F491408

General Info

Members Datasets Scaffolds Average Seq Length
1187 646 971 290

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0155965|Ga0495594_0155965_275_1096
Length 273
Sequence VTPPDYEYLRKLLKDHSGLDLSADKQYLIESRLLPLARKSGLSGISDLVQKMKGGSASQVAQVVEAMTTNETFFFRDKVPFDHFRETIMPELLKARSVRKAIRIWCAAGSTGQEPYSLAMCLKEMAAALAGWRVGIYSQFEVQRGLPIQLLVKYFKQSGELWQINADIRAMVQHRQLNLLHDFSQLGTFDVIFCRNVLIYFDQDTKINIFNRLAKAMEPDGFLVLGAAETVVGLTETFKPYAEWRGLYRPSARAVSPHGGAVMPKIAAMAAGC

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355199
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
49 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
50 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
51 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
52 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
55 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
56 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
63 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
67 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
73 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
74 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
75 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
98 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
99 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
100 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
101 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
102 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
103 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
104 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
105 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
106 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
107 2922368715
108 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
109 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
110 2922425934
111 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
112 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
113 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
114 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
115 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
116 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
117 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
118 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
119 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
120 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
121 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
122 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
123 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
124 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
125 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
126 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
129 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
130 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
131 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
132 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
133 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
134 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
135 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
136 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
137 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
147 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
148 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
149 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
150 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
151 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
152 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
153 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
154 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
155 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
156 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
157 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
158 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
159 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
160 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
161 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
162 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
163 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
164 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
165 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
166 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
167 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
168 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
169 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
170 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
171 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
172 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
173 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
174 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
175 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
176 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
177 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
178 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
179 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
180 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
181 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
182 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
183 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
186 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
187 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
188 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
189 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
190 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
191 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
192 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
193 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
194 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
195 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
196 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
197 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
198 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
199 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
200 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
201 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
202 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
203 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
204 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
205 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
206 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
207 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
208 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
209 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
210 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
211 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
212 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
213 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
214 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
215 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
216 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
217 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
218 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
219 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
220 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
221 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
222 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
223 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
224 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
227 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
228 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
229 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
230 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
231 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
232 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
233 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
234 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
235 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
236 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
237 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
238 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
239 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
240 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
241 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
242 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
243 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
244 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
250 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
251 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
252 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
253 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
254 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
255 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
257 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
258 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
259 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
260 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
261 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
262 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
263 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
264 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
265 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
266 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
268 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
274 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
275 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
276 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
284 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
285 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
286 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
287 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
288 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
289 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
290 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
291 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
292 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
293 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
294 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
295 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
362 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
363 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
364 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
366 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
370 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
371 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
372 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
373 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
374 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
375 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
376 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
377 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
378 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
379 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
380 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
381 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
382 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
383 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
384 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
385 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
386 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
387 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
388 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
389 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
390 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
391 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
392 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
393 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
394 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
395 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
396 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
397 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
398 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
399 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
400 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
401 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
402 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
403 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
404 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
405 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
406 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
407 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
408 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
410 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
411 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
412 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
413 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
414 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
415 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
416 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
419 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
420 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
421 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
422 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
423 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
424 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
425 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
426 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
427 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
428 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
429 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
430 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
431 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
432 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
433 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
434 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
435 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
436 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
439 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
440 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
441 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
442 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
443 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
444 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
445 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
446 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
447 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
448 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
449 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
450 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
451 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
452 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
453 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
454 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
455 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
456 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
457 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
458 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
459 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
460 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
461 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
462 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
463 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
464 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
465 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
466 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
467 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
468 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
469 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
470 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
471 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
472 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
473 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
474 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
475 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
476 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
477 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
478 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
481 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
482 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
483 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
484 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
485 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
486 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
487 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
488 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
489 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
490 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
491 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
492 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
493 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
494 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
495 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
496 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
497 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
498 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
499 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
500 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
501 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
502 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
503 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
504 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
505 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
506 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
507 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
508 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
509 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
510 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
511 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
512 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
513 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
514 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
515 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
516 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
517 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
518 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
519 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
520 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
521 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
522 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
523 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
524 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
525 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
526 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
527 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
528 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
529 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
530 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
531 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
532 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
533 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
534 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
535 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
536 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
537 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
538 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
539 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
540 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
541 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
542 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
543 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
544 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
545 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
546 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
547 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
548 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
551 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
552 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
553 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
554 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
555 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
556 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
557 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
558 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
559 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
563 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
564 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
565 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
566 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
567 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
568 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
569 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
570 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
571 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
572 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
573 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
574 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
575 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
576 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
577 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
578 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
579 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
580 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
581 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
582 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
583 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
584 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
585 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
586 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
587 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
588 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
589 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
590 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
591 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
592 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
593 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
594 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
595 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
596 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
597 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
598 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
599 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
600 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
601 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
602 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
603 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
604 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
605 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
606 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
607 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
608 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
609 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
610 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
611 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
612 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
