025273 Bacteria 139078
263 Ga0209673_1000452 3300025273 Bacteria 69726
264 Ga0209673_1009347 3300025273 Bacteria 4259
265 Ga0209673_1010927 3300025273 Bacteria 3786
266 Ga0209673_1021868 3300025273 Bacteria 2223
267 Ga0209130_1000001 3300025284 Bacteria 831557
268 Ga0209130_1010486 3300025284 Bacteria 2547
269 Ga0209025_1003516 3300025294 Bacteria 14707
270 Ga0209025_1040913 3300025294 Bacteria 1995
271 Ga0209564_1000215 3300025295 Bacteria 132838
272 Ga0209564_1001754 3300025295 Bacteria 20252
273 Ga0209564_1001771 3300025295 Bacteria 20044
274 Ga0209564_1001922 3300025295 Bacteria 18544
275 Ga0209564_1013613 3300025295 Bacteria 3436
276 Ga0209564_1023985 3300025295 Bacteria 2098
277 Ga0209758_1000028 3300025297 Bacteria 530102
278 Ga0209758_1001042 3300025297 Bacteria 36337
279 Ga0209758_1001171 3300025297 Bacteria 33282
280 Ga0209758_1001256 3300025297 Bacteria 31393
281 Ga0209758_1021846 3300025297 Bacteria 2963
282 Ga0209758_1024684 3300025297 Bacteria 2670
283 Ga0209050_1002710 3300025298 Bacteria 14381
284 Ga0209050_1024882 3300025298 Bacteria 2056
285 Ga0209256_1000155 3300025299 Bacteria 144379
286 Ga0209256_1002089 3300025299 Bacteria 17515
287 Ga0209256_1006482 3300025299 Bacteria 6162
288 Ga0209256_1011321 3300025299 Bacteria 3584
289 Ga0209256_1011950 3300025299 Bacteria 3400
290 Ga0209256_1012861 3300025299 Bacteria 3155
291 Ga0207426_1000045 3300025302 Bacteria 422847
292 Ga0207426_1001182 3300025302 Bacteria 23333
293 Ga0207426_1001839 3300025302 Bacteria 15628
294 Ga0207426_1010086 3300025302 Bacteria 3691
295 Ga0209051_1000027 3300025303 Bacteria 412172
296 Ga0209051_1001530 3300025303 Bacteria 19255
297 Ga0209051_1001728 3300025303 Bacteria 17443
298 Ga0209051_1018027 3300025303 Bacteria 3139
299 Ga0209257_1000688 3300025304 Bacteria 52564
300 Ga0209257_1008589 3300025304 Bacteria 5749
301 Ga0209257_1019503 3300025304 Bacteria 2550
302 Ga0209257_1022512 3300025304 Bacteria 2246
303 Ga0207656_10043269 3300025321 Bacteria 1920
304 Ga0207692_10015312 3300025898 Bacteria 3371
305 Ga0207692_10113444 3300025898 Bacteria 1506
306 Ga0207642_10059885 3300025899 Bacteria 1763
307 Ga0207710_10008547 3300025900 Bacteria 4316
308 Ga0207710_10031014 3300025900 Bacteria 2335
309 Ga0207680_10060191 3300025903 Bacteria 2310
310 Ga0207647_10013298 3300025904 Bacteria 5711
311 Ga0207647_10016597 3300025904 Bacteria 5022
312 Ga0207705_10077465 3300025909 Bacteria 2419
313 Ga0207707_10110064 3300025912 Bacteria 2407
314 Ga0207695_10000240 3300025913 Bacteria 143196
315 Ga0207695_10000385 3300025913 Bacteria 99958
316 Ga0207671_10000330 3300025914 Bacteria 69591
317 Ga0207671_10006330 3300025914 Bacteria 10568
318 Ga0207671_10029225 3300025914 Bacteria 4117
319 Ga0207671_10073351 3300025914 Bacteria 2556
320 Ga0207671_10088965 3300025914 Bacteria 2324
321 Ga0207671_10103227 3300025914 Bacteria 2162
322 Ga0207671_10163717 3300025914 Bacteria 1723
323 Ga0207693_10075397 3300025915 Bacteria 2641
324 Ga0207693_10089265 3300025915 Bacteria 2416
325 Ga0207693_10239912 3300025915 Bacteria 1423
326 Ga0207663_10004509 3300025916 Bacteria 6932
327 Ga0207663_10056556 3300025916 Bacteria 2467
328 Ga0207663_10371263 3300025916 Bacteria 1088
329 Ga0207660_10153172 3300025917 Bacteria 1773
330 Ga0207657_10049709 3300025919 Bacteria 3651
331 Ga0207657_10064375 3300025919 Bacteria 3129
332 Ga0207657_10129494 3300025919 Bacteria 2070
333 Ga0207649_10130300 3300025920 Bacteria 1707
334 Ga0207646_10034839 3300025922 Bacteria 4551
335 Ga0207681_10009281 3300025923 Bacteria 6008
336 Ga0207681_10052346 3300025923 Bacteria 2768
337 Ga0207694_10366286 3300025924 Bacteria 1195
338 Ga0207650_10041328 3300025925 Bacteria 3378
339 Ga0207700_10165257 3300025928 Bacteria 1841
340 Ga0207664_10064463 3300025929 Bacteria 2930
341 Ga0207690_10269122 3300025932 Bacteria 1323
342 Ga0207709_10133835 3300025935 Bacteria 1693
343 Ga0207669_10102384 3300025937 Bacteria 1897
344 Ga0207669_10163669 3300025937 Bacteria 1575
345 Ga0207704_10106103 3300025938 Bacteria 1886
346 Ga0207665_10001825 3300025939 Bacteria 14343
347 Ga0207665_10102598 3300025939 Bacteria 1999
348 Ga0207691_10009789 3300025940 Bacteria 9202
349 Ga0207691_10056550 3300025940 Bacteria 3573
350 Ga0207711_10110547 3300025941 Bacteria 2444
351 Ga0207711_10303238 3300025941 Bacteria 1473
352 Ga0207689_10450365 3300025942 Bacteria 1076
353 Ga0207679_10423269 3300025945 Bacteria 1176
354 Ga0207667_10165181 3300025949 Bacteria 2276
355 Ga0207667_10180081 3300025949 Bacteria 2170
356 Ga0207668_10040495 3300025972 Bacteria 3144
357 Ga0207640_10201813 3300025981 Bacteria 1508
358 Ga0207703_10172066 3300026035 Bacteria 1906
359 Ga0207639_10058895 3300026041 Bacteria 2956
360 Ga0207678_10015900 3300026067 Bacteria 6611
361 Ga0207678_10165220 3300026067 Bacteria 1890
362 Ga0207678_10244711 3300026067 Bacteria 1536
363 Ga0207641_10356092 3300026088 Bacteria 1396
364 Ga0207648_10160608 3300026089 Bacteria 1985
365 Ga0207648_10228259 3300026089 Bacteria 1656
366 Ga0207648_10257773 3300026089 Unclassified 1556
367 Ga0207674_10059422 3300026116 Bacteria 3869
368 Ga0207675_100004709 3300026118 Bacteria 13132
369 Ga0207675_100025107 3300026118 Bacteria 5547
370 Ga0207683_10210635 3300026121 Bacteria 1769
371 Ga0207698_10021751 3300026142 Bacteria 4442
372 Ga0207698_10354842 3300026142 Bacteria 1386
373 Ga0209371_1004496 3300027312 Bacteria 6024
374 Ga0209588_1025509 3300027671 Bacteria 1871
375 Ga0209813_10001150 3300027866 Bacteria 5900
376 Ga0209813_10003148 3300027866 Bacteria 3839
377 Ga0209813_10010745 3300027866 Bacteria 2376
378 Ga0207428_10000055 3300027907 Bacteria 166460
379 Ga0207428_10113973 3300027907 Bacteria 2078
380 Ga0268266_10026011 3300028379 Bacteria 4978
381 Ga0268266_10174378 3300028379 Bacteria 1954
382 Ga0268265_10011716 3300028380 Bacteria 5929
383 Ga0268265_10056785 3300028380 Bacteria 2980
384 Ga0268265_10389859 3300028380 Bacteria 1284
385 Ga0268264_10000042 3300028381 Bacteria 372069
386 Ga0268264_10403514 3300028381 Bacteria 1314
387 Ga0265334_10029187 3300028573 Bacteria 2212
388 Ga0265318_10010306 3300028577 Bacteria 4075
389 Ga0307517_10124952 3300028786 Bacteria 1882
390 Ga0307515_10000130 3300028794 Bacteria 179263
391 Ga0268256_1003212 3300030500 Bacteria 7564
392 Ga0265762_1011286 3300030760 Bacteria 1598
393 Ga0265766_1001931 3300030863 Bacteria 1105
394 Ga0265340_10000971 3300031247 Bacteria 16372
395 Ga0265340_10018541 3300031247 Bacteria 3589
396 Ga0265340_10069267 3300031247 Bacteria 1674
397 Ga0265339_10010789 3300031249 Bacteria 5654
398 Ga0265316_10007442 3300031344 Bacteria 10321
399 Ga0307513_10099286 3300031456 Bacteria 2940
400 Ga0265313_10000254 3300031595 Bacteria 58277
401 Ga0265313_10004260 3300031595 Bacteria 11087
402 Ga0265313_10039042 3300031595 Bacteria 2358
403 Ga0307508_10000019 3300031616 Bacteria 197575
404 Ga0265314_10004387 3300031711 Bacteria 13118
405 Ga0265314_10141718 3300031711 Bacteria 1485
406 Ga0265342_10004447 3300031712 Bacteria 11040
407 Ga0307516_10001267 3300031730 Bacteria 35137
408 Ga0307516_10076661 3300031730 Bacteria 3195
409 Ga0307516_10261571 3300031730 Bacteria 1420
410 Ga0307413_10167933 3300031824 Bacteria 1549
411 Ga0307413_10264124 3300031824 Bacteria 1285
412 Ga0307410_10086811 3300031852 Bacteria 2211
413 Ga0307409_100060489 3300031995 Bacteria 2954
414 Ga0307409_100091435 3300031995 Bacteria 2494
415 Ga0316215_1004751 3300033544 Bacteria 1303
416 Ga0373954_0131140 3300035118 Bacteria 1220
417 Ga0373954_0134235 3300035118 Bacteria 1206
418 Ga0373935_0165401 3300035692 Bacteria 1510
419 Ga0373927_0001752 3300035695 Bacteria 16195
420 Ga0373947_0072796 3300035725 Bacteria 2111
421 Ga0373925_0003065 3300037068 Bacteria 13132
422 Ga0373925_0115012 3300037068 Bacteria 2083
423 Ga0373925_0222432 3300037068 Bacteria 1507
424 Ga0373925_0231346 3300037068 Bacteria 1478
425 Ga0395899_0114225 3300037312 Bacteria 1939
426 Ga0395900_0001158 3300037418 Bacteria 33053
427 Ga0395900_0010027 3300037418 Bacteria 9694
428 Ga0395900_0132046 3300037418 Bacteria 2559
429 Ga0395898_0005716 3300037466 Bacteria 13400
430 Ga0395898_0010237 3300037466 Bacteria 9819
431 Ga0395898_0364031 3300037466 Bacteria 1379
432 Ga0395905_0000478 3300037471 Bacteria 55284
433 Ga0395901_0004964 3300038443 Bacteria 13425
434 Ga0395901_0005295 3300038443 Bacteria 13040
435 Ga0395901_0012394 3300038443 Bacteria 8650
436 Ga0395901_0036575 3300038443 Bacteria 5076
437 Ga0395901_0042818 3300038443 Bacteria 4696
438 Ga0436365_0162634 3300039437 Bacteria 18491
439 Ga0436360_0760710 3300039438 Bacteria 1029
440 Ga0436363_1164297 3300039450 Bacteria 3420
441 Ga0451798_1089163 3300041458 Bacteria 2547
442 Ga0451837_1818733 3300041494 Bacteria 1281
443 Ga0451851_0704329 3300041507 Bacteria 2086
444 Ga0451855_1946060 3300041511 Bacteria 1186
445 Ga0451577_0007468 3300042876 Bacteria 10736
446 Ga0466972_0052203 3300044658 Bacteria 1971
447 Ga0466966_0057270 3300044684 Bacteria 2464
448 Ga0453684_0254476 3300044712 Bacteria 2015
449 Ga0466970_0000026 3300044765 Bacteria 56864
450 Ga0466957_0119907 3300044842 Bacteria 1676
451 Ga0466960_0061505 3300044901 Bacteria 1844
452 Ga0466959_0019373 3300045049 Bacteria 5004
453 Ga0466959_0092639 3300045049 Bacteria 2169
454 Ga0466967_0046981 3300045976 Bacteria 3762
455 Ga0466967_0156765 3300045976 Bacteria 2133
456 Ga0495603_0008597 3300046455 Bacteria 6171
457 Ga0495638_0012275 3300046460 Bacteria 5877
458 Ga0495582_0120262 3300046473 Bacteria 1480
459 Ga0495605_0031146 3300046474 Bacteria 2727
460 Ga0495585_0028964 3300046492 Bacteria 3156
461 Ga0495607_0078152 3300046501 Bacteria 1826
462 Ga0495606_0002343 3300046507 Bacteria 22289
463 Ga0495606_0010989 3300046507 Bacteria 7437
464 Ga0495610_0039352 3300046512 Bacteria 2392
465 Ga0495610_0097720 3300046512 Bacteria 1320
466 Ga0495616_0024859 3300046513 Bacteria 3207
467 Ga0495620_0037677 3300046515 Bacteria 2151
468 Ga0495643_0004861 3300046522 Bacteria 9252
469 Ga0495643_0017660 3300046522 Bacteria 4165
470 Ga0495597_0012984 3300046542 Bacteria 4000
471 Ga0495625_0324259 3300046660 Bacteria 980
472 Ga0495649_0208911 3300046694 Bacteria 1012
473 Ga0495660_0084364 3300046810 Bacteria 1661
474 Ga0495660_0117147 3300046810 Bacteria 1352
475 Ga0495674_0035848 3300047319 Bacteria 4472
476 Ga0495683_0071753 3300047323 Bacteria 1699
477 Ga0495687_010319 3300047443 Bacteria 5129
478 Ga0495687_013121 3300047443 Bacteria 4339
479 Ga0495686_0145678 3300047472 Bacteria 1394
480 Ga0496100_0016060 3300048903 Bacteria 4387
481 Ga0496101_0024546 3300048904 Bacteria 4173
482 Ga0496101_0042329 3300048904 Bacteria 3251
483 Ga0496102_0003841 3300048905 Bacteria 12715
484 Ga0496102_0009946 3300048905 Bacteria 8180
485 Ga0496102_0012863 3300048905 Bacteria 7244
486 Ga0496103_0002355 3300048906 Bacteria 11921
487 Ga0496103_0002871 3300048906 Bacteria 10700
488 Ga0496104_0013027 3300048907 Bacteria 7489
489 Ga0496104_0214045 3300048907 Bacteria 1839
490 Ga0496104_0473628 3300048907 Bacteria 1164
491 Ga0496105_0081471 3300048908 Bacteria 2673
492 Ga0496106_0001650 3300048909 Bacteria 16749
493 Ga0496106_0009323 3300048909 Bacteria 7256
494 Ga0496106_0236306 3300048909 Bacteria 1460
495 Ga0496107_0080835 3300048910 Bacteria 2370
496 Ga0496108_0009837 3300048911 Bacteria 7749
497 Ga0496108_0029866 3300048911 Bacteria 4517
498 Ga0496109_0035954 3300048912 Bacteria 4471
