F491408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1187 | 646 | 971 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300046499|Ga0495594_0155965|Ga0495594_0155965_275_1096 |
| Length | 273 |
| Sequence | VTPPDYEYLRKLLKDHSGLDLSADKQYLIESRLLPLARKSGLSGISDLVQKMKGGSASQVAQVVEAMTTNETFFFRDKVPFDHFRETIMPELLKARSVRKAIRIWCAAGSTGQEPYSLAMCLKEMAAALAGWRVGIYSQFEVQRGLPIQLLVKYFKQSGELWQINADIRAMVQHRQLNLLHDFSQLGTFDVIFCRNVLIYFDQDTKINIFNRLAKAMEPDGFLVLGAAETVVGLTETFKPYAEWRGLYRPSARAVSPHGGAVMPKIAAMAAGC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355199 | |||
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 34 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 35 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 36 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 37 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 38 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 39 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 40 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 41 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 42 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 43 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 44 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 45 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 46 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 47 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 48 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 49 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 50 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 51 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 52 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 53 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 54 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 55 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 56 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 57 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 58 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 59 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 60 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 61 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 62 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 63 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 64 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 65 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 66 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 67 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 68 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 69 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 70 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 71 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 72 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 73 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 74 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 75 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 76 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 77 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 78 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 79 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 80 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 81 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 82 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 83 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 84 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 85 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 86 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 91 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 95 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 98 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 99 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 100 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 101 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 102 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 103 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 104 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 105 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 106 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 107 | 2922368715 | |||
| 108 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 109 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 110 | 2922425934 | |||
| 111 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 112 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 113 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 114 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 115 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 116 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 117 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 118 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 119 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 120 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 121 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 122 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 123 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 124 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 125 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 126 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 127 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 128 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 129 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 130 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 131 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 132 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 133 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 134 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 135 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 136 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 137 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 138 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 139 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 140 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 141 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 142 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 143 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 144 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 145 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 146 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 147 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 148 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 149 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 150 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 151 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 152 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 153 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 154 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 155 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 156 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 157 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 158 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 159 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 160 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 161 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 162 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 163 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 164 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 165 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 166 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 167 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 168 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 169 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 170 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 171 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 172 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 173 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 174 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 175 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 176 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 177 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 178 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 179 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 180 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 181 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 182 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 183 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 184 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 185 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 186 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 187 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 188 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 189 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 190 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 191 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 192 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 196 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 197 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 198 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 199 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 206 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 217 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 218 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 222 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 223 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 224 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 227 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 229 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 230 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 231 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 233 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 234 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 235 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 236 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 237 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 238 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 239 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 240 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 241 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 242 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 243 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 244 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 246 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 247 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 248 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 249 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 250 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 252 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 253 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 254 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 255 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 257 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 258 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 259 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 260 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 261 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 262 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 263 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 264 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 265 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 289 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 291 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 292 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 293 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 294 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 295 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 362 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 364 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 365 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 370 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 371 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 372 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 373 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 374 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 375 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 376 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 377 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 378 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 379 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 380 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 381 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 382 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 383 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 384 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 385 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 386 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 387 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 388 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 389 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 390 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 391 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 392 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 393 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 394 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 395 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 396 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 397 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 398 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 399 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 400 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 401 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 402 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 403 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 404 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 405 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 406 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 407 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 408 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 411 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 412 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 413 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 414 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 415 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 416 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 417 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 418 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 419 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 420 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 421 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 422 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 423 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 424 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 425 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 426 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 427 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 428 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 429 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 430 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 431 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 432 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 433 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 434 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 435 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 436 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 437 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 438 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 517 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 518 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 519 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 520 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 521 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 522 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 523 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 525 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 526 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 527 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 528 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 529 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 530 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 531 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 532 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 533 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 534 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 535 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 536 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 537 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 538 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 539 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 540 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 541 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 544 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 545 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 546 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 547 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 548 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 549 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 554 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 557 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 563 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 564 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 565 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 566 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 567 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 568 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 569 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 570 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 571 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 572 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 573 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 574 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 575 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 576 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 577 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 578 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 579 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 580 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 581 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 582 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 583 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 584 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 585 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 586 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 587 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 588 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 589 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 590 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 591 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 592 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 593 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 594 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 595 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 596 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 597 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 598 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 600 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 601 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 602 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 604 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 605 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 606 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 607 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 608 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 609 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 610 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 611 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 612 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 613 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 614 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 615 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 616 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 617 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 618 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 619 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 620 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 621 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 622 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 623 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 624 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 625 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 626 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 627 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 628 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 629 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 630 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 631 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 632 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 633 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 634 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 635 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 636 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 637 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 638 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 639 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 640 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 641 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 642 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 643 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 644 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 645 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 646 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.01 |