613 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
614 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
615 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
616 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
617 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
618 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
619 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
620 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
621 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
622 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
623 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
624 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
625 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
626 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
627 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
628 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
629 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
630 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
631 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
632 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
633 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
634 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
635 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
636 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
637 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
638 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
639 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
640 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
641 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
642 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
643 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
644 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
645 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
646 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.01
Metatranscriptomes 0
Isolates 17.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.84
Nodule 14.49
Rhizoplane 4.89
Rhizosphere 53.41
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1002274 3300000532 Bacteria 1394
2 JGI25406J46586_10012297 3300003203 Bacteria 3721
3 JGI25165J46597_1008047 3300003214 Bacteria 1689
4 JGI25153J46596_10000550 3300003215 Bacteria 23396
5 JGI25153J46596_10007332 3300003215 Bacteria 5444
6 JGI25153J46596_10013291 3300003215 Bacteria 3487
7 JGI25153J46596_10014619 3300003215 Bacteria 3251
8 JGI25153J46596_10016489 3300003215 Bacteria 2955
9 JGI25160J50197_1004506 3300003354 Bacteria 6015
10 JGI25404J52841_10003547 3300003659 Bacteria 3095
11 JGI25404J52841_10030856 3300003659 Bacteria 1146
12 Ga0055539_1004325 3300003752 Bacteria 1895
13 Ga0055531_10014620 3300003794 Bacteria 3521
14 JGI25405J52794_10004824 3300003911 Bacteria 2418
15 Ga0055543_1007285 3300004625 Bacteria 2576
16 Ga0065165_1001646 3300005262 Bacteria 22707
17 Ga0070658_10059476 3300005327 Bacteria 3112
18 Ga0070658_10332214 3300005327 Bacteria 1299
19 Ga0070676_10120250 3300005328 Bacteria 1647
20 Ga0070683_100025426 3300005329 Bacteria 5318
21 Ga0070683_100093829 3300005329 Bacteria 2820
22 Ga0070683_100171658 3300005329 Bacteria 2058
23 Ga0070683_100197019 3300005329 Bacteria 1913
24 Ga0068869_100015937 3300005334 Bacteria 5057
25 Ga0068869_100168334 3300005334 Bacteria 1710
26 Ga0070680_100121818 3300005336 Bacteria 2178
27 Ga0070680_100234704 3300005336 Bacteria 1549
28 Ga0068868_100004833 3300005338 Bacteria 9459
29 Ga0068868_100137371 3300005338 Bacteria 2004
30 Ga0070689_100084174 3300005340 Bacteria 2499
31 Ga0070661_100065479 3300005344 Bacteria 2670
32 Ga0070668_100008596 3300005347 Bacteria 7584
33 Ga0070668_100106056 3300005347 Bacteria 2232
34 Ga0070668_100133324 3300005347 Bacteria 1995
35 Ga0070669_100278027 3300005353 Bacteria 1341
36 Ga0070669_100282872 3300005353 Bacteria 1329
37 Ga0070671_100034823 3300005355 Bacteria 4170
38 Ga0070674_100203677 3300005356 Bacteria 1530
39 Ga0070673_100164033 3300005364 Bacteria 1891
40 Ga0070688_100080943 3300005365 Bacteria 2102
41 Ga0070709_10012913 3300005434 Bacteria 4682
42 Ga0070709_10027828 3300005434 Bacteria 3366
43 Ga0070709_10038498 3300005434 Bacteria 2928
44 Ga0070709_10093365 3300005434 Bacteria 1989
45 Ga0070709_10238639 3300005434 Bacteria 1304
46 Ga0070714_100076810 3300005435 Bacteria 2900
47 Ga0070714_100133016 3300005435 Bacteria 2224
48 Ga0070713_100049420 3300005436 Bacteria 3469
49 Ga0070713_100105541 3300005436 Bacteria 2447
50 Ga0070710_10000755 3300005437 Bacteria 15418
51 Ga0070710_10019413 3300005437 Bacteria 3512
52 Ga0070710_10020372 3300005437 Bacteria 3440
53 Ga0070701_10043293 3300005438 Bacteria 2302
54 Ga0070711_100024686 3300005439 Bacteria 3925
55 Ga0070711_100041640 3300005439 Bacteria 3103
56 Ga0070711_100053801 3300005439 Bacteria 2775
57 Ga0070711_100105501 3300005439 Bacteria 2058
58 Ga0070705_100298350 3300005440 Bacteria 1153
59 Ga0070663_100011356 3300005455 Bacteria 5587
60 Ga0070663_100070714 3300005455 Bacteria 2538
61 Ga0070663_100137664 3300005455 Bacteria 1860
62 Ga0070663_100277020 3300005455 Bacteria 1335
63 Ga0070678_100046211 3300005456 Bacteria 3120
64 Ga0070678_100084635 3300005456 Bacteria 2415
65 Ga0070678_100165171 3300005456 Bacteria 1798
66 Ga0070678_100340499 3300005456 Bacteria 1286
67 Ga0070662_100033435 3300005457 Bacteria 3621
68 Ga0070662_100149362 3300005457 Bacteria 1817
69 Ga0070681_10158376 3300005458 Bacteria 2188
70 Ga0070681_10254456 3300005458 Bacteria 1668
71 Ga0068867_100093754 3300005459 Bacteria 2282
72 Ga0070706_100086269 3300005467 Bacteria 2909
73 Ga0070706_100235748 3300005467 Bacteria 1708
74 Ga0070707_100041107 3300005468 Bacteria 4425
75 Ga0070707_100573453 3300005468 Bacteria 1091
76 Ga0070698_100194297 3300005471 Bacteria 1966
77 Ga0070698_100217995 3300005471 Bacteria 1842
78 Ga0070679_100021186 3300005530 Bacteria 6341
79 Ga0070679_100032725 3300005530 Bacteria 5145
80 Ga0070679_100113377 3300005530 Bacteria 2696
81 Ga0070684_100033972 3300005535 Bacteria 4358
82 Ga0070684_100047929 3300005535 Bacteria 3705
83 Ga0068853_100226396 3300005539 Bacteria 1709
84 Ga0068853_100381150 3300005539 Bacteria 1317
85 Ga0070693_100018521 3300005547 Bacteria 3639
86 Ga0070665_100010827 3300005548 Bacteria 9225
87 Ga0070665_100044008 3300005548 Bacteria 4484
88 Ga0070665_100129065 3300005548 Bacteria 2530
89 Ga0070665_100172998 3300005548 Bacteria 2160
90 Ga0070665_100193449 3300005548 Bacteria 2035
91 Ga0070665_100196283 3300005548 Bacteria 2019
92 Ga0070665_100207601 3300005548 Bacteria 1959
93 Ga0070665_100231793 3300005548 Bacteria 1847
94 Ga0068855_100027913 3300005563 Bacteria 6751
95 Ga0068855_100128289 3300005563 Bacteria 2898
96 Ga0068855_100188651 3300005563 Bacteria 2327
97 Ga0070664_100422125 3300005564 Bacteria 1222
98 Ga0068857_100090503 3300005577 Bacteria 2738
99 Ga0068854_100030068 3300005578 Bacteria 3765
100 Ga0068854_100452171 3300005578 Bacteria 1073
101 Ga0068856_100002282 3300005614 Bacteria 19787
102 Ga0068856_100034134 3300005614 Bacteria 4984
103 Ga0068856_100401795 3300005614 Bacteria 1390
104 Ga0070702_100048678 3300005615 Bacteria 2413
105 Ga0070702_100078193 3300005615 Bacteria 1974
106 Ga0068852_100018340 3300005616 Bacteria 5513
107 Ga0068852_100027518 3300005616 Bacteria 4634
108 Ga0068852_100080688 3300005616 Bacteria 2885
109 Ga0068852_100102155 3300005616 Bacteria 2590
110 Ga0068852_100109235 3300005616 Bacteria 2511
111 Ga0068852_100131914 3300005616 Bacteria 2302
112 Ga0068864_100081294 3300005618 Bacteria 2840
113 Ga0068864_100428372 3300005618 Bacteria 1262
114 Ga0068861_100096646 3300005719 Bacteria 2341
115 Ga0068861_100399308 3300005719 Bacteria 1219
116 Ga0068851_10316409 3300005834 Bacteria 901
117 Ga0068863_100301463 3300005841 Bacteria 1554
118 Ga0068858_100061588 3300005842 Bacteria 3469
119 Ga0068858_100306903 3300005842 Bacteria 1515
120 Ga0068860_100000577 3300005843 Bacteria 44036
121 Ga0068860_100052959 3300005843 Bacteria 3859
122 Ga0068862_100046068 3300005844 Bacteria 3722
123 Ga0068862_100116219 3300005844 Bacteria 2353
124 Ga0068862_100191689 3300005844 Bacteria 1839
125 Ga0068862_100344762 3300005844 Bacteria 1381
126 Ga0081455_10003093 3300005937 Bacteria 19378
127 Ga0081455_10004895 3300005937 Bacteria 14842
128 Ga0081455_10013996 3300005937 Bacteria 7885
129 Ga0081455_10023586 3300005937 Bacteria 5723
130 Ga0081455_10044688 3300005937 Bacteria 3861
131 Ga0081455_10128720 3300005937 Bacteria 1983
132 Ga0081538_10010846 3300005981 Bacteria 7435
133 Ga0081540_1004561 3300005983 Bacteria 10498
134 Ga0081540_1004770 3300005983 Bacteria 10235
135 Ga0081540_1008466 3300005983 Bacteria 7183
136 Ga0081540_1009460 3300005983 Bacteria 6715
137 Ga0081540_1019100 3300005983 Bacteria 4181
138 Ga0081540_1022078 3300005983 Bacteria 3766
139 Ga0081540_1022569 3300005983 Bacteria 3715
140 Ga0081539_10005931 3300005985 Bacteria 12064
141 Ga0081539_10009687 3300005985 Bacteria 7979
142 Ga0081539_10042459 3300005985 Bacteria 2648
143 Ga0070717_10000634 3300006028 Bacteria 22593
144 Ga0070717_10042253 3300006028 Bacteria 3717
145 Ga0075365_10036278 3300006038 Bacteria 3194
146 Ga0075365_10071356 3300006038 Bacteria 2338
147 Ga0075365_10092810 3300006038 Bacteria 2058
148 Ga0075365_10093381 3300006038 Bacteria 2052
149 Ga0075365_10124820 3300006038 Bacteria 1778
150 Ga0075365_10140298 3300006038 Bacteria 1677
151 Ga0075368_10003600 3300006042 Bacteria 5193
152 Ga0075368_10038401 3300006042 Bacteria 1875
153 Ga0075363_100026229 3300006048 Bacteria 2979
154 Ga0075363_100042670 3300006048 Bacteria 2397
155 Ga0075364_10033825 3300006051 Bacteria 3294
156 Ga0075364_10145193 3300006051 Bacteria 1597
157 Ga0070716_100043607 3300006173 Bacteria 2509
158 Ga0070712_100003691 3300006175 Bacteria 9438
159 Ga0070712_100017728 3300006175 Bacteria 4612
160 Ga0070712_100096914 3300006175 Bacteria 2172
161 Ga0070712_100217533 3300006175 Bacteria 1510
162 Ga0075362_10017479 3300006177 Bacteria 2955
163 Ga0075367_10006523 3300006178 Bacteria 5901
164 Ga0075367_10023304 3300006178 Bacteria 3482
165 Ga0075367_10025881 3300006178 Bacteria 3321
166 Ga0075367_10047076 3300006178 Bacteria 2536
167 Ga0075367_10075065 3300006178 Bacteria 2039
168 Ga0075367_10263604 3300006178 Bacteria 1082
169 Ga0075369_10008323 3300006186 Bacteria 3988
170 Ga0075369_10010496 3300006186 Bacteria 3623
171 Ga0075369_10026619 3300006186 Bacteria 2412
172 Ga0075366_10018739 3300006195 Bacteria 3998
173 Ga0075366_10137965 3300006195 Bacteria 1473
174 Ga0097621_100046159 3300006237 Bacteria 3523
175 Ga0097621_100316364 3300006237 Bacteria 1382
176 Ga0075370_10025125 3300006353 Bacteria 3293
177 Ga0075370_10028909 3300006353 Bacteria 3084
178 Ga0075370_10054918 3300006353 Bacteria 2262
179 Ga0075370_10078460 3300006353 Bacteria 1896
180 Ga0068871_100047551 3300006358 Bacteria 3460
181 Ga0068871_100063442 3300006358 Bacteria 3022
182 Ga0075428_100014565 3300006844 Bacteria 8735
183 Ga0075428_100066428 3300006844 Bacteria 3949
184 Ga0075434_100051150 3300006871 Bacteria 4105
185 Ga0068865_100101164 3300006881 Bacteria 2110
186 Ga0068865_100629660 3300006881 Bacteria 910
187 Ga0099825_1025031 3300006941 Bacteria 3387
188 Ga0099824_1009104 3300006942 Bacteria 12375
189 Ga0099824_1014090 3300006942 Bacteria 8068
190 Ga0099822_1011071 3300006943 Bacteria 11071
191 Ga0099794_10046869 3300007265 Bacteria 2071
192 Ga0105240_10077665 3300009093 Bacteria 4090
193 Ga0105240_10077881 3300009093 Bacteria 4084
194 Ga0105240_10095052 3300009093 Bacteria 3634
195 Ga0111539_10165036 3300009094 Bacteria 2590
196 Ga0105245_10031932 3300009098 Bacteria 4661
197 Ga0105245_10066139 3300009098 Bacteria 3271
198 Ga0105247_10071486 3300009101 Bacteria 2170
199 Ga0105247_10283650 3300009101 Bacteria 1143
200 Ga0105243_10256643 3300009148 Bacteria 1563
201 Ga0105241_10052371 3300009174 Bacteria 3116
202 Ga0105241_10087362 3300009174 Bacteria 2454
203 Ga0105241_10140289 3300009174 Bacteria 1967
204 Ga0105248_10105152 3300009177 Bacteria 3183
205 Ga0105248_10159915 3300009177 Bacteria 2541
206 Ga0105237_10031055 3300009545 Bacteria 5419
207 Ga0105237_10300641 3300009545 Bacteria 1608
208 Ga0105237_10583682 3300009545 Bacteria 1125
209 Ga0105238_10060989 3300009551 Bacteria 3775
210 Ga0105238_10135734 3300009551 Bacteria 2438
211 Ga0105238_10248919 3300009551 Bacteria 1755
212 Ga0105238_10301875 3300009551 Bacteria 1585
213 Ga0105249_10232433 3300009553 Bacteria 1819
214 Ga0105249_10405433 3300009553 Bacteria 1394
215 Ga0105239_10056885 3300010375 Bacteria 4289
216 Ga0105239_10087851 3300010375 Bacteria 3427
217 Ga0105239_10121409 3300010375 Bacteria 2902
218 Ga0105239_10122522 3300010375 Bacteria 2889
219 Ga0105239_10212863 3300010375 Bacteria 2167
220 Ga0105239_10378951 3300010375 Bacteria 1599
221 Ga0105246_10040750 3300011119 Bacteria 3136
222 Ga0105246_10212223 3300011119 Bacteria 1512
223 Ga0157369_10077996 3300013105 Bacteria 3550
224 Ga0157374_10178681 3300013296 Bacteria 2072
225 Ga0157374_10185651 3300013296 Bacteria 2033
226 Ga0157378_10041263 3300013297 Bacteria 4093
227 Ga0163162_10164627 3300013306 Bacteria 2341
228 Ga0157372_10438817 3300013307 Bacteria 1522
229 Ga0157375_10132487 3300013308 Bacteria 2613
230 Ga0157375_10217214 3300013308 Bacteria 2070
231 Ga0163163_10062089 3300014325 Bacteria 3702
232 Ga0163163_10541602 3300014325 Bacteria 1226
233 Ga0157380_10189904 3300014326 Bacteria 1812
234 Ga0157380_10216361 3300014326 Bacteria 1711
235 Ga0157380_10282395 3300014326 Bacteria 1520
236 Ga0157377_10106272 3300014745 Bacteria 1681
237 Ga0157379_10166180 3300014968 Bacteria 1991
238 Ga0157379_10412878 3300014968 Bacteria 1242
239 Ga0157376_10054563 3300014969 Bacteria 3332
240 Ga0182006_1092671 3300015261 Bacteria 1085
241 Ga0163161_10010762 3300017792 Bacteria 6339
242 Ga0163161_10117687 3300017792 Bacteria 1993
243 Ga0163161_10251849 3300017792 Bacteria 1377
244 Ga0214544_1000344 3300021320 Bacteria 81005
245 Ga0214542_1000018 3300021321 Bacteria 202226
246 Ga0214545_1000009 3300021324 Bacteria 202915
247 Ga0214543_1029683 3300021327 Bacteria 2407
248 Ga0213873_10002957 3300021358 Bacteria 3007
249 Ga0209563_100670 3300025230 Bacteria 10845
250 Ga0209677_102054 3300025253 Bacteria 7958
251 Ga0209148_1000874 3300025254 Bacteria 20915
252 Ga0209148_1019429 3300025254 Bacteria 1128
253 Ga0209233_1008667 3300025261 Bacteria 3130
254 Ga0209233_1020134 3300025261 Bacteria 1756
255 Ga0209455_1001536 3300025272 Bacteria 10290
256 Ga0209455_1003873 3300025272 Bacteria 5107
257 Ga0209564_1005896 3300025295 Bacteria 6793
258 Ga0209564_1008405 3300025295 Bacteria 5096
259 Ga0209564_1019898 3300025295 Bacteria 2486
260 Ga0209758_1000030 3300025297 Bacteria 509217
261 Ga0209758_1001325 3300025297 Bacteria 30050
262 Ga0209758_1001470 3300025297 Bacteria 27657
263 Ga0209758_1003848 3300025297 Bacteria 13172
264 Ga0209758_1007103 3300025297 Bacteria 7753
265 Ga0209758_1009747 3300025297 Bacteria 5898
266 Ga0209758_1022815 3300025297 Bacteria 2853
267 Ga0209758_1029873 3300025297 Bacteria 2267
268 Ga0209256_1004427 3300025299 Bacteria 8829
269 Ga0207426_1000704 3300025302 Bacteria 39583
270 Ga0207426_1001257 3300025302 Bacteria 22136
271 Ga0207426_1001583 3300025302 Bacteria 18291
272 Ga0207426_1015711 3300025302 Bacteria 2739
273 Ga0209257_1003693 3300025304 Bacteria 12738
274 Ga0209257_1017069 3300025304 Bacteria 2887
275 Ga0207697_10057876 3300025315 Bacteria 1609
276 Ga0207692_10070783 3300025898 Bacteria 1837
277 Ga0207692_10151293 3300025898 Bacteria 1329
278 Ga0207642_10241294 3300025899 Bacteria 1021
279 Ga0207710_10028822 3300025900 Bacteria 2411
280 Ga0207710_10029790 3300025900 Bacteria 2378
281 Ga0207710_10108985 3300025900 Bacteria 1314
282 Ga0207688_10021647 3300025901 Bacteria 3516
283 Ga0207688_10052180 3300025901 Bacteria 2291
284 Ga0207647_10002968 3300025904 Bacteria 12759
285 Ga0207647_10140456 3300025904 Bacteria 1416
286 Ga0207685_10068231 3300025905 Bacteria 1432
287 Ga0207685_10167318 3300025905 Bacteria 1009
288 Ga0207699_10004815 3300025906 Bacteria 6458
289 Ga0207699_10014010 3300025906 Bacteria 4120
290 Ga0207645_10048193 3300025907 Bacteria 2720
291 Ga0207643_10065231 3300025908 Bacteria 2085
292 Ga0207684_10108140 3300025910 Bacteria 2380
293 Ga0207684_10109894 3300025910 Bacteria 2360
294 Ga0207684_10205152 3300025910 Bacteria 1701
295 Ga0207654_10031015 3300025911 Bacteria 2941
296 Ga0207654_10083473 3300025911 Bacteria 1929
297 Ga0207707_10001534 3300025912 Bacteria 21320
298 Ga0207707_10112390 3300025912 Bacteria 2381
299 Ga0207695_10001156 3300025913 Bacteria 45753
300 Ga0207695_10043787 3300025913 Bacteria 4766
301 Ga0207695_10119977 3300025913 Bacteria 2599
302 Ga0207671_10035802 3300025914 Bacteria 3681
303 Ga0207671_10050733 3300025914 Bacteria 3072
304 Ga0207671_10221960 3300025914 Bacteria 1481
305 Ga0207671_10248592 3300025914 Bacteria 1398
306 Ga0207671_10282120 3300025914 Bacteria 1310
307 Ga0207671_10478798 3300025914 Bacteria 992
308 Ga0207693_10002446 3300025915 Bacteria 16130
309 Ga0207693_10029143 3300025915 Bacteria 4362
310 Ga0207693_10041552 3300025915 Bacteria 3620
311 Ga0207693_10044704 3300025915 Bacteria 3480
312 Ga0207693_10085272 3300025915 Bacteria 2474
313 Ga0207693_10367490 3300025915 Bacteria 1125
314 Ga0207663_10028317 3300025916 Bacteria 3278
315 Ga0207660_10033623 3300025917 Bacteria 3549
316 Ga0207660_10062043 3300025917 Bacteria 2692
317 Ga0207662_10093909 3300025918 Bacteria 1849
318 Ga0207657_10074222 3300025919 Bacteria 2873
319 Ga0207657_10338561 3300025919 Bacteria 1188
320 Ga0207652_10165259 3300025921 Bacteria 1984
321 Ga0207646_10028561 3300025922 Bacteria 5075
322 Ga0207681_10052125 3300025923 Bacteria 2774
323 Ga0207681_10126894 3300025923 Bacteria 1880
324 Ga0207694_10136558 3300025924 Bacteria 1970
325 Ga0207694_10181955 3300025924 Bacteria 1705
326 Ga0207694_10358360 3300025924 Bacteria 1208
327 Ga0207659_10137814 3300025926 Bacteria 1891
328 Ga0207659_10317099 3300025926 Bacteria 1285
329 Ga0207687_10020017 3300025927 Bacteria 4438
330 Ga0207700_10008650 3300025928 Bacteria 6320
331 Ga0207700_10010201 3300025928 Bacteria 5911
332 Ga0207664_10064538 3300025929 Bacteria 2929
333 Ga0207664_10068542 3300025929 Bacteria 2850
334 Ga0207664_10502350 3300025929 Bacteria 1086
335 Ga0207644_10214886 3300025931 Bacteria 1522
336 Ga0207690_10350826 3300025932 Bacteria 1167
337 Ga0207706_10093938 3300025933 Bacteria 2638
338 Ga0207706_10180429 3300025933 Bacteria 1854
339 Ga0207709_10341043 3300025935 Bacteria 1128
340 Ga0207670_10302230 3300025936 Bacteria 1253
341 Ga0207669_10066960 3300025937 Bacteria 2236
342 Ga0207669_10085987 3300025937 Bacteria 2032
343 Ga0207669_10105585 3300025937 Bacteria 1874
344 Ga0207669_10243921 3300025937 Bacteria 1333
345 Ga0207669_10331737 3300025937 Bacteria 1168
346 Ga0207665_10004668 3300025939 Bacteria 9103
347 Ga0207665_10066810 3300025939 Bacteria 2448
348 Ga0207665_10117196 3300025939 Bacteria 1878
349 Ga0207691_10087971 3300025940 Bacteria 2786
350 Ga0207691_10168672 3300025940 Bacteria 1917
351 Ga0207711_10083906 3300025941 Bacteria 2788
352 Ga0207661_10005119 3300025944 Bacteria 9204
353 Ga0207661_10025839 3300025944 Bacteria 4468
354 Ga0207661_10093733 3300025944 Bacteria 2507
355 Ga0207661_10164980 3300025944 Bacteria 1924
356 Ga0207679_10123574 3300025945 Bacteria 2064
357 Ga0207679_10155774 3300025945 Bacteria 1865
358 Ga0207679_10173442 3300025945 Bacteria 1778
359 Ga0207679_10242374 3300025945 Bacteria 1528
360 Ga0207667_10015856 3300025949 Bacteria 8539
361 Ga0207651_10074123 3300025960 Bacteria 2423
362 Ga0207651_10120039 3300025960 Bacteria 1992
363 Ga0207712_10077095 3300025961 Bacteria 2415
364 Ga0207712_10220246 3300025961 Bacteria 1517
365 Ga0207712_10403418 3300025961 Bacteria 1149
366 Ga0207668_10005343 3300025972 Bacteria 7557
367 Ga0207668_10045426 3300025972 Bacteria 2995
368 Ga0207668_10135544 3300025972 Bacteria 1886
369 Ga0207668_10251519 3300025972 Bacteria 1435
370 Ga0207668_10310671 3300025972 Bacteria 1304
371 Ga0207640_10014499 3300025981 Bacteria 4540
372 Ga0207658_10086653 3300025986 Bacteria 2416
373 Ga0207658_10199553 3300025986 Bacteria 1669
374 Ga0207677_10038533 3300026023 Bacteria 3135
375 Ga0207677_10108262 3300026023 Bacteria 2063
376 Ga0207703_10043372 3300026035 Bacteria 3611
377 Ga0207703_10306100 3300026035 Bacteria 1451
378 Ga0207639_10159766 3300026041 Bacteria 1898
379 Ga0207639_10253862 3300026041 Bacteria 1535
380 Ga0207639_10264477 3300026041 Bacteria 1506
381 Ga0207678_10034872 3300026067 Bacteria 4382
382 Ga0207678_10073842 3300026067 Bacteria 2923
383 Ga0207678_10076141 3300026067 Bacteria 2874
384 Ga0207678_10084233 3300026067 Bacteria 2719
385 Ga0207678_10267163 3300026067 Bacteria 1466
386 Ga0207702_10001426 3300026078 Bacteria 23867
387 Ga0207648_10068241 3300026089 Bacteria 3098
388 Ga0207648_10130139 3300026089 Bacteria 2215
389 Ga0207676_10473747 3300026095 Bacteria 1184
390 Ga0207674_10035941 3300026116 Bacteria 5167
391 Ga0207675_100166532 3300026118 Bacteria 2105
392 Ga0207675_100243853 3300026118 Bacteria 1737
393 Ga0207683_10063276 3300026121 Bacteria 3259
394 Ga0207683_10069387 3300026121 Bacteria 3113
395 Ga0207683_10360390 3300026121 Bacteria 1335
396 Ga0207683_10387952 3300026121 Bacteria 1284
397 Ga0207698_10063162 3300026142 Bacteria 2896
398 Ga0207698_10101537 3300026142 Bacteria 2386
399 Ga0207698_10219781 3300026142 Bacteria 1716
400 Ga0207698_10507404 3300026142 Bacteria 1175
401 Ga0209389_1000104 3300027296 Bacteria 75132
402 Ga0209389_1000163 3300027296 Bacteria 55041
403 Ga0209589_1000159 3300027357 Bacteria 75132
404 Ga0209589_1001113 3300027357 Bacteria 42801
405 Ga0209489_100194 3300027361 Bacteria 97679
406 Ga0209489_101100 3300027361 Bacteria 55041
407 Ga0209489_101913 3300027361 Bacteria 42801
408 Ga0209700_100014 3300027363 Bacteria 299349
409 Ga0209700_101949 3300027363 Bacteria 42801
410 Ga0209813_10032336 3300027866 Bacteria 1550
411 Ga0268266_10004510 3300028379 Bacteria 13310
412 Ga0268266_10009167 3300028379 Bacteria 8734
413 Ga0268266_10009421 3300028379 Bacteria 8599
414 Ga0268266_10080191 3300028379 Bacteria 2843
415 Ga0268266_10095681 3300028379 Bacteria 2608
416 Ga0268266_10154742 3300028379 Bacteria 2070
417 Ga0268265_10061284 3300028380 Bacteria 2886
418 Ga0268265_10473717 3300028380 Bacteria 1174
419 Ga0268264_10000107 3300028381 Bacteria 209105
420 Ga0268264_10189404 3300028381 Bacteria 1874
421 Ga0268264_10352260 3300028381 Bacteria 1402
422 Ga0268264_10415473 3300028381 Bacteria 1296
423 Ga0268264_10459690 3300028381 Bacteria 1235
424 Ga0265337_1001432 3300028556 Bacteria 11747
425 Ga0265337_1003913 3300028556 Bacteria 6308
426 Ga0265326_10000332 3300028558 Bacteria 20094
427 Ga0265326_10006121 3300028558 Bacteria 3755
428 Ga0265319_1001170 3300028563 Bacteria 16233
429 Ga0265319_1015989 3300028563 Bacteria 2885
430 Ga0265334_10002363 3300028573 Bacteria 8881
431 Ga0265334_10011650 3300028573 Bacteria 3697
432 Ga0265318_10003595 3300028577 Bacteria 7756
433 Ga0265318_10011203 3300028577 Bacteria 3873
434 Ga0265323_10000706 3300028653 Bacteria 18167
435 Ga0265323_10001572 3300028653 Bacteria 11033
436 Ga0265322_10014719 3300028654 Bacteria 2261
437 Ga0265336_10000110 3300028666 Bacteria 62531
438 Ga0265336_10000683 3300028666 Bacteria 18322
439 Ga0307517_10001121 3300028786 Bacteria 45217
440 Ga0307515_10060735 3300028794 Bacteria 5382
441 Ga0307515_10293805 3300028794 Bacteria 1318
442 Ga0265338_10000656 3300028800 Bacteria 59900
443 Ga0265338_10001041 3300028800 Bacteria 46363
444 Ga0265324_10000971 3300029957 Bacteria 17749
445 Ga0265324_10002208 3300029957 Bacteria 10179
446 Ga0307511_10132317 3300030521 Bacteria 1498
447 Ga0307511_10188921 3300030521 Bacteria 1093
448 Ga0265332_10015679 3300031238 Bacteria 3346
449 Ga0265332_10067378 3300031238 Bacteria 1526
450 Ga0265340_10008593 3300031247 Bacteria 5504
451 Ga0265331_10074003 3300031250 Bacteria 1590
452 Ga0307513_10246800 3300031456 Bacteria 1585
453 Ga0307508_10000154 3300031616 Bacteria 82824
454 Ga0307508_10003339 3300031616 Bacteria 16295
455 Ga0307508_10052138 3300031616 Bacteria 3635
456 Ga0307508_10378227 3300031616 Bacteria 1007
457 Ga0307516_10020252 3300031730 Bacteria 6876
458 Ga0307516_10073486 3300031730 Bacteria 3276
459 Ga0307516_10079257 3300031730 Bacteria 3129