499 Ga0496109_0147425 3300048912 Bacteria 2202
500 Ga0496110_0020049 3300048913 Bacteria 5638
501 Ga0496110_0024288 3300048913 Bacteria 5164
502 Ga0496111_0014645 3300048914 Bacteria 5362
503 Ga0496111_0079066 3300048914 Bacteria 2399
504 Ga0496111_0253118 3300048914 Bacteria 1307
505 Ga0496112_0005447 3300048915 Bacteria 11010
506 Ga0496112_0017000 3300048915 Bacteria 6827
507 Ga0496112_0113433 3300048915 Bacteria 2681
508 Ga0496112_0402383 3300048915 Bacteria 1309
509 Ga0496113_0001431 3300048916 Bacteria 13249
510 Ga0496113_0009073 3300048916 Bacteria 6517
511 Ga0496113_0023688 3300048916 Bacteria 4356
512 Ga0496113_0125615 3300048916 Bacteria 2009
513 Ga0496114_0325412 3300048917 Bacteria 1359
514 Ga0496115_0025840 3300048918 Bacteria 4577
515 Ga0496115_0312510 3300048918 Bacteria 1287
516 Ga0496116_0110626 3300048919 Bacteria 1615
517 Ga0496116_0113437 3300048919 Bacteria 1586
518 Ga0496116_0122478 3300048919 Bacteria 1502
519 Ga0496117_0001433 3300048920 Bacteria 34426
520 Ga0496117_0107500 3300048920 Bacteria 1747
521 Ga0496118_0001911 3300048921 Bacteria 29639
522 Ga0496118_0005110 3300048921 Bacteria 15080
523 Ga0496118_0036254 3300048921 Bacteria 3990
524 Ga0496118_0068163 3300048921 Bacteria 2586
525 Ga0496119_0014020 3300048922 Bacteria 6315
526 Ga0496119_0032690 3300048922 Bacteria 3464
527 Ga0496119_0105548 3300048922 Bacteria 1573
528 Ga0496120_0000724 3300048923 Bacteria 48314
529 Ga0496121_0000084 3300048924 Bacteria 225942
530 Ga0496121_0004222 3300048924 Bacteria 19585
531 Ga0496121_0006122 3300048924 Bacteria 15119
532 Ga0496121_0146502 3300048924 Bacteria 1744
533 Ga0496122_0008494 3300048925 Bacteria 11059
534 Ga0496122_0009487 3300048925 Bacteria 10244
535 Ga0496122_0074571 3300048925 Bacteria 2400
536 Ga0496123_0005298 3300048926 Bacteria 13060
537 Ga0496123_0024648 3300048926 Bacteria 4565
538 Ga0496124_0002457 3300048927 Bacteria 24235
539 Ga0496124_0014760 3300048927 Bacteria 7539
540 Ga0496124_0019235 3300048927 Bacteria 6365
541 Ga0496124_0020155 3300048927 Bacteria 6173
542 Ga0496124_0118451 3300048927 Bacteria 2120
543 Ga0496124_0306567 3300048927 Bacteria 1144
544 Ga0496125_0000090 3300048928 Bacteria 214433
545 Ga0496125_0000402 3300048928 Bacteria 80919
546 Ga0496125_0002371 3300048928 Bacteria 24617
547 Ga0496125_0062164 3300048928 Bacteria 2989
548 Ga0496125_0247511 3300048928 Bacteria 1127
549 Ga0496126_0004444 3300048929 Bacteria 16767
550 Ga0496126_0090325 3300048929 Bacteria 2695
551 Ga0496126_0251956 3300048929 Bacteria 1471
552 Ga0501031_0000060 3300049568 Bacteria 58759
553 Ga0501032_0000081 3300049569 Bacteria 82613
554 Ga0501032_0016881 3300049569 Bacteria 5131
555 Ga0501032_0033118 3300049569 Bacteria 3542
556 Ga0501032_0033309 3300049569 Bacteria 3530
557 Ga0501032_0139031 3300049569 Bacteria 1600
558 Ga0501032_0155114 3300049569 Bacteria 1505
559 Ga0501033_0002397 3300049570 Bacteria 15958
560 Ga0501033_0006361 3300049570 Bacteria 9254
561 Ga0501033_0027644 3300049570 Bacteria 4265
562 Ga0501034_0000186 3300049571 Bacteria 116500
563 Ga0501034_0001552 3300049571 Bacteria 30135
564 Ga0501034_0014015 3300049571 Bacteria 8253
565 Ga0501034_0033148 3300049571 Bacteria 5242
566 Ga0501034_0037176 3300049571 Bacteria 4930
567 Ga0501034_0098571 3300049571 Bacteria 2918
568 Ga0501034_0141505 3300049571 Bacteria 2385
569 Ga0501036_0000002 3300049572 Bacteria 293106
570 Ga0501036_0157879 3300049572 Bacteria 1913
571 Ga0501037_0000095 3300049573 Bacteria 82641
572 Ga0501038_0000002 3300049574 Bacteria 330446
573 Ga0501038_0001456 3300049574 Bacteria 21753
574 Ga0501038_0019997 3300049574 Bacteria 6026
575 Ga0501038_0055794 3300049574 Bacteria 3393
576 Ga0501038_0118802 3300049574 Bacteria 2182
577 Ga0501039_0000002 3300049575 Bacteria 375152
578 Ga0501039_0037330 3300049575 Bacteria 3749
579 Ga0501039_0498912 3300049575 Bacteria 956
580 Ga0501043_0010365 3300049579 Bacteria 7305
581 Ga0501043_0117417 3300049579 Bacteria 2087
582 Ga0501043_0140082 3300049579 Bacteria 1894
583 Ga0501043_0155333 3300049579 Bacteria 1789
584 Ga0501046_0036115 3300049580 Bacteria 3978
585 Ga0501047_0011842 3300049581 Bacteria 8248
586 Ga0501047_0012272 3300049581 Bacteria 8108
587 Ga0501047_0016456 3300049581 Bacteria 7060
588 Ga0501047_0064797 3300049581 Bacteria 3524
589 Ga0501047_0065947 3300049581 Bacteria 3489
590 Ga0501047_0230352 3300049581 Bacteria 1706
591 Ga0501047_0272245 3300049581 Bacteria 1539
592 Ga0501048_0015893 3300049582 Bacteria 5552
593 Ga0501067_0068486 3300049583 Bacteria 1965
594 Ga0501067_0165859 3300049583 Bacteria 1230
595 Ga0501068_0012242 3300049584 Bacteria 4853
596 Ga0501068_0041832 3300049584 Bacteria 2754
597 Ga0501068_0063514 3300049584 Bacteria 2246
598 Ga0501070_0013944 3300049586 Bacteria 6766
599 Ga0501070_0017670 3300049586 Bacteria 5988
600 Ga0501070_0018522 3300049586 Bacteria 5841
601 Ga0501070_0023604 3300049586 Bacteria 5153
602 Ga0501070_0033368 3300049586 Bacteria 4308
603 Ga0501070_0061639 3300049586 Bacteria 3107
604 Ga0501070_0124481 3300049586 Bacteria 2131
605 Ga0501071_0067882 3300049587 Bacteria 2594
606 Ga0501071_0071517 3300049587 Bacteria 2529
607 Ga0501072_0059018 3300049588 Bacteria 3025
608 Ga0501072_0163415 3300049588 Bacteria 1776
609 Ga0501073_0034948 3300049589 Bacteria 3574
610 Ga0501073_0049137 3300049589 Bacteria 2958
611 Ga0501073_0073127 3300049589 Bacteria 2387
612 Ga0501073_0131566 3300049589 Bacteria 1734
613 Ga0501074_0002793 3300049590 Bacteria 12217
614 Ga0501074_0146520 3300049590 Bacteria 1688
615 Ga0501075_0026762 3300049591 Bacteria 4249
616 Ga0501080_0052386 3300049742 Bacteria 3798
617 Ga0501080_0088117 3300049742 Bacteria 2883
618 Ga0501080_0108142 3300049742 Bacteria 2577
619 Ga0501080_0134156 3300049742 Bacteria 2292
620 Ga0501081_0164357 3300049743 Bacteria 1600
621 Ga0501081_0355059 3300049743 Bacteria 1081
622 Ga0501081_0461962 3300049743 Bacteria 944
623 Ga0501083_0009431 3300049744 Bacteria 6896
624 Ga0501083_0014473 3300049744 Bacteria 5516
625 Ga0501083_0033110 3300049744 Bacteria 3540
626 Ga0501035_0000022 3300049822 Bacteria 208622
627 Ga0501035_0002943 3300049822 Bacteria 16388
628 Ga0501035_0068774 3300049822 Bacteria 3139
629 Ga0501035_0101480 3300049822 Bacteria 2525
630 Ga0501035_0119146 3300049822 Bacteria 2309
631 Ga0501035_0151609 3300049822 Bacteria 2011
632 Ga0501035_0169006 3300049822 Bacteria 1890
633 Ga0501044_0000002 3300049823 Bacteria 375152
634 Ga0501044_0025354 3300049823 Bacteria 6284
635 Ga0501044_0064575 3300049823 Bacteria 3736
636 Ga0501044_0097977 3300049823 Bacteria 2952
637 Ga0501044_0101816 3300049823 Bacteria 2889
638 Ga0501044_0175462 3300049823 Bacteria 2112
639 Ga0501044_0244539 3300049823 Bacteria 1737
640 Ga0501044_0253472 3300049823 Bacteria 1700
641 Ga0501045_0027119 3300049824 Bacteria 4125
642 nmdc:mga03683_15897_c1 3300050489 Bacteria 2818
643 nmdc:mga03n38_33657_c1 3300050490 Bacteria 2182
644 nmdc:mga00v17_159718_c1 3300050491 Bacteria 1450
645 nmdc:mga00v17_23610_c1 3300050491 Bacteria 3558
646 nmdc:mga00v17_29553_c1 3300050491 Bacteria 3217
647 nmdc:mga0yw44_20507_c1 3300050492 Bacteria 3669
648 nmdc:mga0yw44_228581_c1 3300050492 Bacteria 1235
649 nmdc:mga0yw44_23076_c1 3300050492 Bacteria 3501
650 nmdc:mga0yw44_233095_c1 3300050492 Bacteria 1222
651 nmdc:mga0yw44_59994_c1 3300050492 Bacteria 2329
652 nmdc:mga0yw44_9280_c1 3300050492 Bacteria 4960
653 nmdc:mga0k408_117412_c1 3300050493 Bacteria 1574
654 nmdc:mga0k408_155967_c1 3300050493 Bacteria 1360
655 nmdc:mga0k408_16319_c1 3300050493 Bacteria 4120
656 nmdc:mga06z11_174272_c1 3300050494 Bacteria 1237
657 nmdc:mga06z11_39270_c1 3300050494 Bacteria 2355
658 nmdc:mga06z11_87494_c1 3300050494 Bacteria 1685
659 nmdc:mga04h51_50121_c1 3300050495 Bacteria 1398
660 nmdc:mga04h51_8376_c1 3300050495 Bacteria 2766
661 nmdc:mga07m45_384_c1 3300050496 Bacteria 2609
662 nmdc:mga07m45_87393_c1 3300050496 Bacteria 1784
663 nmdc:mga05p37_421409_c1 3300050507 Bacteria 1553
664 nmdc:mga05p37_76481_c1 3300050507 Bacteria 4121
665 nmdc:mga05p37_99311_c1 3300050507 Bacteria 3585
666 nmdc:mga09592_40750_c1 3300050508 Bacteria 3902
667 nmdc:mga09592_434725_c1 3300050508 Bacteria 1133
668 nmdc:mga08y16_220760_c1 3300050511 Bacteria 1962
669 nmdc:mga08y16_595_c1 3300050511 Bacteria 33721
670 nmdc:mga0sz30_399_c1 3300050516 Bacteria 16539
671 nmdc:mga0sz30_4720_c1 3300050516 Bacteria 4949
672 nmdc:mga0sz30_52329_c1 3300050516 Bacteria 1733
673 Ga0500635_0016036 3300053080 Bacteria 2222
674 Ga0495595_0038192 3300053084 Bacteria 2187
675 Ga0500578_0033481 3300053086 Bacteria 3302
676 Ga0500643_016011 3300053087 Bacteria 2556
677 Ga0500583_0080745 3300053092 Bacteria 1571
678 Ga0500651_0000471 3300053093 Bacteria 21218
679 Ga0500651_0068130 3300053093 Bacteria 2216
680 Ga0500566_0109799 3300053094 Bacteria 1501
681 Ga0500641_0004986 3300053096 Bacteria 4708
682 Ga0500555_013088 3300053103 Bacteria 2391
683 Ga0500569_052581 3300053109 Bacteria 1233
684 Ga0500595_000277 3300053119 Bacteria 33985
685 Ga0500595_000905 3300053119 Bacteria 16915
686 Ga0500595_012013 3300053119 Bacteria 3361
687 Ga0500618_001303 3300053125 Bacteria 11433
688 Ga0500642_0001772 3300053130 Bacteria 6224
689 Ga0500658_0001900 3300053134 Bacteria 8191
690 Ga0500559_0002749 3300053136 Bacteria 8925
691 Ga0500559_0050552 3300053136 Bacteria 1834
692 Ga0500568_0056575 3300053139 Bacteria 1528
693 Ga0500573_0014843 3300053140 Bacteria 4411
694 Ga0500577_0018251 3300053142 Bacteria 2252
695 Ga0500588_0044329 3300053146 Bacteria 1356
696 Ga0500616_0008785 3300053153 Bacteria 6222
697 Ga0500616_0009068 3300053153 Bacteria 6088
698 Ga0500616_0025202 3300053153 Bacteria 3300
699 Ga0500616_0051254 3300053153 Bacteria 2175
700 Ga0500620_000073 3300053155 Bacteria 19157
701 Ga0500627_0105783 3300053158 Bacteria 1265
702 Ga0500639_053700 3300053163 Bacteria 2096
703 Ga0500636_0020080 3300053177 Bacteria 3952
704 Ga0500636_0037374 3300053177 Bacteria 2873
705 Ga0500609_001196 3300053731 Bacteria 3853
706 Ga0500596_003347 3300053735 Bacteria 3061
707 Ga0501084_0045867 3300054114 Bacteria 3659
708 Ga0501084_0047315 3300054114 Bacteria 3603
709 Ga0501084_0104318 3300054114 Bacteria 2381
710 Ga0587084_011383 3300059477 Bacteria 1184
711 Ga0587093_009592 3300059478 Bacteria 1128
712 Ga0587070_009462 3300059491 Bacteria 1409
713 Ga0587082_008725 3300059504 Bacteria 1422
714 Ga0587085_014050 3300059506 Bacteria 1124
715 Ga0587089_006418 3300059509 Bacteria 1364
716 Ga0587091_025449 3300059511 Bacteria 1070
717 Ga0587092_009489 3300059512 Bacteria 1309
718 Ga0587098_004952 3300059604 Bacteria 1283
719 Ga0587109_009900 3300059624 Bacteria 1509
720 Ga0587109_017360 3300059624 Bacteria 1245
721 Ga0587062_005828 3300059639 Bacteria 1377
722 Ga0587067_013055 3300059640 Bacteria 1308
723 Ga0587072_016002 3300059643 Bacteria 1280
724 Ga0587072_019423 3300059643 Bacteria 1189
725 Ga0587075_013073 3300059644 Bacteria 1137
726 Ga0587076_016012 3300059645 Bacteria 1178
727 Ga0587102_003382 3300059649 Bacteria 1295
728 Ga0587107_009843 3300059652 Bacteria 1138
729 Ga0587110_004555 3300059654 Bacteria 1212
730 Ga0587118_02616 3300059657 Bacteria 1176
731 Ga0587119_008385 3300059658 Bacteria 1136
732 Ga0587071_020586 3300060344 Bacteria 1203
733 Ga0501082_0015983 3300060353 Bacteria 6455
734 Ga0501082_0037827 3300060353 Bacteria 4161
735 Ga0501082_0390206 3300060353 Bacteria 1215