| Metatranscriptomes | 0 |
| Isolates | 17.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.84 |
| Nodule | 14.49 |
| Rhizoplane | 4.89 |
| Rhizosphere | 53.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1002274 | 3300000532 | Bacteria | 1394 |
| 2 | JGI25406J46586_10012297 | 3300003203 | Bacteria | 3721 |
| 3 | JGI25165J46597_1008047 | 3300003214 | Bacteria | 1689 |
| 4 | JGI25153J46596_10000550 | 3300003215 | Bacteria | 23396 |
| 5 | JGI25153J46596_10007332 | 3300003215 | Bacteria | 5444 |
| 6 | JGI25153J46596_10013291 | 3300003215 | Bacteria | 3487 |
| 7 | JGI25153J46596_10014619 | 3300003215 | Bacteria | 3251 |
| 8 | JGI25153J46596_10016489 | 3300003215 | Bacteria | 2955 |
| 9 | JGI25160J50197_1004506 | 3300003354 | Bacteria | 6015 |
| 10 | JGI25404J52841_10003547 | 3300003659 | Bacteria | 3095 |
| 11 | JGI25404J52841_10030856 | 3300003659 | Bacteria | 1146 |
| 12 | Ga0055539_1004325 | 3300003752 | Bacteria | 1895 |
| 13 | Ga0055531_10014620 | 3300003794 | Bacteria | 3521 |
| 14 | JGI25405J52794_10004824 | 3300003911 | Bacteria | 2418 |
| 15 | Ga0055543_1007285 | 3300004625 | Bacteria | 2576 |
| 16 | Ga0065165_1001646 | 3300005262 | Bacteria | 22707 |
| 17 | Ga0070658_10059476 | 3300005327 | Bacteria | 3112 |
| 18 | Ga0070658_10332214 | 3300005327 | Bacteria | 1299 |
| 19 | Ga0070676_10120250 | 3300005328 | Bacteria | 1647 |
| 20 | Ga0070683_100025426 | 3300005329 | Bacteria | 5318 |
| 21 | Ga0070683_100093829 | 3300005329 | Bacteria | 2820 |
| 22 | Ga0070683_100171658 | 3300005329 | Bacteria | 2058 |
| 23 | Ga0070683_100197019 | 3300005329 | Bacteria | 1913 |
| 24 | Ga0068869_100015937 | 3300005334 | Bacteria | 5057 |
| 25 | Ga0068869_100168334 | 3300005334 | Bacteria | 1710 |
| 26 | Ga0070680_100121818 | 3300005336 | Bacteria | 2178 |
| 27 | Ga0070680_100234704 | 3300005336 | Bacteria | 1549 |
| 28 | Ga0068868_100004833 | 3300005338 | Bacteria | 9459 |
| 29 | Ga0068868_100137371 | 3300005338 | Bacteria | 2004 |
| 30 | Ga0070689_100084174 | 3300005340 | Bacteria | 2499 |
| 31 | Ga0070661_100065479 | 3300005344 | Bacteria | 2670 |
| 32 | Ga0070668_100008596 | 3300005347 | Bacteria | 7584 |
| 33 | Ga0070668_100106056 | 3300005347 | Bacteria | 2232 |
| 34 | Ga0070668_100133324 | 3300005347 | Bacteria | 1995 |
| 35 | Ga0070669_100278027 | 3300005353 | Bacteria | 1341 |
| 36 | Ga0070669_100282872 | 3300005353 | Bacteria | 1329 |
| 37 | Ga0070671_100034823 | 3300005355 | Bacteria | 4170 |
| 38 | Ga0070674_100203677 | 3300005356 | Bacteria | 1530 |
| 39 | Ga0070673_100164033 | 3300005364 | Bacteria | 1891 |
| 40 | Ga0070688_100080943 | 3300005365 | Bacteria | 2102 |
| 41 | Ga0070709_10012913 | 3300005434 | Bacteria | 4682 |
| 42 | Ga0070709_10027828 | 3300005434 | Bacteria | 3366 |
| 43 | Ga0070709_10038498 | 3300005434 | Bacteria | 2928 |
| 44 | Ga0070709_10093365 | 3300005434 | Bacteria | 1989 |
| 45 | Ga0070709_10238639 | 3300005434 | Bacteria | 1304 |
| 46 | Ga0070714_100076810 | 3300005435 | Bacteria | 2900 |
| 47 | Ga0070714_100133016 | 3300005435 | Bacteria | 2224 |
| 48 | Ga0070713_100049420 | 3300005436 | Bacteria | 3469 |
| 49 | Ga0070713_100105541 | 3300005436 | Bacteria | 2447 |
| 50 | Ga0070710_10000755 | 3300005437 | Bacteria | 15418 |
| 51 | Ga0070710_10019413 | 3300005437 | Bacteria | 3512 |
| 52 | Ga0070710_10020372 | 3300005437 | Bacteria | 3440 |
| 53 | Ga0070701_10043293 | 3300005438 | Bacteria | 2302 |
| 54 | Ga0070711_100024686 | 3300005439 | Bacteria | 3925 |
| 55 | Ga0070711_100041640 | 3300005439 | Bacteria | 3103 |
| 56 | Ga0070711_100053801 | 3300005439 | Bacteria | 2775 |
| 57 | Ga0070711_100105501 | 3300005439 | Bacteria | 2058 |
| 58 | Ga0070705_100298350 | 3300005440 | Bacteria | 1153 |
| 59 | Ga0070663_100011356 | 3300005455 | Bacteria | 5587 |
| 60 | Ga0070663_100070714 | 3300005455 | Bacteria | 2538 |
| 61 | Ga0070663_100137664 | 3300005455 | Bacteria | 1860 |
| 62 | Ga0070663_100277020 | 3300005455 | Bacteria | 1335 |
| 63 | Ga0070678_100046211 | 3300005456 | Bacteria | 3120 |
| 64 | Ga0070678_100084635 | 3300005456 | Bacteria | 2415 |
| 65 | Ga0070678_100165171 | 3300005456 | Bacteria | 1798 |
| 66 | Ga0070678_100340499 | 3300005456 | Bacteria | 1286 |
| 67 | Ga0070662_100033435 | 3300005457 | Bacteria | 3621 |
| 68 | Ga0070662_100149362 | 3300005457 | Bacteria | 1817 |
| 69 | Ga0070681_10158376 | 3300005458 | Bacteria | 2188 |
| 70 | Ga0070681_10254456 | 3300005458 | Bacteria | 1668 |
| 71 | Ga0068867_100093754 | 3300005459 | Bacteria | 2282 |
| 72 | Ga0070706_100086269 | 3300005467 | Bacteria | 2909 |
| 73 | Ga0070706_100235748 | 3300005467 | Bacteria | 1708 |
| 74 | Ga0070707_100041107 | 3300005468 | Bacteria | 4425 |
| 75 | Ga0070707_100573453 | 3300005468 | Bacteria | 1091 |
| 76 | Ga0070698_100194297 | 3300005471 | Bacteria | 1966 |
| 77 | Ga0070698_100217995 | 3300005471 | Bacteria | 1842 |
| 78 | Ga0070679_100021186 | 3300005530 | Bacteria | 6341 |
| 79 | Ga0070679_100032725 | 3300005530 | Bacteria | 5145 |
| 80 | Ga0070679_100113377 | 3300005530 | Bacteria | 2696 |
| 81 | Ga0070684_100033972 | 3300005535 | Bacteria | 4358 |
| 82 | Ga0070684_100047929 | 3300005535 | Bacteria | 3705 |
| 83 | Ga0068853_100226396 | 3300005539 | Bacteria | 1709 |
| 84 | Ga0068853_100381150 | 3300005539 | Bacteria | 1317 |
| 85 | Ga0070693_100018521 | 3300005547 | Bacteria | 3639 |
| 86 | Ga0070665_100010827 | 3300005548 | Bacteria | 9225 |
| 87 | Ga0070665_100044008 | 3300005548 | Bacteria | 4484 |
| 88 | Ga0070665_100129065 | 3300005548 | Bacteria | 2530 |
| 89 | Ga0070665_100172998 | 3300005548 | Bacteria | 2160 |
| 90 | Ga0070665_100193449 | 3300005548 | Bacteria | 2035 |
| 91 | Ga0070665_100196283 | 3300005548 | Bacteria | 2019 |
| 92 | Ga0070665_100207601 | 3300005548 | Bacteria | 1959 |
| 93 | Ga0070665_100231793 | 3300005548 | Bacteria | 1847 |
| 94 | Ga0068855_100027913 | 3300005563 | Bacteria | 6751 |
| 95 | Ga0068855_100128289 | 3300005563 | Bacteria | 2898 |
| 96 | Ga0068855_100188651 | 3300005563 | Bacteria | 2327 |
| 97 | Ga0070664_100422125 | 3300005564 | Bacteria | 1222 |
| 98 | Ga0068857_100090503 | 3300005577 | Bacteria | 2738 |
| 99 | Ga0068854_100030068 | 3300005578 | Bacteria | 3765 |
| 100 | Ga0068854_100452171 | 3300005578 | Bacteria | 1073 |
| 101 | Ga0068856_100002282 | 3300005614 | Bacteria | 19787 |
| 102 | Ga0068856_100034134 | 3300005614 | Bacteria | 4984 |
| 103 | Ga0068856_100401795 | 3300005614 | Bacteria | 1390 |
| 104 | Ga0070702_100048678 | 3300005615 | Bacteria | 2413 |
| 105 | Ga0070702_100078193 | 3300005615 | Bacteria | 1974 |
| 106 | Ga0068852_100018340 | 3300005616 | Bacteria | 5513 |
| 107 | Ga0068852_100027518 | 3300005616 | Bacteria | 4634 |
| 108 | Ga0068852_100080688 | 3300005616 | Bacteria | 2885 |
| 109 | Ga0068852_100102155 | 3300005616 | Bacteria | 2590 |
| 110 | Ga0068852_100109235 | 3300005616 | Bacteria | 2511 |
| 111 | Ga0068852_100131914 | 3300005616 | Bacteria | 2302 |
| 112 | Ga0068864_100081294 | 3300005618 | Bacteria | 2840 |
| 113 | Ga0068864_100428372 | 3300005618 | Bacteria | 1262 |
| 114 | Ga0068861_100096646 | 3300005719 | Bacteria | 2341 |
| 115 | Ga0068861_100399308 | 3300005719 | Bacteria | 1219 |
| 116 | Ga0068851_10316409 | 3300005834 | Bacteria | 901 |
| 117 | Ga0068863_100301463 | 3300005841 | Bacteria | 1554 |
| 118 | Ga0068858_100061588 | 3300005842 | Bacteria | 3469 |
| 119 | Ga0068858_100306903 | 3300005842 | Bacteria | 1515 |
| 120 | Ga0068860_100000577 | 3300005843 | Bacteria | 44036 |
| 121 | Ga0068860_100052959 | 3300005843 | Bacteria | 3859 |
| 122 | Ga0068862_100046068 | 3300005844 | Bacteria | 3722 |
| 123 | Ga0068862_100116219 | 3300005844 | Bacteria | 2353 |
| 124 | Ga0068862_100191689 | 3300005844 | Bacteria | 1839 |
| 125 | Ga0068862_100344762 | 3300005844 | Bacteria | 1381 |
| 126 | Ga0081455_10003093 | 3300005937 | Bacteria | 19378 |
| 127 | Ga0081455_10004895 | 3300005937 | Bacteria | 14842 |
| 128 | Ga0081455_10013996 | 3300005937 | Bacteria | 7885 |
| 129 | Ga0081455_10023586 | 3300005937 | Bacteria | 5723 |
| 130 | Ga0081455_10044688 | 3300005937 | Bacteria | 3861 |
| 131 | Ga0081455_10128720 | 3300005937 | Bacteria | 1983 |
| 132 | Ga0081538_10010846 | 3300005981 | Bacteria | 7435 |
| 133 | Ga0081540_1004561 | 3300005983 | Bacteria | 10498 |
| 134 | Ga0081540_1004770 | 3300005983 | Bacteria | 10235 |
| 135 | Ga0081540_1008466 | 3300005983 | Bacteria | 7183 |
| 136 | Ga0081540_1009460 | 3300005983 | Bacteria | 6715 |
| 137 | Ga0081540_1019100 | 3300005983 | Bacteria | 4181 |
| 138 | Ga0081540_1022078 | 3300005983 | Bacteria | 3766 |
| 139 | Ga0081540_1022569 | 3300005983 | Bacteria | 3715 |
| 140 | Ga0081539_10005931 | 3300005985 | Bacteria | 12064 |
| 141 | Ga0081539_10009687 | 3300005985 | Bacteria | 7979 |
| 142 | Ga0081539_10042459 | 3300005985 | Bacteria | 2648 |
| 143 | Ga0070717_10000634 | 3300006028 | Bacteria | 22593 |
| 144 | Ga0070717_10042253 | 3300006028 | Bacteria | 3717 |
| 145 | Ga0075365_10036278 | 3300006038 | Bacteria | 3194 |
| 146 | Ga0075365_10071356 | 3300006038 | Bacteria | 2338 |
| 147 | Ga0075365_10092810 | 3300006038 | Bacteria | 2058 |
| 148 | Ga0075365_10093381 | 3300006038 | Bacteria | 2052 |
| 149 | Ga0075365_10124820 | 3300006038 | Bacteria | 1778 |
| 150 | Ga0075365_10140298 | 3300006038 | Bacteria | 1677 |
| 151 | Ga0075368_10003600 | 3300006042 | Bacteria | 5193 |
| 152 | Ga0075368_10038401 | 3300006042 | Bacteria | 1875 |
| 153 | Ga0075363_100026229 | 3300006048 | Bacteria | 2979 |
| 154 | Ga0075363_100042670 | 3300006048 | Bacteria | 2397 |
| 155 | Ga0075364_10033825 | 3300006051 | Bacteria | 3294 |
| 156 | Ga0075364_10145193 | 3300006051 | Bacteria | 1597 |
| 157 | Ga0070716_100043607 | 3300006173 | Bacteria | 2509 |
| 158 | Ga0070712_100003691 | 3300006175 | Bacteria | 9438 |
| 159 | Ga0070712_100017728 | 3300006175 | Bacteria | 4612 |
| 160 | Ga0070712_100096914 | 3300006175 | Bacteria | 2172 |
| 161 | Ga0070712_100217533 | 3300006175 | Bacteria | 1510 |
| 162 | Ga0075362_10017479 | 3300006177 | Bacteria | 2955 |
| 163 | Ga0075367_10006523 | 3300006178 | Bacteria | 5901 |
| 164 | Ga0075367_10023304 | 3300006178 | Bacteria | 3482 |
| 165 | Ga0075367_10025881 | 3300006178 | Bacteria | 3321 |
| 166 | Ga0075367_10047076 | 3300006178 | Bacteria | 2536 |
| 167 | Ga0075367_10075065 | 3300006178 | Bacteria | 2039 |
| 168 | Ga0075367_10263604 | 3300006178 | Bacteria | 1082 |
| 169 | Ga0075369_10008323 | 3300006186 | Bacteria | 3988 |
| 170 | Ga0075369_10010496 | 3300006186 | Bacteria | 3623 |
| 171 | Ga0075369_10026619 | 3300006186 | Bacteria | 2412 |
| 172 | Ga0075366_10018739 | 3300006195 | Bacteria | 3998 |
| 173 | Ga0075366_10137965 | 3300006195 | Bacteria | 1473 |
| 174 | Ga0097621_100046159 | 3300006237 | Bacteria | 3523 |
| 175 | Ga0097621_100316364 | 3300006237 | Bacteria | 1382 |
| 176 | Ga0075370_10025125 | 3300006353 | Bacteria | 3293 |
| 177 | Ga0075370_10028909 | 3300006353 | Bacteria | 3084 |
| 178 | Ga0075370_10054918 | 3300006353 | Bacteria | 2262 |
| 179 | Ga0075370_10078460 | 3300006353 | Bacteria | 1896 |
| 180 | Ga0068871_100047551 | 3300006358 | Bacteria | 3460 |
| 181 | Ga0068871_100063442 | 3300006358 | Bacteria | 3022 |
| 182 | Ga0075428_100014565 | 3300006844 | Bacteria | 8735 |
| 183 | Ga0075428_100066428 | 3300006844 | Bacteria | 3949 |
| 184 | Ga0075434_100051150 | 3300006871 | Bacteria | 4105 |
| 185 | Ga0068865_100101164 | 3300006881 | Bacteria | 2110 |
| 186 | Ga0068865_100629660 | 3300006881 | Bacteria | 910 |
| 187 | Ga0099825_1025031 | 3300006941 | Bacteria | 3387 |
| 188 | Ga0099824_1009104 | 3300006942 | Bacteria | 12375 |
| 189 | Ga0099824_1014090 | 3300006942 | Bacteria | 8068 |
| 190 | Ga0099822_1011071 | 3300006943 | Bacteria | 11071 |
| 191 | Ga0099794_10046869 | 3300007265 | Bacteria | 2071 |
| 192 | Ga0105240_10077665 | 3300009093 | Bacteria | 4090 |
| 193 | Ga0105240_10077881 | 3300009093 | Bacteria | 4084 |
| 194 | Ga0105240_10095052 | 3300009093 | Bacteria | 3634 |
| 195 | Ga0111539_10165036 | 3300009094 | Bacteria | 2590 |
| 196 | Ga0105245_10031932 | 3300009098 | Bacteria | 4661 |
| 197 | Ga0105245_10066139 | 3300009098 | Bacteria | 3271 |
| 198 | Ga0105247_10071486 | 3300009101 | Bacteria | 2170 |
| 199 | Ga0105247_10283650 | 3300009101 | Bacteria | 1143 |
| 200 | Ga0105243_10256643 | 3300009148 | Bacteria | 1563 |
| 201 | Ga0105241_10052371 | 3300009174 | Bacteria | 3116 |
| 202 | Ga0105241_10087362 | 3300009174 | Bacteria | 2454 |
| 203 | Ga0105241_10140289 | 3300009174 | Bacteria | 1967 |
| 204 | Ga0105248_10105152 | 3300009177 | Bacteria | 3183 |
| 205 | Ga0105248_10159915 | 3300009177 | Bacteria | 2541 |
| 206 | Ga0105237_10031055 | 3300009545 | Bacteria | 5419 |
| 207 | Ga0105237_10300641 | 3300009545 | Bacteria | 1608 |
| 208 | Ga0105237_10583682 | 3300009545 | Bacteria | 1125 |
| 209 | Ga0105238_10060989 | 3300009551 | Bacteria | 3775 |
| 210 | Ga0105238_10135734 | 3300009551 | Bacteria | 2438 |
| 211 | Ga0105238_10248919 | 3300009551 | Bacteria | 1755 |
| 212 | Ga0105238_10301875 | 3300009551 | Bacteria | 1585 |
| 213 | Ga0105249_10232433 | 3300009553 | Bacteria | 1819 |
| 214 | Ga0105249_10405433 | 3300009553 | Bacteria | 1394 |
| 215 | Ga0105239_10056885 | 3300010375 | Bacteria | 4289 |
| 216 | Ga0105239_10087851 | 3300010375 | Bacteria | 3427 |
| 217 | Ga0105239_10121409 | 3300010375 | Bacteria | 2902 |
| 218 | Ga0105239_10122522 | 3300010375 | Bacteria | 2889 |
| 219 | Ga0105239_10212863 | 3300010375 | Bacteria | 2167 |
| 220 | Ga0105239_10378951 | 3300010375 | Bacteria | 1599 |
| 221 | Ga0105246_10040750 | 3300011119 | Bacteria | 3136 |
| 222 | Ga0105246_10212223 | 3300011119 | Bacteria | 1512 |
| 223 | Ga0157369_10077996 | 3300013105 | Bacteria | 3550 |
| 224 | Ga0157374_10178681 | 3300013296 | Bacteria | 2072 |
| 225 | Ga0157374_10185651 | 3300013296 | Bacteria | 2033 |
| 226 | Ga0157378_10041263 | 3300013297 | Bacteria | 4093 |
| 227 | Ga0163162_10164627 | 3300013306 | Bacteria | 2341 |
| 228 | Ga0157372_10438817 | 3300013307 | Bacteria | 1522 |
| 229 | Ga0157375_10132487 | 3300013308 | Bacteria | 2613 |
| 230 | Ga0157375_10217214 | 3300013308 | Bacteria | 2070 |
| 231 | Ga0163163_10062089 | 3300014325 | Bacteria | 3702 |
| 232 | Ga0163163_10541602 | 3300014325 | Bacteria | 1226 |
| 233 | Ga0157380_10189904 | 3300014326 | Bacteria | 1812 |
| 234 | Ga0157380_10216361 | 3300014326 | Bacteria | 1711 |
| 235 | Ga0157380_10282395 | 3300014326 | Bacteria | 1520 |
| 236 | Ga0157377_10106272 | 3300014745 | Bacteria | 1681 |
| 237 | Ga0157379_10166180 | 3300014968 | Bacteria | 1991 |
| 238 | Ga0157379_10412878 | 3300014968 | Bacteria | 1242 |
| 239 | Ga0157376_10054563 | 3300014969 | Bacteria | 3332 |
| 240 | Ga0182006_1092671 | 3300015261 | Bacteria | 1085 |
| 241 | Ga0163161_10010762 | 3300017792 | Bacteria | 6339 |
| 242 | Ga0163161_10117687 | 3300017792 | Bacteria | 1993 |
| 243 | Ga0163161_10251849 | 3300017792 | Bacteria | 1377 |
| 244 | Ga0214544_1000344 | 3300021320 | Bacteria | 81005 |
| 245 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 246 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 247 | Ga0214543_1029683 | 3300021327 | Bacteria | 2407 |
| 248 | Ga0213873_10002957 | 3300021358 | Bacteria | 3007 |
| 249 | Ga0209563_100670 | 3300025230 | Bacteria | 10845 |
| 250 | Ga0209677_102054 | 3300025253 | Bacteria | 7958 |
| 251 | Ga0209148_1000874 | 3300025254 | Bacteria | 20915 |
| 252 | Ga0209148_1019429 | 3300025254 | Bacteria | 1128 |
| 253 | Ga0209233_1008667 | 3300025261 | Bacteria | 3130 |
| 254 | Ga0209233_1020134 | 3300025261 | Bacteria | 1756 |
| 255 | Ga0209455_1001536 | 3300025272 | Bacteria | 10290 |
| 256 | Ga0209455_1003873 | 3300025272 | Bacteria | 5107 |
| 257 | Ga0209564_1005896 | 3300025295 | Bacteria | 6793 |
| 258 | Ga0209564_1008405 | 3300025295 | Bacteria | 5096 |
| 259 | Ga0209564_1019898 | 3300025295 | Bacteria | 2486 |
| 260 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 261 | Ga0209758_1001325 | 3300025297 | Bacteria | 30050 |
| 262 | Ga0209758_1001470 | 3300025297 | Bacteria | 27657 |
| 263 | Ga0209758_1003848 | 3300025297 | Bacteria | 13172 |
| 264 | Ga0209758_1007103 | 3300025297 | Bacteria | 7753 |
| 265 | Ga0209758_1009747 | 3300025297 | Bacteria | 5898 |
| 266 | Ga0209758_1022815 | 3300025297 | Bacteria | 2853 |
| 267 | Ga0209758_1029873 | 3300025297 | Bacteria | 2267 |
| 268 | Ga0209256_1004427 | 3300025299 | Bacteria | 8829 |
| 269 | Ga0207426_1000704 | 3300025302 | Bacteria | 39583 |
| 270 | Ga0207426_1001257 | 3300025302 | Bacteria | 22136 |
| 271 | Ga0207426_1001583 | 3300025302 | Bacteria | 18291 |
| 272 | Ga0207426_1015711 | 3300025302 | Bacteria | 2739 |
| 273 | Ga0209257_1003693 | 3300025304 | Bacteria | 12738 |
| 274 | Ga0209257_1017069 | 3300025304 | Bacteria | 2887 |
| 275 | Ga0207697_10057876 | 3300025315 | Bacteria | 1609 |
| 276 | Ga0207692_10070783 | 3300025898 | Bacteria | 1837 |
| 277 | Ga0207692_10151293 | 3300025898 | Bacteria | 1329 |
| 278 | Ga0207642_10241294 | 3300025899 | Bacteria | 1021 |
| 279 | Ga0207710_10028822 | 3300025900 | Bacteria | 2411 |
| 280 | Ga0207710_10029790 | 3300025900 | Bacteria | 2378 |
| 281 | Ga0207710_10108985 | 3300025900 | Bacteria | 1314 |
| 282 | Ga0207688_10021647 | 3300025901 | Bacteria | 3516 |
| 283 | Ga0207688_10052180 | 3300025901 | Bacteria | 2291 |
| 284 | Ga0207647_10002968 | 3300025904 | Bacteria | 12759 |
| 285 | Ga0207647_10140456 | 3300025904 | Bacteria | 1416 |
| 286 | Ga0207685_10068231 | 3300025905 | Bacteria | 1432 |
| 287 | Ga0207685_10167318 | 3300025905 | Bacteria | 1009 |
| 288 | Ga0207699_10004815 | 3300025906 | Bacteria | 6458 |
| 289 | Ga0207699_10014010 | 3300025906 | Bacteria | 4120 |
| 290 | Ga0207645_10048193 | 3300025907 | Bacteria | 2720 |
| 291 | Ga0207643_10065231 | 3300025908 | Bacteria | 2085 |
| 292 | Ga0207684_10108140 | 3300025910 | Bacteria | 2380 |
| 293 | Ga0207684_10109894 | 3300025910 | Bacteria | 2360 |
| 294 | Ga0207684_10205152 | 3300025910 | Bacteria | 1701 |
| 295 | Ga0207654_10031015 | 3300025911 | Bacteria | 2941 |
| 296 | Ga0207654_10083473 | 3300025911 | Bacteria | 1929 |
| 297 | Ga0207707_10001534 | 3300025912 | Bacteria | 21320 |
| 298 | Ga0207707_10112390 | 3300025912 | Bacteria | 2381 |
| 299 | Ga0207695_10001156 | 3300025913 | Bacteria | 45753 |
| 300 | Ga0207695_10043787 | 3300025913 | Bacteria | 4766 |
| 301 | Ga0207695_10119977 | 3300025913 | Bacteria | 2599 |
| 302 | Ga0207671_10035802 | 3300025914 | Bacteria | 3681 |
| 303 | Ga0207671_10050733 | 3300025914 | Bacteria | 3072 |
| 304 | Ga0207671_10221960 | 3300025914 | Bacteria | 1481 |
| 305 | Ga0207671_10248592 | 3300025914 | Bacteria | 1398 |
| 306 | Ga0207671_10282120 | 3300025914 | Bacteria | 1310 |
| 307 | Ga0207671_10478798 | 3300025914 | Bacteria | 992 |
| 308 | Ga0207693_10002446 | 3300025915 | Bacteria | 16130 |
| 309 | Ga0207693_10029143 | 3300025915 | Bacteria | 4362 |
| 310 | Ga0207693_10041552 | 3300025915 | Bacteria | 3620 |
| 311 | Ga0207693_10044704 | 3300025915 | Bacteria | 3480 |