460 Ga0307410_10139011 3300031852 Bacteria 1794
461 Ga0307406_10063979 3300031901 Bacteria 2385
462 Ga0307412_10153785 3300031911 Bacteria 1701
463 Ga0307412_10305069 3300031911 Bacteria 1260
464 Ga0307409_100171799 3300031995 Bacteria 1908
465 Ga0307409_100454496 3300031995 Bacteria 1237
466 Ga0307409_100543654 3300031995 Bacteria 1139
467 Ga0307416_100074472 3300032002 Bacteria 2837
468 Ga0307416_100179965 3300032002 Bacteria 1980
469 Ga0307414_10124646 3300032004 Bacteria 1988
470 Ga0307415_100136752 3300032126 Bacteria 1865
471 Ga0307507_10016255 3300033179 Bacteria 8676
472 Ga0307510_10035129 3300033180 Bacteria 5602
473 Ga0307510_10058529 3300033180 Bacteria 3988
474 Ga0307510_10147044 3300033180 Bacteria 1985
475 Ga0315911_1000008 3300033442 Bacteria 381285
476 Ga0373926_0072632 3300035083 Bacteria 1265
477 Ga0373934_0003984 3300035086 Bacteria 5436
478 Ga0373934_0040090 3300035086 Bacteria 1847
479 Ga0373936_0008591 3300035113 Bacteria 3846
480 Ga0373936_0015146 3300035113 Bacteria 2954
481 Ga0373936_0143405 3300035113 Bacteria 1032
482 Ga0373953_0003130 3300035117 Bacteria 5105
483 Ga0373954_0011341 3300035118 Bacteria 3946
484 Ga0373956_0001760 3300035119 Bacteria 8918
485 Ga0373957_0017164 3300035120 Bacteria 2516
486 Ga0373943_0083497 3300035170 Bacteria 1642
487 Ga0373946_0036579 3300035171 Bacteria 1991
488 Ga0373955_0022100 3300035172 Bacteria 3222
489 Ga0373955_0024324 3300035172 Bacteria 3096
490 Ga0373955_0042706 3300035172 Bacteria 2435
491 Ga0373924_0001609 3300035410 Bacteria 7406
492 Ga0373924_0006304 3300035410 Bacteria 4243
493 Ga0373935_0027489 3300035692 Bacteria 3515
494 Ga0373935_0035198 3300035692 Bacteria 3125
495 Ga0373935_0039107 3300035692 Bacteria 2972
496 Ga0373927_0003207 3300035695 Bacteria 11783
497 Ga0373927_0008050 3300035695 Bacteria 7117
498 Ga0373927_0020633 3300035695 Bacteria 4320
499 Ga0373927_0113445 3300035695 Bacteria 1766
500 Ga0373933_0007993 3300035724 Bacteria 5770
501 Ga0373933_0036431 3300035724 Bacteria 2879
502 Ga0373947_0006026 3300035725 Bacteria 7068
503 Ga0373947_0024055 3300035725 Bacteria 3547
504 Ga0373947_0026448 3300035725 Bacteria 3391
505 Ga0373947_0032892 3300035725 Bacteria 3059
506 Ga0373937_0135256 3300036401 Bacteria 2304
507 Ga0373937_0135591 3300036401 Bacteria 2301
508 Ga0373925_0017296 3300037068 Bacteria 5224
509 Ga0373925_0024092 3300037068 Bacteria 4442
510 Ga0373925_0024175 3300037068 Bacteria 4435
511 Ga0373925_0088330 3300037068 Bacteria 2367
512 Ga0395900_0004851 3300037418 Bacteria 14170
513 Ga0395900_0041342 3300037418 Bacteria 4753
514 Ga0395898_0044947 3300037466 Bacteria 4342
515 Ga0395898_0184417 3300037466 Bacteria 1994
516 Ga0395905_0003426 3300037471 Bacteria 16972
517 Ga0395905_0213458 3300037471 Bacteria 1808
518 Ga0436364_1203906 3300037853 Bacteria 1437
519 Ga0436364_1224016 3300037853 Bacteria 1534
520 Ga0395901_0036503 3300038443 Bacteria 5081
521 Ga0395901_0071006 3300038443 Bacteria 3628
522 Ga0395901_0243494 3300038443 Bacteria 1875
523 Ga0436365_0420080 3300039437 Bacteria 1626
524 Ga0436365_0491541 3300039437 Bacteria 9725
525 Ga0436365_0753572 3300039437 Bacteria 3243
526 Ga0436365_0875735 3300039437 Bacteria 999
527 Ga0436365_0989203 3300039437 Bacteria 3792
528 Ga0436360_0811287 3300039438 Bacteria 1730
529 Ga0436361_0752651 3300039447 Bacteria 1971
530 Ga0436361_1023822 3300039447 Bacteria 2203
531 Ga0436363_1043107 3300039450 Bacteria 990
532 Ga0436363_1063318 3300039450 Bacteria 1589
533 Ga0436362_0326507 3300039453 Bacteria 3270
534 Ga0436362_1208454 3300039453 Bacteria 2707
535 Ga0451791_1288432 3300041451 Bacteria 1394
536 Ga0439431_0005614 3300041997 Bacteria 2768
537 Ga0466972_0000234 3300044658 Bacteria 38265
538 Ga0466972_0004129 3300044658 Bacteria 7249
539 Ga0466966_0001471 3300044684 Bacteria 15165
540 Ga0466961_0004761 3300044693 Bacteria 8540
541 Ga0466963_0014602 3300044694 Bacteria 4847
542 Ga0466964_0078152 3300044706 Bacteria 1414
543 Ga0466968_0001995 3300044735 Bacteria 7417
544 Ga0466970_0226211 3300044765 Bacteria 1045
545 Ga0466957_0041259 3300044842 Bacteria 2791
546 Ga0466957_0073853 3300044842 Bacteria 2114
547 Ga0466960_0010923 3300044901 Bacteria 3781
548 Ga0466959_0005681 3300045049 Bacteria 8582
549 Ga0466967_0037023 3300045976 Bacteria 4171
550 Ga0466967_0116898 3300045976 Bacteria 2457
551 Ga0495617_015362 3300046452 Bacteria 2595
552 Ga0495592_0002294 3300046454 Bacteria 13487
553 Ga0495592_0008791 3300046454 Bacteria 7584
554 Ga0495592_0012750 3300046454 Bacteria 6390
555 Ga0495603_0000182 3300046455 Bacteria 32426
556 Ga0495603_0050821 3300046455 Bacteria 2464
557 Ga0495603_0102705 3300046455 Bacteria 1669
558 Ga0495629_0000314 3300046459 Bacteria 41394
559 Ga0495629_0000529 3300046459 Bacteria 31881
560 Ga0495629_0006021 3300046459 Bacteria 9020
561 Ga0495629_0088690 3300046459 Bacteria 2158
562 Ga0495638_0004876 3300046460 Bacteria 10095
563 Ga0495638_0037355 3300046460 Bacteria 3089
564 Ga0495641_0001508 3300046461 Bacteria 19835
565 Ga0495641_0028046 3300046461 Bacteria 2729
566 Ga0495651_0019479 3300046462 Bacteria 5260
567 Ga0495651_0054726 3300046462 Bacteria 3067
568 Ga0495651_0068966 3300046462 Bacteria 2694
569 Ga0495653_0085999 3300046463 Bacteria 2311
570 Ga0495580_0002541 3300046472 Bacteria 15893
571 Ga0495580_0073929 3300046472 Bacteria 2379
572 Ga0495582_0003777 3300046473 Bacteria 8536
573 Ga0495582_0036076 3300046473 Bacteria 2719
574 Ga0495605_0057559 3300046474 Bacteria 1870
575 Ga0495605_0130215 3300046474 Bacteria 1135
576 Ga0495639_0006669 3300046475 Bacteria 4968
577 Ga0495639_0036657 3300046475 Bacteria 2197
578 Ga0495662_0001470 3300046476 Bacteria 11662
579 Ga0495662_0016856 3300046476 Bacteria 3536
580 Ga0495664_0001204 3300046477 Bacteria 13527
581 Ga0495664_0009660 3300046477 Bacteria 5401
582 Ga0495664_0049429 3300046477 Bacteria 2496
583 Ga0495585_0042555 3300046492 Bacteria 2543
584 Ga0495585_0103848 3300046492 Bacteria 1517
585 Ga0495585_0121616 3300046492 Bacteria 1381
586 Ga0495594_0000302 3300046499 Bacteria 24227
587 Ga0495594_0150379 3300046499 Bacteria 1322
588 Ga0495594_0155965 3300046499 Bacteria 1297
589 Ga0495596_0048678 3300046500 Bacteria 1662
590 Ga0495607_0110869 3300046501 Bacteria 1455
591 Ga0495583_0049204 3300046506 Bacteria 1932
592 Ga0495606_0053703 3300046507 Bacteria 2613
593 Ga0495606_0101227 3300046507 Bacteria 1754
594 Ga0495606_0116865 3300046507 Bacteria 1601
595 Ga0495608_0022254 3300046511 Bacteria 4344
596 Ga0495608_0100321 3300046511 Bacteria 1867
597 Ga0495610_0032809 3300046512 Bacteria 2692
598 Ga0495610_0046207 3300046512 Bacteria 2150
599 Ga0495610_0057061 3300046512 Bacteria 1874
600 Ga0495616_0018412 3300046513 Bacteria 3834
601 Ga0495616_0033846 3300046513 Bacteria 2658
602 Ga0495618_0008828 3300046514 Bacteria 6087
603 Ga0495618_0043480 3300046514 Bacteria 2834
604 Ga0495620_0021818 3300046515 Bacteria 3101
605 Ga0495620_0036803 3300046515 Bacteria 2186
606 Ga0495628_0003600 3300046516 Bacteria 13866
607 Ga0495628_0014010 3300046516 Bacteria 6732
608 Ga0495628_0061793 3300046516 Bacteria 2937
609 Ga0495630_0002415 3300046517 Bacteria 12968
610 Ga0495630_0137068 3300046517 Bacteria 1860
611 Ga0495630_0318631 3300046517 Bacteria 1188
612 Ga0495631_0029165 3300046518 Bacteria 2512
613 Ga0495631_0072260 3300046518 Bacteria 1490
614 Ga0495632_0030152 3300046519 Bacteria 2818
615 Ga0495643_0019789 3300046522 Bacteria 3891
616 Ga0495644_0030462 3300046523 Bacteria 2037
617 Ga0495648_0006267 3300046524 Bacteria 9733
618 Ga0495648_0079676 3300046524 Bacteria 1868
619 Ga0495648_0123557 3300046524 Bacteria 1387
620 Ga0495652_0006258 3300046529 Bacteria 11097
621 Ga0495652_0024151 3300046529 Bacteria 5382
622 Ga0495652_0050577 3300046529 Bacteria 3552
623 Ga0495652_0166992 3300046529 Bacteria 1702
624 Ga0495652_0358591 3300046529 Bacteria 1042
625 Ga0495654_0023326 3300046530 Bacteria 3205
626 Ga0495665_0000619 3300046531 Bacteria 18044
627 Ga0495640_0000308 3300046533 Bacteria 33750
628 Ga0495640_0010418 3300046533 Bacteria 7189
629 Ga0495640_0014432 3300046533 Bacteria 5978
630 Ga0495640_0032685 3300046533 Bacteria 3703
631 Ga0495640_0044770 3300046533 Bacteria 3075
632 Ga0495640_0149628 3300046533 Bacteria 1501
633 Ga0495587_0030628 3300046536 Bacteria 3262
634 Ga0495597_0065137 3300046542 Bacteria 1581
635 Ga0495645_0002277 3300046543 Bacteria 13061
636 Ga0495645_0011116 3300046543 Bacteria 6328
637 Ga0495645_0063315 3300046543 Bacteria 2678
638 Ga0495645_0102497 3300046543 Bacteria 2034
639 Ga0495622_0002921 3300046557 Bacteria 8156
640 Ga0495622_0013329 3300046557 Bacteria 3814
641 Ga0495622_0016867 3300046557 Bacteria 3400
642 Ga0495622_0031501 3300046557 Bacteria 2478
643 Ga0495622_0054035 3300046557 Bacteria 1863
644 Ga0495667_0004819 3300046559 Bacteria 9123
645 Ga0495667_0077408 3300046559 Bacteria 2163
646 Ga0495667_0139683 3300046559 Bacteria 1561
647 Ga0495667_0166789 3300046559 Bacteria 1416
648 Ga0495668_0023015 3300046616 Bacteria 3557
649 Ga0495668_0026224 3300046616 Bacteria 3308
650 Ga0495668_0164858 3300046616 Bacteria 1214
651 Ga0495634_0001483 3300046642 Bacteria 20763
652 Ga0495634_0034146 3300046642 Bacteria 3492
653 Ga0495634_0083778 3300046642 Bacteria 2080
654 Ga0495634_0096856 3300046642 Bacteria 1910
655 Ga0495635_0000429 3300046663 Bacteria 26634
656 Ga0495635_0038449 3300046663 Bacteria 3313
657 Ga0495635_0074254 3300046663 Bacteria 2329
658 Ga0495661_0023684 3300046665 Bacteria 3981
659 Ga0495588_0003361 3300046674 Bacteria 6953
660 Ga0495588_0130092 3300046674 Bacteria 1328
661 Ga0495588_0194935 3300046674 Bacteria 1070
662 Ga0495657_0015079 3300046675 Bacteria 5665
663 Ga0495657_0026788 3300046675 Bacteria 4078
664 Ga0495657_0095578 3300046675 Bacteria 1899
665 Ga0495599_0005767 3300046678 Bacteria 7430
666 Ga0495599_0025597 3300046678 Bacteria 3694
667 Ga0495599_0039352 3300046678 Bacteria 2971
668 Ga0495623_0022432 3300046679 Bacteria 4078
669 Ga0495623_0042017 3300046679 Bacteria 2914
670 Ga0495646_0029121 3300046680 Bacteria 3453
671 Ga0495646_0097496 3300046680 Bacteria 1689
672 Ga0495646_0100369 3300046680 Bacteria 1660
673 Ga0495647_0026282 3300046681 Bacteria 2131
674 Ga0495658_0000936 3300046683 Bacteria 15569
675 Ga0495669_0039321 3300046684 Bacteria 2094
676 Ga0495669_0046821 3300046684 Bacteria 1931
677 Ga0495613_0006256 3300046689 Bacteria 8900
678 Ga0495613_0095971 3300046689 Bacteria 2144
679 Ga0495613_0131395 3300046689 Bacteria 1793
680 Ga0495624_0000810 3300046690 Bacteria 24701
681 Ga0495670_0030273 3300046691 Bacteria 2689
682 Ga0495670_0082982 3300046691 Bacteria 1634
683 Ga0495670_0141755 3300046691 Bacteria 1257
684 Ga0495671_0064047 3300046692 Bacteria 1810
685 Ga0495649_0089456 3300046694 Bacteria 1642
686 Ga0495649_0099633 3300046694 Bacteria 1545
687 Ga0495649_0102231 3300046694 Bacteria 1522
688 Ga0495600_0011127 3300046809 Bacteria 5602
689 Ga0495600_0053775 3300046809 Bacteria 2629
690 Ga0495600_0072440 3300046809 Bacteria 2250
691 Ga0495600_0177477 3300046809 Bacteria 1373
692 Ga0495581_0000683 3300047315 Bacteria 17799
693 Ga0495581_0091563 3300047315 Bacteria 1764
694 Ga0495581_0147504 3300047315 Bacteria 1373
695 Ga0495581_0155164 3300047315 Bacteria 1338
696 Ga0495581_0162878 3300047315 Bacteria 1304
697 Ga0495604_0190660 3300047317 Bacteria 1428
698 Ga0495636_0111990 3300047318 Bacteria 1201
699 Ga0495674_0012056 3300047319 Bacteria 8146
700 Ga0495674_0033712 3300047319 Bacteria 4635
701 Ga0495674_0055960 3300047319 Bacteria 3457
702 Ga0495674_0146672 3300047319 Bacteria 1981
703 Ga0495674_0182108 3300047319 Bacteria 1749
704 Ga0495672_0036537 3300047320 Bacteria 3015
705 Ga0495672_0109264 3300047320 Bacteria 1486
706 Ga0495672_0121063 3300047320 Bacteria 1391
707 Ga0495672_0151379 3300047320 Bacteria 1203
708 Ga0495676_0005624 3300047321 Bacteria 11492
709 Ga0495676_0008153 3300047321 Bacteria 9610
710 Ga0495676_0180423 3300047321 Bacteria 1480
711 Ga0495680_0010179 3300047322 Bacteria 8401
712 Ga0495680_0014721 3300047322 Bacteria 6762
713 Ga0495683_0121561 3300047323 Bacteria 1238
714 Ga0495687_057029 3300047443 Bacteria 1626
715 Ga0495675_0037224 3300047444 Bacteria 3098
716 Ga0495675_0054237 3300047444 Bacteria 2544
717 Ga0495677_0025193 3300047445 Bacteria 2158
718 Ga0495673_0013795 3300047469 Bacteria 4224
719 Ga0495673_0021484 3300047469 Bacteria 3185
720 Ga0495673_0111641 3300047469 Bacteria 1092
721 Ga0495684_0000497 3300047471 Bacteria 32091
722 Ga0495686_0148098 3300047472 Bacteria 1380
723 Ga0495593_0000370 3300047673 Bacteria 24754
724 Ga0495593_0001303 3300047673 Bacteria 14631
725 Ga0495593_0062481 3300047673 Bacteria 1946
726 Ga0495593_0087448 3300047673 Bacteria 1607
727 Ga0495593_0127035 3300047673 Bacteria 1296
728 Ga0495602_0016617 3300048088 Bacteria 7397
729 Ga0495614_0039902 3300048089 Bacteria 2015
730 Ga0495626_0132943 3300048091 Bacteria 1061
731 Ga0496100_0074805 3300048903 Bacteria 2270
732 Ga0496100_0257320 3300048903 Bacteria 1293
733 Ga0496100_0305751 3300048903 Bacteria 1191
734 Ga0496101_0019312 3300048904 Bacteria 4651
735 Ga0496101_0118861 3300048904 Bacteria 1996
736 Ga0496101_0137936 3300048904 Bacteria 1857
737 Ga0496102_0005110 3300048905 Bacteria 11116
738 Ga0496102_0014065 3300048905 Bacteria 6950
739 Ga0496102_0179545 3300048905 Bacteria 1994
740 Ga0496103_0017732 3300048906 Bacteria 4263
741 Ga0496104_0010695 3300048907 Bacteria 8204
742 Ga0496104_0069857 3300048907 Bacteria 3338
743 Ga0496104_0264148 3300048907 Bacteria 1634
744 Ga0496104_0299001 3300048907 Bacteria 1521
745 Ga0496105_0035781 3300048908 Bacteria 4089
746 Ga0496105_0063923 3300048908 Bacteria 3036
747 Ga0496105_0150277 3300048908 Bacteria 1914
748 Ga0496105_0167151 3300048908 Bacteria 1804
749 Ga0496105_0234502 3300048908 Bacteria 1490
750 Ga0496106_0007339 3300048909 Bacteria 8148
751 Ga0496106_0009281 3300048909 Bacteria 7270
752 Ga0496106_0070891 3300048909 Bacteria 2662
753 Ga0496106_0220068 3300048909 Bacteria 1514
754 Ga0496106_0236296 3300048909 Bacteria 1460
755 Ga0496107_0012775 3300048910 Bacteria 5867
756 Ga0496107_0042429 3300048910 Bacteria 3267
757 Ga0496107_0114376 3300048910 Bacteria 1985
758 Ga0496107_0258453 3300048910 Bacteria 1296
759 Ga0496107_0441466 3300048910 Bacteria 967
760 Ga0496108_0001270 3300048911 Bacteria 19743
761 Ga0496108_0025132 3300048911 Bacteria 4907
762 Ga0496108_0132477 3300048911 Bacteria 2142
763 Ga0496108_0292098 3300048911 Bacteria 1419
764 Ga0496109_0001572 3300048912 Bacteria 19042
765 Ga0496109_0093609 3300048912 Bacteria 2781
766 Ga0496109_0111042 3300048912 Bacteria 2549
767 Ga0496110_0075443 3300048913 Bacteria 2996
768 Ga0496110_0117639 3300048913 Bacteria 2393
769 Ga0496110_0187701 3300048913 Bacteria 1877
770 Ga0496110_0290131 3300048913 Bacteria 1490
771 Ga0496110_0342296 3300048913 Bacteria 1362
772 Ga0496111_0005572 3300048914 Bacteria 8093
773 Ga0496111_0165583 3300048914 Bacteria 1642
774 Ga0496112_0009102 3300048915 Bacteria 8924
775 Ga0496112_0033395 3300048915 Bacteria 5002
776 Ga0496112_0052144 3300048915 Bacteria 4014
777 Ga0496112_0252013 3300048915 Bacteria 1716
778 Ga0496113_0018458 3300048916 Bacteria 4859
779 Ga0496113_0036524 3300048916 Bacteria 3600
780 Ga0496114_0002069 3300048917 Bacteria 15273
781 Ga0496114_0218598 3300048917 Bacteria 1672
782 Ga0496114_0275343 3300048917 Bacteria 1483
783 Ga0496114_0356741 3300048917 Bacteria 1293
784 Ga0496114_0472319 3300048917 Bacteria 1110
785 Ga0496115_0005035 3300048918 Bacteria 9600
786 Ga0496116_0010029 3300048919 Bacteria 7990
787 Ga0496116_0088561 3300048919 Bacteria 1891
788 Ga0496117_0042436 3300048920 Bacteria 3319
789 Ga0496117_0055758 3300048920 Bacteria 2758
790 Ga0496118_0004035 3300048921 Bacteria 17843
791 Ga0496118_0011634 3300048921 Bacteria 8558
792 Ga0496118_0085105 3300048921 Bacteria 2203
793 Ga0496118_0091827 3300048921 Bacteria 2086
794 Ga0496118_0117077 3300048921 Bacteria 1749
795 Ga0496118_0126147 3300048921 Bacteria 1656
796 Ga0496118_0126844 3300048921 Bacteria 1648
797 Ga0496119_0014732 3300048922 Bacteria 6090
798 Ga0496119_0022207 3300048922 Bacteria 4553
799 Ga0496119_0044130 3300048922 Bacteria 2810
800 Ga0496120_0085482 3300048923 Bacteria 1698
801 Ga0496121_0000640 3300048924 Bacteria 65295
802 Ga0496121_0022163 3300048924 Bacteria 6179
803 Ga0496121_0022640 3300048924 Bacteria 6083
804 Ga0496121_0040352 3300048924 Bacteria 4097
805 Ga0496121_0044057 3300048924 Bacteria 3855
806 Ga0496121_0054773 3300048924 Bacteria 3329
807 Ga0496121_0057072 3300048924 Bacteria 3238
808 Ga0496121_0099645 3300048924 Bacteria 2245
809 Ga0496121_0228676 3300048924 Bacteria 1304
810 Ga0496121_0247518 3300048924 Bacteria 1238
811 Ga0496122_0020500 3300048925 Bacteria 5968
812 Ga0496124_0007008 3300048927 Bacteria 12079
813 Ga0496124_0075371 3300048927 Bacteria 2787
814 Ga0496124_0083961 3300048927 Bacteria 2612
815 Ga0496124_0112193 3300048927 Bacteria 2193
816 Ga0496124_0119573 3300048927 Bacteria 2107
817 Ga0496125_0008236 3300048928 Bacteria 10953
818 Ga0496125_0017706 3300048928 Bacteria 6782
819 Ga0496125_0039824 3300048928 Bacteria 4040
820 Ga0496125_0066290 3300048928 Bacteria 2854
821 Ga0496125_0092356 3300048928 Bacteria 2263
822 Ga0496125_0102411 3300048928 Bacteria 2104
823 Ga0496125_0176402 3300048928 Bacteria 1429
824 Ga0496126_0004306 3300048929 Bacteria 17088
825 Ga0496126_0017921 3300048929 Bacteria 7044
826 Ga0496126_0027691 3300048929 Bacteria 5409
827 Ga0496126_0035492 3300048929 Bacteria 4673
828 Ga0496126_0037296 3300048929 Bacteria 4537
829 Ga0496126_0060621 3300048929 Bacteria 3402
830 Ga0496126_0065959 3300048929 Bacteria 3237
831 Ga0496126_0089520 3300048929 Bacteria 2709
832 Ga0496126_0109176 3300048929 Bacteria 2411
833 Ga0496126_0159757 3300048929 Bacteria 1926
834 Ga0496126_0176114 3300048929 Bacteria 1819
835 Ga0496126_0260492 3300048929 Bacteria 1442
836 Ga0495678_042590 3300049459 Bacteria 1809
837 Ga0501040_0378790 3300049576 Bacteria 1015
838 nmdc:mga03n38_98428_c1 3300050490 Bacteria 1407
839 nmdc:mga00v17_28318_c1 3300050491 Bacteria 3280
840 nmdc:mga0yw44_100542_c1 3300050492 Bacteria 1842
841 nmdc:mga0yw44_125062_c1 3300050492 Bacteria 1660
842 nmdc:mga0yw44_148721_c1 3300050492 Bacteria 1527
843 nmdc:mga0yw44_156044_c1 3300050492 Bacteria 1492
844 nmdc:mga0yw44_225862_c1 3300050492 Bacteria 1242
845 nmdc:mga0yw44_234843_c1 3300050492 Bacteria 1218
846 nmdc:mga0yw44_23941_c1 3300050492 Bacteria 3447
847 nmdc:mga0yw44_2955_c1 3300050492 Bacteria 7405
848 nmdc:mga0yw44_75476_c1 3300050492 Bacteria 2102
849 nmdc:mga0k408_1944_c1 3300050493 Bacteria 11068
850 nmdc:mga0k408_216820_c1 3300050493 Bacteria 1143
851 nmdc:mga06z11_15815_c1 3300050494 Bacteria 3379
852 nmdc:mga06z11_76686_c1 3300050494 Bacteria 1783
853 nmdc:mga06z11_80473_c1 3300050494 Bacteria 1747
854 nmdc:mga04h51_2928_c1 3300050495 Bacteria 4103
855 nmdc:mga07m45_146231_c1 3300050496 Bacteria 1370
856 nmdc:mga07m45_29605_c1 3300050496 Bacteria 3029
857 nmdc:mga07m45_53044_c1 3300050496 Bacteria 2291
858 nmdc:mga08y16_139533_c1 3300050511 Bacteria 2520
859 nmdc:mga08y16_583004_c1 3300050511 Bacteria 1129
860 nmdc:mga0n895_153988_c1 3300050512 Bacteria 2329
861 nmdc:mga0n895_17055_c1 3300050512 Bacteria 6685
862 nmdc:mga0rr50_43438_c1 3300050513 Bacteria 3289
863 nmdc:mga0sz30_14969_c1 3300050516 Bacteria 3060
864 nmdc:mga0sz30_97013_c1 3300050516 Bacteria 1286
865 Ga0495601_0028296 3300053077 Bacteria 3471
866 Ga0495601_0353374 3300053077 Bacteria 955
867 Ga0495612_0083234 3300053078 Bacteria 1346
868 Ga0500635_0001835 3300053080 Bacteria 5192
869 Ga0500635_0009691 3300053080 Bacteria 2680
870 Ga0495655_0045079 3300053083 Bacteria 1144
871 Ga0495595_0005825 3300053084 Bacteria 4990
872 Ga0495595_0079856 3300053084 Bacteria 1557
873 Ga0495619_0221731 3300053085 Bacteria 1310
874 Ga0500578_0090156 3300053086 Bacteria 1946
875 Ga0500578_0223079 3300053086 Bacteria 1145
876 Ga0500643_000160 3300053087 Bacteria 66845
877 Ga0500647_0038056 3300053091 Bacteria 2303
878 Ga0500647_0082960 3300053091 Bacteria 1537
879 Ga0500651_0122446 3300053093 Bacteria 1578
880 Ga0500566_0000275 3300053094 Bacteria 27858
881 Ga0500566_0001345 3300053094 Bacteria 14355
882 Ga0500566_0003522 3300053094 Bacteria 9339
883 Ga0500566_0004243 3300053094 Bacteria 8554
884 Ga0500566_0036998 3300053094 Bacteria 2829
885 Ga0500566_0038684 3300053094 Bacteria 2759
886 Ga0500640_000078 3300053095 Bacteria 16355
887 Ga0500640_040439 3300053095 Bacteria 2048
888 Ga0500641_0008813 3300053096 Bacteria 3612
889 Ga0500641_0013142 3300053096 Bacteria 3039
890 Ga0500641_0018495 3300053096 Bacteria 2621
891 Ga0500648_100738 3300053097 Bacteria 1607
892 Ga0500650_0006071 3300053098 Bacteria 4574
893 Ga0500554_001408 3300053102 Bacteria 4652
894 Ga0500555_008584 3300053103 Bacteria 2914
895 Ga0500556_0000011 3300053104 Bacteria 253393
896 Ga0500556_0011202 3300053104 Bacteria 2651
897 Ga0500557_000128 3300053105 Bacteria 20005
898 Ga0500569_019786 3300053109 Bacteria 1756
899 Ga0500569_030480 3300053109 Bacteria 1509
900 Ga0500569_057461 3300053109 Bacteria 1192
901 Ga0500572_004738 3300053111 Bacteria 3084
902 Ga0500572_009466 3300053111 Bacteria 2303
903 Ga0500572_049175 3300053111 Bacteria 1250
904 Ga0500595_000095 3300053119 Bacteria 61248
905 Ga0500595_009153 3300053119 Bacteria 4010
906 Ga0500597_052598 3300053120 Bacteria 1738
907 Ga0500607_080828 3300053121 Bacteria 1657
908 Ga0500607_168205 3300053121 Bacteria 991
909 Ga0500608_001666 3300053122 Bacteria 7965
910 Ga0500608_007064 3300053122 Bacteria 4616
911 Ga0500608_008201 3300053122 Bacteria 4375
912 Ga0500614_001185 3300053123 Bacteria 6390
913 Ga0500614_008073 3300053123 Bacteria 2228
914 Ga0500618_030412 3300053125 Bacteria 1270
915 Ga0500621_083220 3300053126 Bacteria 1281
916 Ga0500642_0000030 3300053130 Bacteria 115114
917 Ga0500642_0000477 3300053130 Bacteria 12415
918 Ga0500652_001587 3300053131 Bacteria 6940
919 Ga0500559_0000272 3300053136 Bacteria 40384
920 Ga0500559_0001904 3300053136 Bacteria 11296
921 Ga0500559_0096576 3300053136 Bacteria 1358
922 Ga0500559_0104501 3300053136 Bacteria 1308
923 Ga0500561_0011900 3300053137 Bacteria 1841
924 Ga0500564_050860 3300053138 Bacteria 1895
925 Ga0500568_0000246 3300053139 Bacteria 46161
926 Ga0500573_0050681 3300053140 Bacteria 2387
927 Ga0500577_0062271 3300053142 Bacteria 1438
928 Ga0500586_000521 3300053145 Bacteria 7722
929 Ga0500590_082543 3300053148 Bacteria 1575
930 Ga0500603_000142 3300053150 Bacteria 17305
931 Ga0500603_000280 3300053150 Bacteria 13469
932 Ga0500603_005139 3300053150 Bacteria 2806
933 Ga0500603_028448 3300053150 Bacteria 1426
934 Ga0500604_0025852 3300053151 Bacteria 1689
935 Ga0500616_0000026 3300053153 Bacteria 454314
936 Ga0500616_0012689 3300053153 Bacteria 4925
937 Ga0500619_002320 3300053154 Bacteria 3635
938 Ga0500619_019648 3300053154 Bacteria 1918
939 Ga0500620_000583 3300053155 Bacteria 6280
940 Ga0500622_0046926 3300053156 Bacteria 2231
941 Ga0500627_0015386 3300053158 Bacteria 2956
942 Ga0500627_0026563 3300053158 Bacteria 2391
943 Ga0500630_000325 3300053159 Bacteria 19853
944 Ga0500630_011616 3300053159 Bacteria 4335
945 Ga0500638_010149 3300053162 Bacteria 4108
946 Ga0500638_012640 3300053162 Bacteria 3790
947 Ga0500638_016517 3300053162 Bacteria 3408
948 Ga0500638_084844 3300053162 Bacteria 1499
949 Ga0500639_000217 3300053163 Bacteria 28559
950 Ga0500639_060538 3300053163 Bacteria 1951
951 Ga0500636_0001993 3300053177 Bacteria 11232
952 Ga0500636_0022787 3300053177 Bacteria 3701
953 Ga0500636_0047123 3300053177 Bacteria 2539
954 Ga0500636_0157011 3300053177 Bacteria 1244
955 Ga0500637_0002475 3300053178 Bacteria 8223
956 Ga0500637_0005209 3300053178 Bacteria 6273
957 Ga0500637_0020934 3300053178 Bacteria 3548
958 Ga0500637_0128031 3300053178 Bacteria 1473
959 Ga0500625_014183 3300053729 Bacteria 3677
960 Ga0500552_012310 3300053733 Bacteria 1091
961 Ga0500596_000321 3300053735 Bacteria 8562
962 Ga0500596_006983 3300053735 Bacteria 1872
963 Ga0500596_008711 3300053735 Bacteria 1610
964 Ga0500599_001767 3300053736 Bacteria 2529
965 Ga0500601_000795 3300053737 Bacteria 4001
966 Ga0500601_001697 3300053737 Bacteria 2369
967 Ga0500601_012351 3300053737 Bacteria 964
968 Ga0500613_007657 3300053738 Bacteria 1134
969 Ga0500587_008712 3300053739 Bacteria 1303
970 Ga0500661_000198 3300055283 Bacteria 10649
971 Ga0500661_011296 3300055283 Bacteria 1616