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0062164 Ga0496125_0062164_1888_2799 288
2 3300025914 Ga0207671_10029225 Ga0207671_100292253 290
3 3300005546 Ga0070696_100211437 Ga0070696_1002114372 296
4 3300009147 Ga0114129_10211874 Ga0114129_102118742 296
5 3300025915 Ga0207693_10239912 Ga0207693_102399122 296
6 3300035118 Ga0373954_0134235 Ga0373954_0134235_229_1119 296
7 3300050507 nmdc:mga05p37_421409_c1 nmdc:mga05p37_421409_c1_300_1250 296
8 3300049743 Ga0501081_0461962 Ga0501081_0461962_10_903 297
9 3300003762 Ga0055542_1004745 Ga0055542_10047452 298
10 3300005331 Ga0070670_100041442 Ga0070670_1000414423 298
11 3300005335 Ga0070666_10035449 Ga0070666_100354492 298
12 3300005338 Ga0068868_100093007 Ga0068868_1000930072 298
13 3300005355 Ga0070671_100031375 Ga0070671_1000313752 298
14 3300005455 Ga0070663_100004006 Ga0070663_1000040063 298
15 3300005539 Ga0068853_100266363 Ga0068853_1002663632 298
16 3300005578 Ga0068854_100048142 Ga0068854_1000481423 298
17 3300005616 Ga0068852_100002424 Ga0068852_1000024248 298
18 3300005617 Ga0068859_100310691 Ga0068859_1003106912 298
19 3300005844 Ga0068862_100491611 Ga0068862_1004916111 298
20 3300006038 Ga0075365_10074530 Ga0075365_100745303 298
21 3300006042 Ga0075368_10013231 Ga0075368_100132312 298
22 3300006048 Ga0075363_100039272 Ga0075363_1000392722 298
23 3300006051 Ga0075364_10078436 Ga0075364_100784361 298
24 3300006177 Ga0075362_10035658 Ga0075362_100356583 298
25 3300006178 Ga0075367_10003642 Ga0075367_100036427 298
26 3300006186 Ga0075369_10040088 Ga0075369_100400881 298
27 3300006195 Ga0075366_10015675 Ga0075366_100156752 298
28 3300006353 Ga0075370_10084754 Ga0075370_100847542 298
29 3300006931 Ga0097620_100310667 Ga0097620_1003106672 298
30 3300009093 Ga0105240_10006715 Ga0105240_1000671511 298
31 3300009093 Ga0105240_10142684 Ga0105240_101426842 298
32 3300009101 Ga0105247_10025586 Ga0105247_100255863 298
33 3300009174 Ga0105241_10189324 Ga0105241_101893241 298
34 3300009177 Ga0105248_10023698 Ga0105248_100236985 298
35 3300009545 Ga0105237_10007155 Ga0105237_100071551 298
36 3300010375 Ga0105239_10030771 Ga0105239_100307714 298
37 3300011119 Ga0105246_10014291 Ga0105246_100142913 298
38 3300013297 Ga0157378_10086860 Ga0157378_100868602 298
39 3300014325 Ga0163163_10015338 Ga0163163_100153385 298
40 3300014968 Ga0157379_10367279 Ga0157379_103672792 298
41 3300025254 Ga0209148_1000319 Ga0209148_100031949 298
42 3300025261 Ga0209233_1005165 Ga0209233_10051652 298
43 3300025272 Ga0209455_1000782 Ga0209455_100078210 298
44 3300025304 Ga0209257_1022512 Ga0209257_10225121 298
45 3300025900 Ga0207710_10008547 Ga0207710_100085473 298
46 3300025903 Ga0207680_10060191 Ga0207680_100601911 298
47 3300025904 Ga0207647_10013298 Ga0207647_100132982 298
48 3300025913 Ga0207695_10000240 Ga0207695_1000024044 298
49 3300025914 Ga0207671_10006330 Ga0207671_100063304 298
50 3300025924 Ga0207694_10366286 Ga0207694_103662861 298
51 3300025925 Ga0207650_10041328 Ga0207650_100413283 298
52 3300025941 Ga0207711_10110547 Ga0207711_101105471 298
53 3300025949 Ga0207667_10165181 Ga0207667_101651812 298
54 3300025981 Ga0207640_10201813 Ga0207640_102018131 298
55 3300026041 Ga0207639_10058895 Ga0207639_100588952 298
56 3300026067 Ga0207678_10015900 Ga0207678_100159002 298
57 3300026142 Ga0207698_10021751 Ga0207698_100217514 298
58 3300027866 Ga0209813_10001150 Ga0209813_100011501 298
59 3300028380 Ga0268265_10389859 Ga0268265_103898592 298
60 3300046474 Ga0495605_0031146 Ga0495605_0031146_1465_2418 298
61 3300046512 Ga0495610_0039352 Ga0495610_0039352_142_1095 298
62 3300046513 Ga0495616_0024859 Ga0495616_0024859_2195_3148 298
63 3300046522 Ga0495643_0004861 Ga0495643_0004861_321_1274 298
64 3300046542 Ga0495597_0012984 Ga0495597_0012984_2780_3733 298
65 3300047323 Ga0495683_0071753 Ga0495683_0071753_312_1265 298
66 3300047443 Ga0495687_013121 Ga0495687_013121_681_1634 298
67 3300048903 Ga0496100_0016060 Ga0496100_0016060_1266_2219 298
68 3300048904 Ga0496101_0024546 Ga0496101_0024546_336_1289 298
69 3300048905 Ga0496102_0012863 Ga0496102_0012863_198_1151 298
70 3300048906 Ga0496103_0002871 Ga0496103_0002871_5684_6637 298
71 3300048907 Ga0496104_0013027 Ga0496104_0013027_3821_4774 298
72 3300048909 Ga0496106_0236306 Ga0496106_0236306_234_1187 298
73 3300048911 Ga0496108_0029866 Ga0496108_0029866_2165_3118 298
74 3300048912 Ga0496109_0035954 Ga0496109_0035954_2805_3758 298
75 3300048913 Ga0496110_0020049 Ga0496110_0020049_4397_5350 298
76 3300048914 Ga0496111_0079066 Ga0496111_0079066_843_1796 298
77 3300048915 Ga0496112_0005447 Ga0496112_0005447_8125_9078 298
78 3300048916 Ga0496113_0009073 Ga0496113_0009073_2162_3115 298
79 3300048918 Ga0496115_0312510 Ga0496115_0312510_230_1183 298
80 3300048919 Ga0496116_0113437 Ga0496116_0113437_549_1502 298
81 3300048920 Ga0496117_0107500 Ga0496117_0107500_451_1404 298
82 3300048921 Ga0496118_0068163 Ga0496118_0068163_1431_2384 298
83 3300048922 Ga0496119_0014020 Ga0496119_0014020_55_1008 298
84 3300048925 Ga0496122_0074571 Ga0496122_0074571_620_1573 298
85 3300048927 Ga0496124_0020155 Ga0496124_0020155_3216_4169 298
86 3300050490 nmdc:mga03n38_33657_c1 nmdc:mga03n38_33657_c1_637_1590 298
87 3300050491 nmdc:mga00v17_29553_c1 nmdc:mga00v17_29553_c1_1939_2892 298
88 3300050492 nmdc:mga0yw44_9280_c1 nmdc:mga0yw44_9280_c1_2703_3656 298
89 3300050493 nmdc:mga0k408_16319_c1 nmdc:mga0k408_16319_c1_2729_3682 298
90 3300050495 nmdc:mga04h51_8376_c1 nmdc:mga04h51_8376_c1_1734_2687 298
91 3300059511 Ga0587091_025449 Ga0587091_025449_40_993 298
92 3300059649 Ga0587102_003382 Ga0587102_003382_276_1229 298
93 3300031456 Ga0307513_10099286 Ga0307513_100992863 299
94 3300005434 Ga0070709_10016514 Ga0070709_100165142 301
95 3300005436 Ga0070713_100003623 Ga0070713_1000036237 301
96 3300005437 Ga0070710_10002252 Ga0070710_100022523 301
97 3300005439 Ga0070711_100016056 Ga0070711_1000160565 301
98 3300025898 Ga0207692_10113444 Ga0207692_101134442 301
99 3300025915 Ga0207693_10075397 Ga0207693_100753972 301
100 3300025916 Ga0207663_10056556 Ga0207663_100565562 301
101 3300025939 Ga0207665_10102598 Ga0207665_101025982 301
102 3300039438 Ga0436360_0760710 Ga0436360_0760710_34_942 301
103 3300048929 Ga0496126_0090325 Ga0496126_0090325_750_1703 301
104 3300005336 Ga0070680_100170515 Ga0070680_1001705152 302
105 3300005983 Ga0081540_1021073 Ga0081540_10210732 302
106 3300025917 Ga0207660_10153172 Ga0207660_101531722 302
107 3300049579 Ga0501043_0117417 Ga0501043_0117417_933_1880 303
108 3300049586 Ga0501070_0023604 Ga0501070_0023604_903_1850 303
109 3300049822 Ga0501035_0119146 Ga0501035_0119146_1327_2274 303
110 3300009177 Ga0105248_10395955 Ga0105248_103959551 304
111 3300037418 Ga0395900_0001158 Ga0395900_0001158_4080_5045 304
112 3300037466 Ga0395898_0005716 Ga0395898_0005716_2685_3650 304
113 3300038443 Ga0395901_0042818 Ga0395901_0042818_2281_3246 304
114 3300048924 Ga0496121_0146502 Ga0496121_0146502_59_973 304
115 3300005356 Ga0070674_100232836 Ga0070674_1002328361 305
116 3300005539 Ga0068853_100012626 Ga0068853_1000126266 305
117 3300005563 Ga0068855_100228884 Ga0068855_1002288842 305
118 3300005834 Ga0068851_10063179 Ga0068851_100631792 305
119 3300009093 Ga0105240_10339086 Ga0105240_103390862 305
120 3300009545 Ga0105237_10021498 Ga0105237_100214986 305
121 3300009551 Ga0105238_10001985 Ga0105238_100019856 305
122 3300010375 Ga0105239_10049592 Ga0105239_100495922 305
123 3300014969 Ga0157376_10099848 Ga0157376_100998482 305
124 3300025297 Ga0209758_1024684 Ga0209758_10246842 305
125 3300025904 Ga0207647_10016597 Ga0207647_100165972 305
126 3300025914 Ga0207671_10088965 Ga0207671_100889652 305
127 3300025949 Ga0207667_10180081 Ga0207667_101800812 305
128 3300048914 Ga0496111_0253118 Ga0496111_0253118_57_1019 305
129 3300048926 Ga0496123_0024648 Ga0496123_0024648_15_932 305
130 3300059509 Ga0587089_006418 Ga0587089_006418_212_1174 305
131 3300059512 Ga0587092_009489 Ga0587092_009489_152_1114 305
132 3300059624 Ga0587109_009900 Ga0587109_009900_283_1245 305
133 3300059644 Ga0587075_013073 Ga0587075_013073_116_1078 305
134 3300059654 Ga0587110_004555 Ga0587110_004555_196_1158 305
135 3300059657 Ga0587118_02616 Ga0587118_02616_55_1017 305
136 3300003215 JGI25153J46596_10000019 JGI25153J46596_10000019142 306
137 3300003794 Ga0055531_10009724 Ga0055531_100097247 306
138 3300005365 Ga0070688_100086727 Ga0070688_1000867272 306
139 3300005435 Ga0070714_100053890 Ga0070714_1000538902 306
140 3300005437 Ga0070710_10002003 Ga0070710_100020032 306
141 3300005439 Ga0070711_100002848 Ga0070711_1000028485 306
142 3300005439 Ga0070711_100102967 Ga0070711_1001029672 306
143 3300005618 Ga0068864_100195359 Ga0068864_1001953592 306
144 3300006042 Ga0075368_10010975 Ga0075368_100109753 306
145 3300006173 Ga0070716_100004863 Ga0070716_1000048634 306
146 3300006173 Ga0070716_100072012 Ga0070716_1000720123 306
147 3300006237 Ga0097621_100168579 Ga0097621_1001685793 306
148 3300009177 Ga0105248_10043670 Ga0105248_100436702 306
149 3300009545 Ga0105237_10057919 Ga0105237_100579193 306
150 3300009551 Ga0105238_10107581 Ga0105238_101075812 306
151 3300010375 Ga0105239_10017591 Ga0105239_100175912 306
152 3300013306 Ga0163162_10042418 Ga0163162_100424184 306
153 3300013308 Ga0157375_10198245 Ga0157375_101982452 306
154 3300025297 Ga0209758_1000028 Ga0209758_1000028342 306
155 3300025298 Ga0209050_1024882 Ga0209050_10248822 306
156 3300025304 Ga0209257_1000688 Ga0209257_100068823 306
157 3300025898 Ga0207692_10015312 Ga0207692_100153121 306
158 3300025899 Ga0207642_10059885 Ga0207642_100598851 306
159 3300025914 Ga0207671_10103227 Ga0207671_101032272 306
160 3300025916 Ga0207663_10004509 Ga0207663_100045093 306
161 3300025916 Ga0207663_10371263 Ga0207663_103712631 306
162 3300025928 Ga0207700_10165257 Ga0207700_101652572 306
163 3300025929 Ga0207664_10064463 Ga0207664_100644632 306
164 3300025939 Ga0207665_10001825 Ga0207665_100018254 306
165 3300026142 Ga0207698_10354842 Ga0207698_103548422 306
166 3300028381 Ga0268264_10403514 Ga0268264_104035142 306
167 3300035118 Ga0373954_0131140 Ga0373954_0131140_12_965 306
168 3300035725 Ga0373947_0072796 Ga0373947_0072796_219_1169 306
169 3300037068 Ga0373925_0115012 Ga0373925_0115012_716_1666 306
170 3300037068 Ga0373925_0222432 Ga0373925_0222432_344_1297 306
171 3300046660 Ga0495625_0324259 Ga0495625_0324259_18_968 306
172 3300046694 Ga0495649_0208911 Ga0495649_0208911_15_965 306
173 3300047319 Ga0495674_0035848 Ga0495674_0035848_847_1800 306
174 3300048904 Ga0496101_0042329 Ga0496101_0042329_501_1451 306
175 3300048905 Ga0496102_0009946 Ga0496102_0009946_1336_2286 306
176 3300048908 Ga0496105_0081471 Ga0496105_0081471_519_1469 306
177 3300048909 Ga0496106_0009323 Ga0496106_0009323_5293_6243 306
178 3300048910 Ga0496107_0080835 Ga0496107_0080835_656_1606 306
179 3300048911 Ga0496108_0009837 Ga0496108_0009837_76_1026 306
180 3300048912 Ga0496109_0147425 Ga0496109_0147425_1221_2171 306
181 3300048913 Ga0496110_0024288 Ga0496110_0024288_76_1026 306
182 3300048914 Ga0496111_0014645 Ga0496111_0014645_529_1479 306
183 3300048915 Ga0496112_0017000 Ga0496112_0017000_3966_4916 306
184 3300048916 Ga0496113_0001431 Ga0496113_0001431_2763_3713 306
185 3300048918 Ga0496115_0025840 Ga0496115_0025840_358_1308 306
186 3300049569 Ga0501032_0155114 Ga0501032_0155114_288_1238 306