| 312 | Ga0207693_10085272 | 3300025915 | Bacteria | 2474 |
| 313 | Ga0207693_10367490 | 3300025915 | Bacteria | 1125 |
| 314 | Ga0207663_10028317 | 3300025916 | Bacteria | 3278 |
| 315 | Ga0207660_10033623 | 3300025917 | Bacteria | 3549 |
| 316 | Ga0207660_10062043 | 3300025917 | Bacteria | 2692 |
| 317 | Ga0207662_10093909 | 3300025918 | Bacteria | 1849 |
| 318 | Ga0207657_10074222 | 3300025919 | Bacteria | 2873 |
| 319 | Ga0207657_10338561 | 3300025919 | Bacteria | 1188 |
| 320 | Ga0207652_10165259 | 3300025921 | Bacteria | 1984 |
| 321 | Ga0207646_10028561 | 3300025922 | Bacteria | 5075 |
| 322 | Ga0207681_10052125 | 3300025923 | Bacteria | 2774 |
| 323 | Ga0207681_10126894 | 3300025923 | Bacteria | 1880 |
| 324 | Ga0207694_10136558 | 3300025924 | Bacteria | 1970 |
| 325 | Ga0207694_10181955 | 3300025924 | Bacteria | 1705 |
| 326 | Ga0207694_10358360 | 3300025924 | Bacteria | 1208 |
| 327 | Ga0207659_10137814 | 3300025926 | Bacteria | 1891 |
| 328 | Ga0207659_10317099 | 3300025926 | Bacteria | 1285 |
| 329 | Ga0207687_10020017 | 3300025927 | Bacteria | 4438 |
| 330 | Ga0207700_10008650 | 3300025928 | Bacteria | 6320 |
| 331 | Ga0207700_10010201 | 3300025928 | Bacteria | 5911 |
| 332 | Ga0207664_10064538 | 3300025929 | Bacteria | 2929 |
| 333 | Ga0207664_10068542 | 3300025929 | Bacteria | 2850 |
| 334 | Ga0207664_10502350 | 3300025929 | Bacteria | 1086 |
| 335 | Ga0207644_10214886 | 3300025931 | Bacteria | 1522 |
| 336 | Ga0207690_10350826 | 3300025932 | Bacteria | 1167 |
| 337 | Ga0207706_10093938 | 3300025933 | Bacteria | 2638 |
| 338 | Ga0207706_10180429 | 3300025933 | Bacteria | 1854 |
| 339 | Ga0207709_10341043 | 3300025935 | Bacteria | 1128 |
| 340 | Ga0207670_10302230 | 3300025936 | Bacteria | 1253 |
| 341 | Ga0207669_10066960 | 3300025937 | Bacteria | 2236 |
| 342 | Ga0207669_10085987 | 3300025937 | Bacteria | 2032 |
| 343 | Ga0207669_10105585 | 3300025937 | Bacteria | 1874 |
| 344 | Ga0207669_10243921 | 3300025937 | Bacteria | 1333 |
| 345 | Ga0207669_10331737 | 3300025937 | Bacteria | 1168 |
| 346 | Ga0207665_10004668 | 3300025939 | Bacteria | 9103 |
| 347 | Ga0207665_10066810 | 3300025939 | Bacteria | 2448 |
| 348 | Ga0207665_10117196 | 3300025939 | Bacteria | 1878 |
| 349 | Ga0207691_10087971 | 3300025940 | Bacteria | 2786 |
| 350 | Ga0207691_10168672 | 3300025940 | Bacteria | 1917 |
| 351 | Ga0207711_10083906 | 3300025941 | Bacteria | 2788 |
| 352 | Ga0207661_10005119 | 3300025944 | Bacteria | 9204 |
| 353 | Ga0207661_10025839 | 3300025944 | Bacteria | 4468 |
| 354 | Ga0207661_10093733 | 3300025944 | Bacteria | 2507 |
| 355 | Ga0207661_10164980 | 3300025944 | Bacteria | 1924 |
| 356 | Ga0207679_10123574 | 3300025945 | Bacteria | 2064 |
| 357 | Ga0207679_10155774 | 3300025945 | Bacteria | 1865 |
| 358 | Ga0207679_10173442 | 3300025945 | Bacteria | 1778 |
| 359 | Ga0207679_10242374 | 3300025945 | Bacteria | 1528 |
| 360 | Ga0207667_10015856 | 3300025949 | Bacteria | 8539 |
| 361 | Ga0207651_10074123 | 3300025960 | Bacteria | 2423 |
| 362 | Ga0207651_10120039 | 3300025960 | Bacteria | 1992 |
| 363 | Ga0207712_10077095 | 3300025961 | Bacteria | 2415 |
| 364 | Ga0207712_10220246 | 3300025961 | Bacteria | 1517 |
| 365 | Ga0207712_10403418 | 3300025961 | Bacteria | 1149 |
| 366 | Ga0207668_10005343 | 3300025972 | Bacteria | 7557 |
| 367 | Ga0207668_10045426 | 3300025972 | Bacteria | 2995 |
| 368 | Ga0207668_10135544 | 3300025972 | Bacteria | 1886 |
| 369 | Ga0207668_10251519 | 3300025972 | Bacteria | 1435 |
| 370 | Ga0207668_10310671 | 3300025972 | Bacteria | 1304 |
| 371 | Ga0207640_10014499 | 3300025981 | Bacteria | 4540 |
| 372 | Ga0207658_10086653 | 3300025986 | Bacteria | 2416 |
| 373 | Ga0207658_10199553 | 3300025986 | Bacteria | 1669 |
| 374 | Ga0207677_10038533 | 3300026023 | Bacteria | 3135 |
| 375 | Ga0207677_10108262 | 3300026023 | Bacteria | 2063 |
| 376 | Ga0207703_10043372 | 3300026035 | Bacteria | 3611 |
| 377 | Ga0207703_10306100 | 3300026035 | Bacteria | 1451 |
| 378 | Ga0207639_10159766 | 3300026041 | Bacteria | 1898 |
| 379 | Ga0207639_10253862 | 3300026041 | Bacteria | 1535 |
| 380 | Ga0207639_10264477 | 3300026041 | Bacteria | 1506 |
| 381 | Ga0207678_10034872 | 3300026067 | Bacteria | 4382 |
| 382 | Ga0207678_10073842 | 3300026067 | Bacteria | 2923 |
| 383 | Ga0207678_10076141 | 3300026067 | Bacteria | 2874 |
| 384 | Ga0207678_10084233 | 3300026067 | Bacteria | 2719 |
| 385 | Ga0207678_10267163 | 3300026067 | Bacteria | 1466 |
| 386 | Ga0207702_10001426 | 3300026078 | Bacteria | 23867 |
| 387 | Ga0207648_10068241 | 3300026089 | Bacteria | 3098 |
| 388 | Ga0207648_10130139 | 3300026089 | Bacteria | 2215 |
| 389 | Ga0207676_10473747 | 3300026095 | Bacteria | 1184 |
| 390 | Ga0207674_10035941 | 3300026116 | Bacteria | 5167 |
| 391 | Ga0207675_100166532 | 3300026118 | Bacteria | 2105 |
| 392 | Ga0207675_100243853 | 3300026118 | Bacteria | 1737 |
| 393 | Ga0207683_10063276 | 3300026121 | Bacteria | 3259 |
| 394 | Ga0207683_10069387 | 3300026121 | Bacteria | 3113 |
| 395 | Ga0207683_10360390 | 3300026121 | Bacteria | 1335 |
| 396 | Ga0207683_10387952 | 3300026121 | Bacteria | 1284 |
| 397 | Ga0207698_10063162 | 3300026142 | Bacteria | 2896 |
| 398 | Ga0207698_10101537 | 3300026142 | Bacteria | 2386 |
| 399 | Ga0207698_10219781 | 3300026142 | Bacteria | 1716 |
| 400 | Ga0207698_10507404 | 3300026142 | Bacteria | 1175 |
| 401 | Ga0209389_1000104 | 3300027296 | Bacteria | 75132 |
| 402 | Ga0209389_1000163 | 3300027296 | Bacteria | 55041 |
| 403 | Ga0209589_1000159 | 3300027357 | Bacteria | 75132 |
| 404 | Ga0209589_1001113 | 3300027357 | Bacteria | 42801 |
| 405 | Ga0209489_100194 | 3300027361 | Bacteria | 97679 |
| 406 | Ga0209489_101100 | 3300027361 | Bacteria | 55041 |
| 407 | Ga0209489_101913 | 3300027361 | Bacteria | 42801 |
| 408 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 409 | Ga0209700_101949 | 3300027363 | Bacteria | 42801 |
| 410 | Ga0209813_10032336 | 3300027866 | Bacteria | 1550 |
| 411 | Ga0268266_10004510 | 3300028379 | Bacteria | 13310 |
| 412 | Ga0268266_10009167 | 3300028379 | Bacteria | 8734 |
| 413 | Ga0268266_10009421 | 3300028379 | Bacteria | 8599 |
| 414 | Ga0268266_10080191 | 3300028379 | Bacteria | 2843 |
| 415 | Ga0268266_10095681 | 3300028379 | Bacteria | 2608 |
| 416 | Ga0268266_10154742 | 3300028379 | Bacteria | 2070 |
| 417 | Ga0268265_10061284 | 3300028380 | Bacteria | 2886 |
| 418 | Ga0268265_10473717 | 3300028380 | Bacteria | 1174 |
| 419 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 420 | Ga0268264_10189404 | 3300028381 | Bacteria | 1874 |
| 421 | Ga0268264_10352260 | 3300028381 | Bacteria | 1402 |
| 422 | Ga0268264_10415473 | 3300028381 | Bacteria | 1296 |
| 423 | Ga0268264_10459690 | 3300028381 | Bacteria | 1235 |
| 424 | Ga0265337_1001432 | 3300028556 | Bacteria | 11747 |
| 425 | Ga0265337_1003913 | 3300028556 | Bacteria | 6308 |
| 426 | Ga0265326_10000332 | 3300028558 | Bacteria | 20094 |
| 427 | Ga0265326_10006121 | 3300028558 | Bacteria | 3755 |
| 428 | Ga0265319_1001170 | 3300028563 | Bacteria | 16233 |
| 429 | Ga0265319_1015989 | 3300028563 | Bacteria | 2885 |
| 430 | Ga0265334_10002363 | 3300028573 | Bacteria | 8881 |
| 431 | Ga0265334_10011650 | 3300028573 | Bacteria | 3697 |
| 432 | Ga0265318_10003595 | 3300028577 | Bacteria | 7756 |
| 433 | Ga0265318_10011203 | 3300028577 | Bacteria | 3873 |
| 434 | Ga0265323_10000706 | 3300028653 | Bacteria | 18167 |
| 435 | Ga0265323_10001572 | 3300028653 | Bacteria | 11033 |
| 436 | Ga0265322_10014719 | 3300028654 | Bacteria | 2261 |
| 437 | Ga0265336_10000110 | 3300028666 | Bacteria | 62531 |
| 438 | Ga0265336_10000683 | 3300028666 | Bacteria | 18322 |
| 439 | Ga0307517_10001121 | 3300028786 | Bacteria | 45217 |
| 440 | Ga0307515_10060735 | 3300028794 | Bacteria | 5382 |
| 441 | Ga0307515_10293805 | 3300028794 | Bacteria | 1318 |
| 442 | Ga0265338_10000656 | 3300028800 | Bacteria | 59900 |
| 443 | Ga0265338_10001041 | 3300028800 | Bacteria | 46363 |
| 444 | Ga0265324_10000971 | 3300029957 | Bacteria | 17749 |
| 445 | Ga0265324_10002208 | 3300029957 | Bacteria | 10179 |
| 446 | Ga0307511_10132317 | 3300030521 | Bacteria | 1498 |
| 447 | Ga0307511_10188921 | 3300030521 | Bacteria | 1093 |
| 448 | Ga0265332_10015679 | 3300031238 | Bacteria | 3346 |
| 449 | Ga0265332_10067378 | 3300031238 | Bacteria | 1526 |
| 450 | Ga0265340_10008593 | 3300031247 | Bacteria | 5504 |
| 451 | Ga0265331_10074003 | 3300031250 | Bacteria | 1590 |
| 452 | Ga0307513_10246800 | 3300031456 | Bacteria | 1585 |
| 453 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 454 | Ga0307508_10003339 | 3300031616 | Bacteria | 16295 |
| 455 | Ga0307508_10052138 | 3300031616 | Bacteria | 3635 |
| 456 | Ga0307508_10378227 | 3300031616 | Bacteria | 1007 |
| 457 | Ga0307516_10020252 | 3300031730 | Bacteria | 6876 |
| 458 | Ga0307516_10073486 | 3300031730 | Bacteria | 3276 |
| 459 | Ga0307516_10079257 | 3300031730 | Bacteria | 3129 |
| 460 | Ga0307410_10139011 | 3300031852 | Bacteria | 1794 |
| 461 | Ga0307406_10063979 | 3300031901 | Bacteria | 2385 |
| 462 | Ga0307412_10153785 | 3300031911 | Bacteria | 1701 |
| 463 | Ga0307412_10305069 | 3300031911 | Bacteria | 1260 |
| 464 | Ga0307409_100171799 | 3300031995 | Bacteria | 1908 |
| 465 | Ga0307409_100454496 | 3300031995 | Bacteria | 1237 |
| 466 | Ga0307409_100543654 | 3300031995 | Bacteria | 1139 |
| 467 | Ga0307416_100074472 | 3300032002 | Bacteria | 2837 |
| 468 | Ga0307416_100179965 | 3300032002 | Bacteria | 1980 |
| 469 | Ga0307414_10124646 | 3300032004 | Bacteria | 1988 |
| 470 | Ga0307415_100136752 | 3300032126 | Bacteria | 1865 |
| 471 | Ga0307507_10016255 | 3300033179 | Bacteria | 8676 |
| 472 | Ga0307510_10035129 | 3300033180 | Bacteria | 5602 |
| 473 | Ga0307510_10058529 | 3300033180 | Bacteria | 3988 |
| 474 | Ga0307510_10147044 | 3300033180 | Bacteria | 1985 |
| 475 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 476 | Ga0373926_0072632 | 3300035083 | Bacteria | 1265 |
| 477 | Ga0373934_0003984 | 3300035086 | Bacteria | 5436 |
| 478 | Ga0373934_0040090 | 3300035086 | Bacteria | 1847 |
| 479 | Ga0373936_0008591 | 3300035113 | Bacteria | 3846 |
| 480 | Ga0373936_0015146 | 3300035113 | Bacteria | 2954 |
| 481 | Ga0373936_0143405 | 3300035113 | Bacteria | 1032 |
| 482 | Ga0373953_0003130 | 3300035117 | Bacteria | 5105 |
| 483 | Ga0373954_0011341 | 3300035118 | Bacteria | 3946 |
| 484 | Ga0373956_0001760 | 3300035119 | Bacteria | 8918 |
| 485 | Ga0373957_0017164 | 3300035120 | Bacteria | 2516 |
| 486 | Ga0373943_0083497 | 3300035170 | Bacteria | 1642 |
| 487 | Ga0373946_0036579 | 3300035171 | Bacteria | 1991 |
| 488 | Ga0373955_0022100 | 3300035172 | Bacteria | 3222 |
| 489 | Ga0373955_0024324 | 3300035172 | Bacteria | 3096 |
| 490 | Ga0373955_0042706 | 3300035172 | Bacteria | 2435 |
| 491 | Ga0373924_0001609 | 3300035410 | Bacteria | 7406 |
| 492 | Ga0373924_0006304 | 3300035410 | Bacteria | 4243 |
| 493 | Ga0373935_0027489 | 3300035692 | Bacteria | 3515 |
| 494 | Ga0373935_0035198 | 3300035692 | Bacteria | 3125 |
| 495 | Ga0373935_0039107 | 3300035692 | Bacteria | 2972 |
| 496 | Ga0373927_0003207 | 3300035695 | Bacteria | 11783 |
| 497 | Ga0373927_0008050 | 3300035695 | Bacteria | 7117 |
| 498 | Ga0373927_0020633 | 3300035695 | Bacteria | 4320 |
| 499 | Ga0373927_0113445 | 3300035695 | Bacteria | 1766 |
| 500 | Ga0373933_0007993 | 3300035724 | Bacteria | 5770 |
| 501 | Ga0373933_0036431 | 3300035724 | Bacteria | 2879 |
| 502 | Ga0373947_0006026 | 3300035725 | Bacteria | 7068 |
| 503 | Ga0373947_0024055 | 3300035725 | Bacteria | 3547 |
| 504 | Ga0373947_0026448 | 3300035725 | Bacteria | 3391 |
| 505 | Ga0373947_0032892 | 3300035725 | Bacteria | 3059 |
| 506 | Ga0373937_0135256 | 3300036401 | Bacteria | 2304 |
| 507 | Ga0373937_0135591 | 3300036401 | Bacteria | 2301 |
| 508 | Ga0373925_0017296 | 3300037068 | Bacteria | 5224 |
| 509 | Ga0373925_0024092 | 3300037068 | Bacteria | 4442 |
| 510 | Ga0373925_0024175 | 3300037068 | Bacteria | 4435 |
| 511 | Ga0373925_0088330 | 3300037068 | Bacteria | 2367 |
| 512 | Ga0395900_0004851 | 3300037418 | Bacteria | 14170 |
| 513 | Ga0395900_0041342 | 3300037418 | Bacteria | 4753 |
| 514 | Ga0395898_0044947 | 3300037466 | Bacteria | 4342 |
| 515 | Ga0395898_0184417 | 3300037466 | Bacteria | 1994 |
| 516 | Ga0395905_0003426 | 3300037471 | Bacteria | 16972 |
| 517 | Ga0395905_0213458 | 3300037471 | Bacteria | 1808 |
| 518 | Ga0436364_1203906 | 3300037853 | Bacteria | 1437 |
| 519 | Ga0436364_1224016 | 3300037853 | Bacteria | 1534 |
| 520 | Ga0395901_0036503 | 3300038443 | Bacteria | 5081 |
| 521 | Ga0395901_0071006 | 3300038443 | Bacteria | 3628 |
| 522 | Ga0395901_0243494 | 3300038443 | Bacteria | 1875 |
| 523 | Ga0436365_0420080 | 3300039437 | Bacteria | 1626 |
| 524 | Ga0436365_0491541 | 3300039437 | Bacteria | 9725 |
| 525 | Ga0436365_0753572 | 3300039437 | Bacteria | 3243 |
| 526 | Ga0436365_0875735 | 3300039437 | Bacteria | 999 |
| 527 | Ga0436365_0989203 | 3300039437 | Bacteria | 3792 |
| 528 | Ga0436360_0811287 | 3300039438 | Bacteria | 1730 |
| 529 | Ga0436361_0752651 | 3300039447 | Bacteria | 1971 |
| 530 | Ga0436361_1023822 | 3300039447 | Bacteria | 2203 |
| 531 | Ga0436363_1043107 | 3300039450 | Bacteria | 990 |
| 532 | Ga0436363_1063318 | 3300039450 | Bacteria | 1589 |
| 533 | Ga0436362_0326507 | 3300039453 | Bacteria | 3270 |
| 534 | Ga0436362_1208454 | 3300039453 | Bacteria | 2707 |
| 535 | Ga0451791_1288432 | 3300041451 | Bacteria | 1394 |
| 536 | Ga0439431_0005614 | 3300041997 | Bacteria | 2768 |
| 537 | Ga0466972_0000234 | 3300044658 | Bacteria | 38265 |
| 538 | Ga0466972_0004129 | 3300044658 | Bacteria | 7249 |
| 539 | Ga0466966_0001471 | 3300044684 | Bacteria | 15165 |
| 540 | Ga0466961_0004761 | 3300044693 | Bacteria | 8540 |
| 541 | Ga0466963_0014602 | 3300044694 | Bacteria | 4847 |
| 542 | Ga0466964_0078152 | 3300044706 | Bacteria | 1414 |
| 543 | Ga0466968_0001995 | 3300044735 | Bacteria | 7417 |
| 544 | Ga0466970_0226211 | 3300044765 | Bacteria | 1045 |
| 545 | Ga0466957_0041259 | 3300044842 | Bacteria | 2791 |
| 546 | Ga0466957_0073853 | 3300044842 | Bacteria | 2114 |
| 547 | Ga0466960_0010923 | 3300044901 | Bacteria | 3781 |
| 548 | Ga0466959_0005681 | 3300045049 | Bacteria | 8582 |
| 549 | Ga0466967_0037023 | 3300045976 | Bacteria | 4171 |
| 550 | Ga0466967_0116898 | 3300045976 | Bacteria | 2457 |
| 551 | Ga0495617_015362 | 3300046452 | Bacteria | 2595 |
| 552 | Ga0495592_0002294 | 3300046454 | Bacteria | 13487 |
| 553 | Ga0495592_0008791 | 3300046454 | Bacteria | 7584 |
| 554 | Ga0495592_0012750 | 3300046454 | Bacteria | 6390 |
| 555 | Ga0495603_0000182 | 3300046455 | Bacteria | 32426 |
| 556 | Ga0495603_0050821 | 3300046455 | Bacteria | 2464 |
| 557 | Ga0495603_0102705 | 3300046455 | Bacteria | 1669 |
| 558 | Ga0495629_0000314 | 3300046459 | Bacteria | 41394 |
| 559 | Ga0495629_0000529 | 3300046459 | Bacteria | 31881 |
| 560 | Ga0495629_0006021 | 3300046459 | Bacteria | 9020 |
| 561 | Ga0495629_0088690 | 3300046459 | Bacteria | 2158 |
| 562 | Ga0495638_0004876 | 3300046460 | Bacteria | 10095 |
| 563 | Ga0495638_0037355 | 3300046460 | Bacteria | 3089 |
| 564 | Ga0495641_0001508 | 3300046461 | Bacteria | 19835 |
| 565 | Ga0495641_0028046 | 3300046461 | Bacteria | 2729 |
| 566 | Ga0495651_0019479 | 3300046462 | Bacteria | 5260 |
| 567 | Ga0495651_0054726 | 3300046462 | Bacteria | 3067 |
| 568 | Ga0495651_0068966 | 3300046462 | Bacteria | 2694 |
| 569 | Ga0495653_0085999 | 3300046463 | Bacteria | 2311 |
| 570 | Ga0495580_0002541 | 3300046472 | Bacteria | 15893 |
| 571 | Ga0495580_0073929 | 3300046472 | Bacteria | 2379 |
| 572 | Ga0495582_0003777 | 3300046473 | Bacteria | 8536 |
| 573 | Ga0495582_0036076 | 3300046473 | Bacteria | 2719 |
| 574 | Ga0495605_0057559 | 3300046474 | Bacteria | 1870 |
| 575 | Ga0495605_0130215 | 3300046474 | Bacteria | 1135 |
| 576 | Ga0495639_0006669 | 3300046475 | Bacteria | 4968 |
| 577 | Ga0495639_0036657 | 3300046475 | Bacteria | 2197 |
| 578 | Ga0495662_0001470 | 3300046476 | Bacteria | 11662 |
| 579 | Ga0495662_0016856 | 3300046476 | Bacteria | 3536 |
| 580 | Ga0495664_0001204 | 3300046477 | Bacteria | 13527 |
| 581 | Ga0495664_0009660 | 3300046477 | Bacteria | 5401 |
| 582 | Ga0495664_0049429 | 3300046477 | Bacteria | 2496 |
| 583 | Ga0495585_0042555 | 3300046492 | Bacteria | 2543 |
| 584 | Ga0495585_0103848 | 3300046492 | Bacteria | 1517 |
| 585 | Ga0495585_0121616 | 3300046492 | Bacteria | 1381 |
| 586 | Ga0495594_0000302 | 3300046499 | Bacteria | 24227 |
| 587 | Ga0495594_0150379 | 3300046499 | Bacteria | 1322 |
| 588 | Ga0495594_0155965 | 3300046499 | Bacteria | 1297 |
| 589 | Ga0495596_0048678 | 3300046500 | Bacteria | 1662 |
| 590 | Ga0495607_0110869 | 3300046501 | Bacteria | 1455 |
| 591 | Ga0495583_0049204 | 3300046506 | Bacteria | 1932 |
| 592 | Ga0495606_0053703 | 3300046507 | Bacteria | 2613 |
| 593 | Ga0495606_0101227 | 3300046507 | Bacteria | 1754 |
| 594 | Ga0495606_0116865 | 3300046507 | Bacteria | 1601 |
| 595 | Ga0495608_0022254 | 3300046511 | Bacteria | 4344 |
| 596 | Ga0495608_0100321 | 3300046511 | Bacteria | 1867 |
| 597 | Ga0495610_0032809 | 3300046512 | Bacteria | 2692 |
| 598 | Ga0495610_0046207 | 3300046512 | Bacteria | 2150 |
| 599 | Ga0495610_0057061 | 3300046512 | Bacteria | 1874 |
| 600 | Ga0495616_0018412 | 3300046513 | Bacteria | 3834 |
| 601 | Ga0495616_0033846 | 3300046513 | Bacteria | 2658 |
| 602 | Ga0495618_0008828 | 3300046514 | Bacteria | 6087 |
| 603 | Ga0495618_0043480 | 3300046514 | Bacteria | 2834 |
| 604 | Ga0495620_0021818 | 3300046515 | Bacteria | 3101 |
| 605 | Ga0495620_0036803 | 3300046515 | Bacteria | 2186 |
| 606 | Ga0495628_0003600 | 3300046516 | Bacteria | 13866 |
| 607 | Ga0495628_0014010 | 3300046516 | Bacteria | 6732 |
| 608 | Ga0495628_0061793 | 3300046516 | Bacteria | 2937 |
| 609 | Ga0495630_0002415 | 3300046517 | Bacteria | 12968 |
| 610 | Ga0495630_0137068 | 3300046517 | Bacteria | 1860 |
| 611 | Ga0495630_0318631 | 3300046517 | Bacteria | 1188 |
| 612 | Ga0495631_0029165 | 3300046518 | Bacteria | 2512 |
| 613 | Ga0495631_0072260 | 3300046518 | Bacteria | 1490 |
| 614 | Ga0495632_0030152 | 3300046519 | Bacteria | 2818 |
| 615 | Ga0495643_0019789 | 3300046522 | Bacteria | 3891 |
| 616 | Ga0495644_0030462 | 3300046523 | Bacteria | 2037 |
| 617 | Ga0495648_0006267 | 3300046524 | Bacteria | 9733 |
| 618 | Ga0495648_0079676 | 3300046524 | Bacteria | 1868 |
| 619 | Ga0495648_0123557 | 3300046524 | Bacteria | 1387 |
| 620 | Ga0495652_0006258 | 3300046529 | Bacteria | 11097 |
| 621 | Ga0495652_0024151 | 3300046529 | Bacteria | 5382 |
| 622 | Ga0495652_0050577 | 3300046529 | Bacteria | 3552 |
| 623 | Ga0495652_0166992 | 3300046529 | Bacteria | 1702 |
| 624 | Ga0495652_0358591 | 3300046529 | Bacteria | 1042 |
| 625 | Ga0495654_0023326 | 3300046530 | Bacteria | 3205 |
| 626 | Ga0495665_0000619 | 3300046531 | Bacteria | 18044 |
| 627 | Ga0495640_0000308 | 3300046533 | Bacteria | 33750 |
| 628 | Ga0495640_0010418 | 3300046533 | Bacteria | 7189 |
| 629 | Ga0495640_0014432 | 3300046533 | Bacteria | 5978 |
| 630 | Ga0495640_0032685 | 3300046533 | Bacteria | 3703 |
| 631 | Ga0495640_0044770 | 3300046533 | Bacteria | 3075 |
| 632 | Ga0495640_0149628 | 3300046533 | Bacteria | 1501 |
| 633 | Ga0495587_0030628 | 3300046536 | Bacteria | 3262 |
| 634 | Ga0495597_0065137 | 3300046542 | Bacteria | 1581 |
| 635 | Ga0495645_0002277 | 3300046543 | Bacteria | 13061 |
| 636 | Ga0495645_0011116 | 3300046543 | Bacteria | 6328 |
| 637 | Ga0495645_0063315 | 3300046543 | Bacteria | 2678 |
| 638 | Ga0495645_0102497 | 3300046543 | Bacteria | 2034 |
| 639 | Ga0495622_0002921 | 3300046557 | Bacteria | 8156 |
| 640 | Ga0495622_0013329 | 3300046557 | Bacteria | 3814 |
| 641 | Ga0495622_0016867 | 3300046557 | Bacteria | 3400 |
| 642 | Ga0495622_0031501 | 3300046557 | Bacteria | 2478 |
| 643 | Ga0495622_0054035 | 3300046557 | Bacteria | 1863 |
| 644 | Ga0495667_0004819 | 3300046559 | Bacteria | 9123 |
| 645 | Ga0495667_0077408 | 3300046559 | Bacteria | 2163 |
| 646 | Ga0495667_0139683 | 3300046559 | Bacteria | 1561 |
| 647 | Ga0495667_0166789 | 3300046559 | Bacteria | 1416 |
| 648 | Ga0495668_0023015 | 3300046616 | Bacteria | 3557 |
| 649 | Ga0495668_0026224 | 3300046616 | Bacteria | 3308 |
| 650 | Ga0495668_0164858 | 3300046616 | Bacteria | 1214 |
| 651 | Ga0495634_0001483 | 3300046642 | Bacteria | 20763 |
| 652 | Ga0495634_0034146 | 3300046642 | Bacteria | 3492 |
| 653 | Ga0495634_0083778 | 3300046642 | Bacteria | 2080 |
| 654 | Ga0495634_0096856 | 3300046642 | Bacteria | 1910 |
| 655 | Ga0495635_0000429 | 3300046663 | Bacteria | 26634 |
| 656 | Ga0495635_0038449 | 3300046663 | Bacteria | 3313 |
| 657 | Ga0495635_0074254 | 3300046663 | Bacteria | 2329 |
| 658 | Ga0495661_0023684 | 3300046665 | Bacteria | 3981 |
| 659 | Ga0495588_0003361 | 3300046674 | Bacteria | 6953 |
| 660 | Ga0495588_0130092 | 3300046674 | Bacteria | 1328 |
| 661 | Ga0495588_0194935 | 3300046674 | Bacteria | 1070 |