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_008201 Ga0500608_008201_3634_4356 233
2 3300053136 Ga0500559_0001904 Ga0500559_0001904_22_744 233
3 3300053077 Ga0495601_0353374 Ga0495601_0353374_206_931 234
4 3300046518 Ga0495631_0072260 Ga0495631_0072260_15_764 245
5 3300053086 Ga0500578_0223079 Ga0500578_0223079_350_1132 253
6 3300005983 Ga0081540_1019100 Ga0081540_10191005 267
7 3300046472 Ga0495580_0073929 Ga0495580_0073929_597_1475 267
8 3300046642 Ga0495634_0034146 Ga0495634_0034146_652_1539 267
9 3300047673 Ga0495593_0062481 Ga0495593_0062481_423_1301 267
10 3300053078 Ga0495612_0083234 Ga0495612_0083234_275_1162 267
11 3300046499 Ga0495594_0155965 Ga0495594_0155965_275_1096 268
12 3300006028 Ga0070717_10042253 Ga0070717_100422533 271
13 3300035113 Ga0373936_0008591 Ga0373936_0008591_1774_2652 271
14 3300053080 Ga0500635_0001835 Ga0500635_0001835_3722_4597 271
15 3300053091 Ga0500647_0038056 Ga0500647_0038056_874_1752 271
16 3300053094 Ga0500566_0004243 Ga0500566_0004243_6599_7477 271
17 3300053095 Ga0500640_040439 Ga0500640_040439_816_1694 271
18 3300053102 Ga0500554_001408 Ga0500554_001408_3137_4012 271
19 3300053111 Ga0500572_009466 Ga0500572_009466_839_1717 271
20 3300053123 Ga0500614_008073 Ga0500614_008073_814_1692 271
21 3300053150 Ga0500603_000280 Ga0500603_000280_614_1489 271
22 3300053150 Ga0500603_005139 Ga0500603_005139_1088_1966 271
23 3300053159 Ga0500630_011616 Ga0500630_011616_2875_3753 271
24 3300053162 Ga0500638_010149 Ga0500638_010149_151_978 271
25 3300053162 Ga0500638_084844 Ga0500638_084844_105_983 271
26 3300053163 Ga0500639_060538 Ga0500639_060538_408_1286 271
27 3300053178 Ga0500637_0005209 Ga0500637_0005209_3896_4771 271
28 3300053735 Ga0500596_008711 Ga0500596_008711_622_1500 271
29 3300053737 Ga0500601_012351 Ga0500601_012351_28_906 271
30 3300005539 Ga0068853_100381150 Ga0068853_1003811501 273
31 3300047319 Ga0495674_0182108 Ga0495674_0182108_25_870 273
32 3300050492 nmdc:mga0yw44_156044_c1 nmdc:mga0yw44_156044_c1_494_1327 273
33 3300009551 Ga0105238_10301875 Ga0105238_103018752 274
34 3300048917 Ga0496114_0356741 Ga0496114_0356741_447_1283 274
35 3300053085 Ga0495619_0221731 Ga0495619_0221731_426_1262 274
36 3300015261 Ga0182006_1092671 Ga0182006_10926712 275
37 3300044842 Ga0466957_0041259 Ga0466957_0041259_1086_1925 275
38 3300053729 Ga0500625_014183 Ga0500625_014183_2511_3392 275
39 3300006942 Ga0099824_1014090 Ga0099824_10140903 276
40 3300027296 Ga0209389_1000104 Ga0209389_100010463 276
41 3300027357 Ga0209589_1000159 Ga0209589_10001593 276
42 3300027361 Ga0209489_100194 Ga0209489_1001943 276
43 3300035695 Ga0373927_0113445 Ga0373927_0113445_819_1697 277
44 3300039450 Ga0436363_1043107 Ga0436363_1043107_23_868 277
45 3300041997 Ga0439431_0005614 Ga0439431_0005614_1874_2755 277
46 3300047320 Ga0495672_0036537 Ga0495672_0036537_1710_2564 278
47 iso_pu_bacteria 2513237096 2513661626 278
48 iso_pu_bacteria 2513237137 2513863099 278
49 iso_pu_bacteria 2513237145 2513923319 278
50 iso_pu_bacteria 2517572143 2517889118 278
51 iso_pu_bacteria 2667528175 2671121596 278
52 iso_pu_bacteria 2885374607 2885378053 278
53 iso_pu_bacteria 2903748898 2903754208 278
54 iso_pu_bacteria 2906635258 2906643040 278
55 iso_pu_bacteria 2906660503 2906668193 278
56 iso_pu_bacteria 2908739725 2908747730 278
57 iso_pu_bacteria 2922425934 2922433931 278
58 iso_pu_bacteria 2935630451 2935634950 278
59 iso_pu_bacteria 2941507105 2941514262 278
60 iso_pu_bacteria 2941515067 2941522223 278
61 iso_pu_bacteria 2941523033 2941530094 278
62 iso_pu_bacteria 8019555841 8019562740 278
63 iso_pu_bacteria 8019565922 8019572819 278
64 iso_pu_bacteria 2728368998 2728753714 280
65 iso_pu_bacteria 2728368998 2728755499 280
66 iso_pu_bacteria 2932794094 2932800051 280
67 iso_pu_bacteria 2932801729 2932809060 280
68 iso_pu_bacteria 2935883170 2935888267 280
69 iso_pu_bacteria 3005594810 3005595295 280
70 iso_pu_bacteria 3005718088 3005718544 280
71 iso_pu_bacteria 2507262055 2507505502 281
72 iso_pu_bacteria 2508501009 2508539387 281
73 iso_pu_bacteria 2508501042 2508695718 281
74 iso_pu_bacteria 2511231028 2511397419 281
75 iso_pu_bacteria 2513237094 2513642391 281
76 iso_pu_bacteria 2513237095 2513652619 281
77 iso_pu_bacteria 2513237102 2513704756 281
78 iso_pu_bacteria 2513237104 2513721914 281
79 iso_pu_bacteria 2513237139 2513879259 281
80 iso_pu_bacteria 2513237161 2514016910 281
81 iso_pu_bacteria 2515154112 2515630202 281
82 iso_pu_bacteria 2517093001 2517107626 281
83 iso_pu_bacteria 2617270735 2617354372 281
84 iso_pu_bacteria 2617270741 2617377410 281
85 iso_pu_bacteria 2744054633 2745082743 281
86 iso_pu_bacteria 2791355196 2793065724 281
87 iso_pu_bacteria 2802429603 2805921593 281
88 iso_pu_bacteria 2816332527 2818239020 281
89 iso_pu_bacteria 2824600985 2824608459 281
90 iso_pu_bacteria 2824609381 2824617513 281
91 iso_pu_bacteria 2824617872 2824624890 281
92 iso_pu_bacteria 2824626560 2824633765 281
93 iso_pu_bacteria 2824635225 2824640938 281
94 iso_pu_bacteria 2824644064 2824649219 281
95 iso_pu_bacteria 2824653114 2824660255 281
96 iso_pu_bacteria 2824671348 2824678902 281
97 iso_pu_bacteria 2824679649 2824685674 281
98 iso_pu_bacteria 2824687955 2824695438 281
99 iso_pu_bacteria 2824696289 2824703816 281
100 iso_pu_bacteria 2824704595 2824713570 281
101 iso_pu_bacteria 2824714736 2824719400 281
102 iso_pu_bacteria 2824723954 2824729855 281
103 iso_pu_bacteria 2824732956 2824739666 281
104 iso_pu_bacteria 2824746037 2824751629 281
105 iso_pu_bacteria 2824753945 2824761405 281
106 iso_pu_bacteria 2824763712 2824768522 281
107 iso_pu_bacteria 2824773399 2824781302 281
108 iso_pu_bacteria 2838122688 2838130152 281
109 iso_pu_bacteria 2841941048 2841949213 281
110 iso_pu_bacteria 2841949485 2841956995 281
111 iso_pu_bacteria 2841957949 2841964880 281
112 iso_pu_bacteria 2841966195 2841974455 281
113 iso_pu_bacteria 2841974524 2841977387 281
114 iso_pu_bacteria 2841983080 2841990714 281
115 iso_pu_bacteria 2842038055 2842041233 281
116 iso_pu_bacteria 2842045827 2842049275 281
117 iso_pu_bacteria 2844315083 2844315719 281
118 iso_pu_bacteria 2847930680 2847931306 281
119 iso_pu_bacteria 2847939898 2847942397 281
120 iso_pu_bacteria 2849076700 2849083269 281
121 iso_pu_bacteria 2857509624 2857516428 281
122 iso_pu_bacteria 2874590934 2874592577 281
123 iso_pu_bacteria 2874620515 2874622981 281
124 iso_pu_bacteria 2874628541 2874636895 281
125 iso_pu_bacteria 2874645413 2874647401 281
126 iso_pu_bacteria 2876761206 2876763776 281
127 iso_pu_bacteria 2876771140 2876772701 281
128 iso_pu_bacteria 2876818435 2876820034 281
129 iso_pu_bacteria 2879074833 2879076539 281
130 iso_pu_bacteria 2879083081 2879087652 281
131 iso_pu_bacteria 2879127579 2879129173 281
132 iso_pu_bacteria 2879142872 2879144812 281
133 iso_pu_bacteria 2881364244 2881370020 281
134 iso_pu_bacteria 2881665667 2881666238 281
135 iso_pu_bacteria 2885366525 2885368551 281
136 iso_pu_bacteria 2885409591 2885410243 281
137 iso_pu_bacteria 2888378607 2888379334 281
138 iso_pu_bacteria 2888419890 2888420025 281
139 iso_pu_bacteria 2903727486 2903730981 281
140 iso_pu_bacteria 2904666416 2904668957 281
141 iso_pu_bacteria 2904711408 2904714023 281
142 iso_pu_bacteria 2906602504 2906608461 281
143 iso_pu_bacteria 2906626472 2906631597 281
144 iso_pu_bacteria 2906643746 2906652094 281
145 iso_pu_bacteria 2908775508 2908775939 281
146 iso_pu_bacteria 2922393267 2922398075 281
147 iso_pu_bacteria 2935608549 2935614558 281
148 iso_pu_bacteria 2935648319 2935654721 281
149 iso_pu_bacteria 2935656913 2935663601 281
150 iso_pu_bacteria 2935769743 2935774236 281
151 iso_pu_bacteria 2935777560 2935778279 281
152 iso_pu_bacteria 2935785616 2935789049 281
153 iso_pu_bacteria 2935793552 2935796799 281
154 iso_pu_bacteria 2935819856 2935826410 281
155 iso_pu_bacteria 2935847175 2935853897 281
156 iso_pu_bacteria 2935908558 2935915439 281
157 iso_pu_bacteria 2935916978 2935925085 281
158 iso_pu_bacteria 2935926038 2935933334 281
159 iso_pu_bacteria 2935934488 2935941426 281
160 iso_pu_bacteria 2935942939 2935949515 281
161 iso_pu_bacteria 2935951376 2935958310 281
162 iso_pu_bacteria 2935967501 2935974898 281
163 iso_pu_bacteria 2935975950 2935983161 281
164 iso_pu_bacteria 2935984226 2935985212 281
165 iso_pu_bacteria 2936011229 2936017757 281
166 iso_pu_bacteria 2936019824 2936026260 281
167 iso_pu_bacteria 2936028420 2936035007 281
168 iso_pu_bacteria 2936046547 2936053236 281
169 iso_pu_bacteria 2936055302 2936057027 281
170 iso_pu_bacteria 2941531003 2941537939 281
171 iso_pu_bacteria 3005483717 3005489310 281
172 iso_pu_bacteria 3005506211 3005511449 281
173 iso_pu_bacteria 3005587118 3005592339 281
174 iso_pu_bacteria 8006926726 8006930244 281
175 iso_pu_bacteria 8016522445 8016526388 281
176 iso_pu_bacteria 8016530956 8016531457 281
177 iso_pu_bacteria 8016539877 8016544667 281
178 iso_pu_bacteria 8016548790 8016557412 281
179 iso_pu_bacteria 8016566248 8016569723 281
180 iso_pu_bacteria 8016575299 8016582327 281
181 iso_pu_bacteria 8016583857 8016586084 281
182 iso_pu_bacteria 8016595262 8016603370 281
183 iso_pu_bacteria 8016603502 8016606303 281
184 iso_pu_bacteria 8016613128 8016618210 281
185 iso_pu_bacteria 8016622563 8016622862 281
186 iso_pu_bacteria 8016630954 8016635370 281
187 iso_pu_bacteria 8019530166 8019531288 281
188 iso_pu_bacteria 8019538911 8019540269 281
189 iso_pu_bacteria 8019547302 8019549862 281
190 iso_pu_bacteria 8019619141 8019623223 281
191 iso_pu_bacteria 8019659431 8019666711 281
192 iso_pu_bacteria 8019668869 8019676472 281
193 iso_pu_bacteria 8019678201 8019679519 281
194 iso_pu_bacteria 8019687851 8019695993 281
195 iso_pu_bacteria 8056967851 8056975795 281
196 3300006038 Ga0075365_10036278 Ga0075365_100362782 282
197 3300025261 Ga0209233_1020134 Ga0209233_10201342 282
198 3300033442 Ga0315911_1000008 Ga0315911_100000827 282
199 3300039437 Ga0436365_0753572 Ga0436365_0753572_2121_2996 282
200 3300048909 Ga0496106_0220068 Ga0496106_0220068_433_1290 282
201 3300050492 nmdc:mga0yw44_23941_c1 nmdc:mga0yw44_23941_c1_1561_2436 282
202 iso_pu_bacteria 2513237092 2513624839 282
203 iso_pu_bacteria 2513237098 2513671810 282
204 iso_pu_bacteria 2513237101 2513698877 282
205 iso_pu_bacteria 2513237141 2513888963 282
206 iso_pu_bacteria 2528768022 2528851906 282
207 iso_pu_bacteria 2602042107 2603861922 282
208 iso_pu_bacteria 2721755755 2723841883 282
209 iso_pu_bacteria 2791355199 2793079190 282
210 iso_pu_bacteria 2824661429 2824667226 282
211 iso_pu_bacteria 2857524615 2857530471 282
212 iso_pu_bacteria 2874604998 2874610523 282
213 iso_pu_bacteria 2874612657 2874619670 282
214 iso_pu_bacteria 2879099564 2879099701 282
215 iso_pu_bacteria 2879110137 2879115168 282
216 iso_pu_bacteria 2888388044 2888390446 282
217 iso_pu_bacteria 2889033259 2889035206 282
218 iso_pu_bacteria 2893066018 2893069574 282
219 iso_pu_bacteria 2903768456 2903774886 282
220 iso_pu_bacteria 2919073203 2919077366 282
221 iso_pu_bacteria 2922361189 2922363267 282
222 iso_pu_bacteria 2922368715 2922369238 282
223 iso_pu_bacteria 2922386360 2922388805 282
224 iso_pu_bacteria 2929615660 2929618862 282
225 iso_pu_bacteria 2929624759 2929630939 282
226 iso_pu_bacteria 2932784394 2932791051 282
227 iso_pu_bacteria 2932809354 2932817949 282
228 iso_pu_bacteria 2932818245 2932820580 282
229 iso_pu_bacteria 2932828146 2932837129 282
230 iso_pu_bacteria 2933577622 2933580428 282
231 iso_pu_bacteria 2935616580 2935624360 282
232 iso_pu_bacteria 2935638405 2935644351 282
233 iso_pu_bacteria 2935665750 2935674720 282
234 iso_pu_bacteria 2935675223 2935684706 282
235 iso_pu_bacteria 2935684952 2935686652 282
236 iso_pu_bacteria 2935694250 2935701670 282
237 iso_pu_bacteria 2935703347 2935710384 282
238 iso_pu_bacteria 2935713505 2935716340 282
239 iso_pu_bacteria 2935722832 2935723536 282
240 iso_pu_bacteria 2935732158 2935735091 282
241 iso_pu_bacteria 2935741537 2935744118 282
242 iso_pu_bacteria 2935750917 2935752618 282
243 iso_pu_bacteria 2935760218 2935764952 282
244 iso_pu_bacteria 2935801545 2935810504 282
245 iso_pu_bacteria 2935810662 2935816816 282
246 iso_pu_bacteria 2935827899 2935833405 282
247 iso_pu_bacteria 2935837841 2935846039 282
248 iso_pu_bacteria 2935855204 2935863079 282
249 iso_pu_bacteria 2935864058 2935873465 282
250 iso_pu_bacteria 2935873716 2935879973 282
251 iso_pu_bacteria 2935959822 2935966559 282
252 iso_pu_bacteria 2935992306 2935997805 282
253 iso_pu_bacteria 2936002035 2936011001 282
254 iso_pu_bacteria 2936037263 2936043807 282
255 iso_pu_bacteria 2940556831 2940558531 282
256 iso_pu_bacteria 2941538514 2941547080 282
257 iso_pu_bacteria 3005710791 3005711256 282
258 iso_pu_bacteria 8006964411 8006969435 282
259 iso_pu_bacteria 8006984368 8006988474 282
260 iso_pu_bacteria 8006994254 8007000715 282
261 iso_pu_bacteria 8016511872 8016517919 282
262 iso_pu_bacteria 8017057580 8017058720 282
263 iso_pu_bacteria 8019576017 8019576933 282
264 iso_pu_bacteria 8019586578 8019594996 282
265 iso_pu_bacteria 8019597564 8019606745 282
266 iso_pu_bacteria 8019608314 8019611764 282
267 iso_pu_bacteria 8055742211 8055742711 282
268 iso_pu_bacteria 8056673599 8056678605 282
269 3300003215 JGI25153J46596_10016489 JGI25153J46596_100164892 283
270 3300005329 Ga0070683_100197019 Ga0070683_1001970191 283
271 3300005434 Ga0070709_10238639 Ga0070709_102386392 283
272 3300005439 Ga0070711_100105501 Ga0070711_1001055013 283
273 3300005548 Ga0070665_100172998 Ga0070665_1001729982 283
274 3300005563 Ga0068855_100188651 Ga0068855_1001886513 283
275 3300005578 Ga0068854_100452171 Ga0068854_1004521711 283
276 3300006175 Ga0070712_100217533 Ga0070712_1002175332 283
277 3300013105 Ga0157369_10077996 Ga0157369_100779964 283
278 3300013296 Ga0157374_10185651 Ga0157374_101856511 283
279 3300025297 Ga0209758_1001325 Ga0209758_100132526 283
280 3300025898 Ga0207692_10151293 Ga0207692_101512932 283
281 3300025904 Ga0207647_10140456 Ga0207647_101404562 283
282 3300025914 Ga0207671_10478798 Ga0207671_104787981 283
283 3300025915 Ga0207693_10044704 Ga0207693_100447044 283
284 3300025931 Ga0207644_10214886 Ga0207644_102148863 283
285 3300025944 Ga0207661_10164980 Ga0207661_101649801 283
286 3300026067 Ga0207678_10267163 Ga0207678_102671632 283
287 3300026121 Ga0207683_10069387 Ga0207683_100693874 283
288 3300028379 Ga0268266_10154742 Ga0268266_101547422 283