187 3300049581 Ga0501047_0012272 Ga0501047_0012272_1142_2092 306
188 3300049584 Ga0501068_0012242 Ga0501068_0012242_98_1048 306
189 3300049586 Ga0501070_0018522 Ga0501070_0018522_782_1711 306
190 3300049743 Ga0501081_0355059 Ga0501081_0355059_93_1031 306
191 3300049744 Ga0501083_0014473 Ga0501083_0014473_1562_2512 306
192 3300049823 Ga0501044_0097977 Ga0501044_0097977_452_1402 306
193 3300050492 nmdc:mga0yw44_23076_c1 nmdc:mga0yw44_23076_c1_1074_2036 306
194 3300053084 Ga0495595_0038192 Ga0495595_0038192_692_1642 306
195 3300053093 Ga0500651_0068130 Ga0500651_0068130_1241_2191 306
196 3300053103 Ga0500555_013088 Ga0500555_013088_1388_2338 306
197 3300053130 Ga0500642_0001772 Ga0500642_0001772_3978_4928 306
198 3300053142 Ga0500577_0018251 Ga0500577_0018251_62_1012 306
199 3300053146 Ga0500588_0044329 Ga0500588_0044329_52_1002 306
200 3300053153 Ga0500616_0008785 Ga0500616_0008785_5233_6183 306
201 3300053731 Ga0500609_001196 Ga0500609_001196_1872_2822 306
202 3300060353 Ga0501082_0015983 Ga0501082_0015983_3575_4525 306
203 3300060353 Ga0501082_0390206 Ga0501082_0390206_29_967 306
204 3300005985 Ga0081539_10064079 Ga0081539_100640792 307
205 3300007265 Ga0099794_10003764 Ga0099794_100037642 307
206 3300007788 Ga0099795_10004356 Ga0099795_100043563 307
207 3300027671 Ga0209588_1025509 Ga0209588_10255092 307
208 3300049571 Ga0501034_0014015 Ga0501034_0014015_1313_2236 307
209 3300049574 Ga0501038_0001456 Ga0501038_0001456_10814_11737 307
210 3300049575 Ga0501039_0498912 Ga0501039_0498912_11_934 307
211 3300049579 Ga0501043_0155333 Ga0501043_0155333_160_1083 307
212 3300049586 Ga0501070_0013944 Ga0501070_0013944_1687_2610 307
213 3300049589 Ga0501073_0034948 Ga0501073_0034948_2096_3019 307
214 3300049590 Ga0501074_0002793 Ga0501074_0002793_9996_10919 307
215 3300049742 Ga0501080_0052386 Ga0501080_0052386_1622_2545 307
216 3300049822 Ga0501035_0002943 Ga0501035_0002943_1986_2909 307
217 3300049823 Ga0501044_0025354 Ga0501044_0025354_1044_1967 307
218 3300053139 Ga0500568_0056575 Ga0500568_0056575_144_1094 307
219 3300060353 Ga0501082_0037827 Ga0501082_0037827_1103_2026 307
220 iso_pu_bacteria 2687453392 2688595819 307
221 iso_pu_bacteria 2838022645 2838025280 307
222 3300005841 Ga0068863_100245804 Ga0068863_1002458042 308
223 3300006038 Ga0075365_10042674 Ga0075365_100426742 308
224 3300006038 Ga0075365_10118475 Ga0075365_101184752 308
225 3300006051 Ga0075364_10025226 Ga0075364_100252263 308
226 3300006177 Ga0075362_10031420 Ga0075362_100314202 308
227 3300006178 Ga0075367_10011213 Ga0075367_100112132 308
228 3300006186 Ga0075369_10003778 Ga0075369_100037782 308
229 3300006195 Ga0075366_10003365 Ga0075366_100033656 308
230 3300006844 Ga0075428_100017029 Ga0075428_1000170293 308
231 3300006847 Ga0075431_100319425 Ga0075431_1003194251 308
232 3300006880 Ga0075429_100475113 Ga0075429_1004751131 308
233 3300009147 Ga0114129_10119161 Ga0114129_101191612 308
234 3300026088 Ga0207641_10356092 Ga0207641_103560922 308
235 3300048916 Ga0496113_0125615 Ga0496113_0125615_12_941 308
236 3300050489 nmdc:mga03683_15897_c1 nmdc:mga03683_15897_c1_1070_2017 308
237 3300050491 nmdc:mga00v17_23610_c1 nmdc:mga00v17_23610_c1_302_1249 308
238 3300050492 nmdc:mga0yw44_228581_c1 nmdc:mga0yw44_228581_c1_17_964 308
239 3300050492 nmdc:mga0yw44_233095_c1 nmdc:mga0yw44_233095_c1_182_1135 308
240 3300050494 nmdc:mga06z11_174272_c1 nmdc:mga06z11_174272_c1_157_1110 308
241 3300050507 nmdc:mga05p37_76481_c1 nmdc:mga05p37_76481_c1_1799_2746 308
242 3300050508 nmdc:mga09592_434725_c1 nmdc:mga09592_434725_c1_69_1016 308
243 3300050516 nmdc:mga0sz30_4720_c1 nmdc:mga0sz30_4720_c1_1222_2169 308
244 3300045049 Ga0466959_0019373 Ga0466959_0019373_137_1090 309
245 iso_pu_bacteria 2919679072 2919680338 310
246 3300053119 Ga0500595_000277 Ga0500595_000277_29811_30761 311
247 3300053153 Ga0500616_0009068 Ga0500616_0009068_2816_3751 311
248 iso_pu_bacteria 2996336353 2996337932 311
249 3300048915 Ga0496112_0402383 Ga0496112_0402383_345_1298 312
250 3300049569 Ga0501032_0016881 Ga0501032_0016881_272_1219 312
251 3300049571 Ga0501034_0033148 Ga0501034_0033148_2672_3619 312
252 3300049571 Ga0501034_0037176 Ga0501034_0037176_3679_4617 312
253 3300049572 Ga0501036_0157879 Ga0501036_0157879_737_1687 312
254 3300049574 Ga0501038_0019997 Ga0501038_0019997_2707_3654 312
255 3300049581 Ga0501047_0011842 Ga0501047_0011842_172_1119 312
256 3300049581 Ga0501047_0064797 Ga0501047_0064797_2501_3448 312
257 3300049583 Ga0501067_0068486 Ga0501067_0068486_924_1871 312
258 3300049586 Ga0501070_0033368 Ga0501070_0033368_2901_3848 312
259 3300049586 Ga0501070_0061639 Ga0501070_0061639_659_1606 312
260 3300049587 Ga0501071_0071517 Ga0501071_0071517_1493_2449 312
261 3300049590 Ga0501074_0146520 Ga0501074_0146520_647_1594 312
262 3300049591 Ga0501075_0026762 Ga0501075_0026762_2308_3258 312
263 3300049742 Ga0501080_0108142 Ga0501080_0108142_474_1421 312
264 3300049822 Ga0501035_0101480 Ga0501035_0101480_1338_2288 312
265 3300049822 Ga0501035_0151609 Ga0501035_0151609_893_1840 312
266 3300050492 nmdc:mga0yw44_20507_c1 nmdc:mga0yw44_20507_c1_1669_2610 312
267 3300053136 Ga0500559_0002749 Ga0500559_0002749_2482_3420 312
268 3300053140 Ga0500573_0014843 Ga0500573_0014843_230_1168 312
269 3300053163 Ga0500639_053700 Ga0500639_053700_310_1248 312
270 3300053177 Ga0500636_0020080 Ga0500636_0020080_660_1598 312
271 3300053735 Ga0500596_003347 Ga0500596_003347_1722_2660 312
272 3300054114 Ga0501084_0047315 Ga0501084_0047315_2001_2951 312
273 iso_pu_bacteria 2889914905 2889918055 312
274 3300005983 Ga0081540_1027016 Ga0081540_10270163 313
275 3300048907 Ga0496104_0473628 Ga0496104_0473628_61_1002 313
276 3300048922 Ga0496119_0105548 Ga0496119_0105548_342_1286 313
277 3300049587 Ga0501071_0067882 Ga0501071_0067882_1287_2228 313
278 3300059477 Ga0587084_011383 Ga0587084_011383_69_1013 313
279 3300059491 Ga0587070_009462 Ga0587070_009462_161_1105 313
280 3300059506 Ga0587085_014050 Ga0587085_014050_145_1089 313
281 3300059624 Ga0587109_017360 Ga0587109_017360_149_1093 313
282 3300059639 Ga0587062_005828 Ga0587062_005828_274_1218 313
283 3300059643 Ga0587072_019423 Ga0587072_019423_144_1088 313
284 3300059645 Ga0587076_016012 Ga0587076_016012_91_1035 313
285 3300059652 Ga0587107_009843 Ga0587107_009843_36_980 313
286 iso_pu_bacteria 2513237094 2513643122 313
287 iso_pu_bacteria 2513237104 2513715195 313
288 iso_pu_bacteria 2513237141 2513889600 313
289 iso_pu_bacteria 2617270741 2617378803 313
290 iso_pu_bacteria 2824679649 2824681220 313
291 iso_pu_bacteria 2824732956 2824734705 313
292 iso_pu_bacteria 2824746037 2824747777 313
293 iso_pu_bacteria 2844315083 2844317213 313
294 iso_pu_bacteria 2885366525 2885367317 313
295 iso_pu_bacteria 2903727486 2903735196 313
296 iso_pu_bacteria 2906602504 2906607604 313
297 iso_pu_bacteria 2908775508 2908778151 313
298 iso_pu_bacteria 2922393267 2922399443 313
299 iso_pu_bacteria 2941531003 2941535054 313
300 iso_pu_bacteria 3005483717 3005488648 313
301 iso_pu_bacteria 3005587118 3005594736 313
302 iso_pu_bacteria 3005718088 3005720321 313
303 iso_pu_bacteria 8006926726 8006927426 313
304 iso_pu_bacteria 8056967851 8056976246 313
305 3300005293 Ga0065715_10130442 Ga0065715_101304422 314
306 3300005295 Ga0065707_10123094 Ga0065707_101230941 314
307 3300005327 Ga0070658_10096397 Ga0070658_100963972 314
308 3300005339 Ga0070660_100060221 Ga0070660_1000602213 314
309 3300005353 Ga0070669_100010408 Ga0070669_1000104082 314
310 3300005356 Ga0070674_100013636 Ga0070674_1000136363 314
311 3300005364 Ga0070673_100065909 Ga0070673_1000659091 314
312 3300005366 Ga0070659_100193883 Ga0070659_1001938831 314
313 3300005459 Ga0068867_100151672 Ga0068867_1001516721 314
314 3300005543 Ga0070672_100010038 Ga0070672_1000100382 314
315 3300009148 Ga0105243_10630792 Ga0105243_106307921 314
316 3300010375 Ga0105239_10235850 Ga0105239_102358502 314
317 3300013296 Ga0157374_10421124 Ga0157374_104211241 314
318 3300013297 Ga0157378_10177796 Ga0157378_101777962 314
319 3300014497 Ga0182008_10118060 Ga0182008_101180602 314
320 3300025919 Ga0207657_10064375 Ga0207657_100643753 314
321 3300025923 Ga0207681_10009281 Ga0207681_100092814 314
322 3300025923 Ga0207681_10052346 Ga0207681_100523462 314
323 3300025932 Ga0207690_10269122 Ga0207690_102691221 314
324 3300025940 Ga0207691_10009789 Ga0207691_100097896 314
325 3300025940 Ga0207691_10056550 Ga0207691_100565503 314
326 3300025945 Ga0207679_10423269 Ga0207679_104232691 314
327 3300026089 Ga0207648_10228259 Ga0207648_102282591 314
328 3300026089 Ga0207648_10257773 Ga0207648_102577732 314
329 3300026118 Ga0207675_100004709 Ga0207675_1000047093 314
330 3300027907 Ga0207428_10113973 Ga0207428_101139732 314
331 3300028380 Ga0268265_10011716 Ga0268265_100117162 314
332 3300042876 Ga0451577_0007468 Ga0451577_0007468_578_1528 314
333 3300044712 Ga0453684_0254476 Ga0453684_0254476_596_1546 314
334 3300044901 Ga0466960_0061505 Ga0466960_0061505_183_1130 314
335 3300050508 nmdc:mga09592_40750_c1 nmdc:mga09592_40750_c1_1929_2879 314
336 3300053087 Ga0500643_016011 Ga0500643_016011_419_1414 314
337 3300053119 Ga0500595_012013 Ga0500595_012013_1399_2346 314
338 3300059658 Ga0587119_008385 Ga0587119_008385_108_1055 314
339 iso_pu_bacteria 2582581316 2585335511 314
340 iso_pu_bacteria 2615840698 2616557421 314
341 iso_pu_bacteria 2617270742 2617386466 314
342 iso_pu_bacteria 2842482326 2842488623 314
343 iso_pu_bacteria 8005682033 8005687233 314
344 3300003203 JGI25406J46586_10005327 JGI25406J46586_100053273 315
345 3300003305 Ga0006770J48903_1028616 Ga0006770J48903_10286161 315
346 3300005334 Ga0068869_100204935 Ga0068869_1002049351 315
347 3300005344 Ga0070661_100007453 Ga0070661_1000074537 315
348 3300005535 Ga0070684_100416955 Ga0070684_1004169551 315
349 3300005985 Ga0081539_10002462 Ga0081539_1000246222 315
350 3300006042 Ga0075368_10059575 Ga0075368_100595753 315
351 3300006048 Ga0075363_100003916 Ga0075363_1000039165 315
352 3300006177 Ga0075362_10031982 Ga0075362_100319822 315
353 3300009545 Ga0105237_10269275 Ga0105237_102692752 315
354 3300025914 Ga0207671_10163717 Ga0207671_101637172 315
355 3300025942 Ga0207689_10450365 Ga0207689_104503651 315
356 3300027866 Ga0209813_10003148 Ga0209813_100031483 315
357 3300028577 Ga0265318_10010306 Ga0265318_100103062 315
358 3300028794 Ga0307515_10000130 Ga0307515_1000013086 315
359 3300031247 Ga0265340_10000971 Ga0265340_100009712 315
360 3300031249 Ga0265339_10010789 Ga0265339_100107892 315
361 3300031344 Ga0265316_10007442 Ga0265316_100074429 315
362 3300031595 Ga0265313_10000254 Ga0265313_1000025454 315
363 3300031595 Ga0265313_10039042 Ga0265313_100390422 315
364 3300031711 Ga0265314_10004387 Ga0265314_1000438711 315
365 3300031711 Ga0265314_10141718 Ga0265314_101417182 315
366 3300031712 Ga0265342_10004447 Ga0265342_100044473 315
367 3300031730 Ga0307516_10076661 Ga0307516_100766612 315
368 3300031824 Ga0307413_10264124 Ga0307413_102641241 315
369 3300031995 Ga0307409_100091435 Ga0307409_1000914352 315
370 3300045976 Ga0466967_0046981 Ga0466967_0046981_126_1079 315
371 3300049569 Ga0501032_0033309 Ga0501032_0033309_272_1222 315
372 3300049570 Ga0501033_0027644 Ga0501033_0027644_1243_2193 315
373 3300049575 Ga0501039_0037330 Ga0501039_0037330_1987_2937 315
374 3300049580 Ga0501046_0036115 Ga0501046_0036115_2104_3054 315
375 3300049581 Ga0501047_0230352 Ga0501047_0230352_565_1521 315