| 662 | Ga0495657_0015079 | 3300046675 | Bacteria | 5665 |
| 663 | Ga0495657_0026788 | 3300046675 | Bacteria | 4078 |
| 664 | Ga0495657_0095578 | 3300046675 | Bacteria | 1899 |
| 665 | Ga0495599_0005767 | 3300046678 | Bacteria | 7430 |
| 666 | Ga0495599_0025597 | 3300046678 | Bacteria | 3694 |
| 667 | Ga0495599_0039352 | 3300046678 | Bacteria | 2971 |
| 668 | Ga0495623_0022432 | 3300046679 | Bacteria | 4078 |
| 669 | Ga0495623_0042017 | 3300046679 | Bacteria | 2914 |
| 670 | Ga0495646_0029121 | 3300046680 | Bacteria | 3453 |
| 671 | Ga0495646_0097496 | 3300046680 | Bacteria | 1689 |
| 672 | Ga0495646_0100369 | 3300046680 | Bacteria | 1660 |
| 673 | Ga0495647_0026282 | 3300046681 | Bacteria | 2131 |
| 674 | Ga0495658_0000936 | 3300046683 | Bacteria | 15569 |
| 675 | Ga0495669_0039321 | 3300046684 | Bacteria | 2094 |
| 676 | Ga0495669_0046821 | 3300046684 | Bacteria | 1931 |
| 677 | Ga0495613_0006256 | 3300046689 | Bacteria | 8900 |
| 678 | Ga0495613_0095971 | 3300046689 | Bacteria | 2144 |
| 679 | Ga0495613_0131395 | 3300046689 | Bacteria | 1793 |
| 680 | Ga0495624_0000810 | 3300046690 | Bacteria | 24701 |
| 681 | Ga0495670_0030273 | 3300046691 | Bacteria | 2689 |
| 682 | Ga0495670_0082982 | 3300046691 | Bacteria | 1634 |
| 683 | Ga0495670_0141755 | 3300046691 | Bacteria | 1257 |
| 684 | Ga0495671_0064047 | 3300046692 | Bacteria | 1810 |
| 685 | Ga0495649_0089456 | 3300046694 | Bacteria | 1642 |
| 686 | Ga0495649_0099633 | 3300046694 | Bacteria | 1545 |
| 687 | Ga0495649_0102231 | 3300046694 | Bacteria | 1522 |
| 688 | Ga0495600_0011127 | 3300046809 | Bacteria | 5602 |
| 689 | Ga0495600_0053775 | 3300046809 | Bacteria | 2629 |
| 690 | Ga0495600_0072440 | 3300046809 | Bacteria | 2250 |
| 691 | Ga0495600_0177477 | 3300046809 | Bacteria | 1373 |
| 692 | Ga0495581_0000683 | 3300047315 | Bacteria | 17799 |
| 693 | Ga0495581_0091563 | 3300047315 | Bacteria | 1764 |
| 694 | Ga0495581_0147504 | 3300047315 | Bacteria | 1373 |
| 695 | Ga0495581_0155164 | 3300047315 | Bacteria | 1338 |
| 696 | Ga0495581_0162878 | 3300047315 | Bacteria | 1304 |
| 697 | Ga0495604_0190660 | 3300047317 | Bacteria | 1428 |
| 698 | Ga0495636_0111990 | 3300047318 | Bacteria | 1201 |
| 699 | Ga0495674_0012056 | 3300047319 | Bacteria | 8146 |
| 700 | Ga0495674_0033712 | 3300047319 | Bacteria | 4635 |
| 701 | Ga0495674_0055960 | 3300047319 | Bacteria | 3457 |
| 702 | Ga0495674_0146672 | 3300047319 | Bacteria | 1981 |
| 703 | Ga0495674_0182108 | 3300047319 | Bacteria | 1749 |
| 704 | Ga0495672_0036537 | 3300047320 | Bacteria | 3015 |
| 705 | Ga0495672_0109264 | 3300047320 | Bacteria | 1486 |
| 706 | Ga0495672_0121063 | 3300047320 | Bacteria | 1391 |
| 707 | Ga0495672_0151379 | 3300047320 | Bacteria | 1203 |
| 708 | Ga0495676_0005624 | 3300047321 | Bacteria | 11492 |
| 709 | Ga0495676_0008153 | 3300047321 | Bacteria | 9610 |
| 710 | Ga0495676_0180423 | 3300047321 | Bacteria | 1480 |
| 711 | Ga0495680_0010179 | 3300047322 | Bacteria | 8401 |
| 712 | Ga0495680_0014721 | 3300047322 | Bacteria | 6762 |
| 713 | Ga0495683_0121561 | 3300047323 | Bacteria | 1238 |
| 714 | Ga0495687_057029 | 3300047443 | Bacteria | 1626 |
| 715 | Ga0495675_0037224 | 3300047444 | Bacteria | 3098 |
| 716 | Ga0495675_0054237 | 3300047444 | Bacteria | 2544 |
| 717 | Ga0495677_0025193 | 3300047445 | Bacteria | 2158 |
| 718 | Ga0495673_0013795 | 3300047469 | Bacteria | 4224 |
| 719 | Ga0495673_0021484 | 3300047469 | Bacteria | 3185 |
| 720 | Ga0495673_0111641 | 3300047469 | Bacteria | 1092 |
| 721 | Ga0495684_0000497 | 3300047471 | Bacteria | 32091 |
| 722 | Ga0495686_0148098 | 3300047472 | Bacteria | 1380 |
| 723 | Ga0495593_0000370 | 3300047673 | Bacteria | 24754 |
| 724 | Ga0495593_0001303 | 3300047673 | Bacteria | 14631 |
| 725 | Ga0495593_0062481 | 3300047673 | Bacteria | 1946 |
| 726 | Ga0495593_0087448 | 3300047673 | Bacteria | 1607 |
| 727 | Ga0495593_0127035 | 3300047673 | Bacteria | 1296 |
| 728 | Ga0495602_0016617 | 3300048088 | Bacteria | 7397 |
| 729 | Ga0495614_0039902 | 3300048089 | Bacteria | 2015 |
| 730 | Ga0495626_0132943 | 3300048091 | Bacteria | 1061 |
| 731 | Ga0496100_0074805 | 3300048903 | Bacteria | 2270 |
| 732 | Ga0496100_0257320 | 3300048903 | Bacteria | 1293 |
| 733 | Ga0496100_0305751 | 3300048903 | Bacteria | 1191 |
| 734 | Ga0496101_0019312 | 3300048904 | Bacteria | 4651 |
| 735 | Ga0496101_0118861 | 3300048904 | Bacteria | 1996 |
| 736 | Ga0496101_0137936 | 3300048904 | Bacteria | 1857 |
| 737 | Ga0496102_0005110 | 3300048905 | Bacteria | 11116 |
| 738 | Ga0496102_0014065 | 3300048905 | Bacteria | 6950 |
| 739 | Ga0496102_0179545 | 3300048905 | Bacteria | 1994 |
| 740 | Ga0496103_0017732 | 3300048906 | Bacteria | 4263 |
| 741 | Ga0496104_0010695 | 3300048907 | Bacteria | 8204 |
| 742 | Ga0496104_0069857 | 3300048907 | Bacteria | 3338 |
| 743 | Ga0496104_0264148 | 3300048907 | Bacteria | 1634 |
| 744 | Ga0496104_0299001 | 3300048907 | Bacteria | 1521 |
| 745 | Ga0496105_0035781 | 3300048908 | Bacteria | 4089 |
| 746 | Ga0496105_0063923 | 3300048908 | Bacteria | 3036 |
| 747 | Ga0496105_0150277 | 3300048908 | Bacteria | 1914 |
| 748 | Ga0496105_0167151 | 3300048908 | Bacteria | 1804 |
| 749 | Ga0496105_0234502 | 3300048908 | Bacteria | 1490 |
| 750 | Ga0496106_0007339 | 3300048909 | Bacteria | 8148 |
| 751 | Ga0496106_0009281 | 3300048909 | Bacteria | 7270 |
| 752 | Ga0496106_0070891 | 3300048909 | Bacteria | 2662 |
| 753 | Ga0496106_0220068 | 3300048909 | Bacteria | 1514 |
| 754 | Ga0496106_0236296 | 3300048909 | Bacteria | 1460 |
| 755 | Ga0496107_0012775 | 3300048910 | Bacteria | 5867 |
| 756 | Ga0496107_0042429 | 3300048910 | Bacteria | 3267 |
| 757 | Ga0496107_0114376 | 3300048910 | Bacteria | 1985 |
| 758 | Ga0496107_0258453 | 3300048910 | Bacteria | 1296 |
| 759 | Ga0496107_0441466 | 3300048910 | Bacteria | 967 |
| 760 | Ga0496108_0001270 | 3300048911 | Bacteria | 19743 |
| 761 | Ga0496108_0025132 | 3300048911 | Bacteria | 4907 |
| 762 | Ga0496108_0132477 | 3300048911 | Bacteria | 2142 |
| 763 | Ga0496108_0292098 | 3300048911 | Bacteria | 1419 |
| 764 | Ga0496109_0001572 | 3300048912 | Bacteria | 19042 |
| 765 | Ga0496109_0093609 | 3300048912 | Bacteria | 2781 |
| 766 | Ga0496109_0111042 | 3300048912 | Bacteria | 2549 |
| 767 | Ga0496110_0075443 | 3300048913 | Bacteria | 2996 |
| 768 | Ga0496110_0117639 | 3300048913 | Bacteria | 2393 |
| 769 | Ga0496110_0187701 | 3300048913 | Bacteria | 1877 |
| 770 | Ga0496110_0290131 | 3300048913 | Bacteria | 1490 |
| 771 | Ga0496110_0342296 | 3300048913 | Bacteria | 1362 |
| 772 | Ga0496111_0005572 | 3300048914 | Bacteria | 8093 |
| 773 | Ga0496111_0165583 | 3300048914 | Bacteria | 1642 |
| 774 | Ga0496112_0009102 | 3300048915 | Bacteria | 8924 |
| 775 | Ga0496112_0033395 | 3300048915 | Bacteria | 5002 |
| 776 | Ga0496112_0052144 | 3300048915 | Bacteria | 4014 |
| 777 | Ga0496112_0252013 | 3300048915 | Bacteria | 1716 |
| 778 | Ga0496113_0018458 | 3300048916 | Bacteria | 4859 |
| 779 | Ga0496113_0036524 | 3300048916 | Bacteria | 3600 |
| 780 | Ga0496114_0002069 | 3300048917 | Bacteria | 15273 |
| 781 | Ga0496114_0218598 | 3300048917 | Bacteria | 1672 |
| 782 | Ga0496114_0275343 | 3300048917 | Bacteria | 1483 |
| 783 | Ga0496114_0356741 | 3300048917 | Bacteria | 1293 |
| 784 | Ga0496114_0472319 | 3300048917 | Bacteria | 1110 |
| 785 | Ga0496115_0005035 | 3300048918 | Bacteria | 9600 |
| 786 | Ga0496116_0010029 | 3300048919 | Bacteria | 7990 |
| 787 | Ga0496116_0088561 | 3300048919 | Bacteria | 1891 |
| 788 | Ga0496117_0042436 | 3300048920 | Bacteria | 3319 |
| 789 | Ga0496117_0055758 | 3300048920 | Bacteria | 2758 |
| 790 | Ga0496118_0004035 | 3300048921 | Bacteria | 17843 |
| 791 | Ga0496118_0011634 | 3300048921 | Bacteria | 8558 |
| 792 | Ga0496118_0085105 | 3300048921 | Bacteria | 2203 |
| 793 | Ga0496118_0091827 | 3300048921 | Bacteria | 2086 |
| 794 | Ga0496118_0117077 | 3300048921 | Bacteria | 1749 |
| 795 | Ga0496118_0126147 | 3300048921 | Bacteria | 1656 |
| 796 | Ga0496118_0126844 | 3300048921 | Bacteria | 1648 |
| 797 | Ga0496119_0014732 | 3300048922 | Bacteria | 6090 |
| 798 | Ga0496119_0022207 | 3300048922 | Bacteria | 4553 |
| 799 | Ga0496119_0044130 | 3300048922 | Bacteria | 2810 |
| 800 | Ga0496120_0085482 | 3300048923 | Bacteria | 1698 |
| 801 | Ga0496121_0000640 | 3300048924 | Bacteria | 65295 |
| 802 | Ga0496121_0022163 | 3300048924 | Bacteria | 6179 |
| 803 | Ga0496121_0022640 | 3300048924 | Bacteria | 6083 |
| 804 | Ga0496121_0040352 | 3300048924 | Bacteria | 4097 |
| 805 | Ga0496121_0044057 | 3300048924 | Bacteria | 3855 |
| 806 | Ga0496121_0054773 | 3300048924 | Bacteria | 3329 |
| 807 | Ga0496121_0057072 | 3300048924 | Bacteria | 3238 |
| 808 | Ga0496121_0099645 | 3300048924 | Bacteria | 2245 |
| 809 | Ga0496121_0228676 | 3300048924 | Bacteria | 1304 |
| 810 | Ga0496121_0247518 | 3300048924 | Bacteria | 1238 |
| 811 | Ga0496122_0020500 | 3300048925 | Bacteria | 5968 |
| 812 | Ga0496124_0007008 | 3300048927 | Bacteria | 12079 |
| 813 | Ga0496124_0075371 | 3300048927 | Bacteria | 2787 |
| 814 | Ga0496124_0083961 | 3300048927 | Bacteria | 2612 |
| 815 | Ga0496124_0112193 | 3300048927 | Bacteria | 2193 |
| 816 | Ga0496124_0119573 | 3300048927 | Bacteria | 2107 |
| 817 | Ga0496125_0008236 | 3300048928 | Bacteria | 10953 |
| 818 | Ga0496125_0017706 | 3300048928 | Bacteria | 6782 |
| 819 | Ga0496125_0039824 | 3300048928 | Bacteria | 4040 |
| 820 | Ga0496125_0066290 | 3300048928 | Bacteria | 2854 |
| 821 | Ga0496125_0092356 | 3300048928 | Bacteria | 2263 |
| 822 | Ga0496125_0102411 | 3300048928 | Bacteria | 2104 |
| 823 | Ga0496125_0176402 | 3300048928 | Bacteria | 1429 |
| 824 | Ga0496126_0004306 | 3300048929 | Bacteria | 17088 |
| 825 | Ga0496126_0017921 | 3300048929 | Bacteria | 7044 |
| 826 | Ga0496126_0027691 | 3300048929 | Bacteria | 5409 |
| 827 | Ga0496126_0035492 | 3300048929 | Bacteria | 4673 |
| 828 | Ga0496126_0037296 | 3300048929 | Bacteria | 4537 |
| 829 | Ga0496126_0060621 | 3300048929 | Bacteria | 3402 |
| 830 | Ga0496126_0065959 | 3300048929 | Bacteria | 3237 |
| 831 | Ga0496126_0089520 | 3300048929 | Bacteria | 2709 |
| 832 | Ga0496126_0109176 | 3300048929 | Bacteria | 2411 |
| 833 | Ga0496126_0159757 | 3300048929 | Bacteria | 1926 |
| 834 | Ga0496126_0176114 | 3300048929 | Bacteria | 1819 |
| 835 | Ga0496126_0260492 | 3300048929 | Bacteria | 1442 |
| 836 | Ga0495678_042590 | 3300049459 | Bacteria | 1809 |
| 837 | Ga0501040_0378790 | 3300049576 | Bacteria | 1015 |
| 838 | nmdc:mga03n38_98428_c1 | 3300050490 | Bacteria | 1407 |
| 839 | nmdc:mga00v17_28318_c1 | 3300050491 | Bacteria | 3280 |
| 840 | nmdc:mga0yw44_100542_c1 | 3300050492 | Bacteria | 1842 |
| 841 | nmdc:mga0yw44_125062_c1 | 3300050492 | Bacteria | 1660 |
| 842 | nmdc:mga0yw44_148721_c1 | 3300050492 | Bacteria | 1527 |
| 843 | nmdc:mga0yw44_156044_c1 | 3300050492 | Bacteria | 1492 |
| 844 | nmdc:mga0yw44_225862_c1 | 3300050492 | Bacteria | 1242 |
| 845 | nmdc:mga0yw44_234843_c1 | 3300050492 | Bacteria | 1218 |
| 846 | nmdc:mga0yw44_23941_c1 | 3300050492 | Bacteria | 3447 |
| 847 | nmdc:mga0yw44_2955_c1 | 3300050492 | Bacteria | 7405 |
| 848 | nmdc:mga0yw44_75476_c1 | 3300050492 | Bacteria | 2102 |
| 849 | nmdc:mga0k408_1944_c1 | 3300050493 | Bacteria | 11068 |
| 850 | nmdc:mga0k408_216820_c1 | 3300050493 | Bacteria | 1143 |
| 851 | nmdc:mga06z11_15815_c1 | 3300050494 | Bacteria | 3379 |
| 852 | nmdc:mga06z11_76686_c1 | 3300050494 | Bacteria | 1783 |
| 853 | nmdc:mga06z11_80473_c1 | 3300050494 | Bacteria | 1747 |
| 854 | nmdc:mga04h51_2928_c1 | 3300050495 | Bacteria | 4103 |
| 855 | nmdc:mga07m45_146231_c1 | 3300050496 | Bacteria | 1370 |
| 856 | nmdc:mga07m45_29605_c1 | 3300050496 | Bacteria | 3029 |
| 857 | nmdc:mga07m45_53044_c1 | 3300050496 | Bacteria | 2291 |
| 858 | nmdc:mga08y16_139533_c1 | 3300050511 | Bacteria | 2520 |
| 859 | nmdc:mga08y16_583004_c1 | 3300050511 | Bacteria | 1129 |
| 860 | nmdc:mga0n895_153988_c1 | 3300050512 | Bacteria | 2329 |
| 861 | nmdc:mga0n895_17055_c1 | 3300050512 | Bacteria | 6685 |
| 862 | nmdc:mga0rr50_43438_c1 | 3300050513 | Bacteria | 3289 |
| 863 | nmdc:mga0sz30_14969_c1 | 3300050516 | Bacteria | 3060 |
| 864 | nmdc:mga0sz30_97013_c1 | 3300050516 | Bacteria | 1286 |
| 865 | Ga0495601_0028296 | 3300053077 | Bacteria | 3471 |
| 866 | Ga0495601_0353374 | 3300053077 | Bacteria | 955 |
| 867 | Ga0495612_0083234 | 3300053078 | Bacteria | 1346 |
| 868 | Ga0500635_0001835 | 3300053080 | Bacteria | 5192 |
| 869 | Ga0500635_0009691 | 3300053080 | Bacteria | 2680 |
| 870 | Ga0495655_0045079 | 3300053083 | Bacteria | 1144 |
| 871 | Ga0495595_0005825 | 3300053084 | Bacteria | 4990 |
| 872 | Ga0495595_0079856 | 3300053084 | Bacteria | 1557 |
| 873 | Ga0495619_0221731 | 3300053085 | Bacteria | 1310 |
| 874 | Ga0500578_0090156 | 3300053086 | Bacteria | 1946 |
| 875 | Ga0500578_0223079 | 3300053086 | Bacteria | 1145 |
| 876 | Ga0500643_000160 | 3300053087 | Bacteria | 66845 |
| 877 | Ga0500647_0038056 | 3300053091 | Bacteria | 2303 |
| 878 | Ga0500647_0082960 | 3300053091 | Bacteria | 1537 |
| 879 | Ga0500651_0122446 | 3300053093 | Bacteria | 1578 |
| 880 | Ga0500566_0000275 | 3300053094 | Bacteria | 27858 |
| 881 | Ga0500566_0001345 | 3300053094 | Bacteria | 14355 |
| 882 | Ga0500566_0003522 | 3300053094 | Bacteria | 9339 |
| 883 | Ga0500566_0004243 | 3300053094 | Bacteria | 8554 |
| 884 | Ga0500566_0036998 | 3300053094 | Bacteria | 2829 |
| 885 | Ga0500566_0038684 | 3300053094 | Bacteria | 2759 |
| 886 | Ga0500640_000078 | 3300053095 | Bacteria | 16355 |
| 887 | Ga0500640_040439 | 3300053095 | Bacteria | 2048 |
| 888 | Ga0500641_0008813 | 3300053096 | Bacteria | 3612 |
| 889 | Ga0500641_0013142 | 3300053096 | Bacteria | 3039 |
| 890 | Ga0500641_0018495 | 3300053096 | Bacteria | 2621 |
| 891 | Ga0500648_100738 | 3300053097 | Bacteria | 1607 |
| 892 | Ga0500650_0006071 | 3300053098 | Bacteria | 4574 |
| 893 | Ga0500554_001408 | 3300053102 | Bacteria | 4652 |
| 894 | Ga0500555_008584 | 3300053103 | Bacteria | 2914 |
| 895 | Ga0500556_0000011 | 3300053104 | Bacteria | 253393 |
| 896 | Ga0500556_0011202 | 3300053104 | Bacteria | 2651 |
| 897 | Ga0500557_000128 | 3300053105 | Bacteria | 20005 |
| 898 | Ga0500569_019786 | 3300053109 | Bacteria | 1756 |
| 899 | Ga0500569_030480 | 3300053109 | Bacteria | 1509 |
| 900 | Ga0500569_057461 | 3300053109 | Bacteria | 1192 |
| 901 | Ga0500572_004738 | 3300053111 | Bacteria | 3084 |
| 902 | Ga0500572_009466 | 3300053111 | Bacteria | 2303 |
| 903 | Ga0500572_049175 | 3300053111 | Bacteria | 1250 |
| 904 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 905 | Ga0500595_009153 | 3300053119 | Bacteria | 4010 |
| 906 | Ga0500597_052598 | 3300053120 | Bacteria | 1738 |
| 907 | Ga0500607_080828 | 3300053121 | Bacteria | 1657 |
| 908 | Ga0500607_168205 | 3300053121 | Bacteria | 991 |
| 909 | Ga0500608_001666 | 3300053122 | Bacteria | 7965 |
| 910 | Ga0500608_007064 | 3300053122 | Bacteria | 4616 |
| 911 | Ga0500608_008201 | 3300053122 | Bacteria | 4375 |
| 912 | Ga0500614_001185 | 3300053123 | Bacteria | 6390 |
| 913 | Ga0500614_008073 | 3300053123 | Bacteria | 2228 |
| 914 | Ga0500618_030412 | 3300053125 | Bacteria | 1270 |
| 915 | Ga0500621_083220 | 3300053126 | Bacteria | 1281 |
| 916 | Ga0500642_0000030 | 3300053130 | Bacteria | 115114 |
| 917 | Ga0500642_0000477 | 3300053130 | Bacteria | 12415 |
| 918 | Ga0500652_001587 | 3300053131 | Bacteria | 6940 |
| 919 | Ga0500559_0000272 | 3300053136 | Bacteria | 40384 |
| 920 | Ga0500559_0001904 | 3300053136 | Bacteria | 11296 |
| 921 | Ga0500559_0096576 | 3300053136 | Bacteria | 1358 |
| 922 | Ga0500559_0104501 | 3300053136 | Bacteria | 1308 |
| 923 | Ga0500561_0011900 | 3300053137 | Bacteria | 1841 |
| 924 | Ga0500564_050860 | 3300053138 | Bacteria | 1895 |
| 925 | Ga0500568_0000246 | 3300053139 | Bacteria | 46161 |
| 926 | Ga0500573_0050681 | 3300053140 | Bacteria | 2387 |
| 927 | Ga0500577_0062271 | 3300053142 | Bacteria | 1438 |
| 928 | Ga0500586_000521 | 3300053145 | Bacteria | 7722 |
| 929 | Ga0500590_082543 | 3300053148 | Bacteria | 1575 |
| 930 | Ga0500603_000142 | 3300053150 | Bacteria | 17305 |
| 931 | Ga0500603_000280 | 3300053150 | Bacteria | 13469 |
| 932 | Ga0500603_005139 | 3300053150 | Bacteria | 2806 |
| 933 | Ga0500603_028448 | 3300053150 | Bacteria | 1426 |
| 934 | Ga0500604_0025852 | 3300053151 | Bacteria | 1689 |
| 935 | Ga0500616_0000026 | 3300053153 | Bacteria | 454314 |
| 936 | Ga0500616_0012689 | 3300053153 | Bacteria | 4925 |
| 937 | Ga0500619_002320 | 3300053154 | Bacteria | 3635 |
| 938 | Ga0500619_019648 | 3300053154 | Bacteria | 1918 |
| 939 | Ga0500620_000583 | 3300053155 | Bacteria | 6280 |
| 940 | Ga0500622_0046926 | 3300053156 | Bacteria | 2231 |
| 941 | Ga0500627_0015386 | 3300053158 | Bacteria | 2956 |
| 942 | Ga0500627_0026563 | 3300053158 | Bacteria | 2391 |
| 943 | Ga0500630_000325 | 3300053159 | Bacteria | 19853 |
| 944 | Ga0500630_011616 | 3300053159 | Bacteria | 4335 |
| 945 | Ga0500638_010149 | 3300053162 | Bacteria | 4108 |
| 946 | Ga0500638_012640 | 3300053162 | Bacteria | 3790 |
| 947 | Ga0500638_016517 | 3300053162 | Bacteria | 3408 |
| 948 | Ga0500638_084844 | 3300053162 | Bacteria | 1499 |
| 949 | Ga0500639_000217 | 3300053163 | Bacteria | 28559 |
| 950 | Ga0500639_060538 | 3300053163 | Bacteria | 1951 |
| 951 | Ga0500636_0001993 | 3300053177 | Bacteria | 11232 |
| 952 | Ga0500636_0022787 | 3300053177 | Bacteria | 3701 |
| 953 | Ga0500636_0047123 | 3300053177 | Bacteria | 2539 |
| 954 | Ga0500636_0157011 | 3300053177 | Bacteria | 1244 |
| 955 | Ga0500637_0002475 | 3300053178 | Bacteria | 8223 |
| 956 | Ga0500637_0005209 | 3300053178 | Bacteria | 6273 |
| 957 | Ga0500637_0020934 | 3300053178 | Bacteria | 3548 |
| 958 | Ga0500637_0128031 | 3300053178 | Bacteria | 1473 |
| 959 | Ga0500625_014183 | 3300053729 | Bacteria | 3677 |
| 960 | Ga0500552_012310 | 3300053733 | Bacteria | 1091 |
| 961 | Ga0500596_000321 | 3300053735 | Bacteria | 8562 |
| 962 | Ga0500596_006983 | 3300053735 | Bacteria | 1872 |
| 963 | Ga0500596_008711 | 3300053735 | Bacteria | 1610 |
| 964 | Ga0500599_001767 | 3300053736 | Bacteria | 2529 |
| 965 | Ga0500601_000795 | 3300053737 | Bacteria | 4001 |
| 966 | Ga0500601_001697 | 3300053737 | Bacteria | 2369 |
| 967 | Ga0500601_012351 | 3300053737 | Bacteria | 964 |
| 968 | Ga0500613_007657 | 3300053738 | Bacteria | 1134 |
| 969 | Ga0500587_008712 | 3300053739 | Bacteria | 1303 |
| 970 | Ga0500661_000198 | 3300055283 | Bacteria | 10649 |
| 971 | Ga0500661_011296 | 3300055283 | Bacteria | 1616 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053122 | Ga0500608_008201 | Ga0500608_008201_3634_4356 | 233 |
| 2 | 3300053136 | Ga0500559_0001904 | Ga0500559_0001904_22_744 | 233 |
| 3 | 3300053077 | Ga0495601_0353374 | Ga0495601_0353374_206_931 | 234 |
| 4 | 3300046518 | Ga0495631_0072260 | Ga0495631_0072260_15_764 | 245 |
| 5 | 3300053086 | Ga0500578_0223079 | Ga0500578_0223079_350_1132 | 253 |
| 6 | 3300005983 | Ga0081540_1019100 | Ga0081540_10191005 | 267 |
| 7 | 3300046472 | Ga0495580_0073929 | Ga0495580_0073929_597_1475 | 267 |
| 8 | 3300046642 | Ga0495634_0034146 | Ga0495634_0034146_652_1539 | 267 |
| 9 | 3300047673 | Ga0495593_0062481 | Ga0495593_0062481_423_1301 | 267 |
| 10 | 3300053078 | Ga0495612_0083234 | Ga0495612_0083234_275_1162 | 267 |
| 11 | 3300046499 | Ga0495594_0155965 | Ga0495594_0155965_275_1096 | 268 |
| 12 | 3300006028 | Ga0070717_10042253 | Ga0070717_100422533 | 271 |
| 13 | 3300035113 | Ga0373936_0008591 | Ga0373936_0008591_1774_2652 | 271 |
| 14 | 3300053080 | Ga0500635_0001835 | Ga0500635_0001835_3722_4597 | 271 |
| 15 | 3300053091 | Ga0500647_0038056 | Ga0500647_0038056_874_1752 | 271 |
| 16 | 3300053094 | Ga0500566_0004243 | Ga0500566_0004243_6599_7477 | 271 |
| 17 | 3300053095 | Ga0500640_040439 | Ga0500640_040439_816_1694 | 271 |
| 18 | 3300053102 | Ga0500554_001408 | Ga0500554_001408_3137_4012 | 271 |
| 19 | 3300053111 | Ga0500572_009466 | Ga0500572_009466_839_1717 | 271 |
| 20 | 3300053123 | Ga0500614_008073 | Ga0500614_008073_814_1692 | 271 |
| 21 | 3300053150 | Ga0500603_000280 | Ga0500603_000280_614_1489 | 271 |
| 22 | 3300053150 | Ga0500603_005139 | Ga0500603_005139_1088_1966 | 271 |
| 23 | 3300053159 | Ga0500630_011616 | Ga0500630_011616_2875_3753 | 271 |
| 24 | 3300053162 | Ga0500638_010149 | Ga0500638_010149_151_978 | 271 |
| 25 | 3300053162 | Ga0500638_084844 | Ga0500638_084844_105_983 | 271 |
| 26 | 3300053163 | Ga0500639_060538 | Ga0500639_060538_408_1286 | 271 |
| 27 | 3300053178 | Ga0500637_0005209 | Ga0500637_0005209_3896_4771 | 271 |
| 28 | 3300053735 | Ga0500596_008711 | Ga0500596_008711_622_1500 | 271 |
| 29 | 3300053737 | Ga0500601_012351 | Ga0500601_012351_28_906 | 271 |
| 30 | 3300005539 | Ga0068853_100381150 | Ga0068853_1003811501 | 273 |
| 31 | 3300047319 | Ga0495674_0182108 | Ga0495674_0182108_25_870 | 273 |
| 32 | 3300050492 | nmdc:mga0yw44_156044_c1 | nmdc:mga0yw44_156044_c1_494_1327 | 273 |
| 33 | 3300009551 | Ga0105238_10301875 | Ga0105238_103018752 | 274 |