289 3300031730 Ga0307516_10020252 Ga0307516_100202522 283
290 3300037418 Ga0395900_0041342 Ga0395900_0041342_1013_1885 283
291 3300038443 Ga0395901_0071006 Ga0395901_0071006_1145_2017 283
292 3300046674 Ga0495588_0130092 Ga0495588_0130092_107_979 283
293 3300046809 Ga0495600_0177477 Ga0495600_0177477_372_1247 283
294 3300048924 Ga0496121_0022163 Ga0496121_0022163_4160_5032 283
295 3300053094 Ga0500566_0036998 Ga0500566_0036998_1461_2324 283
296 3300053119 Ga0500595_000095 Ga0500595_000095_59853_60716 283
297 3300053136 Ga0500559_0104501 Ga0500559_0104501_260_1123 283
298 3300053178 Ga0500637_0002475 Ga0500637_0002475_593_1456 283
299 3300055283 Ga0500661_000198 Ga0500661_000198_599_1462 283
300 3300005434 Ga0070709_10012913 Ga0070709_100129136 284
301 3300005434 Ga0070709_10027828 Ga0070709_100278284 284
302 3300005435 Ga0070714_100076810 Ga0070714_1000768104 284
303 3300005436 Ga0070713_100049420 Ga0070713_1000494202 284
304 3300005436 Ga0070713_100105541 Ga0070713_1001055412 284
305 3300005437 Ga0070710_10000755 Ga0070710_100007551 284
306 3300005437 Ga0070710_10020372 Ga0070710_100203722 284
307 3300005439 Ga0070711_100041640 Ga0070711_1000416402 284
308 3300005439 Ga0070711_100053801 Ga0070711_1000538013 284
309 3300005467 Ga0070706_100086269 Ga0070706_1000862692 284
310 3300005468 Ga0070707_100041107 Ga0070707_1000411075 284
311 3300005616 Ga0068852_100027518 Ga0068852_1000275183 284
312 3300005842 Ga0068858_100306903 Ga0068858_1003069031 284
313 3300005843 Ga0068860_100000577 Ga0068860_10000057735 284
314 3300005983 Ga0081540_1022078 Ga0081540_10220783 284
315 3300006173 Ga0070716_100043607 Ga0070716_1000436073 284
316 3300006175 Ga0070712_100017728 Ga0070712_1000177285 284
317 3300006175 Ga0070712_100096914 Ga0070712_1000969144 284
318 3300006942 Ga0099824_1009104 Ga0099824_10091049 284
319 3300006943 Ga0099822_1011071 Ga0099822_10110718 284
320 3300009093 Ga0105240_10095052 Ga0105240_100950525 284
321 3300009098 Ga0105245_10031932 Ga0105245_100319326 284
322 3300009174 Ga0105241_10087362 Ga0105241_100873623 284
323 3300009545 Ga0105237_10031055 Ga0105237_100310555 284
324 3300010375 Ga0105239_10056885 Ga0105239_100568852 284
325 3300010375 Ga0105239_10087851 Ga0105239_100878514 284
326 3300010375 Ga0105239_10122522 Ga0105239_101225222 284
327 3300010375 Ga0105239_10378951 Ga0105239_103789513 284
328 3300025898 Ga0207692_10070783 Ga0207692_100707833 284
329 3300025900 Ga0207710_10028822 Ga0207710_100288222 284
330 3300025905 Ga0207685_10068231 Ga0207685_100682312 284
331 3300025906 Ga0207699_10004815 Ga0207699_100048156 284
332 3300025906 Ga0207699_10014010 Ga0207699_100140106 284
333 3300025910 Ga0207684_10108140 Ga0207684_101081402 284
334 3300025910 Ga0207684_10205152 Ga0207684_102051522 284
335 3300025911 Ga0207654_10031015 Ga0207654_100310154 284
336 3300025913 Ga0207695_10001156 Ga0207695_100011563 284
337 3300025914 Ga0207671_10035802 Ga0207671_100358023 284
338 3300025914 Ga0207671_10221960 Ga0207671_102219601 284
339 3300025914 Ga0207671_10248592 Ga0207671_102485922 284
340 3300025915 Ga0207693_10029143 Ga0207693_100291434 284
341 3300025915 Ga0207693_10085272 Ga0207693_100852724 284
342 3300025916 Ga0207663_10028317 Ga0207663_100283175 284
343 3300025922 Ga0207646_10028561 Ga0207646_100285615 284
344 3300025929 Ga0207664_10068542 Ga0207664_100685424 284
345 3300025939 Ga0207665_10004668 Ga0207665_100046684 284
346 3300025939 Ga0207665_10066810 Ga0207665_100668102 284
347 3300027357 Ga0209589_1001113 Ga0209589_10011133 284
348 3300027361 Ga0209489_101913 Ga0209489_1019133 284
349 3300027363 Ga0209700_101949 Ga0209700_10194934 284
350 3300028381 Ga0268264_10000107 Ga0268264_10000107187 284
351 3300028556 Ga0265337_1003913 Ga0265337_10039134 284
352 3300028558 Ga0265326_10006121 Ga0265326_100061213 284
353 3300028563 Ga0265319_1015989 Ga0265319_10159894 284
354 3300028573 Ga0265334_10011650 Ga0265334_100116503 284
355 3300028577 Ga0265318_10011203 Ga0265318_100112034 284
356 3300028653 Ga0265323_10000706 Ga0265323_1000070613 284
357 3300028654 Ga0265322_10014719 Ga0265322_100147193 284
358 3300028666 Ga0265336_10000683 Ga0265336_100006834 284
359 3300028800 Ga0265338_10001041 Ga0265338_1000104131 284
360 3300029957 Ga0265324_10002208 Ga0265324_100022087 284
361 3300030521 Ga0307511_10132317 Ga0307511_101323172 284
362 3300030521 Ga0307511_10188921 Ga0307511_101889212 284
363 3300031730 Ga0307516_10073486 Ga0307516_100734863 284
364 3300033179 Ga0307507_10016255 Ga0307507_100162557 284
365 3300033180 Ga0307510_10058529 Ga0307510_100585292 284
366 3300035113 Ga0373936_0015146 Ga0373936_0015146_48_923 284
367 3300035170 Ga0373943_0083497 Ga0373943_0083497_169_1041 284
368 3300035692 Ga0373935_0035198 Ga0373935_0035198_461_1333 284
369 3300035695 Ga0373927_0020633 Ga0373927_0020633_2176_3048 284
370 3300035725 Ga0373947_0032892 Ga0373947_0032892_1081_1953 284
371 3300037068 Ga0373925_0024175 Ga0373925_0024175_1847_2719 284
372 3300037853 Ga0436364_1203906 Ga0436364_1203906_158_1039 284
373 3300044684 Ga0466966_0001471 Ga0466966_0001471_13053_13928 284
374 3300044693 Ga0466961_0004761 Ga0466961_0004761_7084_7959 284
375 3300044706 Ga0466964_0078152 Ga0466964_0078152_222_1091 284
376 3300044765 Ga0466970_0226211 Ga0466970_0226211_157_1026 284
377 3300045049 Ga0466959_0005681 Ga0466959_0005681_7098_7973 284
378 3300046454 Ga0495592_0008791 Ga0495592_0008791_6677_7555 284
379 3300046459 Ga0495629_0006021 Ga0495629_0006021_1773_2642 284
380 3300046462 Ga0495651_0019479 Ga0495651_0019479_762_1640 284
381 3300046462 Ga0495651_0054726 Ga0495651_0054726_603_1472 284
382 3300046474 Ga0495605_0130215 Ga0495605_0130215_216_1082 284
383 3300046476 Ga0495662_0016856 Ga0495662_0016856_2388_3257 284
384 3300046477 Ga0495664_0001204 Ga0495664_0001204_5923_6801 284
385 3300046507 Ga0495606_0053703 Ga0495606_0053703_811_1683 284
386 3300046511 Ga0495608_0100321 Ga0495608_0100321_404_1273 284
387 3300046514 Ga0495618_0043480 Ga0495618_0043480_480_1349 284
388 3300046516 Ga0495628_0061793 Ga0495628_0061793_612_1490 284
389 3300046517 Ga0495630_0137068 Ga0495630_0137068_640_1518 284
390 3300046524 Ga0495648_0006267 Ga0495648_0006267_7955_8827 284
391 3300046529 Ga0495652_0006258 Ga0495652_0006258_2378_3256 284
392 3300046529 Ga0495652_0166992 Ga0495652_0166992_435_1307 284
393 3300046533 Ga0495640_0010418 Ga0495640_0010418_393_1262 284
394 3300046533 Ga0495640_0032685 Ga0495640_0032685_361_1239 284
395 3300046533 Ga0495640_0149628 Ga0495640_0149628_285_1157 284
396 3300046536 Ga0495587_0030628 Ga0495587_0030628_492_1370 284
397 3300046543 Ga0495645_0002277 Ga0495645_0002277_8903_9781 284
398 3300046557 Ga0495622_0013329 Ga0495622_0013329_566_1435 284
399 3300046557 Ga0495622_0016867 Ga0495622_0016867_1797_2669 284
400 3300046559 Ga0495667_0139683 Ga0495667_0139683_100_978 284
401 3300046642 Ga0495634_0096856 Ga0495634_0096856_693_1571 284
402 3300046663 Ga0495635_0074254 Ga0495635_0074254_712_1581 284
403 3300046675 Ga0495657_0015079 Ga0495657_0015079_4181_5059 284
404 3300046675 Ga0495657_0095578 Ga0495657_0095578_438_1307 284
405 3300046678 Ga0495599_0039352 Ga0495599_0039352_182_1060 284
406 3300046679 Ga0495623_0042017 Ga0495623_0042017_480_1358 284
407 3300046680 Ga0495646_0097496 Ga0495646_0097496_666_1538 284
408 3300046689 Ga0495613_0131395 Ga0495613_0131395_575_1453 284
409 3300046694 Ga0495649_0099633 Ga0495649_0099633_51_923 284
410 3300046809 Ga0495600_0011127 Ga0495600_0011127_822_1691 284
411 3300046809 Ga0495600_0072440 Ga0495600_0072440_516_1394 284
412 3300047315 Ga0495581_0091563 Ga0495581_0091563_455_1324 284
413 3300047315 Ga0495581_0155164 Ga0495581_0155164_163_1029 284
414 3300047317 Ga0495604_0190660 Ga0495604_0190660_209_1078 284
415 3300047321 Ga0495676_0008153 Ga0495676_0008153_6933_7799 284
416 3300047322 Ga0495680_0010179 Ga0495680_0010179_894_1772 284
417 3300047444 Ga0495675_0054237 Ga0495675_0054237_490_1368 284
418 3300048088 Ga0495602_0016617 Ga0495602_0016617_5920_6798 284
419 3300048907 Ga0496104_0010695 Ga0496104_0010695_336_1205 284
420 3300048908 Ga0496105_0063923 Ga0496105_0063923_1554_2423 284
421 3300048909 Ga0496106_0007339 Ga0496106_0007339_1322_2194 284
422 3300048913 Ga0496110_0075443 Ga0496110_0075443_481_1350 284
423 3300048915 Ga0496112_0252013 Ga0496112_0252013_261_1130 284
424 3300048919 Ga0496116_0088561 Ga0496116_0088561_531_1403 284
425 3300048921 Ga0496118_0004035 Ga0496118_0004035_9777_10649 284
426 3300048922 Ga0496119_0022207 Ga0496119_0022207_747_1616 284
427 3300048922 Ga0496119_0044130 Ga0496119_0044130_1906_2778 284
428 3300048924 Ga0496121_0000640 Ga0496121_0000640_51755_52627 284
429 3300048924 Ga0496121_0040352 Ga0496121_0040352_587_1456 284
430 3300048924 Ga0496121_0228676 Ga0496121_0228676_416_1291 284
431 3300048924 Ga0496121_0247518 Ga0496121_0247518_284_1156 284
432 3300048927 Ga0496124_0007008 Ga0496124_0007008_7542_8414 284
433 3300048927 Ga0496124_0112193 Ga0496124_0112193_857_1726 284
434 3300048927 Ga0496124_0119573 Ga0496124_0119573_614_1483 284
435 3300048928 Ga0496125_0008236 Ga0496125_0008236_9518_10393 284
436 3300048928 Ga0496125_0039824 Ga0496125_0039824_2955_3821 284
437 3300048928 Ga0496125_0176402 Ga0496125_0176402_352_1224 284
438 3300048929 Ga0496126_0004306 Ga0496126_0004306_3294_4166 284
439 3300048929 Ga0496126_0017921 Ga0496126_0017921_3459_4331 284
440 3300048929 Ga0496126_0027691 Ga0496126_0027691_335_1210 284
441 3300048929 Ga0496126_0035492 Ga0496126_0035492_1701_2576 284
442 3300048929 Ga0496126_0060621 Ga0496126_0060621_282_1154 284
443 3300048929 Ga0496126_0109176 Ga0496126_0109176_636_1511 284
444 3300048929 Ga0496126_0176114 Ga0496126_0176114_788_1663 284
445 3300050492 nmdc:mga0yw44_225862_c1 nmdc:mga0yw44_225862_c1_271_1137 284
446 3300053083 Ga0495655_0045079 Ga0495655_0045079_122_994 284
447 3300053091 Ga0500647_0082960 Ga0500647_0082960_458_1333 284
448 3300053094 Ga0500566_0000275 Ga0500566_0000275_24932_25807 284
449 3300053094 Ga0500566_0038684 Ga0500566_0038684_1356_2228 284
450 3300053095 Ga0500640_000078 Ga0500640_000078_14762_15637 284
451 3300053097 Ga0500648_100738 Ga0500648_100738_563_1435 284
452 3300053111 Ga0500572_004738 Ga0500572_004738_2069_2944 284
453 3300053120 Ga0500597_052598 Ga0500597_052598_604_1473 284
454 3300053123 Ga0500614_001185 Ga0500614_001185_2302_3177 284
455 3300053140 Ga0500573_0050681 Ga0500573_0050681_1003_1875 284
456 3300053150 Ga0500603_000142 Ga0500603_000142_12512_13387 284
457 3300053150 Ga0500603_028448 Ga0500603_028448_140_1012 284
458 3300053154 Ga0500619_019648 Ga0500619_019648_411_1283 284
459 3300053159 Ga0500630_000325 Ga0500630_000325_1787_2662 284
460 3300053162 Ga0500638_016517 Ga0500638_016517_1104_1979 284
461 3300053163 Ga0500639_000217 Ga0500639_000217_25007_25882 284
462 3300053178 Ga0500637_0020934 Ga0500637_0020934_837_1709 284
463 3300053733 Ga0500552_012310 Ga0500552_012310_166_1035 284
464 3300053735 Ga0500596_000321 Ga0500596_000321_5677_6552 284
465 3300053735 Ga0500596_006983 Ga0500596_006983_538_1410 284
466 3300053737 Ga0500601_001697 Ga0500601_001697_1405_2280 284
467 3300055283 Ga0500661_011296 Ga0500661_011296_567_1433 284
468 3300003214 JGI25165J46597_1008047 JGI25165J46597_10080473 285
469 3300003215 JGI25153J46596_10000550 JGI25153J46596_1000055016 285
470 3300003215 JGI25153J46596_10013291 JGI25153J46596_100132913 285
471 3300003215 JGI25153J46596_10014619 JGI25153J46596_100146193 285
472 3300003354 JGI25160J50197_1004506 JGI25160J50197_10045063 285
473 3300003794 Ga0055531_10014620 Ga0055531_100146203 285
474 3300005262 Ga0065165_1001646 Ga0065165_100164618 285
475 3300005328 Ga0070676_10120250 Ga0070676_101202502 285
476 3300005329 Ga0070683_100093829 Ga0070683_1000938294 285
477 3300005334 Ga0068869_100015937 Ga0068869_1000159371 285
478 3300005336 Ga0070680_100121818 Ga0070680_1001218182 285
479 3300005340 Ga0070689_100084174 Ga0070689_1000841744 285
480 3300005347 Ga0070668_100106056 Ga0070668_1001060563 285
481 3300005355 Ga0070671_100034823 Ga0070671_1000348233 285
482 3300005365 Ga0070688_100080943 Ga0070688_1000809434 285
483 3300005434 Ga0070709_10093365 Ga0070709_100933651 285
484 3300005438 Ga0070701_10043293 Ga0070701_100432934 285
485 3300005455 Ga0070663_100070714 Ga0070663_1000707144 285
486 3300005458 Ga0070681_10158376 Ga0070681_101583763 285
487 3300005458 Ga0070681_10254456 Ga0070681_102544562 285
488 3300005530 Ga0070679_100021186 Ga0070679_1000211863 285
489 3300005530 Ga0070679_100113377 Ga0070679_1001133774 285
490 3300005535 Ga0070684_100033972 Ga0070684_1000339724 285
491 3300005547 Ga0070693_100018521 Ga0070693_1000185212 285
492 3300005548 Ga0070665_100193449 Ga0070665_1001934493 285
493 3300005548 Ga0070665_100207601 Ga0070665_1002076013 285
494 3300005563 Ga0068855_100128289 Ga0068855_1001282892 285
495 3300005577 Ga0068857_100090503 Ga0068857_1000905033 285
496 3300005578 Ga0068854_100030068 Ga0068854_1000300683 285
497 3300005614 Ga0068856_100002282 Ga0068856_10000228215 285
498 3300005616 Ga0068852_100109235 Ga0068852_1001092354 285
499 3300005844 Ga0068862_100046068 Ga0068862_1000460684 285
500 3300005937 Ga0081455_10044688 Ga0081455_100446884 285
501 3300005985 Ga0081539_10009687 Ga0081539_100096875 285
502 3300005985 Ga0081539_10042459 Ga0081539_100424592 285
503 3300006038 Ga0075365_10092810 Ga0075365_100928104 285
504 3300006038 Ga0075365_10124820 Ga0075365_101248203 285
505 3300006042 Ga0075368_10003600 Ga0075368_100036002 285
506 3300006042 Ga0075368_10038401 Ga0075368_100384012 285
507 3300006048 Ga0075363_100042670 Ga0075363_1000426704 285
508 3300006051 Ga0075364_10145193 Ga0075364_101451932 285
509 3300006178 Ga0075367_10047076 Ga0075367_100470763 285
510 3300006178 Ga0075367_10263604 Ga0075367_102636042 285
511 3300006186 Ga0075369_10026619 Ga0075369_100266193 285
512 3300006195 Ga0075366_10137965 Ga0075366_101379651 285
513 3300006353 Ga0075370_10028909 Ga0075370_100289093 285
514 3300006353 Ga0075370_10078460 Ga0075370_100784603 285
515 3300006941 Ga0099825_1025031 Ga0099825_10250315 285
516 3300009174 Ga0105241_10140289 Ga0105241_101402893 285
517 3300009177 Ga0105248_10105152 Ga0105248_101051524 285
518 3300009551 Ga0105238_10135734 Ga0105238_101357342 285
519 3300009551 Ga0105238_10248919 Ga0105238_102489192 285
520 3300013296 Ga0157374_10178681 Ga0157374_101786813 285