376 3300049586 Ga0501070_0124481 Ga0501070_0124481_480_1427 315
377 3300049589 Ga0501073_0131566 Ga0501073_0131566_743_1699 315
378 3300049744 Ga0501083_0009431 Ga0501083_0009431_4506_5456 315
379 3300049744 Ga0501083_0033110 Ga0501083_0033110_1474_2421 315
380 3300049822 Ga0501035_0169006 Ga0501035_0169006_727_1674 315
381 3300049823 Ga0501044_0244539 Ga0501044_0244539_682_1629 315
382 3300049823 Ga0501044_0253472 Ga0501044_0253472_690_1640 315
383 3300050491 nmdc:mga00v17_159718_c1 nmdc:mga00v17_159718_c1_467_1417 315
384 3300050495 nmdc:mga04h51_50121_c1 nmdc:mga04h51_50121_c1_80_1033 315
385 3300053086 Ga0500578_0033481 Ga0500578_0033481_1668_2615 315
386 3300053092 Ga0500583_0080745 Ga0500583_0080745_482_1432 315
387 3300053153 Ga0500616_0025202 Ga0500616_0025202_336_1286 315
388 3300053158 Ga0500627_0105783 Ga0500627_0105783_154_1107 315
389 3300054114 Ga0501084_0045867 Ga0501084_0045867_1467_2417 315
390 iso_pu_bacteria 2513237164 2514038741 315
391 iso_pu_bacteria 2513237351 2514586811 315
392 iso_pu_bacteria 2765235802 2765468683 315
393 iso_pu_bacteria 2839993093 2839995411 315
394 iso_pu_bacteria 2904578770 2904581266 315
395 iso_pu_bacteria 2919119836 2919122505 315
396 3300005295 Ga0065707_10025624 Ga0065707_100256241 316
397 3300005329 Ga0070683_100020044 Ga0070683_1000200443 316
398 3300005340 Ga0070689_100227559 Ga0070689_1002275592 316
399 3300005344 Ga0070661_100131145 Ga0070661_1001311452 316
400 3300005356 Ga0070674_100105019 Ga0070674_1001050192 316
401 3300005366 Ga0070659_100203165 Ga0070659_1002031652 316
402 3300005434 Ga0070709_10182199 Ga0070709_101821992 316
403 3300005436 Ga0070713_100200583 Ga0070713_1002005832 316
404 3300005445 Ga0070708_100164201 Ga0070708_1001642012 316
405 3300005456 Ga0070678_100045677 Ga0070678_1000456773 316
406 3300005458 Ga0070681_10154050 Ga0070681_101540503 316
407 3300005467 Ga0070706_100178845 Ga0070706_1001788452 316
408 3300005468 Ga0070707_100014813 Ga0070707_1000148134 316
409 3300005518 Ga0070699_100206785 Ga0070699_1002067852 316
410 3300005536 Ga0070697_100193233 Ga0070697_1001932332 316
411 3300005548 Ga0070665_100003622 Ga0070665_10000362212 316
412 3300005548 Ga0070665_100047733 Ga0070665_1000477333 316
413 3300005564 Ga0070664_100140515 Ga0070664_1001405152 316
414 3300005617 Ga0068859_100482653 Ga0068859_1004826531 316
415 3300005718 Ga0068866_10121366 Ga0068866_101213662 316
416 3300005719 Ga0068861_100024979 Ga0068861_1000249793 316
417 3300005840 Ga0068870_10200506 Ga0068870_102005062 316
418 3300005842 Ga0068858_100169534 Ga0068858_1001695343 316
419 3300005843 Ga0068860_100000222 Ga0068860_10000022254 316
420 3300005844 Ga0068862_100005467 Ga0068862_10000546711 316
421 3300005937 Ga0081455_10036412 Ga0081455_100364124 316
422 3300005981 Ga0081538_10116406 Ga0081538_101164062 316
423 3300005985 Ga0081539_10000493 Ga0081539_1000049356 316
424 3300006038 Ga0075365_10031255 Ga0075365_100312552 316
425 3300006175 Ga0070712_100004279 Ga0070712_1000042799 316
426 3300006177 Ga0075362_10004305 Ga0075362_100043053 316
427 3300006186 Ga0075369_10001463 Ga0075369_100014637 316
428 3300006195 Ga0075366_10145028 Ga0075366_101450281 316
429 3300006881 Ga0068865_100022831 Ga0068865_1000228314 316
430 3300006931 Ga0097620_100482673 Ga0097620_1004826731 316
431 3300007265 Ga0099794_10015072 Ga0099794_100150722 316
432 3300007788 Ga0099795_10070125 Ga0099795_100701251 316
433 3300009094 Ga0111539_10000090 Ga0111539_1000009035 316
434 3300009098 Ga0105245_10350916 Ga0105245_103509162 316
435 3300009147 Ga0114129_10289767 Ga0114129_102897672 316
436 3300009148 Ga0105243_10046915 Ga0105243_100469152 316
437 3300009148 Ga0105243_10329851 Ga0105243_103298512 316
438 3300009176 Ga0105242_10609960 Ga0105242_106099601 316
439 3300009551 Ga0105238_10024769 Ga0105238_100247693 316
440 3300009551 Ga0105238_10060977 Ga0105238_100609772 316
441 3300010375 Ga0105239_10417617 Ga0105239_104176172 316
442 3300013102 Ga0157371_10228244 Ga0157371_102282442 316
443 3300013104 Ga0157370_10085287 Ga0157370_100852872 316
444 3300013105 Ga0157369_10228695 Ga0157369_102286951 316
445 3300013297 Ga0157378_10326226 Ga0157378_103262261 316
446 3300014326 Ga0157380_10005965 Ga0157380_100059652 316
447 3300019183 Ga0184601_102729 Ga0184601_1027291 316
448 3300019192 Ga0184603_136826 Ga0184603_1368261 316
449 3300020078 Ga0206352_10850575 Ga0206352_108505751 316
450 3300020081 Ga0206354_11218913 Ga0206354_112189131 316
451 3300020082 Ga0206353_10827906 Ga0206353_108279062 316
452 3300021384 Ga0213876_10001735 Ga0213876_100017359 316
453 3300021441 Ga0213871_10036607 Ga0213871_100366071 316
454 3300025297 Ga0209758_1001042 Ga0209758_10010429 316
455 3300025302 Ga0207426_1010086 Ga0207426_10100862 316
456 3300025900 Ga0207710_10031014 Ga0207710_100310142 316
457 3300025912 Ga0207707_10110064 Ga0207707_101100642 316
458 3300025914 Ga0207671_10073351 Ga0207671_100733512 316
459 3300025915 Ga0207693_10089265 Ga0207693_100892651 316
460 3300025919 Ga0207657_10129494 Ga0207657_101294942 316
461 3300025920 Ga0207649_10130300 Ga0207649_101303002 316
462 3300025922 Ga0207646_10034839 Ga0207646_100348391 316
463 3300025937 Ga0207669_10102384 Ga0207669_101023842 316
464 3300025937 Ga0207669_10163669 Ga0207669_101636691 316
465 3300025938 Ga0207704_10106103 Ga0207704_101061031 316
466 3300025972 Ga0207668_10040495 Ga0207668_100404953 316
467 3300026035 Ga0207703_10172066 Ga0207703_101720662 316
468 3300026067 Ga0207678_10244711 Ga0207678_102447111 316
469 3300026116 Ga0207674_10059422 Ga0207674_100594222 316
470 3300026118 Ga0207675_100025107 Ga0207675_1000251074 316
471 3300026121 Ga0207683_10210635 Ga0207683_102106352 316
472 3300027907 Ga0207428_10000055 Ga0207428_1000005511 316
473 3300028379 Ga0268266_10026011 Ga0268266_100260113 316
474 3300028380 Ga0268265_10056785 Ga0268265_100567852 316
475 3300028381 Ga0268264_10000042 Ga0268264_10000042153 316
476 3300028573 Ga0265334_10029187 Ga0265334_100291872 316
477 3300028786 Ga0307517_10124952 Ga0307517_101249522 316
478 3300030760 Ga0265762_1011286 Ga0265762_10112862 316
479 3300030863 Ga0265766_1001931 Ga0265766_10019311 316
480 3300031247 Ga0265340_10018541 Ga0265340_100185415 316
481 3300031247 Ga0265340_10069267 Ga0265340_100692672 316
482 3300031595 Ga0265313_10004260 Ga0265313_100042602 316
483 3300031616 Ga0307508_10000019 Ga0307508_10000019169 316
484 3300031730 Ga0307516_10001267 Ga0307516_100012677 316
485 3300031730 Ga0307516_10261571 Ga0307516_102615712 316
486 3300031824 Ga0307413_10167933 Ga0307413_101679331 316
487 3300031852 Ga0307410_10086811 Ga0307410_100868112 316
488 3300031995 Ga0307409_100060489 Ga0307409_1000604892 316
489 3300033544 Ga0316215_1004751 Ga0316215_10047512 316
490 3300037068 Ga0373925_0231346 Ga0373925_0231346_234_1187 316
491 3300037312 Ga0395899_0114225 Ga0395899_0114225_568_1521 316
492 3300037418 Ga0395900_0010027 Ga0395900_0010027_3359_4318 316
493 3300037466 Ga0395898_0010237 Ga0395898_0010237_658_1617 316
494 3300037466 Ga0395898_0364031 Ga0395898_0364031_60_1013 316
495 3300038443 Ga0395901_0004964 Ga0395901_0004964_2080_3039 316
496 3300038443 Ga0395901_0005295 Ga0395901_0005295_9444_10397 316
497 3300039437 Ga0436365_0162634 Ga0436365_0162634_10266_11336 316
498 3300039450 Ga0436363_1164297 Ga0436363_1164297_39_992 316
499 3300044684 Ga0466966_0057270 Ga0466966_0057270_1466_2416 316
500 3300044842 Ga0466957_0119907 Ga0466957_0119907_259_1212 316
501 3300045049 Ga0466959_0092639 Ga0466959_0092639_989_1939 316
502 3300045976 Ga0466967_0156765 Ga0466967_0156765_921_1874 316
503 3300046455 Ga0495603_0008597 Ga0495603_0008597_1432_2382 316
504 3300046473 Ga0495582_0120262 Ga0495582_0120262_52_1002 316
505 3300048909 Ga0496106_0001650 Ga0496106_0001650_5269_6219 316
506 3300048919 Ga0496116_0122478 Ga0496116_0122478_216_1166 316
507 3300048921 Ga0496118_0005110 Ga0496118_0005110_5234_6184 316
508 3300048921 Ga0496118_0036254 Ga0496118_0036254_2880_3830 316
509 3300048922 Ga0496119_0032690 Ga0496119_0032690_1972_2922 316
510 3300048924 Ga0496121_0004222 Ga0496121_0004222_7689_8639 316
511 3300048924 Ga0496121_0006122 Ga0496121_0006122_3621_4571 316
512 3300048927 Ga0496124_0002457 Ga0496124_0002457_12895_13845 316
513 3300048927 Ga0496124_0306567 Ga0496124_0306567_170_1120 316
514 3300048928 Ga0496125_0000090 Ga0496125_0000090_186158_187108 316
515 3300048928 Ga0496125_0002371 Ga0496125_0002371_23618_24568 316
516 3300048928 Ga0496125_0247511 Ga0496125_0247511_35_1114 316
517 3300048929 Ga0496126_0004444 Ga0496126_0004444_10532_11482 316
518 3300048929 Ga0496126_0251956 Ga0496126_0251956_473_1426 316
519 3300049569 Ga0501032_0139031 Ga0501032_0139031_445_1404 316
520 3300049571 Ga0501034_0001552 Ga0501034_0001552_2224_3177 316
521 3300049571 Ga0501034_0098571 Ga0501034_0098571_567_1526 316
522 3300049571 Ga0501034_0141505 Ga0501034_0141505_1422_2375 316
523 3300049574 Ga0501038_0055794 Ga0501038_0055794_77_1030 316
524 3300049581 Ga0501047_0272245 Ga0501047_0272245_564_1517 316
525 3300049583 Ga0501067_0165859 Ga0501067_0165859_205_1155 316
526 3300049584 Ga0501068_0063514 Ga0501068_0063514_853_1806 316
527 3300049588 Ga0501072_0163415 Ga0501072_0163415_709_1662 316
528 3300049589 Ga0501073_0049137 Ga0501073_0049137_1359_2309 316
529 3300049742 Ga0501080_0134156 Ga0501080_0134156_1261_2211 316
530 3300049743 Ga0501081_0164357 Ga0501081_0164357_541_1494 316
531 3300049823 Ga0501044_0101816 Ga0501044_0101816_457_1416 316
532 3300049823 Ga0501044_0175462 Ga0501044_0175462_1058_2008 316
533 3300050493 nmdc:mga0k408_117412_c1 nmdc:mga0k408_117412_c1_273_1226 316
534 3300050493 nmdc:mga0k408_155967_c1 nmdc:mga0k408_155967_c1_346_1299 316
535 3300050507 nmdc:mga05p37_99311_c1 nmdc:mga05p37_99311_c1_68_1021 316
536 3300050511 nmdc:mga08y16_220760_c1 nmdc:mga08y16_220760_c1_454_1407 316
537 3300050511 nmdc:mga08y16_595_c1 nmdc:mga08y16_595_c1_4404_5360 316
538 3300050516 nmdc:mga0sz30_399_c1 nmdc:mga0sz30_399_c1_4973_5926 316
539 3300053080 Ga0500635_0016036 Ga0500635_0016036_1137_2087 316
540 3300053093 Ga0500651_0000471 Ga0500651_0000471_18570_19520 316
541 3300053094 Ga0500566_0109799 Ga0500566_0109799_441_1391 316
542 3300053096 Ga0500641_0004986 Ga0500641_0004986_2758_3711 316
543 3300053119 Ga0500595_000905 Ga0500595_000905_5514_6464 316
544 3300053177 Ga0500636_0037374 Ga0500636_0037374_1719_2681 316
545 3300054114 Ga0501084_0104318 Ga0501084_0104318_1376_2329 316
546 3300059640 Ga0587067_013055 Ga0587067_013055_221_1174 316
547 iso_pu_bacteria 2508501123 2509114009 316
548 iso_pu_bacteria 2508501127 2509140768 316
549 iso_pu_bacteria 2509276018 2509368565 316
550 iso_pu_bacteria 2509276021 2509391040 316
551 iso_pu_bacteria 2509276022 2509393510 316
552 iso_pu_bacteria 2509276033 2509441786 316
553 iso_pu_bacteria 2510065019 2510133095 316
554 iso_pu_bacteria 2510065059 2510314846 316
555 iso_pu_bacteria 2510461076 2510894457 316
556 iso_pu_bacteria 2510461076 2510899483 316
557 iso_pu_bacteria 2512875016 2512934035 316
558 iso_pu_bacteria 2512875024 2512962299 316
559 iso_pu_bacteria 2513237084 2513569822 316
560 iso_pu_bacteria 2513237085 2513575101 316
561 iso_pu_bacteria 2513237090 2513610670 316
562 iso_pu_bacteria 2513237093 2513635565 316
563 iso_pu_bacteria 2513237103 2513713497 316
564 iso_pu_bacteria 2513237162 2514021898 316
565 iso_pu_bacteria 2513237305 2514418256 316
566 iso_pu_bacteria 2515075009 2515112054 316
567 iso_pu_bacteria 2515154113 2515635525 316
568 iso_pu_bacteria 2515154114 2515644993 316
569 iso_pu_bacteria 2515154116 2515660137 316
570 iso_pu_bacteria 2515154134 2515738787 316
571 iso_pu_bacteria 2516653077 2517035787 316
572 iso_pu_bacteria 2516653085 2517076187 316
573 iso_pu_bacteria 2517093000 2517094932 316
574 iso_pu_bacteria 2517287029 2517406578 316
575 iso_pu_bacteria 2519899620 2520378189 316
576 iso_pu_bacteria 2529292951 2530648514 316
577 iso_pu_bacteria 2534681796 2535520089 316
578 iso_pu_bacteria 2582581294 2585203849 316
579 iso_pu_bacteria 2582581308 2585278039 316
580 iso_pu_bacteria 2582581315 2585328346 316
581 iso_pu_bacteria 2585427526 2585528347 316
582 iso_pu_bacteria 2585427527 2585536959 316
583 iso_pu_bacteria 2585427528 2585539036 316
584 iso_pu_bacteria 2585427530 2585554595 316
585 iso_pu_bacteria 2585427593 2585836986 316
586 iso_pu_bacteria 2588253730 2588520148 316
587 iso_pu_bacteria 2597489875 2597810372 316
588 iso_pu_bacteria 2599185301 2599935271 316
589 iso_pu_bacteria 2615840626 2616309039 316
590 iso_pu_bacteria 2643221595 2643983754 316
591 iso_pu_bacteria 2643221627 2644155887 316
592 iso_pu_bacteria 2643221634 2644194915 316
593 iso_pu_bacteria 2643221643 2644242170 316
594 iso_pu_bacteria 2693429783 2694627987 316
595 iso_pu_bacteria 2693429784 2694636236 316
596 iso_pu_bacteria 2718217882 2719184708 316
597 iso_pu_bacteria 2718217927 2719389273 316
598 iso_pu_bacteria 2718218009 2719728728 316
599 iso_pu_bacteria 2718218363 2721144419 316
600 iso_pu_bacteria 2718218365 2721156367 316
601 iso_pu_bacteria 2718218366 2721161789 316
602 iso_pu_bacteria 2718218423 2721402038 316
603 iso_pu_bacteria 2721755514 2722842934 316
604 iso_pu_bacteria 2721755686 2723573035 316
605 iso_pu_bacteria 2721755809 2724035871 316
606 iso_pu_bacteria 2721755810 2724041753 316
607 iso_pu_bacteria 2724679232 2725952814 316
608 iso_pu_bacteria 2728369365 2730160823 316
609 iso_pu_bacteria 2728369397 2730295900 316
610 iso_pu_bacteria 2738541333 2739033471 316
611 iso_pu_bacteria 2756170246 2756674916 316
612 iso_pu_bacteria 2765235942 2766062962 316
613 iso_pu_bacteria 2791355123 2792747015 316
614 iso_pu_bacteria 2791355259 2793312881 316
615 iso_pu_bacteria 2791355260 2793323762 316
616 iso_pu_bacteria 2791355263 2793344429 316
617 iso_pu_bacteria 2791355264 2793345599 316
618 iso_pu_bacteria 2791355266 2793363680 316
619 iso_pu_bacteria 2791355267 2793370383 316
620 iso_pu_bacteria 2802429633 2806045017 316
621 iso_pu_bacteria 2802429634 2806056232 316
622 iso_pu_bacteria 2802429635 2806063342 316
623 iso_pu_bacteria 2802429636 2806065844 316
624 iso_pu_bacteria 2802429637 2806077654 316
625 iso_pu_bacteria 2818991453 2819643992 316
626 iso_pu_bacteria 2838035591 2838036435 316
627 iso_pu_bacteria 2838042994 2838044280 316
628 iso_pu_bacteria 2838686498 2838689261 316
629 iso_pu_bacteria 2838729681 2838730609 316
630 iso_pu_bacteria 2838742623 2838743550 316
631 iso_pu_bacteria 2841734538 2841736240 316
632 iso_pu_bacteria 2841851746 2841854774 316
633 iso_pu_bacteria 2841864319 2841865622 316
634 iso_pu_bacteria 2842110456 2842110712 316
635 iso_pu_bacteria 2842156927 2842157637 316
636 iso_pu_bacteria 2842163707 2842164831 316
637 iso_pu_bacteria 2842180545 2842180778 316
638 iso_pu_bacteria 2842198810 2842200846 316
639 iso_pu_bacteria 2842217011 2842222924 316
640 iso_pu_bacteria 2842229732 2842231164 316
641 iso_pu_bacteria 2842243621 2842244729 316
642 iso_pu_bacteria 2842257432 2842258542 316
643 iso_pu_bacteria 2842271015 2842273281 316
644 iso_pu_bacteria 2842304105 2842310057 316
645 iso_pu_bacteria 2842341865 2842345552 316
646 iso_pu_bacteria 2842363717 2842363849 316
647 iso_pu_bacteria 2842395702 2842397221 316
648 iso_pu_bacteria 2844002411 2844003602 316
649 iso_pu_bacteria 2844009547 2844010628 316
650 iso_pu_bacteria 2844454524 2844459384 316
651 iso_pu_bacteria 2847670302 2847673339 316
652 iso_pu_bacteria 2856314179 2856319192 316
653 iso_pu_bacteria 2856320880 2856322274 316
654 iso_pu_bacteria 2856328259 2856332695 316
655 iso_pu_bacteria 2856334872 2856340682 316
656 iso_pu_bacteria 2856342000 2856342924 316
657 iso_pu_bacteria 2856349417 2856351752 316
658 iso_pu_bacteria 2856356410 2856360929 316
659 iso_pu_bacteria 2856364286 2856369987 316
660 iso_pu_bacteria 2857349434 2857352819 316
661 iso_pu_bacteria 2857516855 2857518501 316
662 iso_pu_bacteria 2869162929 2869165362 316
663 iso_pu_bacteria 2869169390 2869172482 316
664 iso_pu_bacteria 2869234852 2869239579 316
665 iso_pu_bacteria 2869242130 2869245161 316
666 iso_pu_bacteria 2869249662 2869255874 316
667 iso_pu_bacteria 2869256925 2869257110 316
668 iso_pu_bacteria 2869264136 2869264909 316
669 iso_pu_bacteria 2869271264 2869271392 316
670 iso_pu_bacteria 2869278585 2869284630 316
671 iso_pu_bacteria 2869285874 2869290794 316
672 iso_pu_bacteria 2871429161 2871433076 316
673 iso_pu_bacteria 2871435913 2871436781 316
674 iso_pu_bacteria 2871444079 2871447603 316
675 iso_pu_bacteria 2871451962 2871458526 316
676 iso_pu_bacteria 2871459585 2871466010 316
677 iso_pu_bacteria 2871466892 2871474160 316
678 iso_pu_bacteria 2871474448 2871481261 316
679 iso_pu_bacteria 2871481445 2871486932 316
680 iso_pu_bacteria 2871488783 2871489631 316
681 iso_pu_bacteria 2871495908 2871502278 316
682 iso_pu_bacteria 2874102143 2874106073 316
683 iso_pu_bacteria 2874109183 2874116091 316
684 iso_pu_bacteria 2874116593 2874118221 316
685 iso_pu_bacteria 2874123672 2874124218 316
686 iso_pu_bacteria 2874131515 2874135248 316
687 iso_pu_bacteria 2874139085 2874143051 316
688 iso_pu_bacteria 2874146452 2874153763 316
689 iso_pu_bacteria 2874155637 2874161028 316
690 iso_pu_bacteria 2874162495 2874168317 316
691 iso_pu_bacteria 2874168670 2874172235 316
692 iso_pu_bacteria 2876363079 2876363707 316
693 iso_pu_bacteria 2876369609 2876376079 316
694 iso_pu_bacteria 2876377896 2876382817 316
695 iso_pu_bacteria 2876386047 2876386069 316
696 iso_pu_bacteria 2876392853 2876397156 316
697 iso_pu_bacteria 2876399893 2876403769 316
698 iso_pu_bacteria 2876406927 2876408016 316
699 iso_pu_bacteria 2876413966 2876419068 316
700 iso_pu_bacteria 2876420981 2876425443 316
701 iso_pu_bacteria 2878035449 2878039581 316
702 iso_pu_bacteria 2878730984 2878736025 316
703 iso_pu_bacteria 2878738818 2878740881 316
704 iso_pu_bacteria 2878745973 2878750689 316
705 iso_pu_bacteria 2878753008 2878754333 316
706 iso_pu_bacteria 2878760144 2878766169 316
707 iso_pu_bacteria 2878767105 2878773370 316
708 iso_pu_bacteria 2878774303 2878778226 316
709 iso_pu_bacteria 2878781027 2878784575 316
710 iso_pu_bacteria 2881147464 2881148074 316
711 iso_pu_bacteria 2881155292 2881159167 316
712 iso_pu_bacteria 2881161766 2881164865 316
713 iso_pu_bacteria 2881853255 2881858352 316
714 iso_pu_bacteria 2881861095 2881862150 316
715 iso_pu_bacteria 2882632389 2882634601 316
716 iso_pu_bacteria 2882912400 2882914437 316
717 iso_pu_bacteria 2885305155 2885306740 316
718 iso_pu_bacteria 2885312484 2885314295 316
719 iso_pu_bacteria 2885318864 2885323655 316
720 iso_pu_bacteria 2885326080 2885328522 316
721 iso_pu_bacteria 2885334103 2885340175 316
722 iso_pu_bacteria 2885342637 2885344001 316
723 iso_pu_bacteria 2885350715 2885352338 316
724 iso_pu_bacteria 2888337043 2888343256 316
725 iso_pu_bacteria 2888343758 2888344200 316
726 iso_pu_bacteria 2888350351 2888353050 316
727 iso_pu_bacteria 2889010040 2889014795 316
728 iso_pu_bacteria 2889016732 2889020120 316
729 iso_pu_bacteria 2903448605 2903454208 316
730 iso_pu_bacteria 2903492973 2903496296 316
731 iso_pu_bacteria 2903492973 2903497352 316
732 iso_pu_bacteria 2903513507 2903519215 316
733 iso_pu_bacteria 2903521522 2903523232 316
734 iso_pu_bacteria 2903528002 2903529271 316
735 iso_pu_bacteria 2903540706 2903547215 316
736 iso_pu_bacteria 2904659560 2904663910 316
737 iso_pu_bacteria 2906308376 2906313614 316
738 iso_pu_bacteria 2906321335 2906326323 316
739 iso_pu_bacteria 2906328253 2906334288 316
740 iso_pu_bacteria 2906354277 2906354464 316
741 iso_pu_bacteria 2906363423 2906369738 316
742 iso_pu_bacteria 2906370794 2906372854 316
743 iso_pu_bacteria 2906378014 2906378290 316
744 iso_pu_bacteria 2906386501 2906388681 316
745 iso_pu_bacteria 2906393657 2906395178 316
746 iso_pu_bacteria 2906401398 2906407713 316
747 iso_pu_bacteria 2906408224 2906409238 316
748 iso_pu_bacteria 2906414383 2906419264 316
749 iso_pu_bacteria 2906427513 2906434559 316
750 iso_pu_bacteria 2922130491 2922136537 316
751 iso_pu_bacteria 2922151315 2922155288 316
752 iso_pu_bacteria 2922158528 2922162536 316
753 iso_pu_bacteria 2922172374 2922174369 316
754 iso_pu_bacteria 2922178524 2922183243 316
755 iso_pu_bacteria 2922185730 2922193614 316
756 iso_pu_bacteria 2924710171 2924714226 316
757 iso_pu_bacteria 2924718760 2924723401 316
758 iso_pu_bacteria 2924726620 2924728907 316
759 iso_pu_bacteria 2924733363 2924736490 316
760 iso_pu_bacteria 2924741084 2924741481 316
761 iso_pu_bacteria 2924748358 2924748613 316
762 iso_pu_bacteria 2924754689 2924755403 316
763 iso_pu_bacteria 2924762789 2924765626 316
764 iso_pu_bacteria 2924776078 2924778482 316
765 iso_pu_bacteria 2924784321 2924785662 316
766 iso_pu_bacteria 2933570622 2933576582 316
767 iso_pu_bacteria 2933586486 2933586738 316
768 iso_pu_bacteria 2935901341 2935904523 316
769 iso_pu_bacteria 2936367885 2936372950 316
770 iso_pu_bacteria 2936375103 2936381105 316
771 iso_pu_bacteria 2936381700 2936384444 316
772 iso_pu_bacteria 2937813078 2937820081 316
773 iso_pu_bacteria 2937822353 2937826481 316
774 iso_pu_bacteria 2937836603 2937843171 316
775 iso_pu_bacteria 2937848649 2937849524 316
776 iso_pu_bacteria 2937861824 2937868337 316
777 iso_pu_bacteria 2937868953 2937876570 316
778 iso_pu_bacteria 2937877337 2937879963 316
779 iso_pu_bacteria 2937891427 2937891783 316
780 iso_pu_bacteria 2937972304 2937980001 316
781 iso_pu_bacteria 2937994558 2938001078 316
782 iso_pu_bacteria 2938014810 2938020132 316
783 iso_pu_bacteria 2958034702 2958041514 316
784 iso_pu_bacteria 2958041894 2958042490 316
785 iso_pu_bacteria 2958064165 2958069506 316
786 iso_pu_bacteria 2958071322 2958077201 316
787 iso_pu_bacteria 2958084443 2958086027 316
788 iso_pu_bacteria 2958092219 2958096463 316
789 iso_pu_bacteria 2958100919 2958101971 316
790 iso_pu_bacteria 2958108152 2958108179 316
791 iso_pu_bacteria 2958115193 2958119269 316
792 iso_pu_bacteria 2958122699 2958123232 316
793 iso_pu_bacteria 2958130278 2958135194 316
794 iso_pu_bacteria 2958137437 2958140021 316
795 iso_pu_bacteria 2958144490 2958148567 316
796 iso_pu_bacteria 2958158011 2958159884 316
797 iso_pu_bacteria 2958165035 2958171344 316
798 iso_pu_bacteria 2958172287 2958178943 316
799 iso_pu_bacteria 2958179912 2958184223 316
800 iso_pu_bacteria 2961077736 2961082278 316
801 iso_pu_bacteria 2961114664 2961118950 316
802 iso_pu_bacteria 2961127735 2961134095 316
803 iso_pu_bacteria 2961136820 2961138679 316
804 iso_pu_bacteria 2961163497 2961169785 316
805 iso_pu_bacteria 2961170736 2961176387 316
806 iso_pu_bacteria 2961183825 2961190689 316
807 iso_pu_bacteria 2963644680 2963645167 316
808 iso_pu_bacteria 2965018300 2965024545 316
809 iso_pu_bacteria 2965025482 2965030144 316
810 iso_pu_bacteria 2965032056 2965036574 316
811 iso_pu_bacteria 2965040258 2965042355 316
812 iso_pu_bacteria 2965047637 2965054251 316
813 iso_pu_bacteria 2965062239 2965065184 316
814 iso_pu_bacteria 2965089291 2965096583 316
815 iso_pu_bacteria 2965102966 2965110846 316
816 iso_pu_bacteria 2965110997 2965112097 316
817 iso_pu_bacteria 2965119406 2965127218 316
818 iso_pu_bacteria 2967996073 2967996695 316
819 iso_pu_bacteria 2968003550 2968004757 316
820 iso_pu_bacteria 2968016561 2968023035 316
821 iso_pu_bacteria 2968083720 2968089934 316
822 iso_pu_bacteria 2968091066 2968093700 316
823 iso_pu_bacteria 2968097103 2968098530 316
824 iso_pu_bacteria 2968110612 2968115049 316
825 iso_pu_bacteria 2968117919 2968122774 316
826 iso_pu_bacteria 2968128360 2968133867 316
827 iso_pu_bacteria 2968138860 2968143829 316
828 iso_pu_bacteria 2968171901 2968178177 316
829 iso_pu_bacteria 2970469710 2970475619 316
830 iso_pu_bacteria 2970489779 2970492413 316
831 iso_pu_bacteria 2970503327 2970509058 316
832 iso_pu_bacteria 2970510686 2970511269 316
833 iso_pu_bacteria 2970524798 2970525909 316
834 iso_pu_bacteria 2970532167 2970536428 316
835 iso_pu_bacteria 2970540015 2970545641 316
836 iso_pu_bacteria 2970547951 2970550154 316
837 iso_pu_bacteria 2970554993 2970561023 316
838 iso_pu_bacteria 2970593180 2970599242 316
839 iso_pu_bacteria 2970619444 2970622076 316
840 iso_pu_bacteria 2970627176 2970633255 316
841 iso_pu_bacteria 2977821940 2977823547 316
842 iso_pu_bacteria 2977843712 2977850375 316
843 iso_pu_bacteria 2977851361 2977855221 316
844 iso_pu_bacteria 2977858184 2977863405 316
845 iso_pu_bacteria 2977864932 2977871677 316
846 iso_pu_bacteria 2977872689 2977873767 316
847 iso_pu_bacteria 2977898635 2977906580 316
848 iso_pu_bacteria 2977907340 2977909267 316
849 iso_pu_bacteria 2977915119 2977917039 316
850 iso_pu_bacteria 2977922695 2977925681 316
851 iso_pu_bacteria 2977935797 2977938218 316
852 iso_pu_bacteria 2977942078 2977943459 316
853 iso_pu_bacteria 2977950692 2977954505 316
854 iso_pu_bacteria 2977957713 2977957964 316
855 iso_pu_bacteria 2977971508 2977975316 316
856 iso_pu_bacteria 2977986579 2977989259 316
857 iso_pu_bacteria 2979710463 2979713679 316
858 iso_pu_bacteria 2979742915 2979750181 316
859 iso_pu_bacteria 2979764755 2979765821 316
860 iso_pu_bacteria 2979772303 2979773211 316
861 iso_pu_bacteria 2979779861 2979781778 316
862 iso_pu_bacteria 2979793036 2979797007 316
863 iso_pu_bacteria 2979808191 2979813737 316
864 iso_pu_bacteria 2980125574 2980127614 316
865 iso_pu_bacteria 2987636660 2987641411 316
866 iso_pu_bacteria 2987645492 2987648147 316
867 iso_pu_bacteria 2987652177 2987656396 316
868 iso_pu_bacteria 2987659509 2987666009 316
869 iso_pu_bacteria 2987666974 2987669371 316
870 iso_pu_bacteria 2987673487 2987675693 316
871 iso_pu_bacteria 2996341866 2996342451 316
872 iso_pu_bacteria 2996348954 2996355771 316
873 iso_pu_bacteria 2996386984 2996390524 316
874 iso_pu_bacteria 2996887358 2996893073 316
875 iso_pu_bacteria 2996893221 2996897512 316
876 iso_pu_bacteria 3000135777 3000137264 316
877 iso_pu_bacteria 3004167301 3004173087 316
878 iso_pu_bacteria 3004188549 3004195032 316
879 iso_pu_bacteria 3004195979 3004197112 316
880 iso_pu_bacteria 3004203850 3004210221 316
881 iso_pu_bacteria 3004211236 3004217216 316
882 iso_pu_bacteria 3004218560 3004220518 316
883 iso_pu_bacteria 3004232784 3004234562 316
884 iso_pu_bacteria 3004239961 3004243188 316
885 iso_pu_bacteria 3004248173 3004253949 316
886 iso_pu_bacteria 3004268573 3004274186 316
887 iso_pu_bacteria 3004275668 3004282197 316
888 iso_pu_bacteria 3004334049 3004337550 316
889 iso_pu_bacteria 637000159 637077185 316
890 iso_pu_bacteria 639633055 639648329 316
891 iso_pu_bacteria 649633066 649870386 316
892 iso_pu_bacteria 8004300914 8004302690 316
893 iso_pu_bacteria 8004361976 8004366122 316
894 iso_pu_bacteria 8004374579 8004375909 316
895 iso_pu_bacteria 8004387939 8004393083 316
896 iso_pu_bacteria 8004395343 8004399900 316
897 iso_pu_bacteria 8004633249 8004638419 316
898 iso_pu_bacteria 8004640170 8004641579 316
899 iso_pu_bacteria 8004695233 8004701016 316
900 iso_pu_bacteria 8004703790 8004706853 316
901 iso_pu_bacteria 8004714634 8004719870 316
902 iso_pu_bacteria 8004727605 8004728947 316
903 iso_pu_bacteria 8005275841 8005277615 316
904 iso_pu_bacteria 8005307578 8005314310 316
905 iso_pu_bacteria 8005321885 8005327600 316
906 iso_pu_bacteria 8005376324 8005378971 316
907 iso_pu_bacteria 8005460587 8005462713 316
908 iso_pu_bacteria 8005542996 8005547826 316
909 iso_pu_bacteria 8005556819 8005557944 316
910 iso_pu_bacteria 8005563573 8005569118 316
911 iso_pu_bacteria 8005570704 8005576128 316
912 iso_pu_bacteria 8005695170 8005697849 316
913 iso_pu_bacteria 8018163183 8018168277 316
914 iso_pu_bacteria 8018176218 8018180483 316
915 iso_pu_bacteria 8023680758 8023681128 316
916 iso_pu_bacteria 8024479707 8024485931 316
917 iso_pu_bacteria 8055617313 8055617723 316
918 iso_pu_bacteria 8056375014 8056377842 316
919 iso_pu_bacteria 8057874678 8057875293 316
920 3300038443 Ga0395901_0012394 Ga0395901_0012394_986_1939 317
921 iso_pu_bacteria 2510917030 2511195001 317
922 iso_pu_bacteria 2513237088 2513594930 317
923 iso_pu_bacteria 2513237138 2513867253 317
924 iso_pu_bacteria 2582581298 2585226315 317
925 iso_pu_bacteria 2582581867 2585401896 317
926 iso_pu_bacteria 2585427529 2585548765 317
927 iso_pu_bacteria 2585427590 2585820311 317
928 iso_pu_bacteria 2718217997 2719667075 317
929 iso_pu_bacteria 2718218199 2720493495 317
930 iso_pu_bacteria 2718218232 2720614952 317
931 iso_pu_bacteria 2718218233 2720621724 317
932 iso_pu_bacteria 2718218235 2720633054 317
933 iso_pu_bacteria 2718218269 2720776778 317
934 iso_pu_bacteria 2721755556 2723028367 317
935 iso_pu_bacteria 2721755684 2723561994 317
936 iso_pu_bacteria 2721755685 2723568626 317
937 iso_pu_bacteria 2721755819 2724091385 317
938 iso_pu_bacteria 2721755822 2724105891 317
939 iso_pu_bacteria 2721755823 2724111716 317
940 iso_pu_bacteria 2728369352 2730109303 317
941 iso_pu_bacteria 2791355261 2793331610 317
942 iso_pu_bacteria 2838016132 2838022451 317
943 iso_pu_bacteria 2838048938 2838054533 317
944 iso_pu_bacteria 2838061910 2838068317 317
945 iso_pu_bacteria 2838068647 2838074644 317
946 iso_pu_bacteria 2842264693 2842270856 317
947 iso_pu_bacteria 2842311132 2842317350 317
948 iso_pu_bacteria 2842422224 2842428250 317
949 iso_pu_bacteria 2842428310 2842434739 317
950 iso_pu_bacteria 2842434925 2842441099 317
951 iso_pu_bacteria 2842441272 2842447717 317
952 iso_pu_bacteria 2842447887 2842454402 317
953 iso_pu_bacteria 2842462802 2842469100 317
954 iso_pu_bacteria 2842469257 2842475646 317
955 iso_pu_bacteria 2842495871 2842501401 317
956 iso_pu_bacteria 2923556063 2923558618 317
957 iso_pu_bacteria 2933599457 2933605099 317
958 iso_pu_bacteria 3003930520 3003930691 317
959 iso_pu_bacteria 3005445848 3005452087 317
960 iso_pu_bacteria 8005282627 8005286972 317
961 iso_pu_bacteria 8005395548 8005399379 317
962 iso_pu_bacteria 8005430974 8005435454 317
963 iso_pu_bacteria 8005497431 8005501816 317
964 iso_pu_bacteria 8005619151 8005623170 317
965 iso_pu_bacteria 8005626139 8005629002 317
966 iso_pu_bacteria 8005668836 8005673239 317
967 3300002737 JGI25162J39368_1000720 JGI25162J39368_100072020 318
968 3300003214 JGI25165J46597_1000556 JGI25165J46597_10005567 318
969 3300003323 rootH1_10147757 rootH1_101477571 318
970 3300009098 Ga0105245_10100008 Ga0105245_101000082 318
971 3300025228 Ga0209672_104215 Ga0209672_1042151 318
972 3300025233 Ga0209437_100104 Ga0209437_100104159 318
973 3300025261 Ga0209233_1000279 Ga0209233_100027938 318
974 3300025284 Ga0209130_1010486 Ga0209130_10104861 318
975 3300027312 Ga0209371_1004496 Ga0209371_10044966 318
976 3300030500 Ga0268256_1003212 Ga0268256_10032128 318
977 3300044765 Ga0466970_0000026 Ga0466970_0000026_31629_32585 318
978 3300046460 Ga0495638_0012275 Ga0495638_0012275_2317_3291 318
979 3300053125 Ga0500618_001303 Ga0500618_001303_8902_9858 318
980 3300053136 Ga0500559_0050552 Ga0500559_0050552_339_1298 319
981 3300002705 JGI25156J39149_1005229 JGI25156J39149_10052292 320
982 3300002739 JGI25158J39367_1000130 JGI25158J39367_100013011 320
983 3300002741 JGI25157J39369_1000647 JGI25157J39369_100064720 320
984 3300002773 JGI25152J39213_1000768 JGI25152J39213_10007685 320
985 3300002773 JGI25152J39213_1001049 JGI25152J39213_10010497 320
986 3300002987 JGI25159J45721_1003170 JGI25159J45721_10031702 320
987 3300003187 JGI25151J46595_10001716 JGI25151J46595_100017169 320
988 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078119 320
989 3300003215 JGI25153J46596_10000532 JGI25153J46596_100005325 320
990 3300003215 JGI25153J46596_10001241 JGI25153J46596_1000124110 320
991 3300003215 JGI25153J46596_10002978 JGI25153J46596_100029784 320
992 3300003215 JGI25153J46596_10012294 JGI25153J46596_100122943 320
993 3300003354 JGI25160J50197_1006047 JGI25160J50197_10060475 320
994 3300003374 JGI25161J50226_1000188 JGI25161J50226_10001887 320
995 3300003762 Ga0055542_1000814 Ga0055542_100081411 320
996 3300003763 Ga0055529_1001740 Ga0055529_10017403 320
997 3300003771 Ga0055526_1001352 Ga0055526_100135211 320
998 3300003771 Ga0055526_1001382 Ga0055526_10013827 320
999 3300003771 Ga0055526_1001442 Ga0055526_100144216 320
1000 3300003775 Ga0055524_1001040 Ga0055524_100104016 320
1001 3300003775 Ga0055524_1008223 Ga0055524_10082233 320
1002 3300003775 Ga0055524_1009824 Ga0055524_10098241 320
1003 3300003790 Ga0055528_1000223 Ga0055528_100022337 320
1004 3300003790 Ga0055528_1000597 Ga0055528_100059727 320
1005 3300003790 Ga0055528_1023366 Ga0055528_10233662 320
1006 3300003792 Ga0055540_1000096 Ga0055540_100009641 320
1007 3300003792 Ga0055540_1011814 Ga0055540_10118141 320
1008 3300003792 Ga0055540_1017010 Ga0055540_10170102 320
1009 3300004625 Ga0055543_1000565 Ga0055543_100056512 320
1010 3300004625 Ga0055543_1000877 Ga0055543_10008779 320
1011 3300005262 Ga0065165_1007005 Ga0065165_10070056 320
1012 3300005262 Ga0065165_1044198 Ga0065165_10441981 320
1013 3300005353 Ga0070669_100091611 Ga0070669_1000916112 320
1014 3300005367 Ga0070667_100370994 Ga0070667_1003709941 320
1015 3300005455 Ga0070663_100161983 Ga0070663_1001619831 320
1016 3300005456 Ga0070678_100150904 Ga0070678_1001509042 320
1017 3300005578 Ga0068854_100060919 Ga0068854_1000609192 320
1018 3300005834 Ga0068851_10017949 Ga0068851_100179491 320
1019 3300005937 Ga0081455_10068812 Ga0081455_100688123 320
1020 3300006038 Ga0075365_10044243 Ga0075365_100442432 320
1021 3300006038 Ga0075365_10059257 Ga0075365_100592573 320
1022 3300006042 Ga0075368_10012328 Ga0075368_100123282 320
1023 3300006042 Ga0075368_10025686 Ga0075368_100256861 320
1024 3300006051 Ga0075364_10065112 Ga0075364_100651122 320
1025 3300006177 Ga0075362_10014495 Ga0075362_100144951 320
1026 3300006177 Ga0075362_10026475 Ga0075362_100264752 320
1027 3300006178 Ga0075367_10001159 Ga0075367_100011592 320
1028 3300006178 Ga0075367_10034536 Ga0075367_100345362 320
1029 3300006178 Ga0075367_10125092 Ga0075367_101250921 320
1030 3300006186 Ga0075369_10047733 Ga0075369_100477332 320
1031 3300006195 Ga0075366_10003595 Ga0075366_100035957 320
1032 3300006353 Ga0075370_10014844 Ga0075370_100148443 320
1033 3300006353 Ga0075370_10040346 Ga0075370_100403462 320
1034 3300006353 Ga0075370_10132401 Ga0075370_101324011 320
1035 3300009093 Ga0105240_10000290 Ga0105240_1000029046 320
1036 3300009148 Ga0105243_10171096 Ga0105243_101710962 320
1037 3300009177 Ga0105248_10071086 Ga0105248_100710862 320
1038 3300009545 Ga0105237_10003793 Ga0105237_100037933 320
1039 3300009765 Ga0123341_1000005 Ga0123341_1000005143 320
1040 3300010375 Ga0105239_10000202 Ga0105239_1000020241 320
1041 3300013104 Ga0157370_10003913 Ga0157370_1000391314 320
1042 3300013104 Ga0157370_10150196 Ga0157370_101501961 320
1043 3300013105 Ga0157369_10252267 Ga0157369_102522671 320
1044 3300013296 Ga0157374_10204808 Ga0157374_102048081 320
1045 3300013306 Ga0163162_10485796 Ga0163162_104857961 320
1046 3300014325 Ga0163163_10445410 Ga0163163_104454101 320
1047 3300015262 Ga0182007_10005402 Ga0182007_100054023 320
1048 3300015262 Ga0182007_10030581 Ga0182007_100305812 320
1049 3300015265 Ga0182005_1001606 Ga0182005_10016067 320
1050 3300015265 Ga0182005_1009555 Ga0182005_10095552 320
1051 3300025208 Ga0209436_100007 Ga0209436_1000077 320
1052 3300025245 Ga0207425_1001067 Ga0207425_100106714 320
1053 3300025245 Ga0207425_1008858 Ga0207425_10088581 320
1054 3300025250 Ga0209026_1000151 Ga0209026_100015156 320
1055 3300025253 Ga0209677_100613 Ga0209677_1006133 320
1056 3300025254 Ga0209148_1000032 Ga0209148_1000032511 320
1057 3300025256 Ga0209759_1000350 Ga0209759_100035062 320
1058 3300025258 Ga0209129_1000615 Ga0209129_10006155 320
1059 3300025258 Ga0209129_1002198 Ga0209129_10021989 320
1060 3300025258 Ga0209129_1004197 Ga0209129_10041972 320
1061 3300025261 Ga0209233_1000150 Ga0209233_100015063 320
1062 3300025261 Ga0209233_1000334 Ga0209233_100033410 320
1063 3300025261 Ga0209233_1008548 Ga0209233_10085482 320
1064 3300025272 Ga0209455_1000085 Ga0209455_1000085161 320
1065 3300025273 Ga0209673_1000162 Ga0209673_100016216 320
1066 3300025273 Ga0209673_1000452 Ga0209673_100045227 320
1067 3300025273 Ga0209673_1009347 Ga0209673_10093471 320
1068 3300025273 Ga0209673_1010927 Ga0209673_10109272 320
1069 3300025273 Ga0209673_1021868 Ga0209673_10218682 320
1070 3300025284 Ga0209130_1000001 Ga0209130_1000001763 320
1071 3300025294 Ga0209025_1003516 Ga0209025_100351610 320
1072 3300025294 Ga0209025_1040913 Ga0209025_10409132 320
1073 3300025295 Ga0209564_1000215 Ga0209564_100021570 320
1074 3300025295 Ga0209564_1001754 Ga0209564_100175416 320
1075 3300025295 Ga0209564_1001771 Ga0209564_100177110 320
1076 3300025295 Ga0209564_1001922 Ga0209564_100192217 320
1077 3300025295 Ga0209564_1013613 Ga0209564_10136133 320
1078 3300025295 Ga0209564_1023985 Ga0209564_10239851 320
1079 3300025297 Ga0209758_1001171 Ga0209758_100117110 320
1080 3300025297 Ga0209758_1001256 Ga0209758_10012565 320
1081 3300025297 Ga0209758_1021846 Ga0209758_10218461 320
1082 3300025298 Ga0209050_1002710 Ga0209050_10027108 320
1083 3300025299 Ga0209256_1000155 Ga0209256_100015546 320
1084 3300025299 Ga0209256_1002089 Ga0209256_100208916 320
1085 3300025299 Ga0209256_1006482 Ga0209256_10064823 320
1086 3300025299 Ga0209256_1011321 Ga0209256_10113212 320
1087 3300025299 Ga0209256_1011950 Ga0209256_10119503 320
1088 3300025299 Ga0209256_1012861 Ga0209256_10128612 320
1089 3300025302 Ga0207426_1000045 Ga0207426_1000045372 320
1090 3300025302 Ga0207426_1001182 Ga0207426_100118219 320
1091 3300025302 Ga0207426_1001839 Ga0207426_100183913 320
1092 3300025303 Ga0209051_1000027 Ga0209051_1000027121 320
1093 3300025303 Ga0209051_1001530 Ga0209051_10015303 320
1094 3300025303 Ga0209051_1001728 Ga0209051_100172812 320
1095 3300025303 Ga0209051_1018027 Ga0209051_10180272 320
1096 3300025304 Ga0209257_1008589 Ga0209257_10085894 320
1097 3300025304 Ga0209257_1019503 Ga0209257_10195032 320
1098 3300025321 Ga0207656_10043269 Ga0207656_100432691 320
1099 3300025909 Ga0207705_10077465 Ga0207705_100774652 320
1100 3300025913 Ga0207695_10000385 Ga0207695_1000038540 320
1101 3300025914 Ga0207671_10000330 Ga0207671_1000033049 320
1102 3300025919 Ga0207657_10049709 Ga0207657_100497092 320
1103 3300025935 Ga0207709_10133835 Ga0207709_101338352 320
1104 3300025941 Ga0207711_10303238 Ga0207711_103032381 320
1105 3300026067 Ga0207678_10165220 Ga0207678_101652202 320
1106 3300026089 Ga0207648_10160608 Ga0207648_101606081 320
1107 3300027866 Ga0209813_10010745 Ga0209813_100107452 320
1108 3300028379 Ga0268266_10174378 Ga0268266_101743781 320
1109 3300035692 Ga0373935_0165401 Ga0373935_0165401_219_1181 320
1110 3300035695 Ga0373927_0001752 Ga0373927_0001752_6501_7463 320
1111 3300037068 Ga0373925_0003065 Ga0373925_0003065_9888_10850 320
1112 3300037418 Ga0395900_0132046 Ga0395900_0132046_1490_2452 320
1113 3300037471 Ga0395905_0000478 Ga0395905_0000478_35973_36935 320
1114 3300038443 Ga0395901_0036575 Ga0395901_0036575_2592_3554 320
1115 3300041458 Ga0451798_1089163 Ga0451798_1089163_166_1128 320
1116 3300041494 Ga0451837_1818733 Ga0451837_1818733_59_1021 320
1117 3300041507 Ga0451851_0704329 Ga0451851_0704329_1015_1977 320
1118 3300041511 Ga0451855_1946060 Ga0451855_1946060_98_1060 320
1119 3300044658 Ga0466972_0052203 Ga0466972_0052203_345_1307 320
1120 3300046492 Ga0495585_0028964 Ga0495585_0028964_1952_2914 320
1121 3300046501 Ga0495607_0078152 Ga0495607_0078152_470_1432 320
1122 3300046507 Ga0495606_0002343 Ga0495606_0002343_7636_8598 320
1123 3300046507 Ga0495606_0010989 Ga0495606_0010989_1714_2676 320
1124 3300046512 Ga0495610_0097720 Ga0495610_0097720_229_1191 320
1125 3300046515 Ga0495620_0037677 Ga0495620_0037677_963_1925 320
1126 3300046522 Ga0495643_0017660 Ga0495643_0017660_325_1287 320
1127 3300046810 Ga0495660_0084364 Ga0495660_0084364_346_1308 320
1128 3300046810 Ga0495660_0117147 Ga0495660_0117147_53_1015 320
1129 3300047443 Ga0495687_010319 Ga0495687_010319_1676_2638 320
1130 3300047472 Ga0495686_0145678 Ga0495686_0145678_171_1133 320
1131 3300048905 Ga0496102_0003841 Ga0496102_0003841_1180_2142 320
1132 3300048906 Ga0496103_0002355 Ga0496103_0002355_10948_11910 320
1133 3300048907 Ga0496104_0214045 Ga0496104_0214045_176_1138 320
1134 3300048915 Ga0496112_0113433 Ga0496112_0113433_1471_2433 320
1135 3300048916 Ga0496113_0023688 Ga0496113_0023688_1822_2784 320
1136 3300048917 Ga0496114_0325412 Ga0496114_0325412_61_1023 320
1137 3300048919 Ga0496116_0110626 Ga0496116_0110626_21_983 320
1138 3300048920 Ga0496117_0001433 Ga0496117_0001433_23058_24020 320
1139 3300048921 Ga0496118_0001911 Ga0496118_0001911_23058_24020 320
1140 3300048923 Ga0496120_0000724 Ga0496120_0000724_44191_45153 320
1141 3300048924 Ga0496121_0000084 Ga0496121_0000084_163827_164789 320
1142 3300048925 Ga0496122_0008494 Ga0496122_0008494_548_1510 320
1143 3300048925 Ga0496122_0009487 Ga0496122_0009487_4473_5435 320
1144 3300048926 Ga0496123_0005298 Ga0496123_0005298_3899_4861 320
1145 3300048927 Ga0496124_0014760 Ga0496124_0014760_859_1824 320
1146 3300048927 Ga0496124_0019235 Ga0496124_0019235_866_1828 320
1147 3300048927 Ga0496124_0118451 Ga0496124_0118451_165_1127 320
1148 3300048928 Ga0496125_0000402 Ga0496125_0000402_15543_16505 320
1149 3300049568 Ga0501031_0000060 Ga0501031_0000060_4020_4982 320
1150 3300049569 Ga0501032_0000081 Ga0501032_0000081_77347_78309 320
1151 3300049569 Ga0501032_0033118 Ga0501032_0033118_455_1417 320
1152 3300049570 Ga0501033_0002397 Ga0501033_0002397_13637_14599 320
1153 3300049570 Ga0501033_0006361 Ga0501033_0006361_3988_4950 320
1154 3300049571 Ga0501034_0000186 Ga0501034_0000186_4323_5285 320
1155 3300049572 Ga0501036_0000002 Ga0501036_0000002_180933_181895 320
1156 3300049573 Ga0501037_0000095 Ga0501037_0000095_77375_78337 320
1157 3300049574 Ga0501038_0000002 Ga0501038_0000002_84574_85536 320
1158 3300049574 Ga0501038_0118802 Ga0501038_0118802_503_1465 320
1159 3300049575 Ga0501039_0000002 Ga0501039_0000002_262977_263939 320
1160 3300049579 Ga0501043_0010365 Ga0501043_0010365_3933_4895 320
1161 3300049579 Ga0501043_0140082 Ga0501043_0140082_455_1417 320
1162 3300049581 Ga0501047_0016456 Ga0501047_0016456_1802_2764 320
1163 3300049581 Ga0501047_0065947 Ga0501047_0065947_2050_3012 320
1164 3300049582 Ga0501048_0015893 Ga0501048_0015893_579_1541 320
1165 3300049584 Ga0501068_0041832 Ga0501068_0041832_1035_1997 320
1166 3300049586 Ga0501070_0017670 Ga0501070_0017670_99_1061 320
1167 3300049588 Ga0501072_0059018 Ga0501072_0059018_630_1592 320
1168 3300049589 Ga0501073_0073127 Ga0501073_0073127_736_1698 320
1169 3300049742 Ga0501080_0088117 Ga0501080_0088117_237_1199 320
1170 3300049822 Ga0501035_0000022 Ga0501035_0000022_3966_4928 320
1171 3300049822 Ga0501035_0068774 Ga0501035_0068774_718_1680 320
1172 3300049823 Ga0501044_0000002 Ga0501044_0000002_111214_112176 320
1173 3300049823 Ga0501044_0064575 Ga0501044_0064575_1609_2571 320
1174 3300049824 Ga0501045_0027119 Ga0501045_0027119_1456_2418 320
1175 3300050492 nmdc:mga0yw44_59994_c1 nmdc:mga0yw44_59994_c1_794_1756 320
1176 3300050494 nmdc:mga06z11_39270_c1 nmdc:mga06z11_39270_c1_518_1480 320
1177 3300050494 nmdc:mga06z11_87494_c1 nmdc:mga06z11_87494_c1_71_1033 320
1178 3300050496 nmdc:mga07m45_384_c1 nmdc:mga07m45_384_c1_203_1165 320
1179 3300050496 nmdc:mga07m45_87393_c1 nmdc:mga07m45_87393_c1_477_1439 320
1180 3300050516 nmdc:mga0sz30_52329_c1 nmdc:mga0sz30_52329_c1_237_1199 320
1181 3300053109 Ga0500569_052581 Ga0500569_052581_48_1010 320
1182 3300053134 Ga0500658_0001900 Ga0500658_0001900_438_1400 320
1183 3300053153 Ga0500616_0051254 Ga0500616_0051254_107_1069 320
1184 3300053155 Ga0500620_000073 Ga0500620_000073_10462_11424 320
1185 3300059478 Ga0587093_009592 Ga0587093_009592_63_1025 320
1186 3300059504 Ga0587082_008725 Ga0587082_008725_106_1068 320
1187 3300059604 Ga0587098_004952 Ga0587098_004952_205_1167 320
1188 3300059643 Ga0587072_016002 Ga0587072_016002_101_1063 320
1189 3300060344 Ga0587071_020586 Ga0587071_020586_192_1154 320
1190 iso_pu_bacteria 2599185170 2599416317 320
1191 iso_pu_bacteria 8005382845 8005386420 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

71

324

0.95

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

68

284

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9256 29 310
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9074 31 310
6sw4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9056 30 310
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.8981 29 310
1tm2-assembly1.cif.gz_A crystal structure of the apo form of the salmonella typhimurium ai-2 receptor lsrb 0.8936 31 310
ID Description Score Start End Superfamily
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9069 32 132 3.40.50.2300
4wutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9061 134 262 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9037 134 308 3.40.50.2300
5dteD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9037 131 310 3.40.50.2300
4rxtA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9018 134 264 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C6JXN6-F1-model_v4 Substrate-binding domain-containing protein 0.9376 30 313 GO:0007165
GO:0016020
AF-A0A6C1QXF3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9282 41 314 GO:0005886
GO:0030246
GO:0030313
AF-A0A7X6ZUB6-F1-model_v4 Substrate-binding domain-containing protein 0.9254 28 314 GO:0004888
GO:0006935
GO:0007165
GO:0016020
AF-A0A7X7HH16-F1-model_v4 deleted 0.9199 30 310
AF-A0A436H095-F1-model_v4 deleted 0.9137 131 311

Feature Viewer

pLDDT pTM Quality
91.15 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map