| 34 | 3300048917 | Ga0496114_0356741 | Ga0496114_0356741_447_1283 | 274 |
| 35 | 3300053085 | Ga0495619_0221731 | Ga0495619_0221731_426_1262 | 274 |
| 36 | 3300015261 | Ga0182006_1092671 | Ga0182006_10926712 | 275 |
| 37 | 3300044842 | Ga0466957_0041259 | Ga0466957_0041259_1086_1925 | 275 |
| 38 | 3300053729 | Ga0500625_014183 | Ga0500625_014183_2511_3392 | 275 |
| 39 | 3300006942 | Ga0099824_1014090 | Ga0099824_10140903 | 276 |
| 40 | 3300027296 | Ga0209389_1000104 | Ga0209389_100010463 | 276 |
| 41 | 3300027357 | Ga0209589_1000159 | Ga0209589_10001593 | 276 |
| 42 | 3300027361 | Ga0209489_100194 | Ga0209489_1001943 | 276 |
| 43 | 3300035695 | Ga0373927_0113445 | Ga0373927_0113445_819_1697 | 277 |
| 44 | 3300039450 | Ga0436363_1043107 | Ga0436363_1043107_23_868 | 277 |
| 45 | 3300041997 | Ga0439431_0005614 | Ga0439431_0005614_1874_2755 | 277 |
| 46 | 3300047320 | Ga0495672_0036537 | Ga0495672_0036537_1710_2564 | 278 |
| 47 | iso_pu_bacteria | 2513237096 | 2513661626 | 278 |
| 48 | iso_pu_bacteria | 2513237137 | 2513863099 | 278 |
| 49 | iso_pu_bacteria | 2513237145 | 2513923319 | 278 |
| 50 | iso_pu_bacteria | 2517572143 | 2517889118 | 278 |
| 51 | iso_pu_bacteria | 2667528175 | 2671121596 | 278 |
| 52 | iso_pu_bacteria | 2885374607 | 2885378053 | 278 |
| 53 | iso_pu_bacteria | 2903748898 | 2903754208 | 278 |
| 54 | iso_pu_bacteria | 2906635258 | 2906643040 | 278 |
| 55 | iso_pu_bacteria | 2906660503 | 2906668193 | 278 |
| 56 | iso_pu_bacteria | 2908739725 | 2908747730 | 278 |
| 57 | iso_pu_bacteria | 2922425934 | 2922433931 | 278 |
| 58 | iso_pu_bacteria | 2935630451 | 2935634950 | 278 |
| 59 | iso_pu_bacteria | 2941507105 | 2941514262 | 278 |
| 60 | iso_pu_bacteria | 2941515067 | 2941522223 | 278 |
| 61 | iso_pu_bacteria | 2941523033 | 2941530094 | 278 |
| 62 | iso_pu_bacteria | 8019555841 | 8019562740 | 278 |
| 63 | iso_pu_bacteria | 8019565922 | 8019572819 | 278 |
| 64 | iso_pu_bacteria | 2728368998 | 2728753714 | 280 |
| 65 | iso_pu_bacteria | 2728368998 | 2728755499 | 280 |
| 66 | iso_pu_bacteria | 2932794094 | 2932800051 | 280 |
| 67 | iso_pu_bacteria | 2932801729 | 2932809060 | 280 |
| 68 | iso_pu_bacteria | 2935883170 | 2935888267 | 280 |
| 69 | iso_pu_bacteria | 3005594810 | 3005595295 | 280 |
| 70 | iso_pu_bacteria | 3005718088 | 3005718544 | 280 |
| 71 | iso_pu_bacteria | 2507262055 | 2507505502 | 281 |
| 72 | iso_pu_bacteria | 2508501009 | 2508539387 | 281 |
| 73 | iso_pu_bacteria | 2508501042 | 2508695718 | 281 |
| 74 | iso_pu_bacteria | 2511231028 | 2511397419 | 281 |
| 75 | iso_pu_bacteria | 2513237094 | 2513642391 | 281 |
| 76 | iso_pu_bacteria | 2513237095 | 2513652619 | 281 |
| 77 | iso_pu_bacteria | 2513237102 | 2513704756 | 281 |
| 78 | iso_pu_bacteria | 2513237104 | 2513721914 | 281 |
| 79 | iso_pu_bacteria | 2513237139 | 2513879259 | 281 |
| 80 | iso_pu_bacteria | 2513237161 | 2514016910 | 281 |
| 81 | iso_pu_bacteria | 2515154112 | 2515630202 | 281 |
| 82 | iso_pu_bacteria | 2517093001 | 2517107626 | 281 |
| 83 | iso_pu_bacteria | 2617270735 | 2617354372 | 281 |
| 84 | iso_pu_bacteria | 2617270741 | 2617377410 | 281 |
| 85 | iso_pu_bacteria | 2744054633 | 2745082743 | 281 |
| 86 | iso_pu_bacteria | 2791355196 | 2793065724 | 281 |
| 87 | iso_pu_bacteria | 2802429603 | 2805921593 | 281 |
| 88 | iso_pu_bacteria | 2816332527 | 2818239020 | 281 |
| 89 | iso_pu_bacteria | 2824600985 | 2824608459 | 281 |
| 90 | iso_pu_bacteria | 2824609381 | 2824617513 | 281 |
| 91 | iso_pu_bacteria | 2824617872 | 2824624890 | 281 |
| 92 | iso_pu_bacteria | 2824626560 | 2824633765 | 281 |
| 93 | iso_pu_bacteria | 2824635225 | 2824640938 | 281 |
| 94 | iso_pu_bacteria | 2824644064 | 2824649219 | 281 |
| 95 | iso_pu_bacteria | 2824653114 | 2824660255 | 281 |
| 96 | iso_pu_bacteria | 2824671348 | 2824678902 | 281 |
| 97 | iso_pu_bacteria | 2824679649 | 2824685674 | 281 |
| 98 | iso_pu_bacteria | 2824687955 | 2824695438 | 281 |
| 99 | iso_pu_bacteria | 2824696289 | 2824703816 | 281 |
| 100 | iso_pu_bacteria | 2824704595 | 2824713570 | 281 |
| 101 | iso_pu_bacteria | 2824714736 | 2824719400 | 281 |
| 102 | iso_pu_bacteria | 2824723954 | 2824729855 | 281 |
| 103 | iso_pu_bacteria | 2824732956 | 2824739666 | 281 |
| 104 | iso_pu_bacteria | 2824746037 | 2824751629 | 281 |
| 105 | iso_pu_bacteria | 2824753945 | 2824761405 | 281 |
| 106 | iso_pu_bacteria | 2824763712 | 2824768522 | 281 |
| 107 | iso_pu_bacteria | 2824773399 | 2824781302 | 281 |
| 108 | iso_pu_bacteria | 2838122688 | 2838130152 | 281 |
| 109 | iso_pu_bacteria | 2841941048 | 2841949213 | 281 |
| 110 | iso_pu_bacteria | 2841949485 | 2841956995 | 281 |
| 111 | iso_pu_bacteria | 2841957949 | 2841964880 | 281 |
| 112 | iso_pu_bacteria | 2841966195 | 2841974455 | 281 |
| 113 | iso_pu_bacteria | 2841974524 | 2841977387 | 281 |
| 114 | iso_pu_bacteria | 2841983080 | 2841990714 | 281 |
| 115 | iso_pu_bacteria | 2842038055 | 2842041233 | 281 |
| 116 | iso_pu_bacteria | 2842045827 | 2842049275 | 281 |
| 117 | iso_pu_bacteria | 2844315083 | 2844315719 | 281 |
| 118 | iso_pu_bacteria | 2847930680 | 2847931306 | 281 |
| 119 | iso_pu_bacteria | 2847939898 | 2847942397 | 281 |
| 120 | iso_pu_bacteria | 2849076700 | 2849083269 | 281 |
| 121 | iso_pu_bacteria | 2857509624 | 2857516428 | 281 |
| 122 | iso_pu_bacteria | 2874590934 | 2874592577 | 281 |
| 123 | iso_pu_bacteria | 2874620515 | 2874622981 | 281 |
| 124 | iso_pu_bacteria | 2874628541 | 2874636895 | 281 |
| 125 | iso_pu_bacteria | 2874645413 | 2874647401 | 281 |
| 126 | iso_pu_bacteria | 2876761206 | 2876763776 | 281 |
| 127 | iso_pu_bacteria | 2876771140 | 2876772701 | 281 |
| 128 | iso_pu_bacteria | 2876818435 | 2876820034 | 281 |
| 129 | iso_pu_bacteria | 2879074833 | 2879076539 | 281 |
| 130 | iso_pu_bacteria | 2879083081 | 2879087652 | 281 |
| 131 | iso_pu_bacteria | 2879127579 | 2879129173 | 281 |
| 132 | iso_pu_bacteria | 2879142872 | 2879144812 | 281 |
| 133 | iso_pu_bacteria | 2881364244 | 2881370020 | 281 |
| 134 | iso_pu_bacteria | 2881665667 | 2881666238 | 281 |
| 135 | iso_pu_bacteria | 2885366525 | 2885368551 | 281 |
| 136 | iso_pu_bacteria | 2885409591 | 2885410243 | 281 |
| 137 | iso_pu_bacteria | 2888378607 | 2888379334 | 281 |
| 138 | iso_pu_bacteria | 2888419890 | 2888420025 | 281 |
| 139 | iso_pu_bacteria | 2903727486 | 2903730981 | 281 |
| 140 | iso_pu_bacteria | 2904666416 | 2904668957 | 281 |
| 141 | iso_pu_bacteria | 2904711408 | 2904714023 | 281 |
| 142 | iso_pu_bacteria | 2906602504 | 2906608461 | 281 |
| 143 | iso_pu_bacteria | 2906626472 | 2906631597 | 281 |
| 144 | iso_pu_bacteria | 2906643746 | 2906652094 | 281 |
| 145 | iso_pu_bacteria | 2908775508 | 2908775939 | 281 |
| 146 | iso_pu_bacteria | 2922393267 | 2922398075 | 281 |
| 147 | iso_pu_bacteria | 2935608549 | 2935614558 | 281 |
| 148 | iso_pu_bacteria | 2935648319 | 2935654721 | 281 |
| 149 | iso_pu_bacteria | 2935656913 | 2935663601 | 281 |
| 150 | iso_pu_bacteria | 2935769743 | 2935774236 | 281 |
| 151 | iso_pu_bacteria | 2935777560 | 2935778279 | 281 |
| 152 | iso_pu_bacteria | 2935785616 | 2935789049 | 281 |
| 153 | iso_pu_bacteria | 2935793552 | 2935796799 | 281 |
| 154 | iso_pu_bacteria | 2935819856 | 2935826410 | 281 |
| 155 | iso_pu_bacteria | 2935847175 | 2935853897 | 281 |
| 156 | iso_pu_bacteria | 2935908558 | 2935915439 | 281 |
| 157 | iso_pu_bacteria | 2935916978 | 2935925085 | 281 |
| 158 | iso_pu_bacteria | 2935926038 | 2935933334 | 281 |
| 159 | iso_pu_bacteria | 2935934488 | 2935941426 | 281 |
| 160 | iso_pu_bacteria | 2935942939 | 2935949515 | 281 |
| 161 | iso_pu_bacteria | 2935951376 | 2935958310 | 281 |
| 162 | iso_pu_bacteria | 2935967501 | 2935974898 | 281 |
| 163 | iso_pu_bacteria | 2935975950 | 2935983161 | 281 |
| 164 | iso_pu_bacteria | 2935984226 | 2935985212 | 281 |
| 165 | iso_pu_bacteria | 2936011229 | 2936017757 | 281 |
| 166 | iso_pu_bacteria | 2936019824 | 2936026260 | 281 |
| 167 | iso_pu_bacteria | 2936028420 | 2936035007 | 281 |
| 168 | iso_pu_bacteria | 2936046547 | 2936053236 | 281 |
| 169 | iso_pu_bacteria | 2936055302 | 2936057027 | 281 |
| 170 | iso_pu_bacteria | 2941531003 | 2941537939 | 281 |
| 171 | iso_pu_bacteria | 3005483717 | 3005489310 | 281 |
| 172 | iso_pu_bacteria | 3005506211 | 3005511449 | 281 |
| 173 | iso_pu_bacteria | 3005587118 | 3005592339 | 281 |
| 174 | iso_pu_bacteria | 8006926726 | 8006930244 | 281 |
| 175 | iso_pu_bacteria | 8016522445 | 8016526388 | 281 |
| 176 | iso_pu_bacteria | 8016530956 | 8016531457 | 281 |
| 177 | iso_pu_bacteria | 8016539877 | 8016544667 | 281 |
| 178 | iso_pu_bacteria | 8016548790 | 8016557412 | 281 |
| 179 | iso_pu_bacteria | 8016566248 | 8016569723 | 281 |
| 180 | iso_pu_bacteria | 8016575299 | 8016582327 | 281 |
| 181 | iso_pu_bacteria | 8016583857 | 8016586084 | 281 |
| 182 | iso_pu_bacteria | 8016595262 | 8016603370 | 281 |
| 183 | iso_pu_bacteria | 8016603502 | 8016606303 | 281 |
| 184 | iso_pu_bacteria | 8016613128 | 8016618210 | 281 |
| 185 | iso_pu_bacteria | 8016622563 | 8016622862 | 281 |
| 186 | iso_pu_bacteria | 8016630954 | 8016635370 | 281 |
| 187 | iso_pu_bacteria | 8019530166 | 8019531288 | 281 |
| 188 | iso_pu_bacteria | 8019538911 | 8019540269 | 281 |
| 189 | iso_pu_bacteria | 8019547302 | 8019549862 | 281 |
| 190 | iso_pu_bacteria | 8019619141 | 8019623223 | 281 |
| 191 | iso_pu_bacteria | 8019659431 | 8019666711 | 281 |
| 192 | iso_pu_bacteria | 8019668869 | 8019676472 | 281 |
| 193 | iso_pu_bacteria | 8019678201 | 8019679519 | 281 |
| 194 | iso_pu_bacteria | 8019687851 | 8019695993 | 281 |
| 195 | iso_pu_bacteria | 8056967851 | 8056975795 | 281 |
| 196 | 3300006038 | Ga0075365_10036278 | Ga0075365_100362782 | 282 |
| 197 | 3300025261 | Ga0209233_1020134 | Ga0209233_10201342 | 282 |
| 198 | 3300033442 | Ga0315911_1000008 | Ga0315911_100000827 | 282 |
| 199 | 3300039437 | Ga0436365_0753572 | Ga0436365_0753572_2121_2996 | 282 |
| 200 | 3300048909 | Ga0496106_0220068 | Ga0496106_0220068_433_1290 | 282 |
| 201 | 3300050492 | nmdc:mga0yw44_23941_c1 | nmdc:mga0yw44_23941_c1_1561_2436 | 282 |
| 202 | iso_pu_bacteria | 2513237092 | 2513624839 | 282 |
| 203 | iso_pu_bacteria | 2513237098 | 2513671810 | 282 |
| 204 | iso_pu_bacteria | 2513237101 | 2513698877 | 282 |
| 205 | iso_pu_bacteria | 2513237141 | 2513888963 | 282 |
| 206 | iso_pu_bacteria | 2528768022 | 2528851906 | 282 |
| 207 | iso_pu_bacteria | 2602042107 | 2603861922 | 282 |
| 208 | iso_pu_bacteria | 2721755755 | 2723841883 | 282 |
| 209 | iso_pu_bacteria | 2791355199 | 2793079190 | 282 |
| 210 | iso_pu_bacteria | 2824661429 | 2824667226 | 282 |
| 211 | iso_pu_bacteria | 2857524615 | 2857530471 | 282 |
| 212 | iso_pu_bacteria | 2874604998 | 2874610523 | 282 |
| 213 | iso_pu_bacteria | 2874612657 | 2874619670 | 282 |
| 214 | iso_pu_bacteria | 2879099564 | 2879099701 | 282 |
| 215 | iso_pu_bacteria | 2879110137 | 2879115168 | 282 |
| 216 | iso_pu_bacteria | 2888388044 | 2888390446 | 282 |
| 217 | iso_pu_bacteria | 2889033259 | 2889035206 | 282 |
| 218 | iso_pu_bacteria | 2893066018 | 2893069574 | 282 |
| 219 | iso_pu_bacteria | 2903768456 | 2903774886 | 282 |
| 220 | iso_pu_bacteria | 2919073203 | 2919077366 | 282 |
| 221 | iso_pu_bacteria | 2922361189 | 2922363267 | 282 |
| 222 | iso_pu_bacteria | 2922368715 | 2922369238 | 282 |
| 223 | iso_pu_bacteria | 2922386360 | 2922388805 | 282 |
| 224 | iso_pu_bacteria | 2929615660 | 2929618862 | 282 |
| 225 | iso_pu_bacteria | 2929624759 | 2929630939 | 282 |
| 226 | iso_pu_bacteria | 2932784394 | 2932791051 | 282 |
| 227 | iso_pu_bacteria | 2932809354 | 2932817949 | 282 |
| 228 | iso_pu_bacteria | 2932818245 | 2932820580 | 282 |
| 229 | iso_pu_bacteria | 2932828146 | 2932837129 | 282 |
| 230 | iso_pu_bacteria | 2933577622 | 2933580428 | 282 |
| 231 | iso_pu_bacteria | 2935616580 | 2935624360 | 282 |
| 232 | iso_pu_bacteria | 2935638405 | 2935644351 | 282 |
| 233 | iso_pu_bacteria | 2935665750 | 2935674720 | 282 |
| 234 | iso_pu_bacteria | 2935675223 | 2935684706 | 282 |
| 235 | iso_pu_bacteria | 2935684952 | 2935686652 | 282 |
| 236 | iso_pu_bacteria | 2935694250 | 2935701670 | 282 |
| 237 | iso_pu_bacteria | 2935703347 | 2935710384 | 282 |
| 238 | iso_pu_bacteria | 2935713505 | 2935716340 | 282 |
| 239 | iso_pu_bacteria | 2935722832 | 2935723536 | 282 |
| 240 | iso_pu_bacteria | 2935732158 | 2935735091 | 282 |
| 241 | iso_pu_bacteria | 2935741537 | 2935744118 | 282 |
| 242 | iso_pu_bacteria | 2935750917 | 2935752618 | 282 |
| 243 | iso_pu_bacteria | 2935760218 | 2935764952 | 282 |
| 244 | iso_pu_bacteria | 2935801545 | 2935810504 | 282 |
| 245 | iso_pu_bacteria | 2935810662 | 2935816816 | 282 |
| 246 | iso_pu_bacteria | 2935827899 | 2935833405 | 282 |
| 247 | iso_pu_bacteria | 2935837841 | 2935846039 | 282 |
| 248 | iso_pu_bacteria | 2935855204 | 2935863079 | 282 |
| 249 | iso_pu_bacteria | 2935864058 | 2935873465 | 282 |
| 250 | iso_pu_bacteria | 2935873716 | 2935879973 | 282 |
| 251 | iso_pu_bacteria | 2935959822 | 2935966559 | 282 |
| 252 | iso_pu_bacteria | 2935992306 | 2935997805 | 282 |
| 253 | iso_pu_bacteria | 2936002035 | 2936011001 | 282 |
| 254 | iso_pu_bacteria | 2936037263 | 2936043807 | 282 |
| 255 | iso_pu_bacteria | 2940556831 | 2940558531 | 282 |
| 256 | iso_pu_bacteria | 2941538514 | 2941547080 | 282 |
| 257 | iso_pu_bacteria | 3005710791 | 3005711256 | 282 |
| 258 | iso_pu_bacteria | 8006964411 | 8006969435 | 282 |
| 259 | iso_pu_bacteria | 8006984368 | 8006988474 | 282 |
| 260 | iso_pu_bacteria | 8006994254 | 8007000715 | 282 |
| 261 | iso_pu_bacteria | 8016511872 | 8016517919 | 282 |
| 262 | iso_pu_bacteria | 8017057580 | 8017058720 | 282 |
| 263 | iso_pu_bacteria | 8019576017 | 8019576933 | 282 |
| 264 | iso_pu_bacteria | 8019586578 | 8019594996 | 282 |
| 265 | iso_pu_bacteria | 8019597564 | 8019606745 | 282 |
| 266 | iso_pu_bacteria | 8019608314 | 8019611764 | 282 |
| 267 | iso_pu_bacteria | 8055742211 | 8055742711 | 282 |
| 268 | iso_pu_bacteria | 8056673599 | 8056678605 | 282 |
| 269 | 3300003215 | JGI25153J46596_10016489 | JGI25153J46596_100164892 | 283 |
| 270 | 3300005329 | Ga0070683_100197019 | Ga0070683_1001970191 | 283 |
| 271 | 3300005434 | Ga0070709_10238639 | Ga0070709_102386392 | 283 |
| 272 | 3300005439 | Ga0070711_100105501 | Ga0070711_1001055013 | 283 |
| 273 | 3300005548 | Ga0070665_100172998 | Ga0070665_1001729982 | 283 |
| 274 | 3300005563 | Ga0068855_100188651 | Ga0068855_1001886513 | 283 |
| 275 | 3300005578 | Ga0068854_100452171 | Ga0068854_1004521711 | 283 |
| 276 | 3300006175 | Ga0070712_100217533 | Ga0070712_1002175332 | 283 |
| 277 | 3300013105 | Ga0157369_10077996 | Ga0157369_100779964 | 283 |
| 278 | 3300013296 | Ga0157374_10185651 | Ga0157374_101856511 | 283 |
| 279 | 3300025297 | Ga0209758_1001325 | Ga0209758_100132526 | 283 |
| 280 | 3300025898 | Ga0207692_10151293 | Ga0207692_101512932 | 283 |
| 281 | 3300025904 | Ga0207647_10140456 | Ga0207647_101404562 | 283 |
| 282 | 3300025914 | Ga0207671_10478798 | Ga0207671_104787981 | 283 |
| 283 | 3300025915 | Ga0207693_10044704 | Ga0207693_100447044 | 283 |
| 284 | 3300025931 | Ga0207644_10214886 | Ga0207644_102148863 | 283 |
| 285 | 3300025944 | Ga0207661_10164980 | Ga0207661_101649801 | 283 |
| 286 | 3300026067 | Ga0207678_10267163 | Ga0207678_102671632 | 283 |
| 287 | 3300026121 | Ga0207683_10069387 | Ga0207683_100693874 | 283 |
| 288 | 3300028379 | Ga0268266_10154742 | Ga0268266_101547422 | 283 |
| 289 | 3300031730 | Ga0307516_10020252 | Ga0307516_100202522 | 283 |
| 290 | 3300037418 | Ga0395900_0041342 | Ga0395900_0041342_1013_1885 | 283 |
| 291 | 3300038443 | Ga0395901_0071006 | Ga0395901_0071006_1145_2017 | 283 |
| 292 | 3300046674 | Ga0495588_0130092 | Ga0495588_0130092_107_979 | 283 |
| 293 | 3300046809 | Ga0495600_0177477 | Ga0495600_0177477_372_1247 | 283 |
| 294 | 3300048924 | Ga0496121_0022163 | Ga0496121_0022163_4160_5032 | 283 |
| 295 | 3300053094 | Ga0500566_0036998 | Ga0500566_0036998_1461_2324 | 283 |
| 296 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_59853_60716 | 283 |
| 297 | 3300053136 | Ga0500559_0104501 | Ga0500559_0104501_260_1123 | 283 |
| 298 | 3300053178 | Ga0500637_0002475 | Ga0500637_0002475_593_1456 | 283 |
| 299 | 3300055283 | Ga0500661_000198 | Ga0500661_000198_599_1462 | 283 |
| 300 | 3300005434 | Ga0070709_10012913 | Ga0070709_100129136 | 284 |
| 301 | 3300005434 | Ga0070709_10027828 | Ga0070709_100278284 | 284 |
| 302 | 3300005435 | Ga0070714_100076810 | Ga0070714_1000768104 | 284 |
| 303 | 3300005436 | Ga0070713_100049420 | Ga0070713_1000494202 | 284 |
| 304 | 3300005436 | Ga0070713_100105541 | Ga0070713_1001055412 | 284 |
| 305 | 3300005437 | Ga0070710_10000755 | Ga0070710_100007551 | 284 |
| 306 | 3300005437 | Ga0070710_10020372 | Ga0070710_100203722 | 284 |
| 307 | 3300005439 | Ga0070711_100041640 | Ga0070711_1000416402 | 284 |
| 308 | 3300005439 | Ga0070711_100053801 | Ga0070711_1000538013 | 284 |
| 309 | 3300005467 | Ga0070706_100086269 | Ga0070706_1000862692 | 284 |
| 310 | 3300005468 | Ga0070707_100041107 | Ga0070707_1000411075 | 284 |
| 311 | 3300005616 | Ga0068852_100027518 | Ga0068852_1000275183 | 284 |
| 312 | 3300005842 | Ga0068858_100306903 | Ga0068858_1003069031 | 284 |
| 313 | 3300005843 | Ga0068860_100000577 | Ga0068860_10000057735 | 284 |
| 314 | 3300005983 | Ga0081540_1022078 | Ga0081540_10220783 | 284 |
| 315 | 3300006173 | Ga0070716_100043607 | Ga0070716_1000436073 | 284 |
| 316 | 3300006175 | Ga0070712_100017728 | Ga0070712_1000177285 | 284 |
| 317 | 3300006175 | Ga0070712_100096914 | Ga0070712_1000969144 | 284 |
| 318 | 3300006942 | Ga0099824_1009104 | Ga0099824_10091049 | 284 |
| 319 | 3300006943 | Ga0099822_1011071 | Ga0099822_10110718 | 284 |
| 320 | 3300009093 | Ga0105240_10095052 | Ga0105240_100950525 | 284 |
| 321 | 3300009098 | Ga0105245_10031932 | Ga0105245_100319326 | 284 |
| 322 | 3300009174 | Ga0105241_10087362 | Ga0105241_100873623 | 284 |
| 323 | 3300009545 | Ga0105237_10031055 | Ga0105237_100310555 | 284 |
| 324 | 3300010375 | Ga0105239_10056885 | Ga0105239_100568852 | 284 |
| 325 | 3300010375 | Ga0105239_10087851 | Ga0105239_100878514 | 284 |
| 326 | 3300010375 | Ga0105239_10122522 | Ga0105239_101225222 | 284 |
| 327 | 3300010375 | Ga0105239_10378951 | Ga0105239_103789513 | 284 |
| 328 | 3300025898 | Ga0207692_10070783 | Ga0207692_100707833 | 284 |
| 329 | 3300025900 | Ga0207710_10028822 | Ga0207710_100288222 | 284 |
| 330 | 3300025905 | Ga0207685_10068231 | Ga0207685_100682312 | 284 |
| 331 | 3300025906 | Ga0207699_10004815 | Ga0207699_100048156 | 284 |
| 332 | 3300025906 | Ga0207699_10014010 | Ga0207699_100140106 | 284 |
| 333 | 3300025910 | Ga0207684_10108140 | Ga0207684_101081402 | 284 |
| 334 | 3300025910 | Ga0207684_10205152 | Ga0207684_102051522 | 284 |
| 335 | 3300025911 | Ga0207654_10031015 | Ga0207654_100310154 | 284 |
| 336 | 3300025913 | Ga0207695_10001156 | Ga0207695_100011563 | 284 |
| 337 | 3300025914 | Ga0207671_10035802 | Ga0207671_100358023 | 284 |
| 338 | 3300025914 | Ga0207671_10221960 | Ga0207671_102219601 | 284 |
| 339 | 3300025914 | Ga0207671_10248592 | Ga0207671_102485922 | 284 |
| 340 | 3300025915 | Ga0207693_10029143 | Ga0207693_100291434 | 284 |
| 341 | 3300025915 | Ga0207693_10085272 | Ga0207693_100852724 | 284 |
| 342 | 3300025916 | Ga0207663_10028317 | Ga0207663_100283175 | 284 |
| 343 | 3300025922 | Ga0207646_10028561 | Ga0207646_100285615 | 284 |
| 344 | 3300025929 | Ga0207664_10068542 | Ga0207664_100685424 | 284 |
| 345 | 3300025939 | Ga0207665_10004668 | Ga0207665_100046684 | 284 |
| 346 | 3300025939 | Ga0207665_10066810 | Ga0207665_100668102 | 284 |
| 347 | 3300027357 | Ga0209589_1001113 | Ga0209589_10011133 | 284 |
| 348 | 3300027361 | Ga0209489_101913 | Ga0209489_1019133 | 284 |
| 349 | 3300027363 | Ga0209700_101949 | Ga0209700_10194934 | 284 |
| 350 | 3300028381 | Ga0268264_10000107 | Ga0268264_10000107187 | 284 |
| 351 | 3300028556 | Ga0265337_1003913 | Ga0265337_10039134 | 284 |
| 352 | 3300028558 | Ga0265326_10006121 | Ga0265326_100061213 | 284 |
| 353 | 3300028563 | Ga0265319_1015989 | Ga0265319_10159894 | 284 |
| 354 | 3300028573 | Ga0265334_10011650 | Ga0265334_100116503 | 284 |
| 355 | 3300028577 | Ga0265318_10011203 | Ga0265318_100112034 | 284 |
| 356 | 3300028653 | Ga0265323_10000706 | Ga0265323_1000070613 | 284 |
| 357 | 3300028654 | Ga0265322_10014719 | Ga0265322_100147193 | 284 |
| 358 | 3300028666 | Ga0265336_10000683 | Ga0265336_100006834 | 284 |
| 359 | 3300028800 | Ga0265338_10001041 | Ga0265338_1000104131 | 284 |
| 360 | 3300029957 | Ga0265324_10002208 | Ga0265324_100022087 | 284 |
| 361 | 3300030521 | Ga0307511_10132317 | Ga0307511_101323172 | 284 |
| 362 | 3300030521 | Ga0307511_10188921 | Ga0307511_101889212 | 284 |
| 363 | 3300031730 | Ga0307516_10073486 | Ga0307516_100734863 | 284 |
| 364 | 3300033179 | Ga0307507_10016255 | Ga0307507_100162557 | 284 |
| 365 | 3300033180 | Ga0307510_10058529 | Ga0307510_100585292 | 284 |
| 366 | 3300035113 | Ga0373936_0015146 | Ga0373936_0015146_48_923 | 284 |