521 3300013307 Ga0157372_10438817 Ga0157372_104388172 285
522 3300021320 Ga0214544_1000344 Ga0214544_10003443 285
523 3300021321 Ga0214542_1000018 Ga0214542_10000183 285
524 3300021324 Ga0214545_1000009 Ga0214545_1000009180 285
525 3300021327 Ga0214543_1029683 Ga0214543_10296833 285
526 3300021358 Ga0213873_10002957 Ga0213873_100029573 285
527 3300025254 Ga0209148_1000874 Ga0209148_100087416 285
528 3300025254 Ga0209148_1019429 Ga0209148_10194291 285
529 3300025261 Ga0209233_1008667 Ga0209233_10086673 285
530 3300025272 Ga0209455_1001536 Ga0209455_10015368 285
531 3300025295 Ga0209564_1005896 Ga0209564_10058966 285
532 3300025295 Ga0209564_1008405 Ga0209564_10084053 285
533 3300025297 Ga0209758_1000030 Ga0209758_100003024 285
534 3300025297 Ga0209758_1001470 Ga0209758_100147020 285
535 3300025297 Ga0209758_1003848 Ga0209758_100384811 285
536 3300025297 Ga0209758_1009747 Ga0209758_10097476 285
537 3300025297 Ga0209758_1029873 Ga0209758_10298733 285
538 3300025299 Ga0209256_1004427 Ga0209256_10044278 285
539 3300025302 Ga0207426_1001583 Ga0207426_10015833 285
540 3300025302 Ga0207426_1015711 Ga0207426_10157113 285
541 3300025304 Ga0209257_1003693 Ga0209257_10036934 285
542 3300025304 Ga0209257_1017069 Ga0209257_10170695 285
543 3300025904 Ga0207647_10002968 Ga0207647_100029684 285
544 3300025912 Ga0207707_10001534 Ga0207707_100015343 285
545 3300025912 Ga0207707_10112390 Ga0207707_101123903 285
546 3300025914 Ga0207671_10282120 Ga0207671_102821202 285
547 3300025917 Ga0207660_10033623 Ga0207660_100336235 285
548 3300025917 Ga0207660_10062043 Ga0207660_100620432 285
549 3300025924 Ga0207694_10136558 Ga0207694_101365582 285
550 3300025924 Ga0207694_10358360 Ga0207694_103583602 285
551 3300025936 Ga0207670_10302230 Ga0207670_103022302 285
552 3300025941 Ga0207711_10083906 Ga0207711_100839064 285
553 3300025944 Ga0207661_10025839 Ga0207661_100258396 285
554 3300025981 Ga0207640_10014499 Ga0207640_100144994 285
555 3300026035 Ga0207703_10306100 Ga0207703_103061002 285
556 3300026078 Ga0207702_10001426 Ga0207702_100014262 285
557 3300026116 Ga0207674_10035941 Ga0207674_100359415 285
558 3300027296 Ga0209389_1000163 Ga0209389_100016350 285
559 3300027361 Ga0209489_101100 Ga0209489_10110050 285
560 3300027363 Ga0209700_100014 Ga0209700_100014261 285
561 3300027866 Ga0209813_10032336 Ga0209813_100323362 285
562 3300028379 Ga0268266_10009421 Ga0268266_100094216 285
563 3300028380 Ga0268265_10061284 Ga0268265_100612844 285
564 3300028556 Ga0265337_1001432 Ga0265337_10014327 285
565 3300028558 Ga0265326_10000332 Ga0265326_1000033210 285
566 3300028563 Ga0265319_1001170 Ga0265319_100117012 285
567 3300028573 Ga0265334_10002363 Ga0265334_100023632 285
568 3300028577 Ga0265318_10003595 Ga0265318_100035953 285
569 3300028653 Ga0265323_10001572 Ga0265323_100015722 285
570 3300028666 Ga0265336_10000110 Ga0265336_1000011040 285
571 3300028800 Ga0265338_10000656 Ga0265338_1000065628 285
572 3300029957 Ga0265324_10000971 Ga0265324_100009713 285
573 3300031616 Ga0307508_10000154 Ga0307508_1000015461 285
574 3300031730 Ga0307516_10079257 Ga0307516_100792574 285
575 3300031995 Ga0307409_100543654 Ga0307409_1005436542 285
576 3300033180 Ga0307510_10147044 Ga0307510_101470443 285
577 3300035083 Ga0373926_0072632 Ga0373926_0072632_284_1162 285
578 3300035172 Ga0373955_0042706 Ga0373955_0042706_905_1783 285
579 3300035410 Ga0373924_0001609 Ga0373924_0001609_2732_3610 285
580 3300035692 Ga0373935_0039107 Ga0373935_0039107_374_1252 285
581 3300035695 Ga0373927_0008050 Ga0373927_0008050_6051_6920 285
582 3300035724 Ga0373933_0007993 Ga0373933_0007993_63_941 285
583 3300035725 Ga0373947_0024055 Ga0373947_0024055_2629_3498 285
584 3300035725 Ga0373947_0026448 Ga0373947_0026448_1106_1984 285
585 3300036401 Ga0373937_0135256 Ga0373937_0135256_63_941 285
586 3300037068 Ga0373925_0017296 Ga0373925_0017296_1979_2857 285
587 3300037068 Ga0373925_0024092 Ga0373925_0024092_2485_3363 285
588 3300037418 Ga0395900_0004851 Ga0395900_0004851_629_1522 285
589 3300037466 Ga0395898_0044947 Ga0395898_0044947_611_1504 285
590 3300037471 Ga0395905_0213458 Ga0395905_0213458_597_1490 285
591 3300037853 Ga0436364_1224016 Ga0436364_1224016_235_1104 285
592 3300038443 Ga0395901_0036503 Ga0395901_0036503_1026_1919 285
593 3300039437 Ga0436365_0491541 Ga0436365_0491541_1229_2104 285
594 3300039437 Ga0436365_0875735 Ga0436365_0875735_79_960 285
595 3300039437 Ga0436365_0989203 Ga0436365_0989203_2372_3241 285
596 3300039450 Ga0436363_1063318 Ga0436363_1063318_623_1501 285
597 3300039453 Ga0436362_1208454 Ga0436362_1208454_633_1508 285
598 3300041451 Ga0451791_1288432 Ga0451791_1288432_133_1014 285
599 3300044658 Ga0466972_0000234 Ga0466972_0000234_602_1510 285
600 3300044658 Ga0466972_0004129 Ga0466972_0004129_5308_6186 285
601 3300044694 Ga0466963_0014602 Ga0466963_0014602_1764_2645 285
602 3300044735 Ga0466968_0001995 Ga0466968_0001995_5351_6229 285
603 3300044842 Ga0466957_0073853 Ga0466957_0073853_330_1211 285
604 3300044901 Ga0466960_0010923 Ga0466960_0010923_920_1798 285
605 3300045976 Ga0466967_0037023 Ga0466967_0037023_1215_2096 285
606 3300045976 Ga0466967_0116898 Ga0466967_0116898_1391_2263 285
607 3300046455 Ga0495603_0102705 Ga0495603_0102705_256_1128 285
608 3300046459 Ga0495629_0088690 Ga0495629_0088690_552_1421 285
609 3300046460 Ga0495638_0004876 Ga0495638_0004876_7383_8261 285
610 3300046473 Ga0495582_0003777 Ga0495582_0003777_7046_7924 285
611 3300046475 Ga0495639_0036657 Ga0495639_0036657_740_1618 285
612 3300046477 Ga0495664_0049429 Ga0495664_0049429_1182_2060 285
613 3300046492 Ga0495585_0121616 Ga0495585_0121616_257_1138 285
614 3300046501 Ga0495607_0110869 Ga0495607_0110869_522_1400 285
615 3300046506 Ga0495583_0049204 Ga0495583_0049204_165_1043 285
616 3300046512 Ga0495610_0032809 Ga0495610_0032809_795_1673 285
617 3300046512 Ga0495610_0046207 Ga0495610_0046207_265_1143 285
618 3300046513 Ga0495616_0018412 Ga0495616_0018412_285_1163 285
619 3300046514 Ga0495618_0008828 Ga0495618_0008828_4628_5506 285
620 3300046515 Ga0495620_0036803 Ga0495620_0036803_1033_1911 285
621 3300046517 Ga0495630_0318631 Ga0495630_0318631_129_1007 285
622 3300046522 Ga0495643_0019789 Ga0495643_0019789_607_1485 285
623 3300046524 Ga0495648_0079676 Ga0495648_0079676_491_1369 285
624 3300046524 Ga0495648_0123557 Ga0495648_0123557_257_1135 285
625 3300046533 Ga0495640_0014432 Ga0495640_0014432_190_1068 285
626 3300046543 Ga0495645_0102497 Ga0495645_0102497_784_1662 285
627 3300046559 Ga0495667_0166789 Ga0495667_0166789_437_1315 285
628 3300046663 Ga0495635_0038449 Ga0495635_0038449_312_1190 285
629 3300046680 Ga0495646_0029121 Ga0495646_0029121_595_1473 285
630 3300046689 Ga0495613_0095971 Ga0495613_0095971_683_1561 285
631 3300047315 Ga0495581_0147504 Ga0495581_0147504_373_1251 285
632 3300047319 Ga0495674_0055960 Ga0495674_0055960_284_1162 285
633 3300047443 Ga0495687_057029 Ga0495687_057029_627_1505 285
634 3300047469 Ga0495673_0111641 Ga0495673_0111641_103_981 285
635 3300048091 Ga0495626_0132943 Ga0495626_0132943_111_989 285
636 3300048903 Ga0496100_0305751 Ga0496100_0305751_93_971 285
637 3300048904 Ga0496101_0137936 Ga0496101_0137936_837_1715 285
638 3300048905 Ga0496102_0005110 Ga0496102_0005110_9287_10165 285
639 3300048905 Ga0496102_0179545 Ga0496102_0179545_424_1302 285
640 3300048906 Ga0496103_0017732 Ga0496103_0017732_608_1486 285
641 3300048908 Ga0496105_0150277 Ga0496105_0150277_298_1176 285
642 3300048909 Ga0496106_0236296 Ga0496106_0236296_300_1166 285
643 3300048912 Ga0496109_0093609 Ga0496109_0093609_705_1583 285
644 3300048912 Ga0496109_0111042 Ga0496109_0111042_1351_2229 285
645 3300048913 Ga0496110_0187701 Ga0496110_0187701_33_911 285
646 3300048915 Ga0496112_0033395 Ga0496112_0033395_3623_4501 285
647 3300048916 Ga0496113_0036524 Ga0496113_0036524_187_1065 285
648 3300048917 Ga0496114_0472319 Ga0496114_0472319_81_947 285
649 3300048920 Ga0496117_0055758 Ga0496117_0055758_1086_1964 285
650 3300048921 Ga0496118_0091827 Ga0496118_0091827_608_1486 285
651 3300048921 Ga0496118_0117077 Ga0496118_0117077_254_1132 285
652 3300048922 Ga0496119_0014732 Ga0496119_0014732_2369_3247 285
653 3300048924 Ga0496121_0044057 Ga0496121_0044057_2169_3038 285
654 3300048924 Ga0496121_0099645 Ga0496121_0099645_496_1374 285
655 3300048927 Ga0496124_0083961 Ga0496124_0083961_1497_2366 285
656 3300048928 Ga0496125_0092356 Ga0496125_0092356_1235_2104 285
657 3300050490 nmdc:mga03n38_98428_c1 nmdc:mga03n38_98428_c1_18_1019 285
658 3300050491 nmdc:mga00v17_28318_c1 nmdc:mga00v17_28318_c1_228_1106 285
659 3300050492 nmdc:mga0yw44_100542_c1 nmdc:mga0yw44_100542_c1_519_1397 285
660 3300050492 nmdc:mga0yw44_125062_c1 nmdc:mga0yw44_125062_c1_184_1062 285
661 3300050492 nmdc:mga0yw44_148721_c1 nmdc:mga0yw44_148721_c1_206_1087 285
662 3300050493 nmdc:mga0k408_216820_c1 nmdc:mga0k408_216820_c1_40_918 285
663 3300050494 nmdc:mga06z11_80473_c1 nmdc:mga06z11_80473_c1_319_1188 285
664 3300050495 nmdc:mga04h51_2928_c1 nmdc:mga04h51_2928_c1_1474_2352 285
665 3300050496 nmdc:mga07m45_29605_c1 nmdc:mga07m45_29605_c1_2107_2985 285
666 3300050516 nmdc:mga0sz30_97013_c1 nmdc:mga0sz30_97013_c1_207_1085 285
667 3300053080 Ga0500635_0009691 Ga0500635_0009691_1386_2264 285
668 3300053087 Ga0500643_000160 Ga0500643_000160_640_1518 285
669 3300053094 Ga0500566_0001345 Ga0500566_0001345_956_1834 285
670 3300053103 Ga0500555_008584 Ga0500555_008584_1302_2180 285
671 3300053104 Ga0500556_0011202 Ga0500556_0011202_1137_2015 285
672 3300053105 Ga0500557_000128 Ga0500557_000128_605_1486 285
673 3300053109 Ga0500569_019786 Ga0500569_019786_71_949 285
674 3300053111 Ga0500572_049175 Ga0500572_049175_353_1231 285
675 3300053121 Ga0500607_080828 Ga0500607_080828_512_1390 285
676 3300053121 Ga0500607_168205 Ga0500607_168205_18_896 285
677 3300053122 Ga0500608_007064 Ga0500608_007064_3045_3923 285
678 3300053125 Ga0500618_030412 Ga0500618_030412_335_1213 285
679 3300053126 Ga0500621_083220 Ga0500621_083220_245_1123 285
680 3300053130 Ga0500642_0000477 Ga0500642_0000477_613_1494 285
681 3300053136 Ga0500559_0096576 Ga0500559_0096576_269_1147 285
682 3300053138 Ga0500564_050860 Ga0500564_050860_580_1458 285
683 3300053142 Ga0500577_0062271 Ga0500577_0062271_127_1005 285
684 3300053145 Ga0500586_000521 Ga0500586_000521_2936_3814 285
685 3300053148 Ga0500590_082543 Ga0500590_082543_573_1451 285
686 3300053153 Ga0500616_0012689 Ga0500616_0012689_2560_3438 285
687 3300053154 Ga0500619_002320 Ga0500619_002320_646_1524 285
688 3300053155 Ga0500620_000583 Ga0500620_000583_4143_5021 285
689 3300053158 Ga0500627_0015386 Ga0500627_0015386_833_1711 285
690 3300053162 Ga0500638_012640 Ga0500638_012640_2199_3077 285
691 3300053177 Ga0500636_0001993 Ga0500636_0001993_633_1511 285
692 3300053736 Ga0500599_001767 Ga0500599_001767_684_1562 285
693 3300053737 Ga0500601_000795 Ga0500601_000795_2231_3109 285
694 3300053738 Ga0500613_007657 Ga0500613_007657_70_948 285
695 3300000532 CNAas_1002274 CNAas_10022742 286
696 3300003203 JGI25406J46586_10012297 JGI25406J46586_100122972 286
697 3300003215 JGI25153J46596_10007332 JGI25153J46596_100073326 286
698 3300003659 JGI25404J52841_10003547 JGI25404J52841_100035475 286
699 3300003659 JGI25404J52841_10030856 JGI25404J52841_100308561 286
700 3300003752 Ga0055539_1004325 Ga0055539_10043252 286
701 3300003911 JGI25405J52794_10004824 JGI25405J52794_100048242 286
702 3300004625 Ga0055543_1007285 Ga0055543_10072854 286
703 3300005327 Ga0070658_10059476 Ga0070658_100594763 286
704 3300005327 Ga0070658_10332214 Ga0070658_103322141 286
705 3300005329 Ga0070683_100025426 Ga0070683_1000254267 286
706 3300005329 Ga0070683_100171658 Ga0070683_1001716583 286
707 3300005334 Ga0068869_100168334 Ga0068869_1001683342 286
708 3300005336 Ga0070680_100234704 Ga0070680_1002347041 286
709 3300005338 Ga0068868_100004833 Ga0068868_1000048332 286
710 3300005338 Ga0068868_100137371 Ga0068868_1001373713 286
711 3300005344 Ga0070661_100065479 Ga0070661_1000654794 286
712 3300005347 Ga0070668_100008596 Ga0070668_1000085967 286
713 3300005347 Ga0070668_100133324 Ga0070668_1001333242 286
714 3300005353 Ga0070669_100278027 Ga0070669_1002780272 286
715 3300005353 Ga0070669_100282872 Ga0070669_1002828722 286
716 3300005356 Ga0070674_100203677 Ga0070674_1002036772 286
717 3300005364 Ga0070673_100164033 Ga0070673_1001640332 286
718 3300005434 Ga0070709_10038498 Ga0070709_100384983 286
719 3300005435 Ga0070714_100133016 Ga0070714_1001330162 286
720 3300005437 Ga0070710_10019413 Ga0070710_100194134 286
721 3300005439 Ga0070711_100024686 Ga0070711_1000246862 286
722 3300005440 Ga0070705_100298350 Ga0070705_1002983502 286
723 3300005455 Ga0070663_100011356 Ga0070663_1000113566 286
724 3300005455 Ga0070663_100137664 Ga0070663_1001376642 286
725 3300005455 Ga0070663_100277020 Ga0070663_1002770202 286
726 3300005456 Ga0070678_100046211 Ga0070678_1000462113 286
727 3300005456 Ga0070678_100084635 Ga0070678_1000846352 286
728 3300005456 Ga0070678_100165171 Ga0070678_1001651712 286
729 3300005456 Ga0070678_100340499 Ga0070678_1003404992 286
730 3300005457 Ga0070662_100033435 Ga0070662_1000334352 286
731 3300005457 Ga0070662_100149362 Ga0070662_1001493623 286
732 3300005459 Ga0068867_100093754 Ga0068867_1000937543 286
733 3300005467 Ga0070706_100235748 Ga0070706_1002357482 286
734 3300005468 Ga0070707_100573453 Ga0070707_1005734532 286
735 3300005471 Ga0070698_100194297 Ga0070698_1001942973 286
736 3300005471 Ga0070698_100217995 Ga0070698_1002179952 286
737 3300005530 Ga0070679_100032725 Ga0070679_1000327253 286
738 3300005535 Ga0070684_100047929 Ga0070684_1000479294 286
739 3300005539 Ga0068853_100226396 Ga0068853_1002263963 286
740 3300005548 Ga0070665_100010827 Ga0070665_1000108273 286
741 3300005548 Ga0070665_100044008 Ga0070665_1000440083 286
742 3300005548 Ga0070665_100129065 Ga0070665_1001290654 286
743 3300005548 Ga0070665_100196283 Ga0070665_1001962832 286
744 3300005548 Ga0070665_100231793 Ga0070665_1002317932 286
745 3300005563 Ga0068855_100027913 Ga0068855_1000279135 286
746 3300005564 Ga0070664_100422125 Ga0070664_1004221252 286
747 3300005614 Ga0068856_100034134 Ga0068856_1000341345 286
748 3300005614 Ga0068856_100401795 Ga0068856_1004017951 286
749 3300005615 Ga0070702_100048678 Ga0070702_1000486782 286
750 3300005615 Ga0070702_100078193 Ga0070702_1000781933 286
751 3300005616 Ga0068852_100018340 Ga0068852_1000183404 286
752 3300005616 Ga0068852_100080688 Ga0068852_1000806886 286
753 3300005616 Ga0068852_100102155 Ga0068852_1001021554 286
754 3300005616 Ga0068852_100131914 Ga0068852_1001319142 286
755 3300005618 Ga0068864_100081294 Ga0068864_1000812944 286
756 3300005618 Ga0068864_100428372 Ga0068864_1004283722 286
757 3300005719 Ga0068861_100096646 Ga0068861_1000966462 286
758 3300005719 Ga0068861_100399308 Ga0068861_1003993082 286
759 3300005834 Ga0068851_10316409 Ga0068851_103164091 286
760 3300005841 Ga0068863_100301463 Ga0068863_1003014632 286
761 3300005842 Ga0068858_100061588 Ga0068858_1000615883 286
762 3300005843 Ga0068860_100052959 Ga0068860_1000529592 286
763 3300005844 Ga0068862_100116219 Ga0068862_1001162192 286
764 3300005844 Ga0068862_100191689 Ga0068862_1001916893 286
765 3300005844 Ga0068862_100344762 Ga0068862_1003447622 286
766 3300005937 Ga0081455_10003093 Ga0081455_100030933 286
767 3300005937 Ga0081455_10004895 Ga0081455_100048954 286
768 3300005937 Ga0081455_10013996 Ga0081455_100139965 286
769 3300005937 Ga0081455_10023586 Ga0081455_100235863 286
770 3300005937 Ga0081455_10128720 Ga0081455_101287203 286
771 3300005981 Ga0081538_10010846 Ga0081538_100108464 286
772 3300005983 Ga0081540_1004561 Ga0081540_10045613 286
773 3300005983 Ga0081540_1004770 Ga0081540_10047704 286
774 3300005983 Ga0081540_1008466 Ga0081540_10084664 286
775 3300005983 Ga0081540_1009460 Ga0081540_10094604 286
776 3300005983 Ga0081540_1022569 Ga0081540_10225694 286
777 3300005985 Ga0081539_10005931 Ga0081539_100059319 286
778 3300006028 Ga0070717_10000634 Ga0070717_100006343 286
779 3300006038 Ga0075365_10071356 Ga0075365_100713562 286
780 3300006038 Ga0075365_10093381 Ga0075365_100933813 286
781 3300006038 Ga0075365_10140298 Ga0075365_101402983 286
782 3300006048 Ga0075363_100026229 Ga0075363_1000262293 286
783 3300006051 Ga0075364_10033825 Ga0075364_100338252 286
784 3300006175 Ga0070712_100003691 Ga0070712_1000036917 286
785 3300006177 Ga0075362_10017479 Ga0075362_100174794 286
786 3300006178 Ga0075367_10006523 Ga0075367_100065236 286
787 3300006178 Ga0075367_10023304 Ga0075367_100233044 286
788 3300006178 Ga0075367_10025881 Ga0075367_100258815 286
789 3300006178 Ga0075367_10075065 Ga0075367_100750652 286
790 3300006186 Ga0075369_10008323 Ga0075369_100083232 286
791 3300006186 Ga0075369_10010496 Ga0075369_100104962 286
792 3300006195 Ga0075366_10018739 Ga0075366_100187392 286
793 3300006237 Ga0097621_100046159 Ga0097621_1000461593 286
794 3300006237 Ga0097621_100316364 Ga0097621_1003163642 286
795 3300006353 Ga0075370_10025125 Ga0075370_100251253 286
796 3300006353 Ga0075370_10054918 Ga0075370_100549184 286
797 3300006358 Ga0068871_100047551 Ga0068871_1000475513 286
798 3300006358 Ga0068871_100063442 Ga0068871_1000634422 286
799 3300006844 Ga0075428_100014565 Ga0075428_1000145653 286
800 3300006844 Ga0075428_100066428 Ga0075428_1000664286 286
801 3300006871 Ga0075434_100051150 Ga0075434_1000511504 286
802 3300006881 Ga0068865_100101164 Ga0068865_1001011642 286
803 3300006881 Ga0068865_100629660 Ga0068865_1006296601 286
804 3300007265 Ga0099794_10046869 Ga0099794_100468692 286
805 3300009093 Ga0105240_10077665 Ga0105240_100776653 286
806 3300009093 Ga0105240_10077881 Ga0105240_100778812 286
807 3300009094 Ga0111539_10165036 Ga0111539_101650362 286
808 3300009098 Ga0105245_10066139 Ga0105245_100661394 286
809 3300009101 Ga0105247_10071486 Ga0105247_100714863 286
810 3300009101 Ga0105247_10283650 Ga0105247_102836502 286
811 3300009148 Ga0105243_10256643 Ga0105243_102566433 286
812 3300009174 Ga0105241_10052371 Ga0105241_100523712 286
813 3300009177 Ga0105248_10159915 Ga0105248_101599153 286
814 3300009545 Ga0105237_10300641 Ga0105237_103006412 286
815 3300009545 Ga0105237_10583682 Ga0105237_105836822 286
816 3300009551 Ga0105238_10060989 Ga0105238_100609893 286
817 3300009553 Ga0105249_10232433 Ga0105249_102324331 286
818 3300009553 Ga0105249_10405433 Ga0105249_104054332 286
819 3300010375 Ga0105239_10121409 Ga0105239_101214093 286
820 3300010375 Ga0105239_10212863 Ga0105239_102128633 286
821 3300011119 Ga0105246_10040750 Ga0105246_100407504 286
822 3300011119 Ga0105246_10212223 Ga0105246_102122232 286
823 3300013297 Ga0157378_10041263 Ga0157378_100412633 286
824 3300013306 Ga0163162_10164627 Ga0163162_101646272 286
825 3300013308 Ga0157375_10132487 Ga0157375_101324874 286
826 3300013308 Ga0157375_10217214 Ga0157375_102172142 286
827 3300014325 Ga0163163_10062089 Ga0163163_100620895 286
828 3300014325 Ga0163163_10541602 Ga0163163_105416022 286
829 3300014326 Ga0157380_10189904 Ga0157380_101899042 286
830 3300014326 Ga0157380_10216361 Ga0157380_102163612 286
831 3300014326 Ga0157380_10282395 Ga0157380_102823951 286
832 3300014745 Ga0157377_10106272 Ga0157377_101062722 286
833 3300014968 Ga0157379_10166180 Ga0157379_101661803 286
834 3300014968 Ga0157379_10412878 Ga0157379_104128782 286
835 3300014969 Ga0157376_10054563 Ga0157376_100545632 286
836 3300017792 Ga0163161_10010762 Ga0163161_100107625 286
837 3300017792 Ga0163161_10117687 Ga0163161_101176873 286
838 3300017792 Ga0163161_10251849 Ga0163161_102518492 286
839 3300025230 Ga0209563_100670 Ga0209563_10067010 286
840 3300025253 Ga0209677_102054 Ga0209677_1020547 286
841 3300025272 Ga0209455_1003873 Ga0209455_10038734 286
842 3300025295 Ga0209564_1019898 Ga0209564_10198982 286
843 3300025297 Ga0209758_1007103 Ga0209758_10071033 286
844 3300025297 Ga0209758_1022815 Ga0209758_10228152 286
845 3300025302 Ga0207426_1000704 Ga0207426_10007046 286
846 3300025302 Ga0207426_1001257 Ga0207426_10012574 286
847 3300025315 Ga0207697_10057876 Ga0207697_100578763 286
848 3300025899 Ga0207642_10241294 Ga0207642_102412941 286
849 3300025900 Ga0207710_10029790 Ga0207710_100297903 286
850 3300025900 Ga0207710_10108985 Ga0207710_101089852 286
851 3300025901 Ga0207688_10021647 Ga0207688_100216475 286
852 3300025901 Ga0207688_10052180 Ga0207688_100521802 286
853 3300025905 Ga0207685_10167318 Ga0207685_101673182 286
854 3300025907 Ga0207645_10048193 Ga0207645_100481933 286
855 3300025908 Ga0207643_10065231 Ga0207643_100652314 286
856 3300025910 Ga0207684_10109894 Ga0207684_101098943 286
857 3300025911 Ga0207654_10083473 Ga0207654_100834733 286
858 3300025913 Ga0207695_10043787 Ga0207695_100437875 286
859 3300025913 Ga0207695_10119977 Ga0207695_101199775 286
860 3300025914 Ga0207671_10050733 Ga0207671_100507333 286
861 3300025915 Ga0207693_10002446 Ga0207693_1000244610 286
862 3300025915 Ga0207693_10041552 Ga0207693_100415524 286
863 3300025915 Ga0207693_10367490 Ga0207693_103674902 286
864 3300025918 Ga0207662_10093909 Ga0207662_100939093 286
865 3300025919 Ga0207657_10074222 Ga0207657_100742224 286
866 3300025919 Ga0207657_10338561 Ga0207657_103385612 286
867 3300025921 Ga0207652_10165259 Ga0207652_101652592 286
868 3300025923 Ga0207681_10052125 Ga0207681_100521252 286
869 3300025923 Ga0207681_10126894 Ga0207681_101268942 286
870 3300025924 Ga0207694_10181955 Ga0207694_101819553 286
871 3300025926 Ga0207659_10137814 Ga0207659_101378142 286
872 3300025926 Ga0207659_10317099 Ga0207659_103170992 286
873 3300025927 Ga0207687_10020017 Ga0207687_100200174 286
874 3300025928 Ga0207700_10008650 Ga0207700_100086506 286
875 3300025928 Ga0207700_10010201 Ga0207700_100102015 286
876 3300025929 Ga0207664_10064538 Ga0207664_100645384 286
877 3300025929 Ga0207664_10502350 Ga0207664_105023502 286
878 3300025932 Ga0207690_10350826 Ga0207690_103508261 286
879 3300025933 Ga0207706_10093938 Ga0207706_100939383 286
880 3300025933 Ga0207706_10180429 Ga0207706_101804292 286
881 3300025935 Ga0207709_10341043 Ga0207709_103410432 286
882 3300025937 Ga0207669_10066960 Ga0207669_100669602 286
883 3300025937 Ga0207669_10085987 Ga0207669_100859872 286
884 3300025937 Ga0207669_10105585 Ga0207669_101055853 286
885 3300025937 Ga0207669_10243921 Ga0207669_102439212 286
886 3300025937 Ga0207669_10331737 Ga0207669_103317371 286
887 3300025939 Ga0207665_10117196 Ga0207665_101171962 286
888 3300025940 Ga0207691_10087971 Ga0207691_100879713 286
889 3300025940 Ga0207691_10168672 Ga0207691_101686722 286
890 3300025944 Ga0207661_10005119 Ga0207661_100051194 286
891 3300025944 Ga0207661_10093733 Ga0207661_100937333 286
892 3300025945 Ga0207679_10123574 Ga0207679_101235743 286
893 3300025945 Ga0207679_10155774 Ga0207679_101557743 286
894 3300025945 Ga0207679_10173442 Ga0207679_101734422 286
895 3300025945 Ga0207679_10242374 Ga0207679_102423742 286
896 3300025949 Ga0207667_10015856 Ga0207667_100158565 286
897 3300025960 Ga0207651_10074123 Ga0207651_100741232 286
898 3300025960 Ga0207651_10120039 Ga0207651_101200392 286
899 3300025961 Ga0207712_10077095 Ga0207712_100770953 286
900 3300025961 Ga0207712_10220246 Ga0207712_102202463 286
901 3300025961 Ga0207712_10403418 Ga0207712_104034182 286
902 3300025972 Ga0207668_10005343 Ga0207668_100053437 286
903 3300025972 Ga0207668_10045426 Ga0207668_100454264 286
904 3300025972 Ga0207668_10135544 Ga0207668_101355442 286
905 3300025972 Ga0207668_10251519 Ga0207668_102515192 286
906 3300025972 Ga0207668_10310671 Ga0207668_103106712 286
907 3300025986 Ga0207658_10086653 Ga0207658_100866534 286
908 3300025986 Ga0207658_10199553 Ga0207658_101995533 286
909 3300026023 Ga0207677_10038533 Ga0207677_100385334 286
910 3300026023 Ga0207677_10108262 Ga0207677_101082623 286
911 3300026035 Ga0207703_10043372 Ga0207703_100433725 286
912 3300026041 Ga0207639_10159766 Ga0207639_101597662 286
913 3300026041 Ga0207639_10253862 Ga0207639_102538623 286
914 3300026041 Ga0207639_10264477 Ga0207639_102644772 286
915 3300026067 Ga0207678_10034872 Ga0207678_100348725 286
916 3300026067 Ga0207678_10073842 Ga0207678_100738423 286
917 3300026067 Ga0207678_10076141 Ga0207678_100761414 286
918 3300026067 Ga0207678_10084233 Ga0207678_100842334 286
919 3300026089 Ga0207648_10068241 Ga0207648_100682413 286
920 3300026089 Ga0207648_10130139 Ga0207648_101301392 286
921 3300026095 Ga0207676_10473747 Ga0207676_104737472 286
922 3300026118 Ga0207675_100166532 Ga0207675_1001665322 286
923 3300026118 Ga0207675_100243853 Ga0207675_1002438533 286
924 3300026121 Ga0207683_10063276 Ga0207683_100632763 286
925 3300026121 Ga0207683_10360390 Ga0207683_103603902 286
926 3300026121 Ga0207683_10387952 Ga0207683_103879522 286
927 3300026142 Ga0207698_10063162 Ga0207698_100631624 286
928 3300026142 Ga0207698_10101537 Ga0207698_101015373 286
929 3300026142 Ga0207698_10219781 Ga0207698_102197813 286
930 3300026142 Ga0207698_10507404 Ga0207698_105074042 286
931 3300028379 Ga0268266_10004510 Ga0268266_1000451013 286
932 3300028379 Ga0268266_10009167 Ga0268266_100091674 286
933 3300028379 Ga0268266_10080191 Ga0268266_100801914 286
934 3300028379 Ga0268266_10095681 Ga0268266_100956813 286
935 3300028380 Ga0268265_10473717 Ga0268265_104737172 286
936 3300028381 Ga0268264_10189404 Ga0268264_101894042 286
937 3300028381 Ga0268264_10352260 Ga0268264_103522602 286
938 3300028381 Ga0268264_10415473 Ga0268264_104154732 286
939 3300028381 Ga0268264_10459690 Ga0268264_104596902 286
940 3300028786 Ga0307517_10001121 Ga0307517_100011213 286
941 3300028794 Ga0307515_10060735 Ga0307515_100607353 286
942 3300028794 Ga0307515_10293805 Ga0307515_102938052 286
943 3300031238 Ga0265332_10015679 Ga0265332_100156793 286
944 3300031238 Ga0265332_10067378 Ga0265332_100673782 286
945 3300031247 Ga0265340_10008593 Ga0265340_100085933 286
946 3300031250 Ga0265331_10074003 Ga0265331_100740032 286
947 3300031456 Ga0307513_10246800 Ga0307513_102468003 286
948 3300031616 Ga0307508_10003339 Ga0307508_100033398 286
949 3300031616 Ga0307508_10052138 Ga0307508_100521385 286
950 3300031616 Ga0307508_10378227 Ga0307508_103782271 286
951 3300031852 Ga0307410_10139011 Ga0307410_101390111 286
952 3300031901 Ga0307406_10063979 Ga0307406_100639793 286
953 3300031911 Ga0307412_10153785 Ga0307412_101537853 286
954 3300031911 Ga0307412_10305069 Ga0307412_103050692 286
955 3300031995 Ga0307409_100171799 Ga0307409_1001717992 286
956 3300031995 Ga0307409_100454496 Ga0307409_1004544962 286
957 3300032002 Ga0307416_100074472 Ga0307416_1000744725 286
958 3300032002 Ga0307416_100179965 Ga0307416_1001799654 286
959 3300032004 Ga0307414_10124646 Ga0307414_101246462 286
960 3300032126 Ga0307415_100136752 Ga0307415_1001367523 286
961 3300033180 Ga0307510_10035129 Ga0307510_100351296 286
962 3300035086 Ga0373934_0003984 Ga0373934_0003984_2597_3478 286
963 3300035086 Ga0373934_0040090 Ga0373934_0040090_194_1075 286
964 3300035113 Ga0373936_0143405 Ga0373936_0143405_150_1022 286
965 3300035117 Ga0373953_0003130 Ga0373953_0003130_1628_2509 286
966 3300035118 Ga0373954_0011341 Ga0373954_0011341_1983_2864 286
967 3300035119 Ga0373956_0001760 Ga0373956_0001760_1421_2302 286
968 3300035120 Ga0373957_0017164 Ga0373957_0017164_806_1687 286
969 3300035171 Ga0373946_0036579 Ga0373946_0036579_1047_1928 286
970 3300035172 Ga0373955_0022100 Ga0373955_0022100_1456_2337 286
971 3300035172 Ga0373955_0024324 Ga0373955_0024324_2204_3085 286
972 3300035410 Ga0373924_0006304 Ga0373924_0006304_2007_2888 286
973 3300035692 Ga0373935_0027489 Ga0373935_0027489_945_1826 286
974 3300035695 Ga0373927_0003207 Ga0373927_0003207_2568_3449 286
975 3300035724 Ga0373933_0036431 Ga0373933_0036431_779_1660 286
976 3300035725 Ga0373947_0006026 Ga0373947_0006026_953_1834 286
977 3300036401 Ga0373937_0135591 Ga0373937_0135591_945_1826 286
978 3300037068 Ga0373925_0088330 Ga0373925_0088330_525_1406 286
979 3300037466 Ga0395898_0184417 Ga0395898_0184417_316_1197 286
980 3300037471 Ga0395905_0003426 Ga0395905_0003426_15461_16372 286
981 3300038443 Ga0395901_0243494 Ga0395901_0243494_24_896 286
982 3300039437 Ga0436365_0420080 Ga0436365_0420080_156_1028 286
983 3300039438 Ga0436360_0811287 Ga0436360_0811287_174_1055 286
984 3300039447 Ga0436361_0752651 Ga0436361_0752651_433_1314 286
985 3300039447 Ga0436361_1023822 Ga0436361_1023822_662_1543 286
986 3300039453 Ga0436362_0326507 Ga0436362_0326507_1692_2573 286
987 3300046452 Ga0495617_015362 Ga0495617_015362_1170_2042 286
988 3300046454 Ga0495592_0002294 Ga0495592_0002294_11279_12160 286
989 3300046454 Ga0495592_0012750 Ga0495592_0012750_4649_5530 286
990 3300046455 Ga0495603_0000182 Ga0495603_0000182_30602_31483 286
991 3300046455 Ga0495603_0050821 Ga0495603_0050821_1466_2338 286
992 3300046459 Ga0495629_0000314 Ga0495629_0000314_24351_25232 286
993 3300046459 Ga0495629_0000529 Ga0495629_0000529_805_1686 286
994 3300046460 Ga0495638_0037355 Ga0495638_0037355_853_1725 286
995 3300046461 Ga0495641_0001508 Ga0495641_0001508_958_1839 286
996 3300046461 Ga0495641_0028046 Ga0495641_0028046_125_997 286
997 3300046462 Ga0495651_0068966 Ga0495651_0068966_807_1688 286
998 3300046463 Ga0495653_0085999 Ga0495653_0085999_476_1357 286
999 3300046472 Ga0495580_0002541 Ga0495580_0002541_4893_5774 286
1000 3300046473 Ga0495582_0036076 Ga0495582_0036076_99_980 286
1001 3300046474 Ga0495605_0057559 Ga0495605_0057559_687_1559 286
1002 3300046475 Ga0495639_0006669 Ga0495639_0006669_952_1833 286
1003 3300046476 Ga0495662_0001470 Ga0495662_0001470_10053_10934 286
1004 3300046477 Ga0495664_0009660 Ga0495664_0009660_2316_3200 286
1005 3300046492 Ga0495585_0042555 Ga0495585_0042555_994_1866 286
1006 3300046492 Ga0495585_0103848 Ga0495585_0103848_230_1102 286
1007 3300046499 Ga0495594_0000302 Ga0495594_0000302_1028_1909 286
1008 3300046499 Ga0495594_0150379 Ga0495594_0150379_333_1214 286
1009 3300046500 Ga0495596_0048678 Ga0495596_0048678_97_978 286
1010 3300046507 Ga0495606_0101227 Ga0495606_0101227_202_1083 286
1011 3300046507 Ga0495606_0116865 Ga0495606_0116865_508_1380 286
1012 3300046511 Ga0495608_0022254 Ga0495608_0022254_1273_2154 286
1013 3300046512 Ga0495610_0057061 Ga0495610_0057061_594_1466 286
1014 3300046513 Ga0495616_0033846 Ga0495616_0033846_1621_2502 286
1015 3300046515 Ga0495620_0021818 Ga0495620_0021818_1700_2581 286
1016 3300046516 Ga0495628_0003600 Ga0495628_0003600_12204_13085 286
1017 3300046516 Ga0495628_0014010 Ga0495628_0014010_3678_4559 286
1018 3300046517 Ga0495630_0002415 Ga0495630_0002415_8029_8910 286
1019 3300046518 Ga0495631_0029165 Ga0495631_0029165_1055_1927 286
1020 3300046519 Ga0495632_0030152 Ga0495632_0030152_640_1512 286
1021 3300046523 Ga0495644_0030462 Ga0495644_0030462_851_1723 286
1022 3300046529 Ga0495652_0024151 Ga0495652_0024151_3719_4600 286
1023 3300046529 Ga0495652_0050577 Ga0495652_0050577_2560_3441 286
1024 3300046529 Ga0495652_0358591 Ga0495652_0358591_103_984 286
1025 3300046530 Ga0495654_0023326 Ga0495654_0023326_2175_3056 286
1026 3300046531 Ga0495665_0000619 Ga0495665_0000619_16336_17217 286
1027 3300046533 Ga0495640_0000308 Ga0495640_0000308_24545_25426 286
1028 3300046533 Ga0495640_0044770 Ga0495640_0044770_807_1688 286
1029 3300046542 Ga0495597_0065137 Ga0495597_0065137_649_1521 286
1030 3300046543 Ga0495645_0011116 Ga0495645_0011116_86_970 286
1031 3300046543 Ga0495645_0063315 Ga0495645_0063315_830_1711 286
1032 3300046557 Ga0495622_0002921 Ga0495622_0002921_970_1851 286
1033 3300046557 Ga0495622_0031501 Ga0495622_0031501_1204_2085 286
1034 3300046557 Ga0495622_0054035 Ga0495622_0054035_698_1570 286
1035 3300046559 Ga0495667_0004819 Ga0495667_0004819_3904_4785 286
1036 3300046559 Ga0495667_0077408 Ga0495667_0077408_476_1357 286
1037 3300046616 Ga0495668_0023015 Ga0495668_0023015_1970_2842 286
1038 3300046616 Ga0495668_0026224 Ga0495668_0026224_1886_2767 286
1039 3300046616 Ga0495668_0164858 Ga0495668_0164858_96_968 286
1040 3300046642 Ga0495634_0001483 Ga0495634_0001483_18941_19822 286
1041 3300046642 Ga0495634_0083778 Ga0495634_0083778_1155_2036 286
1042 3300046663 Ga0495635_0000429 Ga0495635_0000429_1315_2196 286
1043 3300046665 Ga0495661_0023684 Ga0495661_0023684_803_1684 286
1044 3300046674 Ga0495588_0003361 Ga0495588_0003361_970_1851 286
1045 3300046674 Ga0495588_0194935 Ga0495588_0194935_55_927 286
1046 3300046675 Ga0495657_0026788 Ga0495657_0026788_807_1688 286
1047 3300046678 Ga0495599_0005767 Ga0495599_0005767_4515_5399 286
1048 3300046678 Ga0495599_0025597 Ga0495599_0025597_2338_3219 286
1049 3300046679 Ga0495623_0022432 Ga0495623_0022432_2391_3272 286
1050 3300046680 Ga0495646_0100369 Ga0495646_0100369_420_1301 286
1051 3300046681 Ga0495647_0026282 Ga0495647_0026282_226_1107 286
1052 3300046683 Ga0495658_0000936 Ga0495658_0000936_910_1791 286
1053 3300046684 Ga0495669_0039321 Ga0495669_0039321_679_1551 286
1054 3300046684 Ga0495669_0046821 Ga0495669_0046821_265_1137 286
1055 3300046689 Ga0495613_0006256 Ga0495613_0006256_769_1650 286
1056 3300046690 Ga0495624_0000810 Ga0495624_0000810_950_1831 286
1057 3300046691 Ga0495670_0030273 Ga0495670_0030273_1533_2414 286
1058 3300046691 Ga0495670_0082982 Ga0495670_0082982_215_1087 286
1059 3300046691 Ga0495670_0141755 Ga0495670_0141755_164_1036 286
1060 3300046692 Ga0495671_0064047 Ga0495671_0064047_849_1721 286
1061 3300046694 Ga0495649_0089456 Ga0495649_0089456_498_1379 286
1062 3300046694 Ga0495649_0102231 Ga0495649_0102231_360_1232 286
1063 3300046809 Ga0495600_0053775 Ga0495600_0053775_476_1357 286
1064 3300047315 Ga0495581_0000683 Ga0495581_0000683_970_1851 286
1065 3300047315 Ga0495581_0162878 Ga0495581_0162878_251_1132 286
1066 3300047318 Ga0495636_0111990 Ga0495636_0111990_13_885 286
1067 3300047319 Ga0495674_0012056 Ga0495674_0012056_6317_7198 286
1068 3300047319 Ga0495674_0033712 Ga0495674_0033712_2874_3755 286
1069 3300047319 Ga0495674_0146672 Ga0495674_0146672_577_1449 286
1070 3300047320 Ga0495672_0109264 Ga0495672_0109264_341_1225 286
1071 3300047320 Ga0495672_0121063 Ga0495672_0121063_105_986 286
1072 3300047320 Ga0495672_0151379 Ga0495672_0151379_218_1090 286
1073 3300047321 Ga0495676_0005624 Ga0495676_0005624_556_1437 286
1074 3300047321 Ga0495676_0180423 Ga0495676_0180423_416_1297 286
1075 3300047322 Ga0495680_0014721 Ga0495680_0014721_4975_5856 286
1076 3300047323 Ga0495683_0121561 Ga0495683_0121561_317_1189 286
1077 3300047444 Ga0495675_0037224 Ga0495675_0037224_1273_2154 286
1078 3300047445 Ga0495677_0025193 Ga0495677_0025193_383_1255 286
1079 3300047469 Ga0495673_0013795 Ga0495673_0013795_1777_2658 286
1080 3300047469 Ga0495673_0021484 Ga0495673_0021484_278_1150 286
1081 3300047471 Ga0495684_0000497 Ga0495684_0000497_30287_31168 286
1082 3300047472 Ga0495686_0148098 Ga0495686_0148098_166_1050 286
1083 3300047673 Ga0495593_0000370 Ga0495593_0000370_830_1711 286
1084 3300047673 Ga0495593_0001303 Ga0495593_0001303_926_1807 286
1085 3300047673 Ga0495593_0087448 Ga0495593_0087448_301_1182 286
1086 3300047673 Ga0495593_0127035 Ga0495593_0127035_402_1268 286
1087 3300048089 Ga0495614_0039902 Ga0495614_0039902_357_1238 286
1088 3300048903 Ga0496100_0074805 Ga0496100_0074805_932_1813 286
1089 3300048903 Ga0496100_0257320 Ga0496100_0257320_256_1122 286
1090 3300048904 Ga0496101_0019312 Ga0496101_0019312_167_1033 286
1091 3300048904 Ga0496101_0118861 Ga0496101_0118861_728_1600 286
1092 3300048905 Ga0496102_0014065 Ga0496102_0014065_3780_4646 286
1093 3300048907 Ga0496104_0069857 Ga0496104_0069857_2408_3289 286
1094 3300048907 Ga0496104_0264148 Ga0496104_0264148_224_1105 286
1095 3300048907 Ga0496104_0299001 Ga0496104_0299001_143_1009 286
1096 3300048908 Ga0496105_0035781 Ga0496105_0035781_42_923 286
1097 3300048908 Ga0496105_0167151 Ga0496105_0167151_446_1312 286
1098 3300048908 Ga0496105_0234502 Ga0496105_0234502_169_1050 286
1099 3300048909 Ga0496106_0009281 Ga0496106_0009281_614_1495 286
1100 3300048909 Ga0496106_0070891 Ga0496106_0070891_771_1652 286
1101 3300048910 Ga0496107_0012775 Ga0496107_0012775_2452_3318 286
1102 3300048910 Ga0496107_0042429 Ga0496107_0042429_407_1288 286
1103 3300048910 Ga0496107_0114376 Ga0496107_0114376_737_1609 286
1104 3300048910 Ga0496107_0258453 Ga0496107_0258453_348_1220 286
1105 3300048910 Ga0496107_0441466 Ga0496107_0441466_26_898 286
1106 3300048911 Ga0496108_0001270 Ga0496108_0001270_2484_3365 286
1107 3300048911 Ga0496108_0025132 Ga0496108_0025132_1635_2507 286
1108 3300048911 Ga0496108_0132477 Ga0496108_0132477_591_1457 286
1109 3300048911 Ga0496108_0292098 Ga0496108_0292098_423_1283 286
1110 3300048912 Ga0496109_0001572 Ga0496109_0001572_15938_16819 286
1111 3300048913 Ga0496110_0117639 Ga0496110_0117639_1379_2245 286
1112 3300048913 Ga0496110_0290131 Ga0496110_0290131_170_1042 286
1113 3300048913 Ga0496110_0342296 Ga0496110_0342296_414_1295 286
1114 3300048914 Ga0496111_0005572 Ga0496111_0005572_3372_4253 286
1115 3300048914 Ga0496111_0165583 Ga0496111_0165583_472_1332 286
1116 3300048915 Ga0496112_0009102 Ga0496112_0009102_6226_7107 286
1117 3300048915 Ga0496112_0052144 Ga0496112_0052144_291_1172 286
1118 3300048916 Ga0496113_0018458 Ga0496113_0018458_269_1135 286
1119 3300048917 Ga0496114_0002069 Ga0496114_0002069_7190_8056 286
1120 3300048917 Ga0496114_0218598 Ga0496114_0218598_448_1320 286
1121 3300048917 Ga0496114_0275343 Ga0496114_0275343_146_1018 286
1122 3300048918 Ga0496115_0005035 Ga0496115_0005035_8147_9013 286
1123 3300048919 Ga0496116_0010029 Ga0496116_0010029_6217_7098 286
1124 3300048920 Ga0496117_0042436 Ga0496117_0042436_53_934 286
1125 3300048921 Ga0496118_0011634 Ga0496118_0011634_727_1599 286
1126 3300048921 Ga0496118_0085105 Ga0496118_0085105_753_1634 286
1127 3300048921 Ga0496118_0126147 Ga0496118_0126147_566_1438 286
1128 3300048921 Ga0496118_0126844 Ga0496118_0126844_354_1235 286
1129 3300048923 Ga0496120_0085482 Ga0496120_0085482_572_1444 286
1130 3300048924 Ga0496121_0022640 Ga0496121_0022640_988_1869 286
1131 3300048924 Ga0496121_0054773 Ga0496121_0054773_1753_2625 286
1132 3300048924 Ga0496121_0057072 Ga0496121_0057072_567_1439 286
1133 3300048925 Ga0496122_0020500 Ga0496122_0020500_4491_5372 286
1134 3300048927 Ga0496124_0075371 Ga0496124_0075371_104_976 286
1135 3300048928 Ga0496125_0017706 Ga0496125_0017706_3452_4333 286
1136 3300048928 Ga0496125_0066290 Ga0496125_0066290_297_1178 286
1137 3300048928 Ga0496125_0102411 Ga0496125_0102411_633_1505 286
1138 3300048929 Ga0496126_0037296 Ga0496126_0037296_1742_2614 286
1139 3300048929 Ga0496126_0065959 Ga0496126_0065959_1481_2362 286
1140 3300048929 Ga0496126_0089520 Ga0496126_0089520_1680_2552 286
1141 3300048929 Ga0496126_0159757 Ga0496126_0159757_763_1635 286
1142 3300048929 Ga0496126_0260492 Ga0496126_0260492_248_1126 286
1143 3300049459 Ga0495678_042590 Ga0495678_042590_566_1438 286
1144 3300049576 Ga0501040_0378790 Ga0501040_0378790_30_902 286
1145 3300050492 nmdc:mga0yw44_234843_c1 nmdc:mga0yw44_234843_c1_160_1041 286
1146 3300050492 nmdc:mga0yw44_2955_c1 nmdc:mga0yw44_2955_c1_596_1468 286
1147 3300050492 nmdc:mga0yw44_75476_c1 nmdc:mga0yw44_75476_c1_525_1406 286
1148 3300050493 nmdc:mga0k408_1944_c1 nmdc:mga0k408_1944_c1_9363_10235 286
1149 3300050494 nmdc:mga06z11_15815_c1 nmdc:mga06z11_15815_c1_938_1810 286
1150 3300050494 nmdc:mga06z11_76686_c1 nmdc:mga06z11_76686_c1_789_1661 286
1151 3300050496 nmdc:mga07m45_146231_c1 nmdc:mga07m45_146231_c1_297_1178 286
1152 3300050496 nmdc:mga07m45_53044_c1 nmdc:mga07m45_53044_c1_596_1468 286
1153 3300050511 nmdc:mga08y16_139533_c1 nmdc:mga08y16_139533_c1_1117_1989 286
1154 3300050511 nmdc:mga08y16_583004_c1 nmdc:mga08y16_583004_c1_199_1071 286
1155 3300050512 nmdc:mga0n895_153988_c1 nmdc:mga0n895_153988_c1_586_1458 286
1156 3300050512 nmdc:mga0n895_17055_c1 nmdc:mga0n895_17055_c1_851_1723 286
1157 3300050513 nmdc:mga0rr50_43438_c1 nmdc:mga0rr50_43438_c1_1507_2379 286
1158 3300050516 nmdc:mga0sz30_14969_c1 nmdc:mga0sz30_14969_c1_1945_2817 286
1159 3300053077 Ga0495601_0028296 Ga0495601_0028296_471_1352 286
1160 3300053084 Ga0495595_0005825 Ga0495595_0005825_1860_2741 286
1161 3300053084 Ga0495595_0079856 Ga0495595_0079856_425_1297 286
1162 3300053086 Ga0500578_0090156 Ga0500578_0090156_617_1489 286
1163 3300053093 Ga0500651_0122446 Ga0500651_0122446_415_1296 286
1164 3300053094 Ga0500566_0003522 Ga0500566_0003522_5562_6443 286
1165 3300053096 Ga0500641_0008813 Ga0500641_0008813_2141_3013 286
1166 3300053096 Ga0500641_0013142 Ga0500641_0013142_1630_2502 286
1167 3300053096 Ga0500641_0018495 Ga0500641_0018495_583_1464 286
1168 3300053098 Ga0500650_0006071 Ga0500650_0006071_394_1275 286
1169 3300053104 Ga0500556_0000011 Ga0500556_0000011_137437_138318 286
1170 3300053109 Ga0500569_030480 Ga0500569_030480_613_1494 286
1171 3300053109 Ga0500569_057461 Ga0500569_057461_267_1139 286
1172 3300053119 Ga0500595_009153 Ga0500595_009153_2265_3137 286
1173 3300053122 Ga0500608_001666 Ga0500608_001666_6852_7733 286
1174 3300053130 Ga0500642_0000030 Ga0500642_0000030_38253_39134 286
1175 3300053131 Ga0500652_001587 Ga0500652_001587_5957_6838 286
1176 3300053136 Ga0500559_0000272 Ga0500559_0000272_6694_7575 286
1177 3300053137 Ga0500561_0011900 Ga0500561_0011900_367_1239 286
1178 3300053139 Ga0500568_0000246 Ga0500568_0000246_7608_8489 286
1179 3300053151 Ga0500604_0025852 Ga0500604_0025852_791_1672 286
1180 3300053153 Ga0500616_0000026 Ga0500616_0000026_210308_211189 286
1181 3300053156 Ga0500622_0046926 Ga0500622_0046926_388_1269 286
1182 3300053158 Ga0500627_0026563 Ga0500627_0026563_1007_1888 286
1183 3300053177 Ga0500636_0022787 Ga0500636_0022787_1258_2130 286
1184 3300053177 Ga0500636_0047123 Ga0500636_0047123_1387_2268 286
1185 3300053177 Ga0500636_0157011 Ga0500636_0157011_239_1111 286
1186 3300053178 Ga0500637_0128031 Ga0500637_0128031_567_1439 286
1187 3300053739 Ga0500587_008712 Ga0500587_008712_123_995 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

4

55

0.96

PF01739

CheR

CheR methyltransferase, SAM binding domain

70

245

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8884 72 267
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8637 72 267
7phf-assembly1.cif.gz_B chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8595 194 242
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8108 99 242
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8044 99 242
ID Description Score Start End Superfamily
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.882 70 267 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8692 70 267 3.40.50.150
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8678 1 68 1.10.155.10
3i53B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8002 103 242 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7916 69 268 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D5UYS3-F1-model_v4 Chemotaxis protein CheR 0.9304 68 269 GO:0008757
AF-A0A3D5UYS3-F1-model_v4 Chemotaxis protein CheR 0.9131 68 269 GO:0008757
AF-A0A168UH17-F1-model_v4 deleted 0.9095 71 267
AF-A0A519KZF9-F1-model_v4 Methyltransferase domain-containing protein 0.9022 140 269 GO:0008757
GO:0032259
AF-A0A831QJC6-F1-model_v4 Protein-glutamate O-methyltransferase CheR 0.9004 56 267 GO:0008757

Feature Viewer

pLDDT pTM Quality
83.81 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map