| 367 | 3300035170 | Ga0373943_0083497 | Ga0373943_0083497_169_1041 | 284 |
| 368 | 3300035692 | Ga0373935_0035198 | Ga0373935_0035198_461_1333 | 284 |
| 369 | 3300035695 | Ga0373927_0020633 | Ga0373927_0020633_2176_3048 | 284 |
| 370 | 3300035725 | Ga0373947_0032892 | Ga0373947_0032892_1081_1953 | 284 |
| 371 | 3300037068 | Ga0373925_0024175 | Ga0373925_0024175_1847_2719 | 284 |
| 372 | 3300037853 | Ga0436364_1203906 | Ga0436364_1203906_158_1039 | 284 |
| 373 | 3300044684 | Ga0466966_0001471 | Ga0466966_0001471_13053_13928 | 284 |
| 374 | 3300044693 | Ga0466961_0004761 | Ga0466961_0004761_7084_7959 | 284 |
| 375 | 3300044706 | Ga0466964_0078152 | Ga0466964_0078152_222_1091 | 284 |
| 376 | 3300044765 | Ga0466970_0226211 | Ga0466970_0226211_157_1026 | 284 |
| 377 | 3300045049 | Ga0466959_0005681 | Ga0466959_0005681_7098_7973 | 284 |
| 378 | 3300046454 | Ga0495592_0008791 | Ga0495592_0008791_6677_7555 | 284 |
| 379 | 3300046459 | Ga0495629_0006021 | Ga0495629_0006021_1773_2642 | 284 |
| 380 | 3300046462 | Ga0495651_0019479 | Ga0495651_0019479_762_1640 | 284 |
| 381 | 3300046462 | Ga0495651_0054726 | Ga0495651_0054726_603_1472 | 284 |
| 382 | 3300046474 | Ga0495605_0130215 | Ga0495605_0130215_216_1082 | 284 |
| 383 | 3300046476 | Ga0495662_0016856 | Ga0495662_0016856_2388_3257 | 284 |
| 384 | 3300046477 | Ga0495664_0001204 | Ga0495664_0001204_5923_6801 | 284 |
| 385 | 3300046507 | Ga0495606_0053703 | Ga0495606_0053703_811_1683 | 284 |
| 386 | 3300046511 | Ga0495608_0100321 | Ga0495608_0100321_404_1273 | 284 |
| 387 | 3300046514 | Ga0495618_0043480 | Ga0495618_0043480_480_1349 | 284 |
| 388 | 3300046516 | Ga0495628_0061793 | Ga0495628_0061793_612_1490 | 284 |
| 389 | 3300046517 | Ga0495630_0137068 | Ga0495630_0137068_640_1518 | 284 |
| 390 | 3300046524 | Ga0495648_0006267 | Ga0495648_0006267_7955_8827 | 284 |
| 391 | 3300046529 | Ga0495652_0006258 | Ga0495652_0006258_2378_3256 | 284 |
| 392 | 3300046529 | Ga0495652_0166992 | Ga0495652_0166992_435_1307 | 284 |
| 393 | 3300046533 | Ga0495640_0010418 | Ga0495640_0010418_393_1262 | 284 |
| 394 | 3300046533 | Ga0495640_0032685 | Ga0495640_0032685_361_1239 | 284 |
| 395 | 3300046533 | Ga0495640_0149628 | Ga0495640_0149628_285_1157 | 284 |
| 396 | 3300046536 | Ga0495587_0030628 | Ga0495587_0030628_492_1370 | 284 |
| 397 | 3300046543 | Ga0495645_0002277 | Ga0495645_0002277_8903_9781 | 284 |
| 398 | 3300046557 | Ga0495622_0013329 | Ga0495622_0013329_566_1435 | 284 |
| 399 | 3300046557 | Ga0495622_0016867 | Ga0495622_0016867_1797_2669 | 284 |
| 400 | 3300046559 | Ga0495667_0139683 | Ga0495667_0139683_100_978 | 284 |
| 401 | 3300046642 | Ga0495634_0096856 | Ga0495634_0096856_693_1571 | 284 |
| 402 | 3300046663 | Ga0495635_0074254 | Ga0495635_0074254_712_1581 | 284 |
| 403 | 3300046675 | Ga0495657_0015079 | Ga0495657_0015079_4181_5059 | 284 |
| 404 | 3300046675 | Ga0495657_0095578 | Ga0495657_0095578_438_1307 | 284 |
| 405 | 3300046678 | Ga0495599_0039352 | Ga0495599_0039352_182_1060 | 284 |
| 406 | 3300046679 | Ga0495623_0042017 | Ga0495623_0042017_480_1358 | 284 |
| 407 | 3300046680 | Ga0495646_0097496 | Ga0495646_0097496_666_1538 | 284 |
| 408 | 3300046689 | Ga0495613_0131395 | Ga0495613_0131395_575_1453 | 284 |
| 409 | 3300046694 | Ga0495649_0099633 | Ga0495649_0099633_51_923 | 284 |
| 410 | 3300046809 | Ga0495600_0011127 | Ga0495600_0011127_822_1691 | 284 |
| 411 | 3300046809 | Ga0495600_0072440 | Ga0495600_0072440_516_1394 | 284 |
| 412 | 3300047315 | Ga0495581_0091563 | Ga0495581_0091563_455_1324 | 284 |
| 413 | 3300047315 | Ga0495581_0155164 | Ga0495581_0155164_163_1029 | 284 |
| 414 | 3300047317 | Ga0495604_0190660 | Ga0495604_0190660_209_1078 | 284 |
| 415 | 3300047321 | Ga0495676_0008153 | Ga0495676_0008153_6933_7799 | 284 |
| 416 | 3300047322 | Ga0495680_0010179 | Ga0495680_0010179_894_1772 | 284 |
| 417 | 3300047444 | Ga0495675_0054237 | Ga0495675_0054237_490_1368 | 284 |
| 418 | 3300048088 | Ga0495602_0016617 | Ga0495602_0016617_5920_6798 | 284 |
| 419 | 3300048907 | Ga0496104_0010695 | Ga0496104_0010695_336_1205 | 284 |
| 420 | 3300048908 | Ga0496105_0063923 | Ga0496105_0063923_1554_2423 | 284 |
| 421 | 3300048909 | Ga0496106_0007339 | Ga0496106_0007339_1322_2194 | 284 |
| 422 | 3300048913 | Ga0496110_0075443 | Ga0496110_0075443_481_1350 | 284 |
| 423 | 3300048915 | Ga0496112_0252013 | Ga0496112_0252013_261_1130 | 284 |
| 424 | 3300048919 | Ga0496116_0088561 | Ga0496116_0088561_531_1403 | 284 |
| 425 | 3300048921 | Ga0496118_0004035 | Ga0496118_0004035_9777_10649 | 284 |
| 426 | 3300048922 | Ga0496119_0022207 | Ga0496119_0022207_747_1616 | 284 |
| 427 | 3300048922 | Ga0496119_0044130 | Ga0496119_0044130_1906_2778 | 284 |
| 428 | 3300048924 | Ga0496121_0000640 | Ga0496121_0000640_51755_52627 | 284 |
| 429 | 3300048924 | Ga0496121_0040352 | Ga0496121_0040352_587_1456 | 284 |
| 430 | 3300048924 | Ga0496121_0228676 | Ga0496121_0228676_416_1291 | 284 |
| 431 | 3300048924 | Ga0496121_0247518 | Ga0496121_0247518_284_1156 | 284 |
| 432 | 3300048927 | Ga0496124_0007008 | Ga0496124_0007008_7542_8414 | 284 |
| 433 | 3300048927 | Ga0496124_0112193 | Ga0496124_0112193_857_1726 | 284 |
| 434 | 3300048927 | Ga0496124_0119573 | Ga0496124_0119573_614_1483 | 284 |
| 435 | 3300048928 | Ga0496125_0008236 | Ga0496125_0008236_9518_10393 | 284 |
| 436 | 3300048928 | Ga0496125_0039824 | Ga0496125_0039824_2955_3821 | 284 |
| 437 | 3300048928 | Ga0496125_0176402 | Ga0496125_0176402_352_1224 | 284 |
| 438 | 3300048929 | Ga0496126_0004306 | Ga0496126_0004306_3294_4166 | 284 |
| 439 | 3300048929 | Ga0496126_0017921 | Ga0496126_0017921_3459_4331 | 284 |
| 440 | 3300048929 | Ga0496126_0027691 | Ga0496126_0027691_335_1210 | 284 |
| 441 | 3300048929 | Ga0496126_0035492 | Ga0496126_0035492_1701_2576 | 284 |
| 442 | 3300048929 | Ga0496126_0060621 | Ga0496126_0060621_282_1154 | 284 |
| 443 | 3300048929 | Ga0496126_0109176 | Ga0496126_0109176_636_1511 | 284 |
| 444 | 3300048929 | Ga0496126_0176114 | Ga0496126_0176114_788_1663 | 284 |
| 445 | 3300050492 | nmdc:mga0yw44_225862_c1 | nmdc:mga0yw44_225862_c1_271_1137 | 284 |
| 446 | 3300053083 | Ga0495655_0045079 | Ga0495655_0045079_122_994 | 284 |
| 447 | 3300053091 | Ga0500647_0082960 | Ga0500647_0082960_458_1333 | 284 |
| 448 | 3300053094 | Ga0500566_0000275 | Ga0500566_0000275_24932_25807 | 284 |
| 449 | 3300053094 | Ga0500566_0038684 | Ga0500566_0038684_1356_2228 | 284 |
| 450 | 3300053095 | Ga0500640_000078 | Ga0500640_000078_14762_15637 | 284 |
| 451 | 3300053097 | Ga0500648_100738 | Ga0500648_100738_563_1435 | 284 |
| 452 | 3300053111 | Ga0500572_004738 | Ga0500572_004738_2069_2944 | 284 |
| 453 | 3300053120 | Ga0500597_052598 | Ga0500597_052598_604_1473 | 284 |
| 454 | 3300053123 | Ga0500614_001185 | Ga0500614_001185_2302_3177 | 284 |
| 455 | 3300053140 | Ga0500573_0050681 | Ga0500573_0050681_1003_1875 | 284 |
| 456 | 3300053150 | Ga0500603_000142 | Ga0500603_000142_12512_13387 | 284 |
| 457 | 3300053150 | Ga0500603_028448 | Ga0500603_028448_140_1012 | 284 |
| 458 | 3300053154 | Ga0500619_019648 | Ga0500619_019648_411_1283 | 284 |
| 459 | 3300053159 | Ga0500630_000325 | Ga0500630_000325_1787_2662 | 284 |
| 460 | 3300053162 | Ga0500638_016517 | Ga0500638_016517_1104_1979 | 284 |
| 461 | 3300053163 | Ga0500639_000217 | Ga0500639_000217_25007_25882 | 284 |
| 462 | 3300053178 | Ga0500637_0020934 | Ga0500637_0020934_837_1709 | 284 |
| 463 | 3300053733 | Ga0500552_012310 | Ga0500552_012310_166_1035 | 284 |
| 464 | 3300053735 | Ga0500596_000321 | Ga0500596_000321_5677_6552 | 284 |
| 465 | 3300053735 | Ga0500596_006983 | Ga0500596_006983_538_1410 | 284 |
| 466 | 3300053737 | Ga0500601_001697 | Ga0500601_001697_1405_2280 | 284 |
| 467 | 3300055283 | Ga0500661_011296 | Ga0500661_011296_567_1433 | 284 |
| 468 | 3300003214 | JGI25165J46597_1008047 | JGI25165J46597_10080473 | 285 |
| 469 | 3300003215 | JGI25153J46596_10000550 | JGI25153J46596_1000055016 | 285 |
| 470 | 3300003215 | JGI25153J46596_10013291 | JGI25153J46596_100132913 | 285 |
| 471 | 3300003215 | JGI25153J46596_10014619 | JGI25153J46596_100146193 | 285 |
| 472 | 3300003354 | JGI25160J50197_1004506 | JGI25160J50197_10045063 | 285 |
| 473 | 3300003794 | Ga0055531_10014620 | Ga0055531_100146203 | 285 |
| 474 | 3300005262 | Ga0065165_1001646 | Ga0065165_100164618 | 285 |
| 475 | 3300005328 | Ga0070676_10120250 | Ga0070676_101202502 | 285 |
| 476 | 3300005329 | Ga0070683_100093829 | Ga0070683_1000938294 | 285 |
| 477 | 3300005334 | Ga0068869_100015937 | Ga0068869_1000159371 | 285 |
| 478 | 3300005336 | Ga0070680_100121818 | Ga0070680_1001218182 | 285 |
| 479 | 3300005340 | Ga0070689_100084174 | Ga0070689_1000841744 | 285 |
| 480 | 3300005347 | Ga0070668_100106056 | Ga0070668_1001060563 | 285 |
| 481 | 3300005355 | Ga0070671_100034823 | Ga0070671_1000348233 | 285 |
| 482 | 3300005365 | Ga0070688_100080943 | Ga0070688_1000809434 | 285 |
| 483 | 3300005434 | Ga0070709_10093365 | Ga0070709_100933651 | 285 |
| 484 | 3300005438 | Ga0070701_10043293 | Ga0070701_100432934 | 285 |
| 485 | 3300005455 | Ga0070663_100070714 | Ga0070663_1000707144 | 285 |
| 486 | 3300005458 | Ga0070681_10158376 | Ga0070681_101583763 | 285 |
| 487 | 3300005458 | Ga0070681_10254456 | Ga0070681_102544562 | 285 |
| 488 | 3300005530 | Ga0070679_100021186 | Ga0070679_1000211863 | 285 |
| 489 | 3300005530 | Ga0070679_100113377 | Ga0070679_1001133774 | 285 |
| 490 | 3300005535 | Ga0070684_100033972 | Ga0070684_1000339724 | 285 |
| 491 | 3300005547 | Ga0070693_100018521 | Ga0070693_1000185212 | 285 |
| 492 | 3300005548 | Ga0070665_100193449 | Ga0070665_1001934493 | 285 |
| 493 | 3300005548 | Ga0070665_100207601 | Ga0070665_1002076013 | 285 |
| 494 | 3300005563 | Ga0068855_100128289 | Ga0068855_1001282892 | 285 |
| 495 | 3300005577 | Ga0068857_100090503 | Ga0068857_1000905033 | 285 |
| 496 | 3300005578 | Ga0068854_100030068 | Ga0068854_1000300683 | 285 |
| 497 | 3300005614 | Ga0068856_100002282 | Ga0068856_10000228215 | 285 |
| 498 | 3300005616 | Ga0068852_100109235 | Ga0068852_1001092354 | 285 |
| 499 | 3300005844 | Ga0068862_100046068 | Ga0068862_1000460684 | 285 |
| 500 | 3300005937 | Ga0081455_10044688 | Ga0081455_100446884 | 285 |
| 501 | 3300005985 | Ga0081539_10009687 | Ga0081539_100096875 | 285 |
| 502 | 3300005985 | Ga0081539_10042459 | Ga0081539_100424592 | 285 |
| 503 | 3300006038 | Ga0075365_10092810 | Ga0075365_100928104 | 285 |
| 504 | 3300006038 | Ga0075365_10124820 | Ga0075365_101248203 | 285 |
| 505 | 3300006042 | Ga0075368_10003600 | Ga0075368_100036002 | 285 |
| 506 | 3300006042 | Ga0075368_10038401 | Ga0075368_100384012 | 285 |
| 507 | 3300006048 | Ga0075363_100042670 | Ga0075363_1000426704 | 285 |
| 508 | 3300006051 | Ga0075364_10145193 | Ga0075364_101451932 | 285 |
| 509 | 3300006178 | Ga0075367_10047076 | Ga0075367_100470763 | 285 |
| 510 | 3300006178 | Ga0075367_10263604 | Ga0075367_102636042 | 285 |
| 511 | 3300006186 | Ga0075369_10026619 | Ga0075369_100266193 | 285 |
| 512 | 3300006195 | Ga0075366_10137965 | Ga0075366_101379651 | 285 |
| 513 | 3300006353 | Ga0075370_10028909 | Ga0075370_100289093 | 285 |
| 514 | 3300006353 | Ga0075370_10078460 | Ga0075370_100784603 | 285 |
| 515 | 3300006941 | Ga0099825_1025031 | Ga0099825_10250315 | 285 |
| 516 | 3300009174 | Ga0105241_10140289 | Ga0105241_101402893 | 285 |
| 517 | 3300009177 | Ga0105248_10105152 | Ga0105248_101051524 | 285 |
| 518 | 3300009551 | Ga0105238_10135734 | Ga0105238_101357342 | 285 |
| 519 | 3300009551 | Ga0105238_10248919 | Ga0105238_102489192 | 285 |
| 520 | 3300013296 | Ga0157374_10178681 | Ga0157374_101786813 | 285 |
| 521 | 3300013307 | Ga0157372_10438817 | Ga0157372_104388172 | 285 |
| 522 | 3300021320 | Ga0214544_1000344 | Ga0214544_10003443 | 285 |
| 523 | 3300021321 | Ga0214542_1000018 | Ga0214542_10000183 | 285 |
| 524 | 3300021324 | Ga0214545_1000009 | Ga0214545_1000009180 | 285 |
| 525 | 3300021327 | Ga0214543_1029683 | Ga0214543_10296833 | 285 |
| 526 | 3300021358 | Ga0213873_10002957 | Ga0213873_100029573 | 285 |
| 527 | 3300025254 | Ga0209148_1000874 | Ga0209148_100087416 | 285 |
| 528 | 3300025254 | Ga0209148_1019429 | Ga0209148_10194291 | 285 |
| 529 | 3300025261 | Ga0209233_1008667 | Ga0209233_10086673 | 285 |
| 530 | 3300025272 | Ga0209455_1001536 | Ga0209455_10015368 | 285 |
| 531 | 3300025295 | Ga0209564_1005896 | Ga0209564_10058966 | 285 |
| 532 | 3300025295 | Ga0209564_1008405 | Ga0209564_10084053 | 285 |
| 533 | 3300025297 | Ga0209758_1000030 | Ga0209758_100003024 | 285 |
| 534 | 3300025297 | Ga0209758_1001470 | Ga0209758_100147020 | 285 |
| 535 | 3300025297 | Ga0209758_1003848 | Ga0209758_100384811 | 285 |
| 536 | 3300025297 | Ga0209758_1009747 | Ga0209758_10097476 | 285 |
| 537 | 3300025297 | Ga0209758_1029873 | Ga0209758_10298733 | 285 |
| 538 | 3300025299 | Ga0209256_1004427 | Ga0209256_10044278 | 285 |
| 539 | 3300025302 | Ga0207426_1001583 | Ga0207426_10015833 | 285 |
| 540 | 3300025302 | Ga0207426_1015711 | Ga0207426_10157113 | 285 |
| 541 | 3300025304 | Ga0209257_1003693 | Ga0209257_10036934 | 285 |
| 542 | 3300025304 | Ga0209257_1017069 | Ga0209257_10170695 | 285 |
| 543 | 3300025904 | Ga0207647_10002968 | Ga0207647_100029684 | 285 |
| 544 | 3300025912 | Ga0207707_10001534 | Ga0207707_100015343 | 285 |
| 545 | 3300025912 | Ga0207707_10112390 | Ga0207707_101123903 | 285 |
| 546 | 3300025914 | Ga0207671_10282120 | Ga0207671_102821202 | 285 |
| 547 | 3300025917 | Ga0207660_10033623 | Ga0207660_100336235 | 285 |
| 548 | 3300025917 | Ga0207660_10062043 | Ga0207660_100620432 | 285 |
| 549 | 3300025924 | Ga0207694_10136558 | Ga0207694_101365582 | 285 |
| 550 | 3300025924 | Ga0207694_10358360 | Ga0207694_103583602 | 285 |
| 551 | 3300025936 | Ga0207670_10302230 | Ga0207670_103022302 | 285 |
| 552 | 3300025941 | Ga0207711_10083906 | Ga0207711_100839064 | 285 |
| 553 | 3300025944 | Ga0207661_10025839 | Ga0207661_100258396 | 285 |
| 554 | 3300025981 | Ga0207640_10014499 | Ga0207640_100144994 | 285 |
| 555 | 3300026035 | Ga0207703_10306100 | Ga0207703_103061002 | 285 |
| 556 | 3300026078 | Ga0207702_10001426 | Ga0207702_100014262 | 285 |
| 557 | 3300026116 | Ga0207674_10035941 | Ga0207674_100359415 | 285 |
| 558 | 3300027296 | Ga0209389_1000163 | Ga0209389_100016350 | 285 |
| 559 | 3300027361 | Ga0209489_101100 | Ga0209489_10110050 | 285 |
| 560 | 3300027363 | Ga0209700_100014 | Ga0209700_100014261 | 285 |
| 561 | 3300027866 | Ga0209813_10032336 | Ga0209813_100323362 | 285 |
| 562 | 3300028379 | Ga0268266_10009421 | Ga0268266_100094216 | 285 |
| 563 | 3300028380 | Ga0268265_10061284 | Ga0268265_100612844 | 285 |
| 564 | 3300028556 | Ga0265337_1001432 | Ga0265337_10014327 | 285 |
| 565 | 3300028558 | Ga0265326_10000332 | Ga0265326_1000033210 | 285 |
| 566 | 3300028563 | Ga0265319_1001170 | Ga0265319_100117012 | 285 |
| 567 | 3300028573 | Ga0265334_10002363 | Ga0265334_100023632 | 285 |
| 568 | 3300028577 | Ga0265318_10003595 | Ga0265318_100035953 | 285 |
| 569 | 3300028653 | Ga0265323_10001572 | Ga0265323_100015722 | 285 |
| 570 | 3300028666 | Ga0265336_10000110 | Ga0265336_1000011040 | 285 |
| 571 | 3300028800 | Ga0265338_10000656 | Ga0265338_1000065628 | 285 |
| 572 | 3300029957 | Ga0265324_10000971 | Ga0265324_100009713 | 285 |
| 573 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015461 | 285 |
| 574 | 3300031730 | Ga0307516_10079257 | Ga0307516_100792574 | 285 |
| 575 | 3300031995 | Ga0307409_100543654 | Ga0307409_1005436542 | 285 |
| 576 | 3300033180 | Ga0307510_10147044 | Ga0307510_101470443 | 285 |
| 577 | 3300035083 | Ga0373926_0072632 | Ga0373926_0072632_284_1162 | 285 |
| 578 | 3300035172 | Ga0373955_0042706 | Ga0373955_0042706_905_1783 | 285 |
| 579 | 3300035410 | Ga0373924_0001609 | Ga0373924_0001609_2732_3610 | 285 |
| 580 | 3300035692 | Ga0373935_0039107 | Ga0373935_0039107_374_1252 | 285 |
| 581 | 3300035695 | Ga0373927_0008050 | Ga0373927_0008050_6051_6920 | 285 |
| 582 | 3300035724 | Ga0373933_0007993 | Ga0373933_0007993_63_941 | 285 |
| 583 | 3300035725 | Ga0373947_0024055 | Ga0373947_0024055_2629_3498 | 285 |
| 584 | 3300035725 | Ga0373947_0026448 | Ga0373947_0026448_1106_1984 | 285 |
| 585 | 3300036401 | Ga0373937_0135256 | Ga0373937_0135256_63_941 | 285 |
| 586 | 3300037068 | Ga0373925_0017296 | Ga0373925_0017296_1979_2857 | 285 |
| 587 | 3300037068 | Ga0373925_0024092 | Ga0373925_0024092_2485_3363 | 285 |
| 588 | 3300037418 | Ga0395900_0004851 | Ga0395900_0004851_629_1522 | 285 |
| 589 | 3300037466 | Ga0395898_0044947 | Ga0395898_0044947_611_1504 | 285 |
| 590 | 3300037471 | Ga0395905_0213458 | Ga0395905_0213458_597_1490 | 285 |
| 591 | 3300037853 | Ga0436364_1224016 | Ga0436364_1224016_235_1104 | 285 |
| 592 | 3300038443 | Ga0395901_0036503 | Ga0395901_0036503_1026_1919 | 285 |
| 593 | 3300039437 | Ga0436365_0491541 | Ga0436365_0491541_1229_2104 | 285 |
| 594 | 3300039437 | Ga0436365_0875735 | Ga0436365_0875735_79_960 | 285 |
| 595 | 3300039437 | Ga0436365_0989203 | Ga0436365_0989203_2372_3241 | 285 |
| 596 | 3300039450 | Ga0436363_1063318 | Ga0436363_1063318_623_1501 | 285 |
| 597 | 3300039453 | Ga0436362_1208454 | Ga0436362_1208454_633_1508 | 285 |
| 598 | 3300041451 | Ga0451791_1288432 | Ga0451791_1288432_133_1014 | 285 |
| 599 | 3300044658 | Ga0466972_0000234 | Ga0466972_0000234_602_1510 | 285 |
| 600 | 3300044658 | Ga0466972_0004129 | Ga0466972_0004129_5308_6186 | 285 |
| 601 | 3300044694 | Ga0466963_0014602 | Ga0466963_0014602_1764_2645 | 285 |
| 602 | 3300044735 | Ga0466968_0001995 | Ga0466968_0001995_5351_6229 | 285 |
| 603 | 3300044842 | Ga0466957_0073853 | Ga0466957_0073853_330_1211 | 285 |
| 604 | 3300044901 | Ga0466960_0010923 | Ga0466960_0010923_920_1798 | 285 |
| 605 | 3300045976 | Ga0466967_0037023 | Ga0466967_0037023_1215_2096 | 285 |
| 606 | 3300045976 | Ga0466967_0116898 | Ga0466967_0116898_1391_2263 | 285 |
| 607 | 3300046455 | Ga0495603_0102705 | Ga0495603_0102705_256_1128 | 285 |
| 608 | 3300046459 | Ga0495629_0088690 | Ga0495629_0088690_552_1421 | 285 |
| 609 | 3300046460 | Ga0495638_0004876 | Ga0495638_0004876_7383_8261 | 285 |
| 610 | 3300046473 | Ga0495582_0003777 | Ga0495582_0003777_7046_7924 | 285 |
| 611 | 3300046475 | Ga0495639_0036657 | Ga0495639_0036657_740_1618 | 285 |
| 612 | 3300046477 | Ga0495664_0049429 | Ga0495664_0049429_1182_2060 | 285 |
| 613 | 3300046492 | Ga0495585_0121616 | Ga0495585_0121616_257_1138 | 285 |
| 614 | 3300046501 | Ga0495607_0110869 | Ga0495607_0110869_522_1400 | 285 |
| 615 | 3300046506 | Ga0495583_0049204 | Ga0495583_0049204_165_1043 | 285 |
| 616 | 3300046512 | Ga0495610_0032809 | Ga0495610_0032809_795_1673 | 285 |
| 617 | 3300046512 | Ga0495610_0046207 | Ga0495610_0046207_265_1143 | 285 |
| 618 | 3300046513 | Ga0495616_0018412 | Ga0495616_0018412_285_1163 | 285 |
| 619 | 3300046514 | Ga0495618_0008828 | Ga0495618_0008828_4628_5506 | 285 |
| 620 | 3300046515 | Ga0495620_0036803 | Ga0495620_0036803_1033_1911 | 285 |
| 621 | 3300046517 | Ga0495630_0318631 | Ga0495630_0318631_129_1007 | 285 |
| 622 | 3300046522 | Ga0495643_0019789 | Ga0495643_0019789_607_1485 | 285 |
| 623 | 3300046524 | Ga0495648_0079676 | Ga0495648_0079676_491_1369 | 285 |
| 624 | 3300046524 | Ga0495648_0123557 | Ga0495648_0123557_257_1135 | 285 |
| 625 | 3300046533 | Ga0495640_0014432 | Ga0495640_0014432_190_1068 | 285 |
| 626 | 3300046543 | Ga0495645_0102497 | Ga0495645_0102497_784_1662 | 285 |
| 627 | 3300046559 | Ga0495667_0166789 | Ga0495667_0166789_437_1315 | 285 |
| 628 | 3300046663 | Ga0495635_0038449 | Ga0495635_0038449_312_1190 | 285 |
| 629 | 3300046680 | Ga0495646_0029121 | Ga0495646_0029121_595_1473 | 285 |
| 630 | 3300046689 | Ga0495613_0095971 | Ga0495613_0095971_683_1561 | 285 |
| 631 | 3300047315 | Ga0495581_0147504 | Ga0495581_0147504_373_1251 | 285 |
| 632 | 3300047319 | Ga0495674_0055960 | Ga0495674_0055960_284_1162 | 285 |
| 633 | 3300047443 | Ga0495687_057029 | Ga0495687_057029_627_1505 | 285 |
| 634 | 3300047469 | Ga0495673_0111641 | Ga0495673_0111641_103_981 | 285 |
| 635 | 3300048091 | Ga0495626_0132943 | Ga0495626_0132943_111_989 | 285 |
| 636 | 3300048903 | Ga0496100_0305751 | Ga0496100_0305751_93_971 | 285 |
| 637 | 3300048904 | Ga0496101_0137936 | Ga0496101_0137936_837_1715 | 285 |
| 638 | 3300048905 | Ga0496102_0005110 | Ga0496102_0005110_9287_10165 | 285 |
| 639 | 3300048905 | Ga0496102_0179545 | Ga0496102_0179545_424_1302 | 285 |
| 640 | 3300048906 | Ga0496103_0017732 | Ga0496103_0017732_608_1486 | 285 |
| 641 | 3300048908 | Ga0496105_0150277 | Ga0496105_0150277_298_1176 | 285 |
| 642 | 3300048909 | Ga0496106_0236296 | Ga0496106_0236296_300_1166 | 285 |
| 643 | 3300048912 | Ga0496109_0093609 | Ga0496109_0093609_705_1583 | 285 |
| 644 | 3300048912 | Ga0496109_0111042 | Ga0496109_0111042_1351_2229 | 285 |
| 645 | 3300048913 | Ga0496110_0187701 | Ga0496110_0187701_33_911 | 285 |
| 646 | 3300048915 | Ga0496112_0033395 | Ga0496112_0033395_3623_4501 | 285 |
| 647 | 3300048916 | Ga0496113_0036524 | Ga0496113_0036524_187_1065 | 285 |
| 648 | 3300048917 | Ga0496114_0472319 | Ga0496114_0472319_81_947 | 285 |
| 649 | 3300048920 | Ga0496117_0055758 | Ga0496117_0055758_1086_1964 | 285 |
| 650 | 3300048921 | Ga0496118_0091827 | Ga0496118_0091827_608_1486 | 285 |
| 651 | 3300048921 | Ga0496118_0117077 | Ga0496118_0117077_254_1132 | 285 |
| 652 | 3300048922 | Ga0496119_0014732 | Ga0496119_0014732_2369_3247 | 285 |
| 653 | 3300048924 | Ga0496121_0044057 | Ga0496121_0044057_2169_3038 | 285 |
| 654 | 3300048924 | Ga0496121_0099645 | Ga0496121_0099645_496_1374 | 285 |
| 655 | 3300048927 | Ga0496124_0083961 | Ga0496124_0083961_1497_2366 | 285 |
| 656 | 3300048928 | Ga0496125_0092356 | Ga0496125_0092356_1235_2104 | 285 |
| 657 | 3300050490 | nmdc:mga03n38_98428_c1 | nmdc:mga03n38_98428_c1_18_1019 | 285 |
| 658 | 3300050491 | nmdc:mga00v17_28318_c1 | nmdc:mga00v17_28318_c1_228_1106 | 285 |
| 659 | 3300050492 | nmdc:mga0yw44_100542_c1 | nmdc:mga0yw44_100542_c1_519_1397 | 285 |
| 660 | 3300050492 | nmdc:mga0yw44_125062_c1 | nmdc:mga0yw44_125062_c1_184_1062 | 285 |
| 661 | 3300050492 | nmdc:mga0yw44_148721_c1 | nmdc:mga0yw44_148721_c1_206_1087 | 285 |
| 662 | 3300050493 | nmdc:mga0k408_216820_c1 | nmdc:mga0k408_216820_c1_40_918 | 285 |
| 663 | 3300050494 | nmdc:mga06z11_80473_c1 | nmdc:mga06z11_80473_c1_319_1188 | 285 |
| 664 | 3300050495 | nmdc:mga04h51_2928_c1 | nmdc:mga04h51_2928_c1_1474_2352 | 285 |
| 665 | 3300050496 | nmdc:mga07m45_29605_c1 | nmdc:mga07m45_29605_c1_2107_2985 | 285 |
| 666 | 3300050516 | nmdc:mga0sz30_97013_c1 | nmdc:mga0sz30_97013_c1_207_1085 | 285 |
| 667 | 3300053080 | Ga0500635_0009691 | Ga0500635_0009691_1386_2264 | 285 |
| 668 | 3300053087 | Ga0500643_000160 | Ga0500643_000160_640_1518 | 285 |
| 669 | 3300053094 | Ga0500566_0001345 | Ga0500566_0001345_956_1834 | 285 |
| 670 | 3300053103 | Ga0500555_008584 | Ga0500555_008584_1302_2180 | 285 |
| 671 | 3300053104 | Ga0500556_0011202 | Ga0500556_0011202_1137_2015 | 285 |
| 672 | 3300053105 | Ga0500557_000128 | Ga0500557_000128_605_1486 | 285 |
| 673 | 3300053109 | Ga0500569_019786 | Ga0500569_019786_71_949 | 285 |
| 674 | 3300053111 | Ga0500572_049175 | Ga0500572_049175_353_1231 | 285 |
| 675 | 3300053121 | Ga0500607_080828 | Ga0500607_080828_512_1390 | 285 |
| 676 | 3300053121 | Ga0500607_168205 | Ga0500607_168205_18_896 | 285 |
| 677 | 3300053122 | Ga0500608_007064 | Ga0500608_007064_3045_3923 | 285 |
| 678 | 3300053125 | Ga0500618_030412 | Ga0500618_030412_335_1213 | 285 |
| 679 | 3300053126 | Ga0500621_083220 | Ga0500621_083220_245_1123 | 285 |
| 680 | 3300053130 | Ga0500642_0000477 | Ga0500642_0000477_613_1494 | 285 |
| 681 | 3300053136 | Ga0500559_0096576 | Ga0500559_0096576_269_1147 | 285 |
| 682 | 3300053138 | Ga0500564_050860 | Ga0500564_050860_580_1458 | 285 |
| 683 | 3300053142 | Ga0500577_0062271 | Ga0500577_0062271_127_1005 | 285 |
| 684 | 3300053145 | Ga0500586_000521 | Ga0500586_000521_2936_3814 | 285 |
| 685 | 3300053148 | Ga0500590_082543 | Ga0500590_082543_573_1451 | 285 |
| 686 | 3300053153 | Ga0500616_0012689 | Ga0500616_0012689_2560_3438 | 285 |
| 687 | 3300053154 | Ga0500619_002320 | Ga0500619_002320_646_1524 | 285 |
| 688 | 3300053155 | Ga0500620_000583 | Ga0500620_000583_4143_5021 | 285 |
| 689 | 3300053158 | Ga0500627_0015386 | Ga0500627_0015386_833_1711 | 285 |
| 690 | 3300053162 | Ga0500638_012640 | Ga0500638_012640_2199_3077 | 285 |
| 691 | 3300053177 | Ga0500636_0001993 | Ga0500636_0001993_633_1511 | 285 |
| 692 | 3300053736 | Ga0500599_001767 | Ga0500599_001767_684_1562 | 285 |
| 693 | 3300053737 | Ga0500601_000795 | Ga0500601_000795_2231_3109 | 285 |
| 694 | 3300053738 | Ga0500613_007657 | Ga0500613_007657_70_948 | 285 |
| 695 | 3300000532 | CNAas_1002274 | CNAas_10022742 | 286 |
| 696 | 3300003203 | JGI25406J46586_10012297 | JGI25406J46586_100122972 | 286 |
| 697 | 3300003215 | JGI25153J46596_10007332 | JGI25153J46596_100073326 | 286 |
| 698 | 3300003659 | JGI25404J52841_10003547 | JGI25404J52841_100035475 | 286 |
| 699 | 3300003659 | JGI25404J52841_10030856 | JGI25404J52841_100308561 | 286 |
| 700 | 3300003752 | Ga0055539_1004325 | Ga0055539_10043252 | 286 |
| 701 | 3300003911 | JGI25405J52794_10004824 | JGI25405J52794_100048242 | 286 |
| 702 | 3300004625 | Ga0055543_1007285 | Ga0055543_10072854 | 286 |
| 703 | 3300005327 | Ga0070658_10059476 | Ga0070658_100594763 | 286 |
| 704 | 3300005327 | Ga0070658_10332214 | Ga0070658_103322141 | 286 |
| 705 | 3300005329 | Ga0070683_100025426 | Ga0070683_1000254267 | 286 |
| 706 | 3300005329 | Ga0070683_100171658 | Ga0070683_1001716583 | 286 |
| 707 | 3300005334 | Ga0068869_100168334 | Ga0068869_1001683342 | 286 |
| 708 | 3300005336 | Ga0070680_100234704 | Ga0070680_1002347041 | 286 |
| 709 | 3300005338 | Ga0068868_100004833 | Ga0068868_1000048332 | 286 |
| 710 | 3300005338 | Ga0068868_100137371 | Ga0068868_1001373713 | 286 |
| 711 | 3300005344 | Ga0070661_100065479 | Ga0070661_1000654794 | 286 |
| 712 | 3300005347 | Ga0070668_100008596 | Ga0070668_1000085967 | 286 |
| 713 | 3300005347 | Ga0070668_100133324 | Ga0070668_1001333242 | 286 |
| 714 | 3300005353 | Ga0070669_100278027 | Ga0070669_1002780272 | 286 |
| 715 | 3300005353 | Ga0070669_100282872 | Ga0070669_1002828722 | 286 |
| 716 | 3300005356 | Ga0070674_100203677 | Ga0070674_1002036772 | 286 |
| 717 | 3300005364 | Ga0070673_100164033 | Ga0070673_1001640332 | 286 |
| 718 | 3300005434 | Ga0070709_10038498 | Ga0070709_100384983 | 286 |
| 719 | 3300005435 | Ga0070714_100133016 | Ga0070714_1001330162 | 286 |
| 720 | 3300005437 | Ga0070710_10019413 | Ga0070710_100194134 | 286 |
| 721 | 3300005439 | Ga0070711_100024686 | Ga0070711_1000246862 | 286 |
| 722 | 3300005440 | Ga0070705_100298350 | Ga0070705_1002983502 | 286 |
| 723 | 3300005455 | Ga0070663_100011356 | Ga0070663_1000113566 | 286 |
| 724 | 3300005455 | Ga0070663_100137664 | Ga0070663_1001376642 | 286 |
| 725 | 3300005455 | Ga0070663_100277020 | Ga0070663_1002770202 | 286 |
| 726 | 3300005456 | Ga0070678_100046211 | Ga0070678_1000462113 | 286 |
| 727 | 3300005456 | Ga0070678_100084635 | Ga0070678_1000846352 | 286 |
| 728 | 3300005456 | Ga0070678_100165171 | Ga0070678_1001651712 | 286 |
| 729 | 3300005456 | Ga0070678_100340499 | Ga0070678_1003404992 | 286 |
| 730 | 3300005457 | Ga0070662_100033435 | Ga0070662_1000334352 | 286 |
| 731 | 3300005457 | Ga0070662_100149362 | Ga0070662_1001493623 | 286 |
| 732 | 3300005459 | Ga0068867_100093754 | Ga0068867_1000937543 | 286 |
| 733 | 3300005467 | Ga0070706_100235748 | Ga0070706_1002357482 | 286 |
| 734 | 3300005468 | Ga0070707_100573453 | Ga0070707_1005734532 | 286 |
| 735 | 3300005471 | Ga0070698_100194297 | Ga0070698_1001942973 | 286 |
| 736 | 3300005471 | Ga0070698_100217995 | Ga0070698_1002179952 | 286 |
| 737 | 3300005530 | Ga0070679_100032725 | Ga0070679_1000327253 | 286 |
| 738 | 3300005535 | Ga0070684_100047929 | Ga0070684_1000479294 | 286 |
| 739 | 3300005539 | Ga0068853_100226396 | Ga0068853_1002263963 | 286 |
| 740 | 3300005548 | Ga0070665_100010827 | Ga0070665_1000108273 | 286 |
| 741 | 3300005548 | Ga0070665_100044008 | Ga0070665_1000440083 | 286 |
| 742 | 3300005548 | Ga0070665_100129065 | Ga0070665_1001290654 | 286 |
| 743 | 3300005548 | Ga0070665_100196283 | Ga0070665_1001962832 | 286 |
| 744 | 3300005548 | Ga0070665_100231793 | Ga0070665_1002317932 | 286 |
| 745 | 3300005563 | Ga0068855_100027913 | Ga0068855_1000279135 | 286 |
| 746 | 3300005564 | Ga0070664_100422125 | Ga0070664_1004221252 | 286 |
| 747 | 3300005614 | Ga0068856_100034134 | Ga0068856_1000341345 | 286 |
| 748 | 3300005614 | Ga0068856_100401795 | Ga0068856_1004017951 | 286 |
| 749 | 3300005615 | Ga0070702_100048678 | Ga0070702_1000486782 | 286 |
| 750 | 3300005615 | Ga0070702_100078193 | Ga0070702_1000781933 | 286 |
| 751 | 3300005616 | Ga0068852_100018340 | Ga0068852_1000183404 | 286 |
| 752 | 3300005616 | Ga0068852_100080688 | Ga0068852_1000806886 | 286 |
| 753 | 3300005616 | Ga0068852_100102155 | Ga0068852_1001021554 | 286 |
| 754 | 3300005616 | Ga0068852_100131914 | Ga0068852_1001319142 | 286 |
| 755 | 3300005618 | Ga0068864_100081294 | Ga0068864_1000812944 | 286 |
| 756 | 3300005618 | Ga0068864_100428372 | Ga0068864_1004283722 | 286 |
| 757 | 3300005719 | Ga0068861_100096646 | Ga0068861_1000966462 | 286 |
| 758 | 3300005719 | Ga0068861_100399308 | Ga0068861_1003993082 | 286 |
| 759 | 3300005834 | Ga0068851_10316409 | Ga0068851_103164091 | 286 |
| 760 | 3300005841 | Ga0068863_100301463 | Ga0068863_1003014632 | 286 |
| 761 | 3300005842 | Ga0068858_100061588 | Ga0068858_1000615883 | 286 |
| 762 | 3300005843 | Ga0068860_100052959 | Ga0068860_1000529592 | 286 |
| 763 | 3300005844 | Ga0068862_100116219 | Ga0068862_1001162192 | 286 |
| 764 | 3300005844 | Ga0068862_100191689 | Ga0068862_1001916893 | 286 |
| 765 | 3300005844 | Ga0068862_100344762 | Ga0068862_1003447622 | 286 |
| 766 | 3300005937 | Ga0081455_10003093 | Ga0081455_100030933 | 286 |
| 767 | 3300005937 | Ga0081455_10004895 | Ga0081455_100048954 | 286 |
| 768 | 3300005937 | Ga0081455_10013996 | Ga0081455_100139965 | 286 |
| 769 | 3300005937 | Ga0081455_10023586 | Ga0081455_100235863 | 286 |
| 770 | 3300005937 | Ga0081455_10128720 | Ga0081455_101287203 | 286 |
| 771 | 3300005981 | Ga0081538_10010846 | Ga0081538_100108464 | 286 |
| 772 | 3300005983 | Ga0081540_1004561 | Ga0081540_10045613 | 286 |
| 773 | 3300005983 | Ga0081540_1004770 | Ga0081540_10047704 | 286 |
| 774 | 3300005983 | Ga0081540_1008466 | Ga0081540_10084664 | 286 |
| 775 | 3300005983 | Ga0081540_1009460 | Ga0081540_10094604 | 286 |
| 776 | 3300005983 | Ga0081540_1022569 | Ga0081540_10225694 | 286 |
| 777 | 3300005985 | Ga0081539_10005931 | Ga0081539_100059319 | 286 |
| 778 | 3300006028 | Ga0070717_10000634 | Ga0070717_100006343 | 286 |
| 779 | 3300006038 | Ga0075365_10071356 | Ga0075365_100713562 | 286 |
| 780 | 3300006038 | Ga0075365_10093381 | Ga0075365_100933813 | 286 |
| 781 | 3300006038 | Ga0075365_10140298 | Ga0075365_101402983 | 286 |
| 782 | 3300006048 | Ga0075363_100026229 | Ga0075363_1000262293 | 286 |
| 783 | 3300006051 | Ga0075364_10033825 | Ga0075364_100338252 | 286 |
| 784 | 3300006175 | Ga0070712_100003691 | Ga0070712_1000036917 | 286 |
| 785 | 3300006177 | Ga0075362_10017479 | Ga0075362_100174794 | 286 |
| 786 | 3300006178 | Ga0075367_10006523 | Ga0075367_100065236 | 286 |
| 787 | 3300006178 | Ga0075367_10023304 | Ga0075367_100233044 | 286 |
| 788 | 3300006178 | Ga0075367_10025881 | Ga0075367_100258815 | 286 |
| 789 | 3300006178 | Ga0075367_10075065 | Ga0075367_100750652 | 286 |
| 790 | 3300006186 | Ga0075369_10008323 | Ga0075369_100083232 | 286 |
| 791 | 3300006186 | Ga0075369_10010496 | Ga0075369_100104962 | 286 |
| 792 | 3300006195 | Ga0075366_10018739 | Ga0075366_100187392 | 286 |
| 793 | 3300006237 | Ga0097621_100046159 | Ga0097621_1000461593 | 286 |
| 794 | 3300006237 | Ga0097621_100316364 | Ga0097621_1003163642 | 286 |
| 795 | 3300006353 | Ga0075370_10025125 | Ga0075370_100251253 | 286 |
| 796 | 3300006353 | Ga0075370_10054918 | Ga0075370_100549184 | 286 |
| 797 | 3300006358 | Ga0068871_100047551 | Ga0068871_1000475513 | 286 |
| 798 | 3300006358 | Ga0068871_100063442 | Ga0068871_1000634422 | 286 |
| 799 | 3300006844 | Ga0075428_100014565 | Ga0075428_1000145653 | 286 |
| 800 | 3300006844 | Ga0075428_100066428 | Ga0075428_1000664286 | 286 |
| 801 | 3300006871 | Ga0075434_100051150 | Ga0075434_1000511504 | 286 |
| 802 | 3300006881 | Ga0068865_100101164 | Ga0068865_1001011642 | 286 |
| 803 | 3300006881 | Ga0068865_100629660 | Ga0068865_1006296601 | 286 |
| 804 | 3300007265 | Ga0099794_10046869 | Ga0099794_100468692 | 286 |
| 805 | 3300009093 | Ga0105240_10077665 | Ga0105240_100776653 | 286 |
| 806 | 3300009093 | Ga0105240_10077881 | Ga0105240_100778812 | 286 |
| 807 | 3300009094 | Ga0111539_10165036 | Ga0111539_101650362 | 286 |
| 808 | 3300009098 | Ga0105245_10066139 | Ga0105245_100661394 | 286 |
| 809 | 3300009101 | Ga0105247_10071486 | Ga0105247_100714863 | 286 |
| 810 | 3300009101 | Ga0105247_10283650 | Ga0105247_102836502 | 286 |
| 811 | 3300009148 | Ga0105243_10256643 | Ga0105243_102566433 | 286 |
| 812 | 3300009174 | Ga0105241_10052371 | Ga0105241_100523712 | 286 |
| 813 | 3300009177 | Ga0105248_10159915 | Ga0105248_101599153 | 286 |
| 814 | 3300009545 | Ga0105237_10300641 | Ga0105237_103006412 | 286 |
| 815 | 3300009545 | Ga0105237_10583682 | Ga0105237_105836822 | 286 |
| 816 | 3300009551 | Ga0105238_10060989 | Ga0105238_100609893 | 286 |
| 817 | 3300009553 | Ga0105249_10232433 | Ga0105249_102324331 | 286 |
| 818 | 3300009553 | Ga0105249_10405433 | Ga0105249_104054332 | 286 |
| 819 | 3300010375 | Ga0105239_10121409 | Ga0105239_101214093 | 286 |
| 820 | 3300010375 | Ga0105239_10212863 | Ga0105239_102128633 | 286 |
| 821 | 3300011119 | Ga0105246_10040750 | Ga0105246_100407504 | 286 |
| 822 | 3300011119 | Ga0105246_10212223 | Ga0105246_102122232 | 286 |
| 823 | 3300013297 | Ga0157378_10041263 | Ga0157378_100412633 | 286 |
| 824 | 3300013306 | Ga0163162_10164627 | Ga0163162_101646272 | 286 |
| 825 | 3300013308 | Ga0157375_10132487 | Ga0157375_101324874 | 286 |
| 826 | 3300013308 | Ga0157375_10217214 | Ga0157375_102172142 | 286 |
| 827 | 3300014325 | Ga0163163_10062089 | Ga0163163_100620895 | 286 |
| 828 | 3300014325 | Ga0163163_10541602 | Ga0163163_105416022 | 286 |
| 829 | 3300014326 | Ga0157380_10189904 | Ga0157380_101899042 | 286 |
| 830 | 3300014326 | Ga0157380_10216361 | Ga0157380_102163612 | 286 |
| 831 | 3300014326 | Ga0157380_10282395 | Ga0157380_102823951 | 286 |
| 832 | 3300014745 | Ga0157377_10106272 | Ga0157377_101062722 | 286 |
| 833 | 3300014968 | Ga0157379_10166180 | Ga0157379_101661803 | 286 |
| 834 | 3300014968 | Ga0157379_10412878 | Ga0157379_104128782 | 286 |
| 835 | 3300014969 | Ga0157376_10054563 | Ga0157376_100545632 | 286 |
| 836 | 3300017792 | Ga0163161_10010762 | Ga0163161_100107625 | 286 |
| 837 | 3300017792 | Ga0163161_10117687 | Ga0163161_101176873 | 286 |
| 838 | 3300017792 | Ga0163161_10251849 | Ga0163161_102518492 | 286 |
| 839 | 3300025230 | Ga0209563_100670 | Ga0209563_10067010 | 286 |
| 840 | 3300025253 | Ga0209677_102054 | Ga0209677_1020547 | 286 |
| 841 | 3300025272 | Ga0209455_1003873 | Ga0209455_10038734 | 286 |
| 842 | 3300025295 | Ga0209564_1019898 | Ga0209564_10198982 | 286 |
| 843 | 3300025297 | Ga0209758_1007103 | Ga0209758_10071033 | 286 |
| 844 | 3300025297 | Ga0209758_1022815 | Ga0209758_10228152 | 286 |
| 845 | 3300025302 | Ga0207426_1000704 | Ga0207426_10007046 | 286 |
| 846 | 3300025302 | Ga0207426_1001257 | Ga0207426_10012574 | 286 |
| 847 | 3300025315 | Ga0207697_10057876 | Ga0207697_100578763 | 286 |
| 848 | 3300025899 | Ga0207642_10241294 | Ga0207642_102412941 | 286 |
| 849 | 3300025900 | Ga0207710_10029790 | Ga0207710_100297903 | 286 |
| 850 | 3300025900 | Ga0207710_10108985 | Ga0207710_101089852 | 286 |
| 851 | 3300025901 | Ga0207688_10021647 | Ga0207688_100216475 | 286 |
| 852 | 3300025901 | Ga0207688_10052180 | Ga0207688_100521802 | 286 |
| 853 | 3300025905 | Ga0207685_10167318 | Ga0207685_101673182 | 286 |
| 854 | 3300025907 | Ga0207645_10048193 | Ga0207645_100481933 | 286 |
| 855 | 3300025908 | Ga0207643_10065231 | Ga0207643_100652314 | 286 |
| 856 | 3300025910 | Ga0207684_10109894 | Ga0207684_101098943 | 286 |
| 857 | 3300025911 | Ga0207654_10083473 | Ga0207654_100834733 | 286 |
| 858 | 3300025913 | Ga0207695_10043787 | Ga0207695_100437875 | 286 |
| 859 | 3300025913 | Ga0207695_10119977 | Ga0207695_101199775 | 286 |
| 860 | 3300025914 | Ga0207671_10050733 | Ga0207671_100507333 | 286 |
| 861 | 3300025915 | Ga0207693_10002446 | Ga0207693_1000244610 | 286 |
| 862 | 3300025915 | Ga0207693_10041552 | Ga0207693_100415524 | 286 |
| 863 | 3300025915 | Ga0207693_10367490 | Ga0207693_103674902 | 286 |
| 864 | 3300025918 | Ga0207662_10093909 | Ga0207662_100939093 | 286 |
| 865 | 3300025919 | Ga0207657_10074222 | Ga0207657_100742224 | 286 |
| 866 | 3300025919 | Ga0207657_10338561 | Ga0207657_103385612 | 286 |
| 867 | 3300025921 | Ga0207652_10165259 | Ga0207652_101652592 | 286 |
| 868 | 3300025923 | Ga0207681_10052125 | Ga0207681_100521252 | 286 |
| 869 | 3300025923 | Ga0207681_10126894 | Ga0207681_101268942 | 286 |
| 870 | 3300025924 | Ga0207694_10181955 | Ga0207694_101819553 | 286 |
| 871 | 3300025926 | Ga0207659_10137814 | Ga0207659_101378142 | 286 |
| 872 | 3300025926 | Ga0207659_10317099 | Ga0207659_103170992 | 286 |
| 873 | 3300025927 | Ga0207687_10020017 | Ga0207687_100200174 | 286 |
| 874 | 3300025928 | Ga0207700_10008650 | Ga0207700_100086506 | 286 |
| 875 | 3300025928 | Ga0207700_10010201 | Ga0207700_100102015 | 286 |
| 876 | 3300025929 | Ga0207664_10064538 | Ga0207664_100645384 | 286 |
| 877 | 3300025929 | Ga0207664_10502350 | Ga0207664_105023502 | 286 |
| 878 | 3300025932 | Ga0207690_10350826 | Ga0207690_103508261 | 286 |
| 879 | 3300025933 | Ga0207706_10093938 | Ga0207706_100939383 | 286 |
| 880 | 3300025933 | Ga0207706_10180429 | Ga0207706_101804292 | 286 |
| 881 | 3300025935 | Ga0207709_10341043 | Ga0207709_103410432 | 286 |
| 882 | 3300025937 | Ga0207669_10066960 | Ga0207669_100669602 | 286 |
| 883 | 3300025937 | Ga0207669_10085987 | Ga0207669_100859872 | 286 |
| 884 | 3300025937 | Ga0207669_10105585 | Ga0207669_101055853 | 286 |
| 885 | 3300025937 | Ga0207669_10243921 | Ga0207669_102439212 | 286 |
| 886 | 3300025937 | Ga0207669_10331737 | Ga0207669_103317371 | 286 |
| 887 | 3300025939 | Ga0207665_10117196 | Ga0207665_101171962 | 286 |
| 888 | 3300025940 | Ga0207691_10087971 | Ga0207691_100879713 | 286 |
| 889 | 3300025940 | Ga0207691_10168672 | Ga0207691_101686722 | 286 |
| 890 | 3300025944 | Ga0207661_10005119 | Ga0207661_100051194 | 286 |
| 891 | 3300025944 | Ga0207661_10093733 | Ga0207661_100937333 | 286 |
| 892 | 3300025945 | Ga0207679_10123574 | Ga0207679_101235743 | 286 |
| 893 | 3300025945 | Ga0207679_10155774 | Ga0207679_101557743 | 286 |
| 894 | 3300025945 | Ga0207679_10173442 | Ga0207679_101734422 | 286 |
| 895 | 3300025945 | Ga0207679_10242374 | Ga0207679_102423742 | 286 |
| 896 | 3300025949 | Ga0207667_10015856 | Ga0207667_100158565 | 286 |
| 897 | 3300025960 | Ga0207651_10074123 | Ga0207651_100741232 | 286 |
| 898 | 3300025960 | Ga0207651_10120039 | Ga0207651_101200392 | 286 |
| 899 | 3300025961 | Ga0207712_10077095 | Ga0207712_100770953 | 286 |
| 900 | 3300025961 | Ga0207712_10220246 | Ga0207712_102202463 | 286 |
| 901 | 3300025961 | Ga0207712_10403418 | Ga0207712_104034182 | 286 |
| 902 | 3300025972 | Ga0207668_10005343 | Ga0207668_100053437 | 286 |
| 903 | 3300025972 | Ga0207668_10045426 | Ga0207668_100454264 | 286 |
| 904 | 3300025972 | Ga0207668_10135544 | Ga0207668_101355442 | 286 |
| 905 | 3300025972 | Ga0207668_10251519 | Ga0207668_102515192 | 286 |
| 906 | 3300025972 | Ga0207668_10310671 | Ga0207668_103106712 | 286 |
| 907 | 3300025986 | Ga0207658_10086653 | Ga0207658_100866534 | 286 |
| 908 | 3300025986 | Ga0207658_10199553 | Ga0207658_101995533 | 286 |
| 909 | 3300026023 | Ga0207677_10038533 | Ga0207677_100385334 | 286 |
| 910 | 3300026023 | Ga0207677_10108262 | Ga0207677_101082623 | 286 |
| 911 | 3300026035 | Ga0207703_10043372 | Ga0207703_100433725 | 286 |
| 912 | 3300026041 | Ga0207639_10159766 | Ga0207639_101597662 | 286 |
| 913 | 3300026041 | Ga0207639_10253862 | Ga0207639_102538623 | 286 |
| 914 | 3300026041 | Ga0207639_10264477 | Ga0207639_102644772 | 286 |
| 915 | 3300026067 | Ga0207678_10034872 | Ga0207678_100348725 | 286 |
| 916 | 3300026067 | Ga0207678_10073842 | Ga0207678_100738423 | 286 |
| 917 | 3300026067 | Ga0207678_10076141 | Ga0207678_100761414 | 286 |
| 918 | 3300026067 | Ga0207678_10084233 | Ga0207678_100842334 | 286 |
| 919 | 3300026089 | Ga0207648_10068241 | Ga0207648_100682413 | 286 |
| 920 | 3300026089 | Ga0207648_10130139 | Ga0207648_101301392 | 286 |
| 921 | 3300026095 | Ga0207676_10473747 | Ga0207676_104737472 | 286 |
| 922 | 3300026118 | Ga0207675_100166532 | Ga0207675_1001665322 | 286 |
| 923 | 3300026118 | Ga0207675_100243853 | Ga0207675_1002438533 | 286 |
| 924 | 3300026121 | Ga0207683_10063276 | Ga0207683_100632763 | 286 |
| 925 | 3300026121 | Ga0207683_10360390 | Ga0207683_103603902 | 286 |
| 926 | 3300026121 | Ga0207683_10387952 | Ga0207683_103879522 | 286 |
| 927 | 3300026142 | Ga0207698_10063162 | Ga0207698_100631624 | 286 |
| 928 | 3300026142 | Ga0207698_10101537 | Ga0207698_101015373 | 286 |
| 929 | 3300026142 | Ga0207698_10219781 | Ga0207698_102197813 | 286 |
| 930 | 3300026142 | Ga0207698_10507404 | Ga0207698_105074042 | 286 |
| 931 | 3300028379 | Ga0268266_10004510 | Ga0268266_1000451013 | 286 |
| 932 | 3300028379 | Ga0268266_10009167 | Ga0268266_100091674 | 286 |
| 933 | 3300028379 | Ga0268266_10080191 | Ga0268266_100801914 | 286 |
| 934 | 3300028379 | Ga0268266_10095681 | Ga0268266_100956813 | 286 |
| 935 | 3300028380 | Ga0268265_10473717 | Ga0268265_104737172 | 286 |
| 936 | 3300028381 | Ga0268264_10189404 | Ga0268264_101894042 | 286 |
| 937 | 3300028381 | Ga0268264_10352260 | Ga0268264_103522602 | 286 |
| 938 | 3300028381 | Ga0268264_10415473 | Ga0268264_104154732 | 286 |
| 939 | 3300028381 | Ga0268264_10459690 | Ga0268264_104596902 | 286 |
| 940 | 3300028786 | Ga0307517_10001121 | Ga0307517_100011213 | 286 |
| 941 | 3300028794 | Ga0307515_10060735 | Ga0307515_100607353 | 286 |
| 942 | 3300028794 | Ga0307515_10293805 | Ga0307515_102938052 | 286 |
| 943 | 3300031238 | Ga0265332_10015679 | Ga0265332_100156793 | 286 |
| 944 | 3300031238 | Ga0265332_10067378 | Ga0265332_100673782 | 286 |
| 945 | 3300031247 | Ga0265340_10008593 | Ga0265340_100085933 | 286 |
| 946 | 3300031250 | Ga0265331_10074003 | Ga0265331_100740032 | 286 |
| 947 | 3300031456 | Ga0307513_10246800 | Ga0307513_102468003 | 286 |
| 948 | 3300031616 | Ga0307508_10003339 | Ga0307508_100033398 | 286 |
| 949 | 3300031616 | Ga0307508_10052138 | Ga0307508_100521385 | 286 |
| 950 | 3300031616 | Ga0307508_10378227 | Ga0307508_103782271 | 286 |
| 951 | 3300031852 | Ga0307410_10139011 | Ga0307410_101390111 | 286 |
| 952 | 3300031901 | Ga0307406_10063979 | Ga0307406_100639793 | 286 |
| 953 | 3300031911 | Ga0307412_10153785 | Ga0307412_101537853 | 286 |
| 954 | 3300031911 | Ga0307412_10305069 | Ga0307412_103050692 | 286 |
| 955 | 3300031995 | Ga0307409_100171799 | Ga0307409_1001717992 | 286 |
| 956 | 3300031995 | Ga0307409_100454496 | Ga0307409_1004544962 | 286 |
| 957 | 3300032002 | Ga0307416_100074472 | Ga0307416_1000744725 | 286 |
| 958 | 3300032002 | Ga0307416_100179965 | Ga0307416_1001799654 | 286 |
| 959 | 3300032004 | Ga0307414_10124646 | Ga0307414_101246462 | 286 |
| 960 | 3300032126 | Ga0307415_100136752 | Ga0307415_1001367523 | 286 |
| 961 | 3300033180 | Ga0307510_10035129 | Ga0307510_100351296 | 286 |
| 962 | 3300035086 | Ga0373934_0003984 | Ga0373934_0003984_2597_3478 | 286 |
| 963 | 3300035086 | Ga0373934_0040090 | Ga0373934_0040090_194_1075 | 286 |
| 964 | 3300035113 | Ga0373936_0143405 | Ga0373936_0143405_150_1022 | 286 |
| 965 | 3300035117 | Ga0373953_0003130 | Ga0373953_0003130_1628_2509 | 286 |
| 966 | 3300035118 | Ga0373954_0011341 | Ga0373954_0011341_1983_2864 | 286 |
| 967 | 3300035119 | Ga0373956_0001760 | Ga0373956_0001760_1421_2302 | 286 |
| 968 | 3300035120 | Ga0373957_0017164 | Ga0373957_0017164_806_1687 | 286 |
| 969 | 3300035171 | Ga0373946_0036579 | Ga0373946_0036579_1047_1928 | 286 |
| 970 | 3300035172 | Ga0373955_0022100 | Ga0373955_0022100_1456_2337 | 286 |
| 971 | 3300035172 | Ga0373955_0024324 | Ga0373955_0024324_2204_3085 | 286 |
| 972 | 3300035410 | Ga0373924_0006304 | Ga0373924_0006304_2007_2888 | 286 |
| 973 | 3300035692 | Ga0373935_0027489 | Ga0373935_0027489_945_1826 | 286 |
| 974 | 3300035695 | Ga0373927_0003207 | Ga0373927_0003207_2568_3449 | 286 |
| 975 | 3300035724 | Ga0373933_0036431 | Ga0373933_0036431_779_1660 | 286 |
| 976 | 3300035725 | Ga0373947_0006026 | Ga0373947_0006026_953_1834 | 286 |
| 977 | 3300036401 | Ga0373937_0135591 | Ga0373937_0135591_945_1826 | 286 |
| 978 | 3300037068 | Ga0373925_0088330 | Ga0373925_0088330_525_1406 | 286 |
| 979 | 3300037466 | Ga0395898_0184417 | Ga0395898_0184417_316_1197 | 286 |
| 980 | 3300037471 | Ga0395905_0003426 | Ga0395905_0003426_15461_16372 | 286 |
| 981 | 3300038443 | Ga0395901_0243494 | Ga0395901_0243494_24_896 | 286 |
| 982 | 3300039437 | Ga0436365_0420080 | Ga0436365_0420080_156_1028 | 286 |
| 983 | 3300039438 | Ga0436360_0811287 | Ga0436360_0811287_174_1055 | 286 |
| 984 | 3300039447 | Ga0436361_0752651 | Ga0436361_0752651_433_1314 | 286 |
| 985 | 3300039447 | Ga0436361_1023822 | Ga0436361_1023822_662_1543 | 286 |
| 986 | 3300039453 | Ga0436362_0326507 | Ga0436362_0326507_1692_2573 | 286 |
| 987 | 3300046452 | Ga0495617_015362 | Ga0495617_015362_1170_2042 | 286 |
| 988 | 3300046454 | Ga0495592_0002294 | Ga0495592_0002294_11279_12160 | 286 |
| 989 | 3300046454 | Ga0495592_0012750 | Ga0495592_0012750_4649_5530 | 286 |
| 990 | 3300046455 | Ga0495603_0000182 | Ga0495603_0000182_30602_31483 | 286 |
| 991 | 3300046455 | Ga0495603_0050821 | Ga0495603_0050821_1466_2338 | 286 |
| 992 | 3300046459 | Ga0495629_0000314 | Ga0495629_0000314_24351_25232 | 286 |
| 993 | 3300046459 | Ga0495629_0000529 | Ga0495629_0000529_805_1686 | 286 |
| 994 | 3300046460 | Ga0495638_0037355 | Ga0495638_0037355_853_1725 | 286 |
| 995 | 3300046461 | Ga0495641_0001508 | Ga0495641_0001508_958_1839 | 286 |
| 996 | 3300046461 | Ga0495641_0028046 | Ga0495641_0028046_125_997 | 286 |
| 997 | 3300046462 | Ga0495651_0068966 | Ga0495651_0068966_807_1688 | 286 |
| 998 | 3300046463 | Ga0495653_0085999 | Ga0495653_0085999_476_1357 | 286 |
| 999 | 3300046472 | Ga0495580_0002541 | Ga0495580_0002541_4893_5774 | 286 |
| 1000 | 3300046473 | Ga0495582_0036076 | Ga0495582_0036076_99_980 | 286 |
| 1001 | 3300046474 | Ga0495605_0057559 | Ga0495605_0057559_687_1559 | 286 |
| 1002 | 3300046475 | Ga0495639_0006669 | Ga0495639_0006669_952_1833 | 286 |
| 1003 | 3300046476 | Ga0495662_0001470 | Ga0495662_0001470_10053_10934 | 286 |
| 1004 | 3300046477 | Ga0495664_0009660 | Ga0495664_0009660_2316_3200 | 286 |
| 1005 | 3300046492 | Ga0495585_0042555 | Ga0495585_0042555_994_1866 | 286 |
| 1006 | 3300046492 | Ga0495585_0103848 | Ga0495585_0103848_230_1102 | 286 |
| 1007 | 3300046499 | Ga0495594_0000302 | Ga0495594_0000302_1028_1909 | 286 |
| 1008 | 3300046499 | Ga0495594_0150379 | Ga0495594_0150379_333_1214 | 286 |
| 1009 | 3300046500 | Ga0495596_0048678 | Ga0495596_0048678_97_978 | 286 |
| 1010 | 3300046507 | Ga0495606_0101227 | Ga0495606_0101227_202_1083 | 286 |
| 1011 | 3300046507 | Ga0495606_0116865 | Ga0495606_0116865_508_1380 | 286 |
| 1012 | 3300046511 | Ga0495608_0022254 | Ga0495608_0022254_1273_2154 | 286 |
| 1013 | 3300046512 | Ga0495610_0057061 | Ga0495610_0057061_594_1466 | 286 |
| 1014 | 3300046513 | Ga0495616_0033846 | Ga0495616_0033846_1621_2502 | 286 |
| 1015 | 3300046515 | Ga0495620_0021818 | Ga0495620_0021818_1700_2581 | 286 |
| 1016 | 3300046516 | Ga0495628_0003600 | Ga0495628_0003600_12204_13085 | 286 |
| 1017 | 3300046516 | Ga0495628_0014010 | Ga0495628_0014010_3678_4559 | 286 |
| 1018 | 3300046517 | Ga0495630_0002415 | Ga0495630_0002415_8029_8910 | 286 |
| 1019 | 3300046518 | Ga0495631_0029165 | Ga0495631_0029165_1055_1927 | 286 |
| 1020 | 3300046519 | Ga0495632_0030152 | Ga0495632_0030152_640_1512 | 286 |
| 1021 | 3300046523 | Ga0495644_0030462 | Ga0495644_0030462_851_1723 | 286 |
| 1022 | 3300046529 | Ga0495652_0024151 | Ga0495652_0024151_3719_4600 | 286 |
| 1023 | 3300046529 | Ga0495652_0050577 | Ga0495652_0050577_2560_3441 | 286 |
| 1024 | 3300046529 | Ga0495652_0358591 | Ga0495652_0358591_103_984 | 286 |
| 1025 | 3300046530 | Ga0495654_0023326 | Ga0495654_0023326_2175_3056 | 286 |
| 1026 | 3300046531 | Ga0495665_0000619 | Ga0495665_0000619_16336_17217 | 286 |
| 1027 | 3300046533 | Ga0495640_0000308 | Ga0495640_0000308_24545_25426 | 286 |
| 1028 | 3300046533 | Ga0495640_0044770 | Ga0495640_0044770_807_1688 | 286 |
| 1029 | 3300046542 | Ga0495597_0065137 | Ga0495597_0065137_649_1521 | 286 |
| 1030 | 3300046543 | Ga0495645_0011116 | Ga0495645_0011116_86_970 | 286 |
| 1031 | 3300046543 | Ga0495645_0063315 | Ga0495645_0063315_830_1711 | 286 |
| 1032 | 3300046557 | Ga0495622_0002921 | Ga0495622_0002921_970_1851 | 286 |
| 1033 | 3300046557 | Ga0495622_0031501 | Ga0495622_0031501_1204_2085 | 286 |
| 1034 | 3300046557 | Ga0495622_0054035 | Ga0495622_0054035_698_1570 | 286 |
| 1035 | 3300046559 | Ga0495667_0004819 | Ga0495667_0004819_3904_4785 | 286 |
| 1036 | 3300046559 | Ga0495667_0077408 | Ga0495667_0077408_476_1357 | 286 |
| 1037 | 3300046616 | Ga0495668_0023015 | Ga0495668_0023015_1970_2842 | 286 |
| 1038 | 3300046616 | Ga0495668_0026224 | Ga0495668_0026224_1886_2767 | 286 |
| 1039 | 3300046616 | Ga0495668_0164858 | Ga0495668_0164858_96_968 | 286 |
| 1040 | 3300046642 | Ga0495634_0001483 | Ga0495634_0001483_18941_19822 | 286 |
| 1041 | 3300046642 | Ga0495634_0083778 | Ga0495634_0083778_1155_2036 | 286 |
| 1042 | 3300046663 | Ga0495635_0000429 | Ga0495635_0000429_1315_2196 | 286 |
| 1043 | 3300046665 | Ga0495661_0023684 | Ga0495661_0023684_803_1684 | 286 |
| 1044 | 3300046674 | Ga0495588_0003361 | Ga0495588_0003361_970_1851 | 286 |
| 1045 | 3300046674 | Ga0495588_0194935 | Ga0495588_0194935_55_927 | 286 |
| 1046 | 3300046675 | Ga0495657_0026788 | Ga0495657_0026788_807_1688 | 286 |
| 1047 | 3300046678 | Ga0495599_0005767 | Ga0495599_0005767_4515_5399 | 286 |
| 1048 | 3300046678 | Ga0495599_0025597 | Ga0495599_0025597_2338_3219 | 286 |
| 1049 | 3300046679 | Ga0495623_0022432 | Ga0495623_0022432_2391_3272 | 286 |
| 1050 | 3300046680 | Ga0495646_0100369 | Ga0495646_0100369_420_1301 | 286 |
| 1051 | 3300046681 | Ga0495647_0026282 | Ga0495647_0026282_226_1107 | 286 |
| 1052 | 3300046683 | Ga0495658_0000936 | Ga0495658_0000936_910_1791 | 286 |
| 1053 | 3300046684 | Ga0495669_0039321 | Ga0495669_0039321_679_1551 | 286 |
| 1054 | 3300046684 | Ga0495669_0046821 | Ga0495669_0046821_265_1137 | 286 |
| 1055 | 3300046689 | Ga0495613_0006256 | Ga0495613_0006256_769_1650 | 286 |
| 1056 | 3300046690 | Ga0495624_0000810 | Ga0495624_0000810_950_1831 | 286 |
| 1057 | 3300046691 | Ga0495670_0030273 | Ga0495670_0030273_1533_2414 | 286 |
| 1058 | 3300046691 | Ga0495670_0082982 | Ga0495670_0082982_215_1087 | 286 |
| 1059 | 3300046691 | Ga0495670_0141755 | Ga0495670_0141755_164_1036 | 286 |
| 1060 | 3300046692 | Ga0495671_0064047 | Ga0495671_0064047_849_1721 | 286 |
| 1061 | 3300046694 | Ga0495649_0089456 | Ga0495649_0089456_498_1379 | 286 |
| 1062 | 3300046694 | Ga0495649_0102231 | Ga0495649_0102231_360_1232 | 286 |
| 1063 | 3300046809 | Ga0495600_0053775 | Ga0495600_0053775_476_1357 | 286 |
| 1064 | 3300047315 | Ga0495581_0000683 | Ga0495581_0000683_970_1851 | 286 |
| 1065 | 3300047315 | Ga0495581_0162878 | Ga0495581_0162878_251_1132 | 286 |
| 1066 | 3300047318 | Ga0495636_0111990 | Ga0495636_0111990_13_885 | 286 |
| 1067 | 3300047319 | Ga0495674_0012056 | Ga0495674_0012056_6317_7198 | 286 |
| 1068 | 3300047319 | Ga0495674_0033712 | Ga0495674_0033712_2874_3755 | 286 |
| 1069 | 3300047319 | Ga0495674_0146672 | Ga0495674_0146672_577_1449 | 286 |
| 1070 | 3300047320 | Ga0495672_0109264 | Ga0495672_0109264_341_1225 | 286 |
| 1071 | 3300047320 | Ga0495672_0121063 | Ga0495672_0121063_105_986 | 286 |
| 1072 | 3300047320 | Ga0495672_0151379 | Ga0495672_0151379_218_1090 | 286 |
| 1073 | 3300047321 | Ga0495676_0005624 | Ga0495676_0005624_556_1437 | 286 |
| 1074 | 3300047321 | Ga0495676_0180423 | Ga0495676_0180423_416_1297 | 286 |
| 1075 | 3300047322 | Ga0495680_0014721 | Ga0495680_0014721_4975_5856 | 286 |
| 1076 | 3300047323 | Ga0495683_0121561 | Ga0495683_0121561_317_1189 | 286 |
| 1077 | 3300047444 | Ga0495675_0037224 | Ga0495675_0037224_1273_2154 | 286 |
| 1078 | 3300047445 | Ga0495677_0025193 | Ga0495677_0025193_383_1255 | 286 |
| 1079 | 3300047469 | Ga0495673_0013795 | Ga0495673_0013795_1777_2658 | 286 |
| 1080 | 3300047469 | Ga0495673_0021484 | Ga0495673_0021484_278_1150 | 286 |
| 1081 | 3300047471 | Ga0495684_0000497 | Ga0495684_0000497_30287_31168 | 286 |
| 1082 | 3300047472 | Ga0495686_0148098 | Ga0495686_0148098_166_1050 | 286 |
| 1083 | 3300047673 | Ga0495593_0000370 | Ga0495593_0000370_830_1711 | 286 |
| 1084 | 3300047673 | Ga0495593_0001303 | Ga0495593_0001303_926_1807 | 286 |
| 1085 | 3300047673 | Ga0495593_0087448 | Ga0495593_0087448_301_1182 | 286 |
| 1086 | 3300047673 | Ga0495593_0127035 | Ga0495593_0127035_402_1268 | 286 |
| 1087 | 3300048089 | Ga0495614_0039902 | Ga0495614_0039902_357_1238 | 286 |
| 1088 | 3300048903 | Ga0496100_0074805 | Ga0496100_0074805_932_1813 | 286 |
| 1089 | 3300048903 | Ga0496100_0257320 | Ga0496100_0257320_256_1122 | 286 |
| 1090 | 3300048904 | Ga0496101_0019312 | Ga0496101_0019312_167_1033 | 286 |
| 1091 | 3300048904 | Ga0496101_0118861 | Ga0496101_0118861_728_1600 | 286 |
| 1092 | 3300048905 | Ga0496102_0014065 | Ga0496102_0014065_3780_4646 | 286 |
| 1093 | 3300048907 | Ga0496104_0069857 | Ga0496104_0069857_2408_3289 | 286 |
| 1094 | 3300048907 | Ga0496104_0264148 | Ga0496104_0264148_224_1105 | 286 |
| 1095 | 3300048907 | Ga0496104_0299001 | Ga0496104_0299001_143_1009 | 286 |
| 1096 | 3300048908 | Ga0496105_0035781 | Ga0496105_0035781_42_923 | 286 |
| 1097 | 3300048908 | Ga0496105_0167151 | Ga0496105_0167151_446_1312 | 286 |
| 1098 | 3300048908 | Ga0496105_0234502 | Ga0496105_0234502_169_1050 | 286 |
| 1099 | 3300048909 | Ga0496106_0009281 | Ga0496106_0009281_614_1495 | 286 |
| 1100 | 3300048909 | Ga0496106_0070891 | Ga0496106_0070891_771_1652 | 286 |
| 1101 | 3300048910 | Ga0496107_0012775 | Ga0496107_0012775_2452_3318 | 286 |
| 1102 | 3300048910 | Ga0496107_0042429 | Ga0496107_0042429_407_1288 | 286 |
| 1103 | 3300048910 | Ga0496107_0114376 | Ga0496107_0114376_737_1609 | 286 |
| 1104 | 3300048910 | Ga0496107_0258453 | Ga0496107_0258453_348_1220 | 286 |
| 1105 | 3300048910 | Ga0496107_0441466 | Ga0496107_0441466_26_898 | 286 |
| 1106 | 3300048911 | Ga0496108_0001270 | Ga0496108_0001270_2484_3365 | 286 |
| 1107 | 3300048911 | Ga0496108_0025132 | Ga0496108_0025132_1635_2507 | 286 |
| 1108 | 3300048911 | Ga0496108_0132477 | Ga0496108_0132477_591_1457 | 286 |
| 1109 | 3300048911 | Ga0496108_0292098 | Ga0496108_0292098_423_1283 | 286 |
| 1110 | 3300048912 | Ga0496109_0001572 | Ga0496109_0001572_15938_16819 | 286 |
| 1111 | 3300048913 | Ga0496110_0117639 | Ga0496110_0117639_1379_2245 | 286 |
| 1112 | 3300048913 | Ga0496110_0290131 | Ga0496110_0290131_170_1042 | 286 |
| 1113 | 3300048913 | Ga0496110_0342296 | Ga0496110_0342296_414_1295 | 286 |
| 1114 | 3300048914 | Ga0496111_0005572 | Ga0496111_0005572_3372_4253 | 286 |
| 1115 | 3300048914 | Ga0496111_0165583 | Ga0496111_0165583_472_1332 | 286 |
| 1116 | 3300048915 | Ga0496112_0009102 | Ga0496112_0009102_6226_7107 | 286 |
| 1117 | 3300048915 | Ga0496112_0052144 | Ga0496112_0052144_291_1172 | 286 |
| 1118 | 3300048916 | Ga0496113_0018458 | Ga0496113_0018458_269_1135 | 286 |
| 1119 | 3300048917 | Ga0496114_0002069 | Ga0496114_0002069_7190_8056 | 286 |
| 1120 | 3300048917 | Ga0496114_0218598 | Ga0496114_0218598_448_1320 | 286 |
| 1121 | 3300048917 | Ga0496114_0275343 | Ga0496114_0275343_146_1018 | 286 |
| 1122 | 3300048918 | Ga0496115_0005035 | Ga0496115_0005035_8147_9013 | 286 |
| 1123 | 3300048919 | Ga0496116_0010029 | Ga0496116_0010029_6217_7098 | 286 |
| 1124 | 3300048920 | Ga0496117_0042436 | Ga0496117_0042436_53_934 | 286 |
| 1125 | 3300048921 | Ga0496118_0011634 | Ga0496118_0011634_727_1599 | 286 |
| 1126 | 3300048921 | Ga0496118_0085105 | Ga0496118_0085105_753_1634 | 286 |
| 1127 | 3300048921 | Ga0496118_0126147 | Ga0496118_0126147_566_1438 | 286 |
| 1128 | 3300048921 | Ga0496118_0126844 | Ga0496118_0126844_354_1235 | 286 |
| 1129 | 3300048923 | Ga0496120_0085482 | Ga0496120_0085482_572_1444 | 286 |
| 1130 | 3300048924 | Ga0496121_0022640 | Ga0496121_0022640_988_1869 | 286 |
| 1131 | 3300048924 | Ga0496121_0054773 | Ga0496121_0054773_1753_2625 | 286 |
| 1132 | 3300048924 | Ga0496121_0057072 | Ga0496121_0057072_567_1439 | 286 |
| 1133 | 3300048925 | Ga0496122_0020500 | Ga0496122_0020500_4491_5372 | 286 |
| 1134 | 3300048927 | Ga0496124_0075371 | Ga0496124_0075371_104_976 | 286 |
| 1135 | 3300048928 | Ga0496125_0017706 | Ga0496125_0017706_3452_4333 | 286 |
| 1136 | 3300048928 | Ga0496125_0066290 | Ga0496125_0066290_297_1178 | 286 |
| 1137 | 3300048928 | Ga0496125_0102411 | Ga0496125_0102411_633_1505 | 286 |
| 1138 | 3300048929 | Ga0496126_0037296 | Ga0496126_0037296_1742_2614 | 286 |
| 1139 | 3300048929 | Ga0496126_0065959 | Ga0496126_0065959_1481_2362 | 286 |
| 1140 | 3300048929 | Ga0496126_0089520 | Ga0496126_0089520_1680_2552 | 286 |
| 1141 | 3300048929 | Ga0496126_0159757 | Ga0496126_0159757_763_1635 | 286 |
| 1142 | 3300048929 | Ga0496126_0260492 | Ga0496126_0260492_248_1126 | 286 |
| 1143 | 3300049459 | Ga0495678_042590 | Ga0495678_042590_566_1438 | 286 |
| 1144 | 3300049576 | Ga0501040_0378790 | Ga0501040_0378790_30_902 | 286 |
| 1145 | 3300050492 | nmdc:mga0yw44_234843_c1 | nmdc:mga0yw44_234843_c1_160_1041 | 286 |
| 1146 | 3300050492 | nmdc:mga0yw44_2955_c1 | nmdc:mga0yw44_2955_c1_596_1468 | 286 |
| 1147 | 3300050492 | nmdc:mga0yw44_75476_c1 | nmdc:mga0yw44_75476_c1_525_1406 | 286 |
| 1148 | 3300050493 | nmdc:mga0k408_1944_c1 | nmdc:mga0k408_1944_c1_9363_10235 | 286 |
| 1149 | 3300050494 | nmdc:mga06z11_15815_c1 | nmdc:mga06z11_15815_c1_938_1810 | 286 |
| 1150 | 3300050494 | nmdc:mga06z11_76686_c1 | nmdc:mga06z11_76686_c1_789_1661 | 286 |
| 1151 | 3300050496 | nmdc:mga07m45_146231_c1 | nmdc:mga07m45_146231_c1_297_1178 | 286 |
| 1152 | 3300050496 | nmdc:mga07m45_53044_c1 | nmdc:mga07m45_53044_c1_596_1468 | 286 |
| 1153 | 3300050511 | nmdc:mga08y16_139533_c1 | nmdc:mga08y16_139533_c1_1117_1989 | 286 |
| 1154 | 3300050511 | nmdc:mga08y16_583004_c1 | nmdc:mga08y16_583004_c1_199_1071 | 286 |
| 1155 | 3300050512 | nmdc:mga0n895_153988_c1 | nmdc:mga0n895_153988_c1_586_1458 | 286 |
| 1156 | 3300050512 | nmdc:mga0n895_17055_c1 | nmdc:mga0n895_17055_c1_851_1723 | 286 |
| 1157 | 3300050513 | nmdc:mga0rr50_43438_c1 | nmdc:mga0rr50_43438_c1_1507_2379 | 286 |
| 1158 | 3300050516 | nmdc:mga0sz30_14969_c1 | nmdc:mga0sz30_14969_c1_1945_2817 | 286 |
| 1159 | 3300053077 | Ga0495601_0028296 | Ga0495601_0028296_471_1352 | 286 |
| 1160 | 3300053084 | Ga0495595_0005825 | Ga0495595_0005825_1860_2741 | 286 |
| 1161 | 3300053084 | Ga0495595_0079856 | Ga0495595_0079856_425_1297 | 286 |
| 1162 | 3300053086 | Ga0500578_0090156 | Ga0500578_0090156_617_1489 | 286 |
| 1163 | 3300053093 | Ga0500651_0122446 | Ga0500651_0122446_415_1296 | 286 |
| 1164 | 3300053094 | Ga0500566_0003522 | Ga0500566_0003522_5562_6443 | 286 |
| 1165 | 3300053096 | Ga0500641_0008813 | Ga0500641_0008813_2141_3013 | 286 |
| 1166 | 3300053096 | Ga0500641_0013142 | Ga0500641_0013142_1630_2502 | 286 |
| 1167 | 3300053096 | Ga0500641_0018495 | Ga0500641_0018495_583_1464 | 286 |
| 1168 | 3300053098 | Ga0500650_0006071 | Ga0500650_0006071_394_1275 | 286 |
| 1169 | 3300053104 | Ga0500556_0000011 | Ga0500556_0000011_137437_138318 | 286 |
| 1170 | 3300053109 | Ga0500569_030480 | Ga0500569_030480_613_1494 | 286 |
| 1171 | 3300053109 | Ga0500569_057461 | Ga0500569_057461_267_1139 | 286 |
| 1172 | 3300053119 | Ga0500595_009153 | Ga0500595_009153_2265_3137 | 286 |
| 1173 | 3300053122 | Ga0500608_001666 | Ga0500608_001666_6852_7733 | 286 |
| 1174 | 3300053130 | Ga0500642_0000030 | Ga0500642_0000030_38253_39134 | 286 |
| 1175 | 3300053131 | Ga0500652_001587 | Ga0500652_001587_5957_6838 | 286 |
| 1176 | 3300053136 | Ga0500559_0000272 | Ga0500559_0000272_6694_7575 | 286 |
| 1177 | 3300053137 | Ga0500561_0011900 | Ga0500561_0011900_367_1239 | 286 |
| 1178 | 3300053139 | Ga0500568_0000246 | Ga0500568_0000246_7608_8489 | 286 |
| 1179 | 3300053151 | Ga0500604_0025852 | Ga0500604_0025852_791_1672 | 286 |
| 1180 | 3300053153 | Ga0500616_0000026 | Ga0500616_0000026_210308_211189 | 286 |
| 1181 | 3300053156 | Ga0500622_0046926 | Ga0500622_0046926_388_1269 | 286 |
| 1182 | 3300053158 | Ga0500627_0026563 | Ga0500627_0026563_1007_1888 | 286 |
| 1183 | 3300053177 | Ga0500636_0022787 | Ga0500636_0022787_1258_2130 | 286 |
| 1184 | 3300053177 | Ga0500636_0047123 | Ga0500636_0047123_1387_2268 | 286 |
| 1185 | 3300053177 | Ga0500636_0157011 | Ga0500636_0157011_239_1111 | 286 |
| 1186 | 3300053178 | Ga0500637_0128031 | Ga0500637_0128031_567_1439 | 286 |
| 1187 | 3300053739 | Ga0500587_008712 | Ga0500587_008712_123_995 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xlx-assembly1.cif.gz_D | crystal structure of the c-terminal domain of cher1 containing sah | 0.8884 | 72 | 267 |
| 5xlx-assembly1.cif.gz_D | crystal structure of the c-terminal domain of cher1 containing sah | 0.8637 | 72 | 267 |
| 7phf-assembly1.cif.gz_B | chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk | 0.8595 | 194 | 242 |
| 8hkr-assembly1.cif.gz_B | crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis | 0.8108 | 99 | 242 |
| 8hkr-assembly1.cif.gz_A | crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis | 0.8044 | 99 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ftwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.882 | 70 | 267 | 3.40.50.150 |
| 5ftwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8692 | 70 | 267 | 3.40.50.150 |
| 1bc5A01 | Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain | 0.8678 | 1 | 68 | 1.10.155.10 |
| 3i53B03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8002 | 103 | 242 | 3.40.50.150 |
| 1af7A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7916 | 69 | 268 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5UYS3-F1-model_v4 | Chemotaxis protein CheR | 0.9304 | 68 | 269 |
GO:0008757
|
| AF-A0A3D5UYS3-F1-model_v4 | Chemotaxis protein CheR | 0.9131 | 68 | 269 |
GO:0008757
|
| AF-A0A168UH17-F1-model_v4 | deleted | 0.9095 | 71 | 267 |
|
| AF-A0A519KZF9-F1-model_v4 | Methyltransferase domain-containing protein | 0.9022 | 140 | 269 |
GO:0008757
GO:0032259 |
| AF-A0A831QJC6-F1-model_v4 | Protein-glutamate O-methyltransferase CheR | 0.9004 | 56 | 267 |
GO:0008757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar