F491391
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1186 | 414 | 1140 | 300 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221605|2644040732 |
| Length | 353 |
| Sequence | VWVEHEGGAVKDATLSTVTAAAKLGEVHLLVAGQGVGGVADAAAKIAGVGKVHVADDAAYANALPENVAPLVVELMGHHDAFLAPATANGKXIAPRVAALLDVMQISEILSVESEDSFTRPTYAGATVQSSDAKKVITVRATAFEKAAREGGSGSVEAVSGKGDAGLSSFVGAEISKSERPELTSAKVIVSGGRALQNGENFHEIIEPLADKLGAAVGASRAAVXPGQPRRLEELFGLVIVSGGRALQNGENFHEIIEPLADKLGAAVGASRAAVXAGYVPNDYQVGQTGKIVAPEVYIAVGISGAIQHLAGMKDSKTIIAINKDEEAPIFQVADLGLVGDLFKVVPELTGKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 7 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 8 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 9 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 10 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 11 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 12 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 13 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 14 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 15 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 16 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 17 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 18 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 19 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 20 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 21 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 22 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 23 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 24 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 25 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 26 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 27 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 28 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 29 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 30 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 31 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 32 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 33 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 34 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 35 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 36 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 37 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 38 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 39 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 40 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 41 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 42 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 43 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 44 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 45 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 46 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 47 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 48 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 49 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 50 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 53 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 72 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 121 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 122 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 123 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 124 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 125 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 126 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 127 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 136 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 179 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 180 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 181 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 266 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 267 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 268 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 269 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 271 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 272 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 273 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 274 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 276 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 277 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 278 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 279 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 280 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 281 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 282 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 298 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 299 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 300 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 301 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 302 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 395 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 401 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 408 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 414 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.87 |
| Metatranscriptomes | 0.25 |
| Isolates | 3.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.67 |
| Bulb | 0 |
| Endosphere | 8.18 |
| Nodule | 0.51 |
| Rhizoplane | 3.71 |
| Rhizosphere | 79.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2401412 | 2162886007 | Eukaryota | 56725 |
| 2 | SwRhRL2b_contig_3660944 | 2162886007 | Bacteria | 20313 |
| 3 | JGI24736J21556_1000001 | 3300001904 | Bacteria | 63863 |
| 4 | JGI24736J21556_1000014 | 3300001904 | Bacteria | 29181 |
| 5 | JGI24741J21665_1002462 | 3300001915 | Bacteria | 4798 |
| 6 | JGI24752J21851_1000099 | 3300001976 | Bacteria | 11498 |
| 7 | JGI24752J21851_1000837 | 3300001976 | Bacteria | 4165 |
| 8 | JGI24740J21852_10002997 | 3300001979 | Bacteria | 7474 |
| 9 | JGI24740J21852_10015018 | 3300001979 | Bacteria | 2839 |
| 10 | JGI24740J21852_10015278 | 3300001979 | Bacteria | 2807 |
| 11 | JGI24739J22299_10001158 | 3300001989 | Bacteria | 9857 |
| 12 | JGI24739J22299_10006093 | 3300001989 | Bacteria | 4557 |
| 13 | JGI24739J22299_10013801 | 3300001989 | Bacteria | 2945 |
| 14 | JGI24737J22298_10009546 | 3300001990 | Bacteria | 3220 |
| 15 | JGI24737J22298_10013918 | 3300001990 | Bacteria | 2616 |
| 16 | JGI24737J22298_10021087 | 3300001990 | Bacteria | 2078 |
| 17 | JGI24737J22298_10035213 | 3300001990 | Bacteria | 1549 |
| 18 | JGI24743J22301_10011359 | 3300001991 | Bacteria | 1603 |
| 19 | JGI24735J21928_10001152 | 3300002067 | Bacteria | 9454 |
| 20 | JGI24735J21928_10006565 | 3300002067 | Bacteria | 3823 |
| 21 | JGI24735J21928_10007993 | 3300002067 | Bacteria | 3435 |
| 22 | JGI24735J21928_10009260 | 3300002067 | Bacteria | 3167 |
| 23 | JGI24735J21928_10047060 | 3300002067 | Bacteria | 1250 |
| 24 | JGI24738J21930_10001186 | 3300002075 | Bacteria | 7294 |
| 25 | JGI24738J21930_10004607 | 3300002075 | Bacteria | 3363 |
| 26 | JGI24749J21850_1000250 | 3300002076 | Bacteria | 8443 |
| 27 | JGI24034J26672_10001749 | 3300002239 | Bacteria | 2922 |
| 28 | JGI24751J29686_10001179 | 3300002459 | Bacteria | 5568 |
| 29 | JGI24751J29686_10029286 | 3300002459 | Bacteria | 1143 |
| 30 | JGI25150J39212_1000067 | 3300002774 | Bacteria | 63491 |
| 31 | JGI25153J46596_10000073 | 3300003215 | Bacteria | 115166 |
| 32 | JGI25153J46596_10042831 | 3300003215 | Bacteria | 1378 |
| 33 | rootL2_10049419 | 3300003322 | Bacteria | 2822 |
| 34 | Ga0055542_1008710 | 3300003762 | Bacteria | 1965 |
| 35 | Ga0055542_1010209 | 3300003762 | Bacteria | 1728 |
| 36 | Ga0055529_1005011 | 3300003763 | Bacteria | 1959 |
| 37 | Ga0055526_1002635 | 3300003771 | Bacteria | 11987 |
| 38 | Ga0055537_1000855 | 3300003773 | Bacteria | 14807 |
| 39 | Ga0055537_1003353 | 3300003773 | Bacteria | 4953 |
| 40 | Ga0055524_1000489 | 3300003775 | Bacteria | 31181 |
| 41 | Ga0055536_1009244 | 3300003781 | Bacteria | 4107 |
| 42 | Ga0055530_10000012 | 3300003791 | Bacteria | 164829 |
| 43 | Ga0055530_10000915 | 3300003791 | Bacteria | 24243 |
| 44 | Ga0055530_10007450 | 3300003791 | Bacteria | 4602 |
| 45 | Ga0055540_1001979 | 3300003792 | Bacteria | 11458 |
| 46 | Ga0055531_10001375 | 3300003794 | Bacteria | 18071 |
| 47 | Ga0055531_10002076 | 3300003794 | Bacteria | 13773 |
| 48 | Ga0055531_10010680 | 3300003794 | Bacteria | 4531 |
| 49 | Ga0055531_10010691 | 3300003794 | Bacteria | 4527 |
| 50 | Ga0055531_10011843 | 3300003794 | Bacteria | 4162 |
| 51 | Ga0055531_10019236 | 3300003794 | Bacteria | 2775 |
| 52 | Ga0065704_10070183 | 3300005289 | Eukaryota | 120256 |
| 53 | Ga0065704_10070410 | 3300005289 | Bacteria | 26094 |
| 54 | Ga0065704_10078581 | 3300005289 | Bacteria | 4388 |
| 55 | Ga0065704_10080202 | 3300005289 | Bacteria | 3990 |
| 56 | Ga0065704_10085713 | 3300005289 | Bacteria | 3193 |
| 57 | Ga0065715_10000525 | 3300005293 | Bacteria | 18834 |
| 58 | Ga0065707_10093150 | 3300005295 | Bacteria | 3667 |
| 59 | Ga0065707_10098335 | 3300005295 | Bacteria | 3093 |
| 60 | Ga0070658_10000492 | 3300005327 | Bacteria | 34327 |
| 61 | Ga0070658_10002437 | 3300005327 | Bacteria | 15566 |
| 62 | Ga0070658_10003145 | 3300005327 | Bacteria | 13618 |
| 63 | Ga0070658_10004725 | 3300005327 | Bacteria | 11074 |
| 64 | Ga0070658_10016748 | 3300005327 | Bacteria | 5867 |
| 65 | Ga0070658_10128241 | 3300005327 | Bacteria | 2113 |
| 66 | Ga0070658_10503319 | 3300005327 | Bacteria | 1046 |
| 67 | Ga0070676_10000029 | 3300005328 | Bacteria | 43536 |
| 68 | Ga0070676_10051976 | 3300005328 | Bacteria | 2407 |
| 69 | Ga0070676_10064458 | 3300005328 | Bacteria | 2185 |
| 70 | Ga0070683_100226595 | 3300005329 | Bacteria | 1776 |
| 71 | Ga0070683_100501317 | 3300005329 | Bacteria | 1160 |
| 72 | Ga0070690_100151851 | 3300005330 | Bacteria | 1581 |
| 73 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 74 | Ga0070670_100001338 | 3300005331 | Bacteria | 19696 |
| 75 | Ga0070670_100002350 | 3300005331 | Bacteria | 15582 |
| 76 | Ga0070670_100028850 | 3300005331 | Bacteria | 4776 |
| 77 | Ga0070670_100056786 | 3300005331 | Bacteria | 3360 |
| 78 | Ga0070670_100094261 | 3300005331 | Bacteria | 2575 |
| 79 | Ga0070670_100207902 | 3300005331 | Bacteria | 1701 |
| 80 | Ga0070677_10006520 | 3300005333 | Bacteria | 3879 |
| 81 | Ga0068869_100000668 | 3300005334 | Bacteria | 19399 |
| 82 | Ga0068869_100096737 | 3300005334 | Bacteria | 2229 |
| 83 | Ga0070666_10000089 | 3300005335 | Bacteria | 64147 |
| 84 | Ga0070666_10058133 | 3300005335 | Bacteria | 2614 |
| 85 | Ga0070680_100001504 | 3300005336 | Bacteria | 16982 |
| 86 | Ga0070680_100025496 | 3300005336 | Bacteria | 4726 |
| 87 | Ga0070680_100045358 | 3300005336 | Bacteria | 3574 |
| 88 | Ga0070680_100048827 | 3300005336 | Bacteria | 3449 |
| 89 | Ga0070682_100073675 | 3300005337 | Bacteria | 2191 |
| 90 | Ga0070682_100194291 | 3300005337 | Bacteria | 1427 |
| 91 | Ga0068868_100000139 | 3300005338 | Bacteria | 46645 |
| 92 | Ga0068868_100025889 | 3300005338 | Bacteria | 4466 |
| 93 | Ga0068868_100179309 | 3300005338 | Bacteria | 1757 |
| 94 | Ga0070660_100000017 | 3300005339 | Bacteria | 102283 |
| 95 | Ga0070660_100005671 | 3300005339 | Bacteria | 8651 |
| 96 | Ga0070660_100021489 | 3300005339 | Bacteria | 4761 |
| 97 | Ga0070660_100120546 | 3300005339 | Bacteria | 2093 |
| 98 | Ga0070660_100316740 | 3300005339 | Bacteria | 1281 |
| 99 | Ga0070689_100037387 | 3300005340 | Bacteria | 3712 |
| 100 | Ga0070691_10042850 | 3300005341 | Bacteria | 2143 |
| 101 | Ga0070687_100009474 | 3300005343 | Bacteria | 4175 |
| 102 | Ga0070661_100019204 | 3300005344 | Bacteria | 4868 |
| 103 | Ga0070661_100029048 | 3300005344 | Bacteria | 3989 |
| 104 | Ga0070661_100061123 | 3300005344 | Bacteria | 2765 |
| 105 | Ga0070661_100065746 | 3300005344 | Bacteria | 2664 |
| 106 | Ga0070692_10028039 | 3300005345 | Bacteria | 2797 |
| 107 | Ga0070668_100000009 | 3300005347 | Bacteria | 136884 |
| 108 | Ga0070668_100001726 | 3300005347 | Bacteria | 15886 |
| 109 | Ga0070668_100007239 | 3300005347 | Bacteria | 8228 |
| 110 | Ga0070668_100019447 | 3300005347 | Bacteria | 5111 |
| 111 | Ga0070668_100024478 | 3300005347 | Bacteria | 4576 |
| 112 | Ga0070668_100059003 | 3300005347 | Bacteria | 2970 |
| 113 | Ga0070668_100076241 | 3300005347 | Bacteria | 2619 |
| 114 | Ga0070668_100176014 | 3300005347 | Bacteria | 1745 |
| 115 | Ga0070668_100254258 | 3300005347 | Bacteria | 1459 |
| 116 | Ga0070668_100353942 | 3300005347 | Bacteria | 1243 |
| 117 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 118 | Ga0070669_100000610 | 3300005353 | Bacteria | 26599 |
| 119 | Ga0070669_100000646 | 3300005353 | Bacteria | 25770 |
| 120 | Ga0070669_100001807 | 3300005353 | Bacteria | 15406 |
| 121 | Ga0070669_100018055 | 3300005353 | Bacteria | 5040 |
| 122 | Ga0070675_100018279 | 3300005354 | Bacteria | 5579 |
| 123 | Ga0070675_100024384 | 3300005354 | Bacteria | 4844 |
| 124 | Ga0070675_100068100 | 3300005354 | Bacteria | 2947 |
| 125 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 126 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 127 | Ga0070671_100000098 | 3300005355 | Bacteria | 55077 |
| 128 | Ga0070671_100000864 | 3300005355 | Bacteria | 22133 |
| 129 | Ga0070671_100004809 | 3300005355 | Bacteria | 10737 |
| 130 | Ga0070671_100007364 | 3300005355 | Bacteria | 8790 |
| 131 | Ga0070671_100075885 | 3300005355 | Bacteria | 2808 |
| 132 | Ga0070671_100496505 | 3300005355 | Bacteria | 1050 |
| 133 | Ga0070674_100010715 | 3300005356 | Bacteria | 5556 |
| 134 | Ga0070674_100218124 | 3300005356 | Bacteria | 1483 |
| 135 | Ga0070673_100000013 | 3300005364 | Bacteria | 137021 |
| 136 | Ga0070673_100015714 | 3300005364 | Bacteria | 5326 |
| 137 | Ga0070659_100068324 | 3300005366 | Bacteria | 2818 |
| 138 | Ga0070659_100395683 | 3300005366 | Bacteria | 1166 |
| 139 | Ga0070667_100000315 | 3300005367 | Bacteria | 54132 |
| 140 | Ga0070667_100000513 | 3300005367 | Bacteria | 39042 |
| 141 | Ga0070667_100001750 | 3300005367 | Bacteria | 19407 |
| 142 | Ga0070667_100009388 | 3300005367 | Bacteria | 8114 |
| 143 | Ga0070667_100013726 | 3300005367 | Bacteria | 6696 |
| 144 | Ga0070667_100113539 | 3300005367 | Bacteria | 2351 |
| 145 | Ga0070667_100114296 | 3300005367 | Bacteria | 2343 |
| 146 | Ga0070667_100165074 | 3300005367 | Bacteria | 1953 |
| 147 | Ga0070714_100000922 | 3300005435 | Bacteria | 20838 |
| 148 | Ga0070705_100044993 | 3300005440 | Bacteria | 2538 |
| 149 | Ga0070700_100094271 | 3300005441 | Bacteria | 1960 |
| 150 | Ga0070694_100073343 | 3300005444 | Bacteria | 2364 |
| 151 | Ga0070708_100000180 | 3300005445 | Bacteria | 45454 |
| 152 | Ga0070708_100374285 | 3300005445 | Bacteria | 1343 |
| 153 | Ga0070663_100017908 | 3300005455 | Bacteria | 4631 |
| 154 | Ga0070678_100004619 | 3300005456 | Bacteria | 7826 |
| 155 | Ga0070662_100000631 | 3300005457 | Bacteria | 21318 |
| 156 | Ga0070662_100001553 | 3300005457 | Bacteria | 14170 |
| 157 | Ga0070662_100017146 | 3300005457 | Bacteria | 4875 |
| 158 | Ga0070662_100090723 | 3300005457 | Bacteria | 2294 |
| 159 | Ga0070662_100101972 | 3300005457 | Bacteria | 2173 |
| 160 | Ga0070662_100145686 | 3300005457 | Bacteria | 1839 |
| 161 | Ga0070662_100161588 | 3300005457 | Bacteria | 1752 |
| 162 | Ga0070681_10000473 | 3300005458 | Bacteria | 32789 |
| 163 | Ga0070681_10005511 | 3300005458 | Bacteria | 12228 |
| 164 | Ga0070681_10034434 | 3300005458 | Bacteria | 5085 |
| 165 | Ga0070681_10055257 | 3300005458 | Bacteria | 3953 |
| 166 | Ga0070681_10067156 | 3300005458 | Bacteria | 3555 |
| 167 | Ga0070681_10107087 | 3300005458 | Bacteria | 2737 |
| 168 | Ga0070681_10250387 | 3300005458 | Bacteria | 1684 |
| 169 | Ga0070681_10359658 | 3300005458 | Bacteria | 1366 |
| 170 | Ga0068867_100000009 | 3300005459 | Bacteria | 137021 |
| 171 | Ga0068867_100010488 | 3300005459 | Bacteria | 6536 |
| 172 | Ga0068867_100014480 | 3300005459 | Bacteria | 5589 |
| 173 | Ga0068867_100141052 | 3300005459 | Bacteria | 1884 |
| 174 | Ga0068867_100212467 | 3300005459 | Bacteria | 1554 |
| 175 | Ga0070707_100002462 | 3300005468 | Bacteria | 17638 |
| 176 | Ga0070698_100153526 | 3300005471 | Bacteria | 2249 |
| 177 | Ga0070699_100018911 | 3300005518 | Bacteria | 5924 |
| 178 | Ga0070699_100068978 | 3300005518 | Bacteria | 3072 |
| 179 | Ga0070679_100028399 | 3300005530 | Bacteria | 5515 |
| 180 | Ga0070679_100028853 | 3300005530 | Bacteria | 5473 |
| 181 | Ga0070679_100031597 | 3300005530 | Bacteria | 5232 |
| 182 | Ga0070679_100032305 | 3300005530 | Bacteria | 5176 |
| 183 | Ga0070679_100078547 | 3300005530 | Bacteria | 3289 |
| 184 | Ga0070679_100132969 | 3300005530 | Bacteria | 2469 |
| 185 | Ga0070679_100321954 | 3300005530 | Bacteria | 1495 |
| 186 | Ga0070679_100345940 | 3300005530 | Bacteria | 1435 |
| 187 | Ga0070684_100027814 | 3300005535 | Bacteria | 4776 |
| 188 | Ga0070697_100118843 | 3300005536 | Bacteria | 2209 |
| 189 | Ga0070697_100229209 | 3300005536 | Bacteria | 1584 |
| 190 | Ga0068853_100000490 | 3300005539 | Bacteria | 27013 |
| 191 | Ga0068853_100001865 | 3300005539 | Bacteria | 15492 |
| 192 | Ga0068853_100038328 | 3300005539 | Bacteria | 4081 |
| 193 | Ga0068853_100154611 | 3300005539 | Bacteria | 2066 |
| 194 | Ga0068853_100161664 | 3300005539 | Bacteria | 2021 |
| 195 | Ga0070672_100002940 | 3300005543 | Bacteria | 10968 |
| 196 | Ga0070672_100497323 | 3300005543 | Bacteria | 1054 |
| 197 | Ga0070696_100003725 | 3300005546 | Bacteria | 10173 |
| 198 | Ga0070696_100148847 | 3300005546 | Archaea | 1717 |
| 199 | Ga0070693_100016243 | 3300005547 | Bacteria | 3849 |
| 200 | Ga0070693_100205483 | 3300005547 | Bacteria | 1282 |
| 201 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 202 | Ga0070665_100053373 | 3300005548 | Bacteria | 4054 |
| 203 | Ga0070665_100174748 | 3300005548 | Bacteria | 2149 |
| 204 | Ga0070704_100242153 | 3300005549 | Bacteria | 1477 |
| 205 | Ga0068855_100000040 | 3300005563 | Bacteria | 153617 |
| 206 | Ga0068855_100006774 | 3300005563 | Bacteria | 13899 |
| 207 | Ga0068855_100010819 | 3300005563 | Bacteria | 11018 |
| 208 | Ga0068855_100013556 | 3300005563 | Bacteria | 9833 |
| 209 | Ga0068855_100059685 | 3300005563 | Bacteria | 4462 |
| 210 | Ga0068855_100092167 | 3300005563 | Bacteria | 3494 |
| 211 | Ga0068855_100179588 | 3300005563 | Bacteria | 2394 |
| 212 | Ga0068855_100376394 | 3300005563 | Bacteria | 1560 |
| 213 | Ga0070664_100066229 | 3300005564 | Bacteria | 3084 |
| 214 | Ga0070664_100102469 | 3300005564 | Bacteria | 2490 |
| 215 | Ga0070664_100219990 | 3300005564 | Bacteria | 1699 |
| 216 | Ga0070664_100224747 | 3300005564 | Bacteria | 1680 |
| 217 | Ga0068857_100003398 | 3300005577 | Bacteria | 13258 |
| 218 | Ga0068857_100036094 | 3300005577 | Bacteria | 4380 |
| 219 | Ga0068857_100190133 | 3300005577 | Bacteria | 1870 |
| 220 | Ga0068857_100234602 | 3300005577 | Bacteria | 1678 |
| 221 | Ga0068857_100507083 | 3300005577 | Bacteria | 1133 |
| 222 | Ga0068857_100523620 | 3300005577 | Bacteria | 1114 |
| 223 | Ga0068854_100000259 | 3300005578 | Bacteria | 36169 |
| 224 | Ga0068854_100009382 | 3300005578 | Bacteria | 6318 |
| 225 | Ga0068854_100034186 | 3300005578 | Bacteria | 3549 |
| 226 | Ga0068854_100037446 | 3300005578 | Bacteria | 3405 |
| 227 | Ga0068854_100063354 | 3300005578 | Bacteria | 2684 |
| 228 | Ga0068854_100151179 | 3300005578 | Bacteria | 1790 |
| 229 | Ga0068854_100232983 | 3300005578 | Bacteria | 1462 |
| 230 | Ga0068856_100003650 | 3300005614 | Bacteria | 15458 |
| 231 | Ga0068856_100287513 | 3300005614 | Bacteria | 1661 |
| 232 | Ga0068852_100004798 | 3300005616 | Bacteria | 9603 |
| 233 | Ga0068852_100006128 | 3300005616 | Bacteria | 8672 |
| 234 | Ga0068852_100017160 | 3300005616 | Bacteria | 5673 |
| 235 | Ga0068852_100091137 | 3300005616 | Bacteria | 2728 |
| 236 | Ga0068852_100162017 | 3300005616 | Bacteria | 2089 |
| 237 | Ga0068852_100286571 | 3300005616 | Bacteria | 1589 |
| 238 | Ga0068859_100000256 | 3300005617 | Bacteria | 52870 |
| 239 | Ga0068859_100000442 | 3300005617 | Bacteria | 41408 |
| 240 | Ga0068859_100009578 | 3300005617 | Bacteria | 9783 |
| 241 | Ga0068859_100010242 | 3300005617 | Bacteria | 9436 |
| 242 | Ga0068859_100015774 | 3300005617 | Bacteria | 7593 |
| 243 | Ga0068859_100018998 | 3300005617 | Bacteria | 6902 |
| 244 | Ga0068859_100029609 | 3300005617 | Bacteria | 5494 |
| 245 | Ga0068859_100114703 | 3300005617 | Bacteria | 2758 |
| 246 | Ga0068864_100000100 | 3300005618 | Bacteria | 85101 |
| 247 | Ga0068864_100007063 | 3300005618 | Bacteria | 9218 |
| 248 | Ga0068864_100008948 | 3300005618 | Bacteria | 8254 |
| 249 | Ga0068864_100026684 | 3300005618 | Bacteria | 4871 |
| 250 | Ga0068861_100000063 | 3300005719 | Bacteria | 51048 |
| 251 | Ga0068861_100001909 | 3300005719 | Bacteria | 13415 |
| 252 | Ga0068861_100011417 | 3300005719 | Bacteria | 6175 |
| 253 | Ga0068851_10003428 | 3300005834 | Bacteria | 7056 |
| 254 | Ga0068851_10024392 | 3300005834 | Bacteria | 2960 |
| 255 | Ga0068851_10070258 | 3300005834 | Bacteria | 1810 |
| 256 | Ga0068851_10092143 | 3300005834 | Bacteria | 1596 |
| 257 | Ga0068851_10108531 | 3300005834 | Bacteria | 1480 |
| 258 | Ga0068870_10013846 | 3300005840 | Bacteria | 3799 |
| 259 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 260 | Ga0068863_100000040 | 3300005841 | Bacteria | 158465 |
| 261 | Ga0068863_100000576 | 3300005841 | Bacteria | 37385 |
| 262 | Ga0068863_100001264 | 3300005841 | Bacteria | 25207 |
| 263 | Ga0068863_100002638 | 3300005841 | Bacteria | 17757 |
| 264 | Ga0068863_100006668 | 3300005841 | Bacteria | 11332 |
| 265 | Ga0068863_100037797 | 3300005841 | Bacteria | 4594 |
| 266 | Ga0068863_100143232 | 3300005841 | Bacteria | 2285 |
| 267 | Ga0068858_100002936 | 3300005842 | Bacteria | 17158 |
| 268 | Ga0068858_100004155 | 3300005842 | Bacteria | 14245 |
| 269 | Ga0068858_100005425 | 3300005842 | Bacteria | 12494 |
| 270 | Ga0068858_100028254 | 3300005842 | Bacteria | 5211 |
| 271 | Ga0068858_100041218 | 3300005842 | Bacteria | 4282 |
| 272 | Ga0068860_100000473 | 3300005843 | Bacteria | 49993 |
| 273 | Ga0068860_100000812 | 3300005843 | Bacteria | 34919 |
| 274 | Ga0068860_100010214 | 3300005843 | Bacteria | 9290 |
| 275 | Ga0068860_100010895 | 3300005843 | Bacteria | 8967 |
| 276 | Ga0068860_100030395 | 3300005843 | Bacteria | 5195 |
| 277 | Ga0068860_100032158 | 3300005843 | Bacteria | 5043 |
| 278 | Ga0068860_100118059 | 3300005843 | Bacteria | 2539 |
| 279 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 280 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 281 | Ga0068862_100000310 | 3300005844 | Bacteria | 53315 |
| 282 | Ga0068862_100021652 | 3300005844 | Bacteria | 5375 |
| 283 | Ga0068862_100035470 | 3300005844 | Bacteria | 4225 |
| 284 | Ga0068862_100051191 | 3300005844 | Bacteria | 3531 |
| 285 | Ga0068862_100156221 | 3300005844 | Bacteria | 2033 |
| 286 | Ga0068862_100267069 | 3300005844 | Bacteria | 1564 |
| 287 | Ga0081455_10143107 | 3300005937 | Bacteria | 1854 |
| 288 | Ga0081539_10041438 | 3300005985 | Bacteria | 2691 |
| 289 | Ga0081539_10063347 | 3300005985 | Bacteria | 2018 |
| 290 | Ga0070717_10251370 | 3300006028 | Bacteria | 1562 |
| 291 | Ga0075364_10020342 | 3300006051 | Bacteria | 4174 |
| 292 | Ga0075364_10024319 | 3300006051 | Bacteria | 3845 |
| 293 | Ga0075432_10055756 | 3300006058 | Bacteria | 1400 |
| 294 | Ga0070716_100001330 | 3300006173 | Bacteria | 10940 |
| 295 | Ga0075362_10041739 | 3300006177 | Bacteria | 2024 |
| 296 | Ga0075369_10018437 | 3300006186 | Bacteria | 2841 |
| 297 | Ga0075366_10086130 | 3300006195 | Bacteria | 1880 |
| 298 | Ga0075366_10129777 | 3300006195 | Bacteria | 1521 |
| 299 | Ga0075370_10060482 | 3300006353 | Bacteria | 2158 |
| 300 | Ga0075428_100191014 | 3300006844 | Bacteria | 2215 |
| 301 | Ga0075431_100027520 | 3300006847 | Bacteria | 5836 |
| 302 | Ga0075433_10026279 | 3300006852 | Bacteria | 4927 |
| 303 | Ga0075434_100027782 | 3300006871 | Bacteria | 5555 |
| 304 | Ga0068865_100000005 | 3300006881 | Bacteria | 213248 |
| 305 | Ga0068865_100154166 | 3300006881 | Bacteria | 1746 |
| 306 | Ga0075436_100029866 | 3300006914 | Bacteria | 3749 |
| 307 | Ga0097620_100000256 | 3300006931 | Bacteria | 52870 |
| 308 | Ga0097620_100000442 | 3300006931 | Bacteria | 41408 |
| 309 | Ga0097620_100009578 | 3300006931 | Bacteria | 9783 |
| 310 | Ga0097620_100010242 | 3300006931 | Bacteria | 9436 |
| 311 | Ga0097620_100015774 | 3300006931 | Bacteria | 7593 |
| 312 | Ga0097620_100018998 | 3300006931 | Bacteria | 6902 |
| 313 | Ga0097620_100029609 | 3300006931 | Bacteria | 5494 |
| 314 | Ga0097620_100114704 | 3300006931 | Bacteria | 2758 |
| 315 | Ga0105251_10000159 | 3300009011 | Bacteria | 68974 |
| 316 | Ga0105251_10000232 | 3300009011 | Bacteria | 56006 |
| 317 | Ga0105250_10005152 | 3300009092 | Bacteria | 5900 |
| 318 | Ga0105240_10000867 | 3300009093 | Bacteria | 54480 |
| 319 | Ga0105240_10001331 | 3300009093 | Bacteria | 42512 |
| 320 | Ga0105240_10002301 | 3300009093 | Bacteria | 30895 |
| 321 | Ga0105240_10029739 | 3300009093 | Bacteria | 7109 |
| 322 | Ga0105240_10041737 | 3300009093 | Bacteria | 5851 |
| 323 | Ga0105240_10069217 | 3300009093 | Bacteria | 4369 |
| 324 | Ga0105240_10069861 | 3300009093 | Bacteria | 4346 |
| 325 | Ga0105240_10164425 | 3300009093 | Bacteria | 2633 |
| 326 | Ga0105240_10244333 | 3300009093 | Bacteria | 2079 |
| 327 | Ga0105240_10484320 | 3300009093 | Bacteria | 1378 |
| 328 | Ga0105245_10007234 | 3300009098 | Bacteria | 9724 |
| 329 | Ga0105247_10000692 | 3300009101 | Bacteria | 26532 |
| 330 | Ga0105247_10005638 | 3300009101 | Bacteria | 7854 |
| 331 | Ga0105247_10011543 | 3300009101 | Bacteria | 5320 |
| 332 | Ga0105247_10011571 | 3300009101 | Bacteria | 5315 |
| 333 | Ga0105247_10036943 | 3300009101 | Bacteria | 2979 |
| 334 | Ga0114129_10407027 | 3300009147 | Bacteria | 1792 |
| 335 | Ga0105243_10000032 | 3300009148 | Bacteria | 183324 |
| 336 | Ga0105243_10042605 | 3300009148 | Bacteria | 3554 |
| 337 | Ga0105241_10008644 | 3300009174 | Bacteria | 7486 |
| 338 | Ga0105241_10059775 | 3300009174 | Bacteria | 2931 |
| 339 | Ga0105241_10086848 | 3300009174 | Bacteria | 2460 |
| 340 | Ga0105241_10195252 | 3300009174 | Bacteria | 1687 |
| 341 | Ga0105241_10209539 | 3300009174 | Bacteria | 1632 |
| 342 | Ga0105242_10000166 | 3300009176 | Bacteria | 49832 |
| 343 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 344 | Ga0105248_10000785 | 3300009177 | Bacteria | 35691 |
| 345 | Ga0105248_10001383 | 3300009177 | Bacteria | 27020 |
| 346 | Ga0105248_10002368 | 3300009177 | Bacteria | 20929 |
| 347 | Ga0105248_10008545 | 3300009177 | Bacteria | 11240 |
| 348 | Ga0105248_10138668 | 3300009177 | Bacteria | 2743 |
| 349 | Ga0105248_10393016 | 3300009177 | Bacteria | 1561 |
| 350 | Ga0105237_10000303 | 3300009545 | Bacteria | 68288 |
| 351 | Ga0105237_10017167 | 3300009545 | Bacteria | 7507 |
| 352 | Ga0105237_10023330 | 3300009545 | Bacteria | 6341 |
| 353 | Ga0105237_10085934 | 3300009545 | Bacteria | 3136 |
| 354 | Ga0105237_10133456 | 3300009545 | Bacteria | 2478 |
| 355 | Ga0105237_10350075 | 3300009545 | Bacteria | 1482 |
| 356 | Ga0105238_10002601 | 3300009551 | Bacteria | 17995 |
| 357 | Ga0105238_10056205 | 3300009551 | Bacteria | 3949 |
| 358 | Ga0105238_10059364 | 3300009551 | Bacteria | 3832 |
| 359 | Ga0105238_10075403 | 3300009551 | Bacteria | 3365 |
| 360 | Ga0105238_10231489 | 3300009551 | Bacteria | 1824 |
| 361 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 362 | Ga0105249_10000061 | 3300009553 | Bacteria | 153313 |
| 363 | Ga0105249_10000110 | 3300009553 | Bacteria | 111292 |
| 364 | Ga0105249_10019428 | 3300009553 | Bacteria | 6063 |
| 365 | Ga0105249_10021831 | 3300009553 | Bacteria | 5732 |
| 366 | Ga0105249_10064119 | 3300009553 | Bacteria | 3377 |
| 367 | Ga0105249_10069928 | 3300009553 | Bacteria | 3240 |
| 368 | Ga0105239_10000151 | 3300010375 | Bacteria | 99979 |
| 369 | Ga0105239_10000271 | 3300010375 | Bacteria | 76812 |
| 370 | Ga0105239_10123564 | 3300010375 | Bacteria | 2876 |
| 371 | Ga0105239_10180266 | 3300010375 | Bacteria | 2363 |
| 372 | Ga0105246_10000160 | 3300011119 | Bacteria | 32154 |
| 373 | Ga0105246_10001368 | 3300011119 | Bacteria | 14374 |
| 374 | Ga0157326_1000175 | 3300012513 | Bacteria | 7108 |
| 375 | Ga0157373_10024313 | 3300013100 | Bacteria | 4390 |
| 376 | Ga0157373_10047838 | 3300013100 | Bacteria | 3050 |
| 377 | Ga0157373_10250440 | 3300013100 | Bacteria | 1253 |
| 378 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 379 | Ga0157371_10021298 | 3300013102 | Bacteria | 4761 |
| 380 | Ga0157370_10024341 | 3300013104 | Bacteria | 5995 |
| 381 | Ga0157370_10059080 | 3300013104 | Bacteria | 3645 |
| 382 | Ga0157370_10207164 | 3300013104 | Bacteria | 1818 |
| 383 | Ga0157369_10003257 | 3300013105 | Bacteria | 19330 |
| 384 | Ga0157369_10018458 | 3300013105 | Bacteria | 7820 |
| 385 | Ga0157369_10058845 | 3300013105 | Bacteria | 4144 |
| 386 | Ga0157369_10076259 | 3300013105 | Bacteria | 3594 |
| 387 | Ga0157369_10238530 | 3300013105 | Bacteria | 1899 |
| 388 | Ga0157369_10275353 | 3300013105 | Bacteria | 1753 |
| 389 | Ga0157374_10000134 | 3300013296 | Bacteria | 67433 |
| 390 | Ga0157378_10009372 | 3300013297 | Bacteria | 8529 |
| 391 | Ga0157378_10045278 | 3300013297 | Bacteria | 3909 |
| 392 | Ga0163162_10021139 | 3300013306 | Bacteria | 6401 |
| 393 | Ga0163162_10079336 | 3300013306 | Bacteria | 3349 |
| 394 | Ga0163162_10298481 | 3300013306 | Bacteria | 1743 |
| 395 | Ga0163162_10311287 | 3300013306 | Bacteria | 1707 |
| 396 | Ga0157372_10129059 | 3300013307 | Bacteria | 2908 |
| 397 | Ga0157372_10181482 | 3300013307 | Bacteria | 2437 |
| 398 | Ga0157372_10501534 | 3300013307 | Bacteria | 1415 |
| 399 | Ga0157372_10579879 | 3300013307 | Bacteria | 1307 |
| 400 | Ga0157375_10000242 | 3300013308 | Bacteria | 50251 |
| 401 | Ga0157375_10089002 | 3300013308 | Bacteria | 3143 |
| 402 | Ga0163163_10000139 | 3300014325 | Bacteria | 75197 |
| 403 | Ga0163163_10046351 | 3300014325 | Bacteria | 4271 |
| 404 | Ga0163163_10086154 | 3300014325 | Bacteria | 3150 |
| 405 | Ga0163163_10094269 | 3300014325 | Bacteria | 3011 |
| 406 | Ga0157380_10001834 | 3300014326 | Bacteria | 14037 |
| 407 | Ga0157380_10020143 | 3300014326 | Bacteria | 4983 |
| 408 | Ga0157380_10106046 | 3300014326 | Bacteria | 2351 |
| 409 | Ga0157380_10374770 | 3300014326 | Bacteria | 1341 |
| 410 | Ga0182008_10005339 | 3300014497 | Bacteria | 7337 |
| 411 | Ga0157379_10038845 | 3300014968 | Bacteria | 4246 |
| 412 | Ga0157379_10042887 | 3300014968 | Bacteria | 4040 |
| 413 | Ga0157379_10151323 | 3300014968 | Bacteria | 2093 |
| 414 | Ga0157376_10000111 | 3300014969 | Bacteria | 58460 |
| 415 | Ga0157376_10134214 | 3300014969 | Bacteria | 2213 |
| 416 | Ga0157376_10290716 | 3300014969 | Bacteria | 1543 |
| 417 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 418 | Ga0163161_10001166 | 3300017792 | Bacteria | 19753 |
| 419 | Ga0163161_10025334 | 3300017792 | Bacteria | 4198 |
| 420 | Ga0163161_10139979 | 3300017792 | Bacteria | 1832 |
| 421 | Ga0163161_10204056 | 3300017792 | Bacteria | 1524 |
| 422 | Ga0197907_10074559 | 3300020069 | Eukaryota | 1324 |
| 423 | Ga0206353_10063925 | 3300020082 | Bacteria | 1096 |
| 424 | Ga0206353_10399482 | 3300020082 | Bacteria | 1599 |
| 425 | Ga0213873_10000016 | 3300021358 | Bacteria | 124829 |
| 426 | Ga0213872_10007647 | 3300021361 | Bacteria | 5296 |
| 427 | Ga0213872_10088520 | 3300021361 | Bacteria | 1386 |
| 428 | Ga0213876_10000056 | 3300021384 | Bacteria | 135017 |
| 429 | Ga0213876_10162713 | 3300021384 | Bacteria | 1187 |
| 430 | Ga0213876_10189706 | 3300021384 | Bacteria | 1093 |
| 431 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 432 | Ga0209646_1011061 | 3300025246 | Bacteria | 1403 |
| 433 | Ga0209677_107269 | 3300025253 | Bacteria | 2395 |
| 434 | Ga0209148_1000160 | 3300025254 | Bacteria | 139522 |
| 435 | Ga0209148_1001582 | 3300025254 | Bacteria | 10766 |
| 436 | Ga0209129_1001349 | 3300025258 | Bacteria | 13861 |
| 437 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 438 | Ga0209565_1000272 | 3300025263 | Bacteria | 52468 |
| 439 | Ga0209455_1000749 | 3300025272 | Bacteria | 18574 |
| 440 | Ga0209673_1011390 | 3300025273 | Bacteria | 3672 |
| 441 | Ga0209675_1000472 | 3300025291 | Bacteria | 30895 |
| 442 | Ga0209676_1000226 | 3300025292 | Bacteria | 124004 |
| 443 | Ga0209676_1000387 | 3300025292 | Bacteria | 80494 |
| 444 | Ga0209676_1000760 | 3300025292 | Bacteria | 43458 |
| 445 | Ga0209676_1005732 | 3300025292 | Bacteria | 6374 |
| 446 | Ga0209025_1000477 | 3300025294 | Bacteria | 77692 |
| 447 | Ga0209025_1014061 | 3300025294 | Bacteria | 4967 |
| 448 | Ga0209564_1000949 | 3300025295 | Bacteria | 37130 |
| 449 | Ga0209564_1018313 | 3300025295 | Bacteria | 2677 |
| 450 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 451 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 452 | Ga0209050_1000167 | 3300025298 | Bacteria | 151608 |
| 453 | Ga0209050_1000450 | 3300025298 | Bacteria | 74598 |
| 454 | Ga0209050_1004367 | 3300025298 | Bacteria | 9601 |
| 455 | Ga0209050_1012902 | 3300025298 | Bacteria | 3779 |
| 456 | Ga0209050_1013829 | 3300025298 | Bacteria | 3543 |
| 457 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 458 | Ga0209051_1000472 | 3300025303 | Bacteria | 52350 |
| 459 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 460 | Ga0209257_1002265 | 3300025304 | Bacteria | 19641 |
| 461 | Ga0209257_1002450 | 3300025304 | Bacteria | 18426 |
| 462 | Ga0209257_1004307 | 3300025304 | Bacteria | 11188 |
| 463 | Ga0209257_1005425 | 3300025304 | Bacteria | 8962 |
| 464 | Ga0207697_10000312 | 3300025315 | Bacteria | 27160 |
| 465 | Ga0207697_10001058 | 3300025315 | Bacteria | 15200 |
| 466 | Ga0207656_10004486 | 3300025321 | Bacteria | 4880 |
| 467 | Ga0207656_10020017 | 3300025321 | Bacteria | 2654 |
| 468 | Ga0207656_10020092 | 3300025321 | Bacteria | 2650 |
| 469 | Ga0207656_10034506 | 3300025321 | Bacteria | 2113 |
| 470 | Ga0207713_1000491 | 3300025735 | Bacteria | 40778 |
| 471 | Ga0207713_1001216 | 3300025735 | Bacteria | 21534 |
| 472 | Ga0207682_10000353 | 3300025893 | Bacteria | 21055 |
| 473 | Ga0207710_10002210 | 3300025900 | Bacteria | 9148 |
| 474 | Ga0207710_10003921 | 3300025900 | Bacteria | 6572 |
| 475 | Ga0207710_10006603 | 3300025900 | Bacteria | 4946 |
| 476 | Ga0207710_10011439 | 3300025900 | Bacteria | 3737 |
| 477 | Ga0207688_10033182 | 3300025901 | Bacteria | 2854 |
| 478 | Ga0207688_10075641 | 3300025901 | Bacteria | 1917 |
| 479 | Ga0207688_10103057 | 3300025901 | Bacteria | 1650 |
| 480 | Ga0207680_10000298 | 3300025903 | Bacteria | 23556 |
| 481 | Ga0207680_10049863 | 3300025903 | Bacteria | 2494 |
| 482 | Ga0207647_10000301 | 3300025904 | Bacteria | 40628 |
| 483 | Ga0207647_10000701 | 3300025904 | Bacteria | 26288 |
| 484 | Ga0207647_10007823 | 3300025904 | Bacteria | 7693 |
| 485 | Ga0207647_10095564 | 3300025904 | Bacteria | 1769 |
| 486 | Ga0207647_10111901 | 3300025904 | Bacteria | 1614 |
| 487 | Ga0207699_10167766 | 3300025906 | Bacteria | 1466 |
| 488 | Ga0207645_10003327 | 3300025907 | Bacteria | 12262 |
| 489 | Ga0207645_10003989 | 3300025907 | Bacteria | 11005 |
| 490 | Ga0207645_10007479 | 3300025907 | Bacteria | 7710 |
| 491 | Ga0207645_10066974 | 3300025907 | Bacteria | 2295 |
| 492 | Ga0207645_10152287 | 3300025907 | Bacteria | 1510 |
| 493 | Ga0207643_10048655 | 3300025908 | Bacteria | 2402 |
| 494 | Ga0207643_10139735 | 3300025908 | Bacteria | 1446 |
| 495 | Ga0207705_10000046 | 3300025909 | Bacteria | 177574 |
| 496 | Ga0207705_10000073 | 3300025909 | Bacteria | 124226 |
| 497 | Ga0207705_10000103 | 3300025909 | Bacteria | 97511 |
| 498 | Ga0207705_10003277 | 3300025909 | Bacteria | 12330 |
| 499 | Ga0207705_10010984 | 3300025909 | Bacteria | 6576 |
| 500 | Ga0207705_10066862 | 3300025909 | Bacteria | 2600 |
| 501 | Ga0207705_10127460 | 3300025909 | Bacteria | 1892 |
| 502 | Ga0207654_10000150 | 3300025911 | Bacteria | 44134 |
| 503 | Ga0207654_10000836 | 3300025911 | Bacteria | 16952 |
| 504 | Ga0207654_10003282 | 3300025911 | Bacteria | 8177 |
| 505 | Ga0207654_10062980 | 3300025911 | Bacteria | 2175 |
| 506 | Ga0207654_10151892 | 3300025911 | Bacteria | 1487 |
| 507 | Ga0207654_10297958 | 3300025911 | Bacteria | 1096 |
| 508 | Ga0207707_10000423 | 3300025912 | Bacteria | 44206 |
| 509 | Ga0207707_10004235 | 3300025912 | Bacteria | 12698 |
| 510 | Ga0207707_10015113 | 3300025912 | Bacteria | 6720 |
| 511 | Ga0207707_10019058 | 3300025912 | Bacteria | 5987 |
| 512 | Ga0207707_10020753 | 3300025912 | Bacteria | 5738 |
| 513 | Ga0207707_10028894 | 3300025912 | Bacteria | 4846 |
| 514 | Ga0207707_10075505 | 3300025912 | Bacteria | 2941 |
| 515 | Ga0207707_10264273 | 3300025912 | Bacteria | 1492 |
| 516 | Ga0207707_10291043 | 3300025912 | Bacteria | 1413 |
| 517 | Ga0207707_10293737 | 3300025912 | Bacteria | 1406 |
| 518 | Ga0207695_10002890 | 3300025913 | Bacteria | 24889 |
| 519 | Ga0207695_10005103 | 3300025913 | Bacteria | 17590 |
| 520 | Ga0207695_10005114 | 3300025913 | Bacteria | 17565 |
| 521 | Ga0207695_10008637 | 3300025913 | Bacteria | 12718 |
| 522 | Ga0207695_10008997 | 3300025913 | Bacteria | 12425 |
| 523 | Ga0207695_10012367 | 3300025913 | Bacteria | 10252 |
| 524 | Ga0207695_10050060 | 3300025913 | Bacteria | 4398 |
| 525 | Ga0207695_10111754 | 3300025913 | Bacteria | 2711 |
| 526 | Ga0207695_10142285 | 3300025913 | Bacteria | 2346 |
| 527 | Ga0207695_10151872 | 3300025913 | Bacteria | 2255 |
| 528 | Ga0207695_10196709 | 3300025913 | Bacteria | 1932 |
| 529 | Ga0207695_10227666 | 3300025913 | Bacteria | 1770 |
| 530 | Ga0207671_10000592 | 3300025914 | Bacteria | 48411 |
| 531 | Ga0207671_10000881 | 3300025914 | Bacteria | 37996 |
| 532 | Ga0207671_10002796 | 3300025914 | Bacteria | 18194 |
| 533 | Ga0207671_10006341 | 3300025914 | Bacteria | 10553 |
| 534 | Ga0207671_10007591 | 3300025914 | Bacteria | 9385 |
| 535 | Ga0207671_10039482 | 3300025914 | Bacteria | 3495 |
| 536 | Ga0207660_10008593 | 3300025917 | Bacteria | 6607 |
| 537 | Ga0207660_10029939 | 3300025917 | Bacteria | 3739 |
| 538 | Ga0207660_10040194 | 3300025917 | Bacteria | 3273 |
| 539 | Ga0207660_10053794 | 3300025917 | Bacteria | 2871 |
| 540 | Ga0207660_10067313 | 3300025917 | Bacteria | 2594 |
| 541 | Ga0207660_10080481 | 3300025917 | Bacteria | 2392 |
| 542 | Ga0207660_10231439 | 3300025917 | Bacteria | 1453 |
| 543 | Ga0207660_10397361 | 3300025917 | Bacteria | 1110 |
| 544 | Ga0207662_10095943 | 3300025918 | Bacteria | 1831 |
| 545 | Ga0207662_10120637 | 3300025918 | Bacteria | 1644 |
| 546 | Ga0207657_10001746 | 3300025919 | Bacteria | 23433 |
| 547 | Ga0207657_10005880 | 3300025919 | Bacteria | 12781 |
| 548 | Ga0207657_10009564 | 3300025919 | Bacteria | 9730 |
| 549 | Ga0207657_10026923 | 3300025919 | Bacteria | 5273 |
| 550 | Ga0207657_10041643 | 3300025919 | Bacteria | 4059 |
| 551 | Ga0207657_10044453 | 3300025919 | Bacteria | 3904 |
| 552 | Ga0207657_10054674 | 3300025919 | Bacteria | 3451 |
| 553 | Ga0207657_10081288 | 3300025919 | Bacteria | 2722 |
| 554 | Ga0207657_10173587 | 3300025919 | Bacteria | 1745 |
| 555 | Ga0207657_10203639 | 3300025919 | Bacteria | 1591 |
| 556 | Ga0207657_10213794 | 3300025919 | Bacteria | 1547 |
| 557 | Ga0207649_10002862 | 3300025920 | Bacteria | 9518 |
| 558 | Ga0207649_10039967 | 3300025920 | Bacteria | 2847 |
| 559 | Ga0207649_10060458 | 3300025920 | Bacteria | 2381 |
| 560 | Ga0207649_10168566 | 3300025920 | Bacteria | 1523 |
| 561 | Ga0207652_10001835 | 3300025921 | Bacteria | 18411 |
| 562 | Ga0207652_10016980 | 3300025921 | Bacteria | 5953 |
| 563 | Ga0207652_10022155 | 3300025921 | Bacteria | 5251 |
| 564 | Ga0207652_10024980 | 3300025921 | Bacteria | 4962 |
| 565 | Ga0207652_10074434 | 3300025921 | Bacteria | 2957 |
| 566 | Ga0207652_10116860 | 3300025921 | Bacteria | 2370 |
| 567 | Ga0207652_10172984 | 3300025921 | Bacteria | 1938 |
| 568 | Ga0207652_10187730 | 3300025921 | Bacteria | 1858 |
| 569 | Ga0207652_10198852 | 3300025921 | Bacteria | 1804 |
| 570 | Ga0207652_10347530 | 3300025921 | Bacteria | 1339 |
| 571 | Ga0207646_10001573 | 3300025922 | Bacteria | 27938 |
| 572 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 573 | Ga0207681_10000260 | 3300025923 | Bacteria | 40385 |
| 574 | Ga0207681_10000274 | 3300025923 | Bacteria | 38677 |
| 575 | Ga0207681_10004134 | 3300025923 | Bacteria | 9000 |
| 576 | Ga0207681_10157179 | 3300025923 | Bacteria | 1710 |
| 577 | Ga0207681_10226613 | 3300025923 | Bacteria | 1449 |
| 578 | Ga0207694_10001416 | 3300025924 | Bacteria | 20546 |
| 579 | Ga0207694_10003304 | 3300025924 | Bacteria | 12831 |
| 580 | Ga0207694_10011065 | 3300025924 | Bacteria | 6814 |
| 581 | Ga0207694_10050606 | 3300025924 | Bacteria | 3218 |
| 582 | Ga0207694_10083568 | 3300025924 | Bacteria | 2511 |
| 583 | Ga0207694_10101530 | 3300025924 | Bacteria | 2280 |
| 584 | Ga0207694_10112161 | 3300025924 | Bacteria | 2170 |
| 585 | Ga0207650_10000243 | 3300025925 | Bacteria | 59507 |
| 586 | Ga0207650_10003098 | 3300025925 | Bacteria | 11452 |
| 587 | Ga0207650_10026696 | 3300025925 | Bacteria | 4123 |
| 588 | Ga0207687_10084324 | 3300025927 | Bacteria | 2303 |
| 589 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 590 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 591 | Ga0207644_10000035 | 3300025931 | Bacteria | 131979 |
| 592 | Ga0207644_10000301 | 3300025931 | Bacteria | 32173 |
| 593 | Ga0207644_10018490 | 3300025931 | Bacteria | 4716 |
| 594 | Ga0207644_10056208 | 3300025931 | Bacteria | 2839 |
| 595 | Ga0207644_10098416 | 3300025931 | Bacteria | 2192 |
| 596 | Ga0207690_10015458 | 3300025932 | Bacteria | 4626 |
| 597 | Ga0207690_10092013 | 3300025932 | Bacteria | 2145 |
| 598 | Ga0207690_10125324 | 3300025932 | Bacteria | 1872 |
| 599 | Ga0207706_10000489 | 3300025933 | Bacteria | 42307 |
| 600 | Ga0207706_10002195 | 3300025933 | Bacteria | 19021 |
| 601 | Ga0207706_10006049 | 3300025933 | Bacteria | 11256 |
| 602 | Ga0207706_10006210 | 3300025933 | Bacteria | 11101 |
| 603 | Ga0207706_10124921 | 3300025933 | Bacteria | 2263 |
| 604 | Ga0207686_10000250 | 3300025934 | Bacteria | 40936 |
| 605 | Ga0207709_10000051 | 3300025935 | Bacteria | 227968 |
| 606 | Ga0207709_10023531 | 3300025935 | Bacteria | 3507 |
| 607 | Ga0207669_10063701 | 3300025937 | Bacteria | 2277 |
| 608 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 609 | Ga0207704_10042745 | 3300025938 | Bacteria | 2670 |
| 610 | Ga0207704_10072732 | 3300025938 | Bacteria | 2187 |
| 611 | Ga0207704_10193535 | 3300025938 | Bacteria | 1481 |
| 612 | Ga0207665_10001828 | 3300025939 | Bacteria | 14321 |
| 613 | Ga0207691_10000784 | 3300025940 | Bacteria | 31530 |
| 614 | Ga0207691_10212909 | 3300025940 | Bacteria | 1678 |
| 615 | Ga0207691_10662643 | 3300025940 | Bacteria | 881 |
| 616 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 617 | Ga0207711_10000571 | 3300025941 | Bacteria | 37524 |
| 618 | Ga0207711_10000673 | 3300025941 | Bacteria | 33946 |
| 619 | Ga0207711_10004144 | 3300025941 | Bacteria | 12419 |
| 620 | Ga0207711_10016447 | 3300025941 | Bacteria | 6147 |
| 621 | Ga0207711_10017131 | 3300025941 | Bacteria | 6018 |
| 622 | Ga0207711_10042522 | 3300025941 | Bacteria | 3872 |
| 623 | Ga0207711_10045371 | 3300025941 | Bacteria | 3756 |
| 624 | Ga0207711_10062216 | 3300025941 | Bacteria | 3220 |
| 625 | Ga0207711_10452027 | 3300025941 | Bacteria | 1196 |
| 626 | Ga0207689_10000059 | 3300025942 | Bacteria | 85713 |
| 627 | Ga0207689_10112111 | 3300025942 | Bacteria | 2242 |
| 628 | Ga0207689_10235722 | 3300025942 | Bacteria | 1513 |
| 629 | Ga0207661_10105349 | 3300025944 | Bacteria | 2376 |
| 630 | Ga0207661_10298609 | 3300025944 | Bacteria | 1443 |
| 631 | Ga0207679_10097854 | 3300025945 | Bacteria | 2286 |
| 632 | Ga0207679_10263971 | 3300025945 | Bacteria | 1470 |
| 633 | Ga0207679_10398710 | 3300025945 | Bacteria | 1210 |
| 634 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 635 | Ga0207667_10000024 | 3300025949 | Bacteria | 355874 |
| 636 | Ga0207667_10000716 | 3300025949 | Bacteria | 43016 |
| 637 | Ga0207667_10000881 | 3300025949 | Bacteria | 38298 |
| 638 | Ga0207667_10001580 | 3300025949 | Bacteria | 28640 |
| 639 | Ga0207667_10002081 | 3300025949 | Bacteria | 25073 |
| 640 | Ga0207667_10003709 | 3300025949 | Bacteria | 18842 |
| 641 | Ga0207667_10004218 | 3300025949 | Bacteria | 17642 |
| 642 | Ga0207667_10034948 | 3300025949 | Bacteria | 5394 |
| 643 | Ga0207667_10055895 | 3300025949 | Bacteria | 4148 |
| 644 | Ga0207667_10056456 | 3300025949 | Bacteria | 4125 |
| 645 | Ga0207667_10070268 | 3300025949 | Bacteria | 3644 |
| 646 | Ga0207667_10161957 | 3300025949 | Bacteria | 2301 |
| 647 | Ga0207651_10000006 | 3300025960 | Bacteria | 227893 |
| 648 | Ga0207651_10005055 | 3300025960 | Bacteria | 6728 |
| 649 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 650 | Ga0207712_10000144 | 3300025961 | Bacteria | 74254 |
| 651 | Ga0207712_10000311 | 3300025961 | Bacteria | 44496 |
| 652 | Ga0207712_10014244 | 3300025961 | Bacteria | 5109 |
| 653 | Ga0207712_10298350 | 3300025961 | Bacteria | 1321 |
| 654 | Ga0207668_10000147 | 3300025972 | Bacteria | 48279 |
| 655 | Ga0207668_10002842 | 3300025972 | Bacteria | 10147 |
| 656 | Ga0207668_10005504 | 3300025972 | Bacteria | 7464 |
| 657 | Ga0207668_10006180 | 3300025972 | Bacteria | 7066 |
| 658 | Ga0207668_10032968 | 3300025972 | Bacteria | 3429 |
| 659 | Ga0207668_10046230 | 3300025972 | Bacteria | 2973 |
| 660 | Ga0207668_10069145 | 3300025972 | Bacteria | 2513 |
| 661 | Ga0207668_10070549 | 3300025972 | Bacteria | 2492 |
| 662 | Ga0207640_10000254 | 3300025981 | Bacteria | 36224 |
| 663 | Ga0207640_10001543 | 3300025981 | Bacteria | 12411 |
| 664 | Ga0207640_10002074 | 3300025981 | Bacteria | 10800 |
| 665 | Ga0207640_10012044 | 3300025981 | Bacteria | 4915 |
| 666 | Ga0207640_10014644 | 3300025981 | Bacteria | 4519 |
| 667 | Ga0207640_10036511 | 3300025981 | Bacteria | 3086 |
| 668 | Ga0207640_10056542 | 3300025981 | Bacteria | 2576 |
| 669 | Ga0207640_10062898 | 3300025981 | Bacteria | 2464 |
| 670 | Ga0207640_10069894 | 3300025981 | Bacteria | 2359 |
| 671 | Ga0207640_10119803 | 3300025981 | Bacteria | 1883 |
| 672 | Ga0207640_10186160 | 3300025981 | Bacteria | 1561 |
| 673 | Ga0207640_10381406 | 3300025981 | Bacteria | 1142 |
| 674 | Ga0207658_10000287 | 3300025986 | Bacteria | 52758 |
| 675 | Ga0207658_10001852 | 3300025986 | Bacteria | 15833 |
| 676 | Ga0207658_10006778 | 3300025986 | Bacteria | 7800 |
| 677 | Ga0207658_10009773 | 3300025986 | Bacteria | 6514 |
| 678 | Ga0207658_10010486 | 3300025986 | Bacteria | 6293 |
| 679 | Ga0207658_10011407 | 3300025986 | Bacteria | 6048 |
| 680 | Ga0207658_10012640 | 3300025986 | Bacteria | 5766 |
| 681 | Ga0207658_10012726 | 3300025986 | Bacteria | 5746 |
| 682 | Ga0207658_10034186 | 3300025986 | Bacteria | 3631 |
| 683 | Ga0207658_10097040 | 3300025986 | Bacteria | 2300 |
| 684 | Ga0207658_10395802 | 3300025986 | Bacteria | 1213 |
| 685 | Ga0207677_10111773 | 3300026023 | Bacteria | 2036 |
| 686 | Ga0207677_10140350 | 3300026023 | Bacteria | 1849 |
| 687 | Ga0207703_10002484 | 3300026035 | Bacteria | 15989 |
| 688 | Ga0207703_10002643 | 3300026035 | Bacteria | 15438 |
| 689 | Ga0207703_10042797 | 3300026035 | Bacteria | 3633 |
| 690 | Ga0207703_10125579 | 3300026035 | Bacteria | 2208 |
| 691 | Ga0207639_10005274 | 3300026041 | Bacteria | 8724 |
| 692 | Ga0207639_10015767 | 3300026041 | Bacteria | 5333 |
| 693 | Ga0207639_10029484 | 3300026041 | Bacteria | 4018 |
| 694 | Ga0207639_10046271 | 3300026041 | Bacteria | 3282 |
| 695 | Ga0207639_10133388 | 3300026041 | Bacteria | 2059 |
| 696 | Ga0207639_10134557 | 3300026041 | Bacteria | 2051 |
| 697 | Ga0207639_10163844 | 3300026041 | Bacteria | 1876 |
| 698 | Ga0207639_10239306 | 3300026041 | Bacteria | 1577 |
| 699 | Ga0207639_10249595 | 3300026041 | Bacteria | 1547 |
| 700 | Ga0207678_10038375 | 3300026067 | Bacteria | 4162 |
| 701 | Ga0207678_10080522 | 3300026067 | Bacteria | 2788 |
| 702 | Ga0207678_10118381 | 3300026067 | Bacteria | 2260 |
| 703 | Ga0207708_10146702 | 3300026075 | Bacteria | 1855 |
| 704 | Ga0207708_10335931 | 3300026075 | Bacteria | 1236 |
| 705 | Ga0207702_10000727 | 3300026078 | Bacteria | 35312 |
| 706 | Ga0207702_10001637 | 3300026078 | Bacteria | 22151 |
| 707 | Ga0207702_10009596 | 3300026078 | Bacteria | 8125 |
| 708 | Ga0207702_10043031 | 3300026078 | Bacteria | 3790 |
| 709 | Ga0207702_10055491 | 3300026078 | Bacteria | 3360 |
| 710 | Ga0207702_10099945 | 3300026078 | Bacteria | 2558 |
| 711 | Ga0207702_10340022 | 3300026078 | Bacteria | 1434 |
| 712 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 713 | Ga0207641_10000039 | 3300026088 | Bacteria | 199453 |
| 714 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 715 | Ga0207641_10000500 | 3300026088 | Bacteria | 44148 |
| 716 | Ga0207641_10001788 | 3300026088 | Bacteria | 20704 |
| 717 | Ga0207641_10006496 | 3300026088 | Bacteria | 9846 |
| 718 | Ga0207641_10007735 | 3300026088 | Bacteria | 8934 |
| 719 | Ga0207641_10111036 | 3300026088 | Bacteria | 2430 |
| 720 | Ga0207648_10000022 | 3300026089 | Bacteria | 137000 |
| 721 | Ga0207648_10018143 | 3300026089 | Bacteria | 6374 |
| 722 | Ga0207648_10129184 | 3300026089 | Bacteria | 2224 |
| 723 | Ga0207648_10382161 | 3300026089 | Bacteria | 1273 |
| 724 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 725 | Ga0207676_10001441 | 3300026095 | Bacteria | 17694 |
| 726 | Ga0207676_10008948 | 3300026095 | Bacteria | 7124 |
| 727 | Ga0207676_10023166 | 3300026095 | Bacteria | 4576 |
| 728 | Ga0207676_10023901 | 3300026095 | Bacteria | 4516 |
| 729 | Ga0207674_10001869 | 3300026116 | Bacteria | 26815 |
| 730 | Ga0207674_10011227 | 3300026116 | Bacteria | 10066 |
| 731 | Ga0207674_10011292 | 3300026116 | Bacteria | 10038 |
| 732 | Ga0207674_10019862 | 3300026116 | Bacteria | 7270 |
| 733 | Ga0207674_10099608 | 3300026116 | Bacteria | 2888 |
| 734 | Ga0207674_10099843 | 3300026116 | Bacteria | 2884 |
| 735 | Ga0207674_10170119 | 3300026116 | Bacteria | 2133 |
| 736 | Ga0207674_10200621 | 3300026116 | Bacteria | 1944 |
| 737 | Ga0207674_10249440 | 3300026116 | Bacteria | 1722 |
| 738 | Ga0207674_10276710 | 3300026116 | Bacteria | 1626 |
| 739 | Ga0207675_100000613 | 3300026118 | Bacteria | 34803 |
| 740 | Ga0207675_100005808 | 3300026118 | Bacteria | 11793 |
| 741 | Ga0207675_100011460 | 3300026118 | Bacteria | 8292 |
| 742 | Ga0207675_100106354 | 3300026118 | Bacteria | 2645 |
| 743 | Ga0207683_10012052 | 3300026121 | Bacteria | 7381 |
| 744 | Ga0207683_10049848 | 3300026121 | Bacteria | 3666 |
| 745 | Ga0207698_10000308 | 3300026142 | Bacteria | 29436 |
| 746 | Ga0207698_10004831 | 3300026142 | Bacteria | 8254 |
| 747 | Ga0207698_10008742 | 3300026142 | Bacteria | 6422 |
| 748 | Ga0207698_10012219 | 3300026142 | Bacteria | 5608 |
| 749 | Ga0207698_10020890 | 3300026142 | Bacteria | 4517 |
| 750 | Ga0207698_10040422 | 3300026142 | Bacteria | 3465 |
| 751 | Ga0207698_10265394 | 3300026142 | Bacteria | 1579 |
| 752 | Ga0207698_10318589 | 3300026142 | Bacteria | 1455 |
| 753 | Ga0207698_10329487 | 3300026142 | Bacteria | 1434 |
| 754 | Ga0207698_10405887 | 3300026142 | Bacteria | 1303 |
| 755 | Ga0209999_1003073 | 3300027543 | Bacteria | 2973 |
| 756 | Ga0210002_1011448 | 3300027617 | Bacteria | 1370 |
| 757 | Ga0209983_1014737 | 3300027665 | Bacteria | 1611 |
| 758 | Ga0209974_10016711 | 3300027876 | Bacteria | 2435 |
| 759 | Ga0207428_10054976 | 3300027907 | Bacteria | 3167 |
| 760 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 761 | Ga0268266_10330615 | 3300028379 | Bacteria | 1428 |
| 762 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 763 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 764 | Ga0268265_10001374 | 3300028380 | Bacteria | 20668 |
| 765 | Ga0268265_10023250 | 3300028380 | Bacteria | 4368 |
| 766 | Ga0268265_10029848 | 3300028380 | Bacteria | 3921 |
| 767 | Ga0268265_10059987 | 3300028380 | Bacteria | 2913 |
| 768 | Ga0268265_10081867 | 3300028380 | Bacteria | 2550 |
| 769 | Ga0268265_10103672 | 3300028380 | Bacteria | 2304 |
| 770 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 771 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 772 | Ga0268264_10000743 | 3300028381 | Bacteria | 36984 |
| 773 | Ga0268264_10006008 | 3300028381 | Bacteria | 10275 |
| 774 | Ga0268264_10007424 | 3300028381 | Bacteria | 9155 |
| 775 | Ga0268264_10018778 | 3300028381 | Bacteria | 5653 |
| 776 | Ga0268264_10020235 | 3300028381 | Bacteria | 5439 |
| 777 | Ga0268264_10027689 | 3300028381 | Bacteria | 4633 |
| 778 | Ga0268264_10148564 | 3300028381 | Bacteria | 2099 |
| 779 | Ga0265334_10056604 | 3300028573 | Bacteria | 1488 |
| 780 | Ga0316182_1045715 | 3300030745 | Bacteria | 2682 |
| 781 | Ga0307513_10011435 | 3300031456 | Bacteria | 11032 |
| 782 | Ga0307408_100000067 | 3300031548 | Bacteria | 120790 |
| 783 | Ga0307408_100011407 | 3300031548 | Bacteria | 5871 |
| 784 | Ga0307408_100240539 | 3300031548 | Bacteria | 1487 |
| 785 | Ga0307408_100292757 | 3300031548 | Bacteria | 1360 |
| 786 | Ga0316579_10027068 | 3300031691 | Bacteria | 2600 |
| 787 | Ga0307405_10004177 | 3300031731 | Bacteria | 6796 |
| 788 | Ga0307405_10004673 | 3300031731 | Bacteria | 6508 |
| 789 | Ga0307405_10013215 | 3300031731 | Bacteria | 4399 |
| 790 | Ga0307405_10038349 | 3300031731 | Bacteria | 2887 |
| 791 | Ga0307405_10102745 | 3300031731 | Bacteria | 1920 |
| 792 | Ga0307405_10108448 | 3300031731 | Bacteria | 1876 |
| 793 | Ga0307405_10124309 | 3300031731 | Bacteria | 1771 |
| 794 | Ga0307405_10155505 | 3300031731 | Bacteria | 1613 |
| 795 | Ga0307405_10158867 | 3300031731 | Bacteria | 1598 |
| 796 | Ga0307405_10292087 | 3300031731 | Bacteria | 1232 |
| 797 | Ga0307405_10383749 | 3300031731 | Bacteria | 1094 |
| 798 | Ga0307413_10002129 | 3300031824 | Bacteria | 7947 |
| 799 | Ga0307413_10003908 | 3300031824 | Bacteria | 6376 |
| 800 | Ga0307413_10026545 | 3300031824 | Bacteria | 3193 |
| 801 | Ga0307413_10057655 | 3300031824 | Bacteria | 2376 |
| 802 | Ga0307413_10115736 | 3300031824 | Bacteria | 1805 |
| 803 | Ga0307413_10141680 | 3300031824 | Bacteria | 1662 |
| 804 | Ga0307413_10148402 | 3300031824 | Bacteria | 1631 |
| 805 | Ga0307410_10029066 | 3300031852 | Bacteria | 3515 |
| 806 | Ga0307410_10092179 | 3300031852 | Bacteria | 2153 |
| 807 | Ga0307410_10093005 | 3300031852 | Bacteria | 2145 |
| 808 | Ga0307410_10162412 | 3300031852 | Bacteria | 1675 |
| 809 | Ga0307410_10170549 | 3300031852 | Bacteria | 1639 |
| 810 | Ga0307410_10239030 | 3300031852 | Bacteria | 1406 |
| 811 | Ga0307410_10276584 | 3300031852 | Bacteria | 1315 |
| 812 | Ga0307406_10025473 | 3300031901 | Bacteria | 3542 |
| 813 | Ga0307406_10027321 | 3300031901 | Bacteria | 3437 |
| 814 | Ga0307406_10085005 | 3300031901 | Bacteria | 2114 |
| 815 | Ga0307406_10239859 | 3300031901 | Bacteria | 1359 |
| 816 | Ga0307406_10288367 | 3300031901 | Bacteria | 1255 |
| 817 | Ga0307407_10028585 | 3300031903 | Bacteria | 2982 |
| 818 | Ga0307407_10035819 | 3300031903 | Bacteria | 2730 |
| 819 | Ga0307407_10077303 | 3300031903 | Bacteria | 2001 |
| 820 | Ga0307407_10136573 | 3300031903 | Bacteria | 1576 |
| 821 | Ga0307412_10000252 | 3300031911 | Bacteria | 34826 |
| 822 | Ga0307412_10000540 | 3300031911 | Bacteria | 22480 |
| 823 | Ga0307412_10007524 | 3300031911 | Bacteria | 6185 |
| 824 | Ga0307412_10025962 | 3300031911 | Bacteria | 3635 |
| 825 | Ga0307412_10027378 | 3300031911 | Bacteria | 3553 |
| 826 | Ga0307412_10030738 | 3300031911 | Bacteria | 3385 |
| 827 | Ga0307412_10049612 | 3300031911 | Bacteria | 2766 |
| 828 | Ga0307412_10064345 | 3300031911 | Bacteria | 2478 |
| 829 | Ga0307412_10139622 | 3300031911 | Bacteria | 1772 |
| 830 | Ga0307412_10174817 | 3300031911 | Bacteria | 1609 |
| 831 | Ga0307412_10226057 | 3300031911 | Bacteria | 1438 |
| 832 | Ga0307409_100016478 | 3300031995 | Bacteria | 4891 |
| 833 | Ga0307409_100039050 | 3300031995 | Bacteria | 3518 |
| 834 | Ga0307409_100128373 | 3300031995 | Bacteria | 2161 |
| 835 | Ga0307409_100152307 | 3300031995 | Bacteria | 2009 |
| 836 | Ga0307409_100165435 | 3300031995 | Bacteria | 1940 |
| 837 | Ga0307409_100302523 | 3300031995 | Bacteria | 1488 |
| 838 | Ga0307409_100416179 | 3300031995 | Bacteria | 1288 |
| 839 | Ga0307416_100020872 | 3300032002 | Bacteria | 4685 |
| 840 | Ga0307416_100118645 | 3300032002 | Bacteria | 2351 |
| 841 | Ga0307416_100275533 | 3300032002 | Bacteria | 1655 |
| 842 | Ga0307416_100350597 | 3300032002 | Bacteria | 1493 |
| 843 | Ga0307414_10000185 | 3300032004 | Bacteria | 42230 |
| 844 | Ga0307414_10000398 | 3300032004 | Bacteria | 23554 |
| 845 | Ga0307414_10003403 | 3300032004 | Bacteria | 8491 |
| 846 | Ga0307414_10004530 | 3300032004 | Bacteria | 7557 |
| 847 | Ga0307414_10007234 | 3300032004 | Bacteria | 6233 |
| 848 | Ga0307414_10047611 | 3300032004 | Bacteria | 2952 |
| 849 | Ga0307414_10157704 | 3300032004 | Bacteria | 1799 |
| 850 | Ga0307414_10181692 | 3300032004 | Bacteria | 1692 |
| 851 | Ga0307414_10240795 | 3300032004 | Bacteria | 1497 |
| 852 | Ga0307414_10531306 | 3300032004 | Bacteria | 1045 |
| 853 | Ga0307411_10002515 | 3300032005 | Bacteria | 8154 |
| 854 | Ga0307411_10010490 | 3300032005 | Bacteria | 4942 |
| 855 | Ga0307411_10033556 | 3300032005 | Bacteria | 3184 |
| 856 | Ga0307411_10038405 | 3300032005 | Bacteria | 3020 |
| 857 | Ga0307411_10046252 | 3300032005 | Bacteria | 2804 |
| 858 | Ga0307411_10064838 | 3300032005 | Bacteria | 2447 |
| 859 | Ga0307411_10086206 | 3300032005 | Bacteria | 2178 |
| 860 | Ga0307411_10104058 | 3300032005 | Bacteria | 2015 |
| 861 | Ga0307411_10182144 | 3300032005 | Bacteria | 1595 |
| 862 | Ga0307415_100007852 | 3300032126 | Bacteria | 5867 |
| 863 | Ga0307415_100098253 | 3300032126 | Bacteria | 2139 |
| 864 | Ga0307415_100226331 | 3300032126 | Bacteria | 1503 |
| 865 | Ga0316583_10005519 | 3300032133 | Bacteria | 4538 |
| 866 | Ga0373948_0019815 | 3300034817 | Bacteria | 1276 |
| 867 | Ga0373959_0004818 | 3300034820 | Bacteria | 2193 |
| 868 | Ga0373940_0024327 | 3300035088 | Bacteria | 1569 |
| 869 | Ga0373932_0006608 | 3300035112 | Bacteria | 2745 |
| 870 | Ga0373941_0016082 | 3300035115 | Bacteria | 2027 |
| 871 | Ga0373931_0028779 | 3300035691 | Bacteria | 2848 |
| 872 | Ga0316582_0024908 | 3300036647 | Bacteria | 3586 |
| 873 | Ga0316582_0233046 | 3300036647 | Bacteria | 1260 |
| 874 | Ga0316584_0078234 | 3300036712 | Bacteria | 2477 |
| 875 | Ga0395899_0047146 | 3300037312 | Bacteria | 3208 |
| 876 | Ga0395900_0000380 | 3300037418 | Bacteria | 64150 |
| 877 | Ga0395900_0021446 | 3300037418 | Bacteria | 6604 |
| 878 | Ga0395900_0024980 | 3300037418 | Bacteria | 6115 |
| 879 | Ga0395900_0028914 | 3300037418 | Bacteria | 5682 |
| 880 | Ga0395900_0231169 | 3300037418 | Bacteria | 1859 |
| 881 | Ga0395898_0020952 | 3300037466 | Bacteria | 6633 |
| 882 | Ga0395898_0147210 | 3300037466 | Bacteria | 2254 |
| 883 | Ga0395905_0001357 | 3300037471 | Bacteria | 29810 |
| 884 | Ga0395905_0006585 | 3300037471 | Bacteria | 11667 |
| 885 | Ga0395905_0009993 | 3300037471 | Bacteria | 9250 |
| 886 | Ga0395905_0016465 | 3300037471 | Bacteria | 7028 |
| 887 | Ga0395905_0024923 | 3300037471 | Bacteria | 5644 |
| 888 | Ga0395905_0031754 | 3300037471 | Bacteria | 4969 |
| 889 | Ga0395905_0124451 | 3300037471 | Bacteria | 2424 |
| 890 | Ga0395905_0132126 | 3300037471 | Bacteria | 2348 |
| 891 | Ga0395901_0003571 | 3300038443 | Bacteria | 15683 |
| 892 | Ga0395901_0253429 | 3300038443 | Bacteria | 1833 |
| 893 | Ga0395901_0393239 | 3300038443 | Bacteria | 1425 |
| 894 | Ga0436365_0594533 | 3300039437 | Bacteria | 37835 |
| 895 | Ga0436365_1385090 | 3300039437 | Bacteria | 1093 |
| 896 | Ga0436365_1821495 | 3300039437 | Bacteria | 1908 |
| 897 | Ga0436361_0330351 | 3300039447 | Bacteria | 13498 |
| 898 | Ga0436361_0443819 | 3300039447 | Bacteria | 9532 |
| 899 | Ga0436361_1020396 | 3300039447 | Bacteria | 1520 |
| 900 | Ga0436362_0580304 | 3300039453 | Bacteria | 124869 |
| 901 | Ga0439464_0004701 | 3300042439 | Bacteria | 3499 |
| 902 | Ga0466973_0087873 | 3300044659 | Bacteria | 2691 |
| 903 | Ga0466966_0000041 | 3300044684 | Bacteria | 97092 |
| 904 | Ga0466966_0005296 | 3300044684 | Bacteria | 8481 |
| 905 | Ga0466961_0092149 | 3300044693 | Bacteria | 1913 |
| 906 | Ga0466970_0030510 | 3300044765 | Bacteria | 2843 |
| 907 | Ga0466970_0040694 | 3300044765 | Bacteria | 2468 |
| 908 | Ga0466957_0010185 | 3300044842 | Bacteria | 5383 |
| 909 | Ga0466959_0006808 | 3300045049 | Bacteria | 7962 |
| 910 | Ga0466967_0033536 | 3300045976 | Bacteria | 4347 |
| 911 | Ga0495627_000598 | 3300046453 | Bacteria | 28785 |
| 912 | Ga0495629_0000049 | 3300046459 | Bacteria | 109116 |
| 913 | Ga0495638_0011014 | 3300046460 | Bacteria | 6249 |
| 914 | Ga0495638_0034250 | 3300046460 | Bacteria | 3243 |
| 915 | Ga0495653_0002923 | 3300046463 | Bacteria | 13669 |
| 916 | Ga0495650_0012931 | 3300046471 | Bacteria | 4452 |
| 917 | Ga0495580_0002459 | 3300046472 | Bacteria | 16192 |
| 918 | Ga0495580_0005345 | 3300046472 | Bacteria | 10640 |
| 919 | Ga0495585_0087990 | 3300046492 | Bacteria | 1676 |
| 920 | Ga0495596_0000016 | 3300046500 | Bacteria | 117489 |
| 921 | Ga0495596_0000247 | 3300046500 | Bacteria | 36077 |
| 922 | Ga0495583_0000474 | 3300046506 | Bacteria | 58751 |
| 923 | Ga0495583_0000577 | 3300046506 | Bacteria | 50418 |
| 924 | Ga0495583_0004192 | 3300046506 | Bacteria | 10500 |
| 925 | Ga0495606_0041089 | 3300046507 | Bacteria | 3103 |
| 926 | Ga0495606_0128040 | 3300046507 | Bacteria | 1512 |
| 927 | Ga0495610_0035531 | 3300046512 | Bacteria | 2557 |
| 928 | Ga0495610_0052202 | 3300046512 | Bacteria | 1986 |
| 929 | Ga0495620_0000761 | 3300046515 | Bacteria | 19766 |
| 930 | Ga0495637_0000085 | 3300046520 | Bacteria | 72965 |
| 931 | Ga0495643_0000555 | 3300046522 | Bacteria | 46241 |
| 932 | Ga0495643_0000806 | 3300046522 | Bacteria | 34503 |
| 933 | Ga0495643_0002033 | 3300046522 | Bacteria | 16829 |
| 934 | Ga0495643_0008791 | 3300046522 | Bacteria | 6362 |
| 935 | Ga0495648_0000114 | 3300046524 | Bacteria | 98677 |
| 936 | Ga0495648_0022564 | 3300046524 | Bacteria | 4329 |
| 937 | Ga0495663_0007342 | 3300046525 | Bacteria | 3044 |
| 938 | Ga0495663_0009419 | 3300046525 | Bacteria | 2708 |
| 939 | Ga0495663_0049882 | 3300046525 | Bacteria | 1293 |
| 940 | Ga0495663_0054255 | 3300046525 | Bacteria | 1248 |
| 941 | Ga0495642_0003949 | 3300046528 | Bacteria | 5802 |
| 942 | Ga0495654_0030806 | 3300046530 | Bacteria | 2727 |
| 943 | Ga0495654_0068032 | 3300046530 | Bacteria | 1694 |
| 944 | Ga0495654_0095026 | 3300046530 | Bacteria | 1378 |
| 945 | Ga0495598_0013057 | 3300046537 | Bacteria | 2051 |
| 946 | Ga0495598_0053394 | 3300046537 | Bacteria | 1224 |
| 947 | Ga0495609_0018276 | 3300046538 | Bacteria | 3249 |
| 948 | Ga0495621_0002637 | 3300046539 | Bacteria | 4851 |
| 949 | Ga0495621_0006066 | 3300046539 | Bacteria | 3510 |
| 950 | Ga0495633_0000847 | 3300046558 | Bacteria | 26761 |
| 951 | Ga0495633_0068583 | 3300046558 | Bacteria | 1655 |
| 952 | Ga0495633_0081824 | 3300046558 | Bacteria | 1502 |
| 953 | Ga0495633_0141236 | 3300046558 | Bacteria | 1113 |
| 954 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 955 | Ga0495668_0019846 | 3300046616 | Bacteria | 3868 |
| 956 | Ga0495668_0209515 | 3300046616 | Bacteria | 1067 |
| 957 | Ga0495625_0001219 | 3300046660 | Bacteria | 32635 |
| 958 | Ga0495625_0001605 | 3300046660 | Bacteria | 26691 |
| 959 | Ga0495625_0012265 | 3300046660 | Bacteria | 6950 |
| 960 | Ga0495625_0056411 | 3300046660 | Bacteria | 2796 |
| 961 | Ga0495661_0058386 | 3300046665 | Bacteria | 2300 |
| 962 | Ga0495669_0025550 | 3300046684 | Bacteria | 2576 |
| 963 | Ga0495669_0049749 | 3300046684 | Bacteria | 1878 |
| 964 | Ga0495669_0089557 | 3300046684 | Bacteria | 1419 |
| 965 | Ga0495624_0000070 | 3300046690 | Bacteria | 66024 |
| 966 | Ga0495670_0000016 | 3300046691 | Bacteria | 128045 |
| 967 | Ga0495670_0064401 | 3300046691 | Bacteria | 1847 |
| 968 | Ga0495671_0000249 | 3300046692 | Bacteria | 46241 |
| 969 | Ga0495671_0017383 | 3300046692 | Bacteria | 3829 |
| 970 | Ga0495600_0009002 | 3300046809 | Bacteria | 6150 |
| 971 | Ga0495674_0000123 | 3300047319 | Bacteria | 58638 |
| 972 | Ga0495677_0073744 | 3300047445 | Bacteria | 1273 |
| 973 | Ga0495673_0040173 | 3300047469 | Bacteria | 2116 |
| 974 | Ga0495681_0002495 | 3300047470 | Bacteria | 13127 |
| 975 | Ga0495681_0005245 | 3300047470 | Bacteria | 8704 |
| 976 | Ga0495686_0000100 | 3300047472 | Bacteria | 180492 |
| 977 | Ga0495593_0000610 | 3300047673 | Bacteria | 20414 |
| 978 | Ga0495615_0000012 | 3300048090 | Bacteria | 64858 |
| 979 | Ga0496100_0026550 | 3300048903 | Bacteria | 3551 |
| 980 | Ga0496101_0050962 | 3300048904 | Bacteria | 2981 |
| 981 | Ga0496101_0123697 | 3300048904 | Bacteria | 1958 |
| 982 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 983 | Ga0496102_0000321 | 3300048905 | Bacteria | 60110 |
| 984 | Ga0496102_0053503 | 3300048905 | Bacteria | 3679 |
| 985 | Ga0496102_0334039 | 3300048905 | Bacteria | 1427 |
| 986 | Ga0496102_0731208 | 3300048905 | Bacteria | 912 |
| 987 | Ga0496103_0000167 | 3300048906 | Bacteria | 68561 |
| 988 | Ga0496103_0000199 | 3300048906 | Bacteria | 60032 |
| 989 | Ga0496103_0148434 | 3300048906 | Bacteria | 1501 |
| 990 | Ga0496104_0019331 | 3300048907 | Bacteria | 6229 |
| 991 | Ga0496104_0060220 | 3300048907 | Bacteria | 3597 |
| 992 | Ga0496104_0089183 | 3300048907 | Bacteria | 2946 |
| 993 | Ga0496104_0236157 | 3300048907 | Bacteria | 1740 |
| 994 | Ga0496105_0000847 | 3300048908 | Bacteria | 20846 |
| 995 | Ga0496105_0010549 | 3300048908 | Bacteria | 7268 |
| 996 | Ga0496105_0039344 | 3300048908 | Bacteria | 3898 |
| 997 | Ga0496105_0055319 | 3300048908 | Bacteria | 3276 |
| 998 | Ga0496105_0267698 | 3300048908 | Bacteria | 1381 |
| 999 | Ga0496106_0007150 | 3300048909 | Bacteria | 8245 |
| 1000 | Ga0496107_0025054 | 3300048910 | Bacteria | 4222 |
| 1001 | Ga0496108_0000162 | 3300048911 | Bacteria | 63296 |
| 1002 | Ga0496108_0124850 | 3300048911 | Bacteria | 2209 |
| 1003 | Ga0496109_0000939 | 3300048912 | Bacteria | 24123 |
| 1004 | Ga0496109_0399177 | 3300048912 | Bacteria | 1299 |
| 1005 | Ga0496110_0087800 | 3300048913 | Bacteria | 2777 |
| 1006 | Ga0496110_0098914 | 3300048913 | Bacteria | 2615 |
| 1007 | Ga0496110_0103597 | 3300048913 | Bacteria | 2552 |
| 1008 | Ga0496110_0225473 | 3300048913 | Bacteria | 1704 |
| 1009 | Ga0496111_0093320 | 3300048914 | Bacteria | 2206 |
| 1010 | Ga0496112_0000394 | 3300048915 | Bacteria | 28507 |
| 1011 | Ga0496112_0001985 | 3300048915 | Bacteria | 16179 |
| 1012 | Ga0496112_0061314 | 3300048915 | Bacteria | 3707 |
| 1013 | Ga0496113_0000082 | 3300048916 | Bacteria | 41671 |
| 1014 | Ga0496113_0002634 | 3300048916 | Bacteria | 10503 |
| 1015 | Ga0496114_0007983 | 3300048917 | Bacteria | 8374 |
| 1016 | Ga0496114_0008871 | 3300048917 | Bacteria | 7972 |
| 1017 | Ga0496114_0016127 | 3300048917 | Bacteria | 6013 |
| 1018 | Ga0496114_0190704 | 3300048917 | Bacteria | 1793 |
| 1019 | Ga0496114_0386218 | 3300048917 | Bacteria | 1240 |
| 1020 | Ga0496115_0000029 | 3300048918 | Bacteria | 141359 |
| 1021 | Ga0496115_0004979 | 3300048918 | Bacteria | 9643 |
| 1022 | Ga0496116_0000648 | 3300048919 | Bacteria | 45494 |
| 1023 | Ga0496116_0018949 | 3300048919 | Bacteria | 5285 |
| 1024 | Ga0496116_0025177 | 3300048919 | Bacteria | 4380 |
| 1025 | Ga0496116_0027942 | 3300048919 | Unclassified | 4097 |
| 1026 | Ga0496116_0061976 | 3300048919 | Bacteria | 2417 |
| 1027 | Ga0496116_0083341 | 3300048919 | Bacteria | 1974 |
| 1028 | Ga0496116_0192978 | 3300048919 | Unclassified | 1076 |
| 1029 | Ga0496117_0000260 | 3300048920 | Bacteria | 99636 |
| 1030 | Ga0496117_0000584 | 3300048920 | Bacteria | 60140 |
| 1031 | Ga0496117_0007303 | 3300048920 | Bacteria | 10848 |
| 1032 | Ga0496117_0043201 | 3300048920 | Bacteria | 3280 |
| 1033 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 1034 | Ga0496118_0000588 | 3300048921 | Bacteria | 60153 |
| 1035 | Ga0496118_0000689 | 3300048921 | Bacteria | 54897 |
| 1036 | Ga0496118_0009536 | 3300048921 | Bacteria | 9779 |
| 1037 | Ga0496118_0010136 | 3300048921 | Bacteria | 9365 |
| 1038 | Ga0496118_0042162 | 3300048921 | Bacteria | 3603 |
| 1039 | Ga0496118_0092055 | 3300048921 | Bacteria | 2082 |
| 1040 | Ga0496118_0139245 | 3300048921 | Bacteria | 1542 |
| 1041 | Ga0496119_0034760 | 3300048922 | Bacteria | 3311 |
| 1042 | Ga0496120_0006949 | 3300048923 | Bacteria | 8536 |
| 1043 | Ga0496120_0045488 | 3300048923 | Bacteria | 2542 |
| 1044 | Ga0496121_0000683 | 3300048924 | Bacteria | 63257 |
| 1045 | Ga0496121_0000949 | 3300048924 | Bacteria | 52413 |
| 1046 | Ga0496121_0002864 | 3300048924 | Bacteria | 25422 |
| 1047 | Ga0496121_0005909 | 3300048924 | Bacteria | 15486 |
| 1048 | Ga0496121_0007120 | 3300048924 | Bacteria | 13576 |
| 1049 | Ga0496121_0007335 | 3300048924 | Bacteria | 13332 |
| 1050 | Ga0496121_0056386 | 3300048924 | Bacteria | 3264 |
| 1051 | Ga0496121_0098452 | 3300048924 | Bacteria | 2263 |
| 1052 | Ga0496122_0000033 | 3300048925 | Bacteria | 324104 |
| 1053 | Ga0496122_0000218 | 3300048925 | Bacteria | 127770 |
| 1054 | Ga0496122_0006049 | 3300048925 | Bacteria | 14104 |
| 1055 | Ga0496122_0050313 | 3300048925 | Unclassified | 3179 |
| 1056 | Ga0496122_0101374 | 3300048925 | Bacteria | 1923 |
| 1057 | Ga0496123_0000089 | 3300048926 | Bacteria | 179941 |
| 1058 | Ga0496123_0000741 | 3300048926 | Bacteria | 52871 |
| 1059 | Ga0496123_0002070 | 3300048926 | Bacteria | 25866 |
| 1060 | Ga0496123_0010286 | 3300048926 | Bacteria | 8299 |
| 1061 | Ga0496123_0060612 | 3300048926 | Bacteria | 2438 |
| 1062 | Ga0496123_0155476 | 3300048926 | Unclassified | 1227 |
| 1063 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 1064 | Ga0496124_0000387 | 3300048927 | Bacteria | 80517 |
| 1065 | Ga0496124_0007325 | 3300048927 | Bacteria | 11758 |
| 1066 | Ga0496124_0011763 | 3300048927 | Bacteria | 8725 |
| 1067 | Ga0496124_0021172 | 3300048927 | Bacteria | 5995 |
| 1068 | Ga0496124_0139411 | 3300048927 | Bacteria | 1915 |
| 1069 | Ga0496125_0000117 | 3300048928 | Bacteria | 176766 |
| 1070 | Ga0496125_0071439 | 3300048928 | Unclassified | 2711 |
| 1071 | Ga0496125_0086716 | 3300048928 | Bacteria | 2366 |
| 1072 | Ga0496126_0000469 | 3300048929 | Bacteria | 80156 |
| 1073 | Ga0496126_0008764 | 3300048929 | Unclassified | 10857 |
| 1074 | Ga0496126_0179803 | 3300048929 | Bacteria | 1797 |
| 1075 | Ga0496126_0239104 | 3300048929 | Bacteria | 1518 |
| 1076 | Ga0501031_0216850 | 3300049568 | Bacteria | 1247 |
| 1077 | Ga0501033_0059716 | 3300049570 | Bacteria | 2815 |
| 1078 | Ga0501034_0042628 | 3300049571 | Bacteria | 4594 |
| 1079 | Ga0501034_0407314 | 3300049571 | Bacteria | 1282 |
| 1080 | Ga0501034_0423429 | 3300049571 | Bacteria | 1252 |
| 1081 | Ga0501037_0247914 | 3300049573 | Bacteria | 1247 |
| 1082 | Ga0501038_0121385 | 3300049574 | Bacteria | 2154 |
| 1083 | Ga0501039_0062198 | 3300049575 | Bacteria | 2892 |
| 1084 | Ga0501043_0055003 | 3300049579 | Bacteria | 3126 |
| 1085 | Ga0501043_0063181 | 3300049579 | Bacteria | 2907 |
| 1086 | Ga0501046_0088564 | 3300049580 | Bacteria | 2384 |
| 1087 | Ga0501047_0000864 | 3300049581 | Bacteria | 30960 |
| 1088 | Ga0501047_0026935 | 3300049581 | Bacteria | 5535 |
| 1089 | Ga0501047_0073181 | 3300049581 | Bacteria | 3299 |
| 1090 | Ga0501047_0441956 | 3300049581 | Bacteria | 1130 |
| 1091 | Ga0501070_0314275 | 3300049586 | Bacteria | 1275 |
| 1092 | Ga0501073_0197340 | 3300049589 | Bacteria | 1392 |
| 1093 | Ga0501233_003600 | 3300049668 | Bacteria | 2792 |
| 1094 | Ga0501225_0010631 | 3300049705 | Bacteria | 2605 |
| 1095 | Ga0501281_03626 | 3300049777 | Bacteria | 1101 |
| 1096 | Ga0501035_0037003 | 3300049822 | Bacteria | 4421 |
| 1097 | Ga0501035_0116757 | 3300049822 | Bacteria | 2335 |
| 1098 | Ga0501044_0070436 | 3300049823 | Bacteria | 3556 |
| 1099 | Ga0501044_0152694 | 3300049823 | Bacteria | 2291 |
| 1100 | Ga0501044_0261059 | 3300049823 | Bacteria | 1670 |
| 1101 | nmdc:mga00v17_7478_c1 | 3300050491 | Bacteria | 5831 |
| 1102 | nmdc:mga0k408_6415_c1 | 3300050493 | Bacteria | 4278 |
| 1103 | nmdc:mga0k408_90392_c1 | 3300050493 | Bacteria | 1798 |
| 1104 | nmdc:mga07m45_91046_c1 | 3300050496 | Bacteria | 1747 |
| 1105 | nmdc:mga05p37_69169_c1 | 3300050507 | Bacteria | 4342 |
| 1106 | nmdc:mga08y16_1605_c2 | 3300050511 | Bacteria | 21111 |
| 1107 | nmdc:mga08x19_224069_c1 | 3300050514 | Bacteria | 1293 |
| 1108 | nmdc:mga0sz30_125788_c1 | 3300050516 | Bacteria | 1128 |
| 1109 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 1110 | Ga0500643_001098 | 3300053087 | Bacteria | 16256 |
| 1111 | Ga0500643_003982 | 3300053087 | Bacteria | 6833 |
| 1112 | Ga0500641_0000927 | 3300053096 | Bacteria | 10472 |
| 1113 | Ga0500555_000457 | 3300053103 | Bacteria | 16951 |
| 1114 | Ga0500556_0000522 | 3300053104 | Bacteria | 26239 |
| 1115 | Ga0500556_0054774 | 3300053104 | Bacteria | 1453 |
| 1116 | Ga0500562_048154 | 3300053108 | Bacteria | 1138 |
| 1117 | Ga0500572_015101 | 3300053111 | Bacteria | 1942 |
| 1118 | Ga0500592_012209 | 3300053116 | Bacteria | 1373 |
| 1119 | Ga0500597_013253 | 3300053120 | Bacteria | 3052 |
| 1120 | Ga0500607_001228 | 3300053121 | Bacteria | 23562 |
| 1121 | Ga0500618_000711 | 3300053125 | Bacteria | 19286 |
| 1122 | Ga0500618_000842 | 3300053125 | Bacteria | 16615 |
| 1123 | Ga0500618_011359 | 3300053125 | Bacteria | 2364 |
| 1124 | Ga0500642_0000007 | 3300053130 | Bacteria | 294238 |
| 1125 | Ga0500658_0001207 | 3300053134 | Bacteria | 10507 |
| 1126 | Ga0500568_0002901 | 3300053139 | Bacteria | 9847 |
| 1127 | Ga0500574_013783 | 3300053141 | Bacteria | 1890 |
| 1128 | Ga0500616_0019037 | 3300053153 | Bacteria | 3876 |
| 1129 | Ga0500624_000007 | 3300053157 | Bacteria | 184487 |
| 1130 | Ga0500624_000050 | 3300053157 | Bacteria | 80450 |
| 1131 | Ga0500627_0000017 | 3300053158 | Bacteria | 119507 |
| 1132 | Ga0500627_0028673 | 3300053158 | Bacteria | 2314 |
| 1133 | Ga0500627_0079275 | 3300053158 | Bacteria | 1462 |
| 1134 | Ga0500638_100469 | 3300053162 | Bacteria | 1350 |
| 1135 | Ga0500636_0003403 | 3300053177 | Bacteria | 8947 |
| 1136 | Ga0500636_0006756 | 3300053177 | Bacteria | 6604 |
| 1137 | Ga0500637_0000061 | 3300053178 | Bacteria | 38370 |
| 1138 | Ga0500645_000038 | 3300053730 | Bacteria | 112786 |
| 1139 | Ga0500645_000637 | 3300053730 | Bacteria | 22300 |
| 1140 | Ga0500645_004200 | 3300053730 | Bacteria | 5602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025931 | Ga0207644_10098416 | Ga0207644_100984162 | 235 |
| 2 | 3300048917 | Ga0496114_0190704 | Ga0496114_0190704_787_1716 | 235 |
| 3 | 3300048918 | Ga0496115_0004979 | Ga0496115_0004979_6040_6969 | 235 |
| 4 | 3300006051 | Ga0075364_10024319 | Ga0075364_100243192 | 236 |
| 5 | 3300050491 | nmdc:mga00v17_7478_c1 | nmdc:mga00v17_7478_c1_2349_3278 | 236 |
| 6 | 3300005563 | Ga0068855_100013556 | Ga0068855_1000135568 | 237 |
| 7 | 3300025949 | Ga0207667_10000881 | Ga0207667_1000088134 | 237 |
| 8 | 3300014969 | Ga0157376_10134214 | Ga0157376_101342143 | 238 |
| 9 | 3300005355 | Ga0070671_100004809 | Ga0070671_10000480910 | 240 |
| 10 | 3300025931 | Ga0207644_10018490 | Ga0207644_100184902 | 240 |
| 11 | 3300048911 | Ga0496108_0124850 | Ga0496108_0124850_1145_2077 | 240 |
| 12 | 3300048913 | Ga0496110_0087800 | Ga0496110_0087800_903_1835 | 240 |
| 13 | 3300048917 | Ga0496114_0016127 | Ga0496114_0016127_1352_2284 | 240 |
| 14 | 3300048925 | Ga0496122_0101374 | Ga0496122_0101374_922_1857 | 240 |
| 15 | 3300005335 | Ga0070666_10058133 | Ga0070666_100581332 | 241 |
| 16 | 3300025940 | Ga0207691_10662643 | Ga0207691_106626431 | 242 |
| 17 | 3300012513 | Ga0157326_1000175 | Ga0157326_10001756 | 244 |
| 18 | 3300053125 | Ga0500618_000711 | Ga0500618_000711_18076_19014 | 248 |
| 19 | 3300005842 | Ga0068858_100041218 | Ga0068858_1000412181 | 250 |
| 20 | 3300006195 | Ga0075366_10129777 | Ga0075366_101297772 | 250 |
| 21 | 3300025941 | Ga0207711_10017131 | Ga0207711_100171312 | 250 |
| 22 | 3300026035 | Ga0207703_10002643 | Ga0207703_100026437 | 250 |
| 23 | 3300050493 | nmdc:mga0k408_6415_c1 | nmdc:mga0k408_6415_c1_366_1298 | 250 |
| 24 | 3300005616 | Ga0068852_100162017 | Ga0068852_1001620171 | 251 |
| 25 | 3300021361 | Ga0213872_10088520 | Ga0213872_100885202 | 253 |
| 26 | 3300039447 | Ga0436361_0330351 | Ga0436361_0330351_2721_3650 | 253 |
| 27 | 3300001979 | JGI24740J21852_10002997 | JGI24740J21852_100029973 | 254 |
| 28 | 3300005327 | Ga0070658_10000492 | Ga0070658_1000049211 | 254 |
| 29 | 3300005578 | Ga0068854_100000259 | Ga0068854_10000025921 | 254 |
| 30 | 3300005614 | Ga0068856_100003650 | Ga0068856_1000036508 | 254 |
| 31 | 3300005616 | Ga0068852_100004798 | Ga0068852_1000047982 | 254 |
| 32 | 3300005834 | Ga0068851_10108531 | Ga0068851_101085312 | 254 |
| 33 | 3300009093 | Ga0105240_10002301 | Ga0105240_1000230114 | 254 |
| 34 | 3300025321 | Ga0207656_10034506 | Ga0207656_100345062 | 254 |
| 35 | 3300025904 | Ga0207647_10007823 | Ga0207647_100078236 | 254 |
| 36 | 3300025909 | Ga0207705_10000073 | Ga0207705_100000739 | 254 |
| 37 | 3300025913 | Ga0207695_10008997 | Ga0207695_100089974 | 254 |
| 38 | 3300025981 | Ga0207640_10000254 | Ga0207640_100002542 | 254 |
| 39 | 3300025981 | Ga0207640_10062898 | Ga0207640_100628982 | 254 |
| 40 | 3300026041 | Ga0207639_10134557 | Ga0207639_101345573 | 254 |
| 41 | 3300026078 | Ga0207702_10009596 | Ga0207702_100095968 | 254 |
| 42 | 3300026116 | Ga0207674_10099843 | Ga0207674_100998432 | 254 |
| 43 | 3300026142 | Ga0207698_10000308 | Ga0207698_100003084 | 254 |
| 44 | 3300048921 | Ga0496118_0139245 | Ga0496118_0139245_161_1093 | 254 |
| 45 | 3300048924 | Ga0496121_0002864 | Ga0496121_0002864_18532_19464 | 254 |
| 46 | 3300002459 | JGI24751J29686_10001179 | JGI24751J29686_100011794 | 255 |
| 47 | 3300005577 | Ga0068857_100190133 | Ga0068857_1001901332 | 255 |
| 48 | 3300026116 | Ga0207674_10170119 | Ga0207674_101701192 | 255 |
| 49 | 3300048905 | Ga0496102_0731208 | Ga0496102_0731208_128_901 | 257 |
| 50 | 3300005367 | Ga0070667_100001750 | Ga0070667_10000175013 | 259 |
| 51 | 3300005843 | Ga0068860_100000473 | Ga0068860_10000047345 | 259 |
| 52 | 3300025986 | Ga0207658_10001852 | Ga0207658_100018528 | 259 |
| 53 | 3300028381 | Ga0268264_10000224 | Ga0268264_1000022496 | 259 |
| 54 | 3300002067 | JGI24735J21928_10047060 | JGI24735J21928_100470602 | 261 |
| 55 | 3300005339 | Ga0070660_100316740 | Ga0070660_1003167401 | 261 |
| 56 | 3300005354 | Ga0070675_100024384 | Ga0070675_1000243844 | 261 |
| 57 | 3300005366 | Ga0070659_100068324 | Ga0070659_1000683242 | 261 |
| 58 | 3300005456 | Ga0070678_100004619 | Ga0070678_1000046194 | 261 |
| 59 | 3300005543 | Ga0070672_100497323 | Ga0070672_1004973231 | 261 |
| 60 | 3300025901 | Ga0207688_10033182 | Ga0207688_100331822 | 261 |
| 61 | 3300025904 | Ga0207647_10095564 | Ga0207647_100955642 | 261 |
| 62 | 3300025919 | Ga0207657_10044453 | Ga0207657_100444532 | 261 |
| 63 | 3300025932 | Ga0207690_10092013 | Ga0207690_100920131 | 261 |
| 64 | 3300025940 | Ga0207691_10212909 | Ga0207691_102129092 | 261 |
| 65 | 3300026121 | Ga0207683_10012052 | Ga0207683_100120522 | 261 |
| 66 | 3300005347 | Ga0070668_100024478 | Ga0070668_1000244783 | 262 |
| 67 | 3300005355 | Ga0070671_100496505 | Ga0070671_1004965051 | 262 |
| 68 | 3300025972 | Ga0207668_10069145 | Ga0207668_100691453 | 262 |
| 69 | 3300003794 | Ga0055531_10019236 | Ga0055531_100192362 | 268 |
| 70 | 3300005339 | Ga0070660_100000017 | Ga0070660_1000000173 | 268 |
| 71 | 3300005366 | Ga0070659_100395683 | Ga0070659_1003956832 | 268 |
| 72 | 3300005563 | Ga0068855_100376394 | Ga0068855_1003763942 | 268 |
| 73 | 3300010375 | Ga0105239_10123564 | Ga0105239_101235642 | 268 |
| 74 | 3300025292 | Ga0209676_1000760 | Ga0209676_100076037 | 268 |
| 75 | 3300025304 | Ga0209257_1002450 | Ga0209257_10024504 | 268 |
| 76 | 3300025904 | Ga0207647_10111901 | Ga0207647_101119012 | 268 |
| 77 | 3300025919 | Ga0207657_10001746 | Ga0207657_100017463 | 268 |
| 78 | 3300025949 | Ga0207667_10055895 | Ga0207667_100558952 | 268 |
| 79 | 3300003763 | Ga0055529_1005011 | Ga0055529_10050112 | 270 |
| 80 | 3300005334 | Ga0068869_100000668 | Ga0068869_1000006687 | 270 |
| 81 | 3300005338 | Ga0068868_100000139 | Ga0068868_10000013921 | 270 |
| 82 | 3300009553 | Ga0105249_10019428 | Ga0105249_100194282 | 270 |
| 83 | 3300011119 | Ga0105246_10001368 | Ga0105246_100013688 | 270 |
| 84 | 3300017792 | Ga0163161_10139979 | Ga0163161_101399792 | 270 |
| 85 | 3300025254 | Ga0209148_1001582 | Ga0209148_10015824 | 270 |
| 86 | 3300025272 | Ga0209455_1000749 | Ga0209455_10007496 | 270 |
| 87 | 3300025942 | Ga0207689_10000059 | Ga0207689_1000005936 | 270 |
| 88 | 3300048921 | Ga0496118_0009536 | Ga0496118_0009536_2891_3826 | 270 |
| 89 | 3300048923 | Ga0496120_0045488 | Ga0496120_0045488_1419_2354 | 270 |
| 90 | 3300002067 | JGI24735J21928_10006565 | JGI24735J21928_100065652 | 271 |
| 91 | 3300003762 | Ga0055542_1008710 | Ga0055542_10087101 | 271 |
| 92 | 3300003762 | Ga0055542_1010209 | Ga0055542_10102092 | 271 |
| 93 | 3300005458 | Ga0070681_10359658 | Ga0070681_103596582 | 271 |
| 94 | 3300005530 | Ga0070679_100345940 | Ga0070679_1003459402 | 271 |
| 95 | 3300005539 | Ga0068853_100038328 | Ga0068853_1000383283 | 271 |
| 96 | 3300005616 | Ga0068852_100091137 | Ga0068852_1000911374 | 271 |
| 97 | 3300009093 | Ga0105240_10029739 | Ga0105240_100297394 | 271 |
| 98 | 3300009551 | Ga0105238_10056205 | Ga0105238_100562055 | 271 |
| 99 | 3300025254 | Ga0209148_1000160 | Ga0209148_100016028 | 271 |
| 100 | 3300025909 | Ga0207705_10003277 | Ga0207705_100032774 | 271 |
| 101 | 3300025912 | Ga0207707_10293737 | Ga0207707_102937372 | 271 |
| 102 | 3300025913 | Ga0207695_10008637 | Ga0207695_100086375 | 271 |
| 103 | 3300025917 | Ga0207660_10080481 | Ga0207660_100804812 | 271 |
| 104 | 3300025919 | Ga0207657_10173587 | Ga0207657_101735872 | 271 |
| 105 | 3300025921 | Ga0207652_10347530 | Ga0207652_103475302 | 271 |
| 106 | 3300025924 | Ga0207694_10083568 | Ga0207694_100835684 | 271 |
| 107 | 3300025949 | Ga0207667_10002081 | Ga0207667_100020813 | 271 |
| 108 | 3300026041 | Ga0207639_10029484 | Ga0207639_100294845 | 271 |
| 109 | 3300026078 | Ga0207702_10055491 | Ga0207702_100554913 | 271 |
| 110 | 3300044765 | Ga0466970_0040694 | Ga0466970_0040694_44_979 | 271 |
| 111 | 3300048921 | Ga0496118_0092055 | Ga0496118_0092055_473_1408 | 271 |
| 112 | 3300048924 | Ga0496121_0007120 | Ga0496121_0007120_2375_3310 | 271 |
| 113 | 3300005353 | Ga0070669_100000610 | Ga0070669_10000061017 | 272 |
| 114 | 3300005842 | Ga0068858_100004155 | Ga0068858_10000415513 | 272 |
| 115 | 3300013105 | Ga0157369_10275353 | Ga0157369_102753532 | 272 |
| 116 | 3300025923 | Ga0207681_10000260 | Ga0207681_1000026031 | 272 |
| 117 | 3300025941 | Ga0207711_10042522 | Ga0207711_100425223 | 272 |
| 118 | 3300037466 | Ga0395898_0147210 | Ga0395898_0147210_619_1554 | 272 |
| 119 | 3300048913 | Ga0496110_0098914 | Ga0496110_0098914_1539_2471 | 272 |
| 120 | 3300048914 | Ga0496111_0093320 | Ga0496111_0093320_1204_2136 | 272 |
| 121 | 3300001991 | JGI24743J22301_10011359 | JGI24743J22301_100113592 | 274 |
| 122 | 3300005328 | Ga0070676_10000029 | Ga0070676_1000002923 | 274 |
| 123 | 3300005364 | Ga0070673_100000013 | Ga0070673_10000001342 | 274 |
| 124 | 3300005459 | Ga0068867_100000009 | Ga0068867_10000000984 | 274 |
| 125 | 3300006881 | Ga0068865_100000005 | Ga0068865_10000000527 | 274 |
| 126 | 3300009148 | Ga0105243_10000032 | Ga0105243_1000003242 | 274 |
| 127 | 3300009176 | Ga0105242_10000166 | Ga0105242_1000016610 | 274 |
| 128 | 3300013296 | Ga0157374_10000134 | Ga0157374_1000013437 | 274 |
| 129 | 3300013308 | Ga0157375_10000242 | Ga0157375_1000024242 | 274 |
| 130 | 3300014969 | Ga0157376_10000111 | Ga0157376_1000011138 | 274 |
| 131 | 3300025907 | Ga0207645_10007479 | Ga0207645_100074793 | 274 |
| 132 | 3300025934 | Ga0207686_10000250 | Ga0207686_100002502 | 274 |
| 133 | 3300025935 | Ga0207709_10000051 | Ga0207709_10000051198 | 274 |
| 134 | 3300025938 | Ga0207704_10000001 | Ga0207704_1000000142 | 274 |
| 135 | 3300025960 | Ga0207651_10000006 | Ga0207651_10000006197 | 274 |
| 136 | 3300026089 | Ga0207648_10000022 | Ga0207648_1000002287 | 274 |
| 137 | 3300037471 | Ga0395905_0024923 | Ga0395905_0024923_4017_4946 | 274 |
| 138 | 3300044684 | Ga0466966_0000041 | Ga0466966_0000041_89408_90337 | 274 |
| 139 | 3300005455 | Ga0070663_100017908 | Ga0070663_1000179083 | 275 |
| 140 | 3300013105 | Ga0157369_10003257 | Ga0157369_100032579 | 275 |
| 141 | 3300025920 | Ga0207649_10039967 | Ga0207649_100399673 | 275 |
| 142 | 3300025949 | Ga0207667_10003709 | Ga0207667_100037099 | 275 |
| 143 | 3300026067 | Ga0207678_10080522 | Ga0207678_100805223 | 275 |
| 144 | 3300026142 | Ga0207698_10008742 | Ga0207698_100087421 | 275 |
| 145 | 3300005353 | Ga0070669_100018055 | Ga0070669_1000180552 | 277 |
| 146 | 3300006847 | Ga0075431_100027520 | Ga0075431_1000275205 | 277 |
| 147 | 3300025923 | Ga0207681_10226613 | Ga0207681_102266132 | 277 |
| 148 | 3300028380 | Ga0268265_10029848 | Ga0268265_100298484 | 277 |
| 149 | 3300031731 | Ga0307405_10124309 | Ga0307405_101243091 | 277 |
| 150 | 3300031901 | Ga0307406_10239859 | Ga0307406_102398592 | 277 |
| 151 | 3300046525 | Ga0495663_0049882 | Ga0495663_0049882_242_1171 | 277 |
| 152 | 3300046537 | Ga0495598_0013057 | Ga0495598_0013057_413_1342 | 277 |
| 153 | 3300046539 | Ga0495621_0002637 | Ga0495621_0002637_1802_2731 | 277 |
| 154 | 3300025919 | Ga0207657_10213794 | Ga0207657_102137942 | 278 |
| 155 | 3300003322 | rootL2_10049419 | rootL2_100494193 | 279 |
| 156 | 3300031731 | Ga0307405_10004673 | Ga0307405_100046732 | 279 |
| 157 | 3300031911 | Ga0307412_10000540 | Ga0307412_1000054015 | 279 |
| 158 | 3300032004 | Ga0307414_10000185 | Ga0307414_100001859 | 279 |
| 159 | 3300048909 | Ga0496106_0007150 | Ga0496106_0007150_6951_7883 | 279 |
| 160 | 3300053121 | Ga0500607_001228 | Ga0500607_001228_332_1264 | 279 |
| 161 | 3300002067 | JGI24735J21928_10007993 | JGI24735J21928_100079934 | 280 |
| 162 | 3300005563 | Ga0068855_100000040 | Ga0068855_10000004045 | 280 |
| 163 | 3300025949 | Ga0207667_10000024 | Ga0207667_1000002456 | 280 |
| 164 | 3300031731 | Ga0307405_10108448 | Ga0307405_101084481 | 280 |
| 165 | 3300031911 | Ga0307412_10226057 | Ga0307412_102260572 | 280 |
| 166 | 3300032005 | Ga0307411_10104058 | Ga0307411_101040582 | 280 |
| 167 | 3300046691 | Ga0495670_0000016 | Ga0495670_0000016_101547_102476 | 280 |
| 168 | 3300005295 | Ga0065707_10093150 | Ga0065707_100931502 | 281 |
| 169 | 3300013306 | Ga0163162_10311287 | Ga0163162_103112872 | 281 |
| 170 | 3300014326 | Ga0157380_10001834 | Ga0157380_100018343 | 281 |
| 171 | 3300044693 | Ga0466961_0092149 | Ga0466961_0092149_815_1750 | 281 |
| 172 | 3300001990 | JGI24737J22298_10009546 | JGI24737J22298_100095462 | 282 |
| 173 | 3300005355 | Ga0070671_100000005 | Ga0070671_1000000052 | 282 |
| 174 | 3300025903 | Ga0207680_10049863 | Ga0207680_100498632 | 282 |
| 175 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008321 | 282 |
| 176 | 3300037471 | Ga0395905_0124451 | Ga0395905_0124451_1464_2393 | 282 |
| 177 | 3300048903 | Ga0496100_0026550 | Ga0496100_0026550_751_1683 | 282 |
| 178 | 3300048905 | Ga0496102_0053503 | Ga0496102_0053503_1166_2098 | 282 |
| 179 | 3300048907 | Ga0496104_0019331 | Ga0496104_0019331_1533_2465 | 282 |
| 180 | 3300048908 | Ga0496105_0055319 | Ga0496105_0055319_1593_2525 | 282 |
| 181 | 3300048910 | Ga0496107_0025054 | Ga0496107_0025054_2467_3399 | 282 |
| 182 | 3300048915 | Ga0496112_0061314 | Ga0496112_0061314_123_1055 | 282 |
| 183 | 3300048916 | Ga0496113_0002634 | Ga0496113_0002634_5497_6429 | 282 |
| 184 | 2162886007 | SwRhRL2b_contig_3660944 | SwRhRL2b_0919.00005060 | 283 |
| 185 | 3300001904 | JGI24736J21556_1000014 | JGI24736J21556_100001418 | 283 |
| 186 | 3300001989 | JGI24739J22299_10006093 | JGI24739J22299_100060933 | 283 |
| 187 | 3300002067 | JGI24735J21928_10009260 | JGI24735J21928_100092602 | 283 |
| 188 | 3300002075 | JGI24738J21930_10001186 | JGI24738J21930_100011867 | 283 |
| 189 | 3300005289 | Ga0065704_10070410 | Ga0065704_100704107 | 283 |
| 190 | 3300005327 | Ga0070658_10016748 | Ga0070658_100167484 | 283 |
| 191 | 3300005344 | Ga0070661_100029048 | Ga0070661_1000290482 | 283 |
| 192 | 3300005834 | Ga0068851_10070258 | Ga0068851_100702582 | 283 |
| 193 | 3300025321 | Ga0207656_10004486 | Ga0207656_100044864 | 283 |
| 194 | 3300025904 | Ga0207647_10000301 | Ga0207647_1000030130 | 283 |
| 195 | 3300025909 | Ga0207705_10066862 | Ga0207705_100668622 | 283 |
| 196 | 3300025911 | Ga0207654_10003282 | Ga0207654_100032826 | 283 |
| 197 | 3300025913 | Ga0207695_10002890 | Ga0207695_1000289029 | 283 |
| 198 | 3300025919 | Ga0207657_10026923 | Ga0207657_100269232 | 283 |
| 199 | 3300025924 | Ga0207694_10003304 | Ga0207694_100033049 | 283 |
| 200 | 3300025949 | Ga0207667_10000716 | Ga0207667_1000071628 | 283 |
| 201 | 3300025981 | Ga0207640_10186160 | Ga0207640_101861602 | 283 |
| 202 | 3300026067 | Ga0207678_10038375 | Ga0207678_100383752 | 283 |
| 203 | 3300026116 | Ga0207674_10249440 | Ga0207674_102494402 | 283 |
| 204 | 3300053134 | Ga0500658_0001207 | Ga0500658_0001207_3496_4425 | 283 |
| 205 | 3300001976 | JGI24752J21851_1000837 | JGI24752J21851_10008374 | 284 |
| 206 | 3300002459 | JGI24751J29686_10029286 | JGI24751J29686_100292861 | 284 |
| 207 | 3300005295 | Ga0065707_10098335 | Ga0065707_100983353 | 284 |
| 208 | 3300005331 | Ga0070670_100028850 | Ga0070670_1000288502 | 284 |
| 209 | 3300005335 | Ga0070666_10000089 | Ga0070666_1000008962 | 284 |
| 210 | 3300005347 | Ga0070668_100254258 | Ga0070668_1002542582 | 284 |
| 211 | 3300005353 | Ga0070669_100000024 | Ga0070669_100000024119 | 284 |
| 212 | 3300005355 | Ga0070671_100000006 | Ga0070671_100000006133 | 284 |
| 213 | 3300005367 | Ga0070667_100113539 | Ga0070667_1001135393 | 284 |
| 214 | 3300005440 | Ga0070705_100044993 | Ga0070705_1000449934 | 284 |
| 215 | 3300005445 | Ga0070708_100374285 | Ga0070708_1003742852 | 284 |
| 216 | 3300005539 | Ga0068853_100161664 | Ga0068853_1001616642 | 284 |
| 217 | 3300005617 | Ga0068859_100000256 | Ga0068859_1000002568 | 284 |
| 218 | 3300005719 | Ga0068861_100011417 | Ga0068861_1000114172 | 284 |
| 219 | 3300005841 | Ga0068863_100143232 | Ga0068863_1001432323 | 284 |
| 220 | 3300005842 | Ga0068858_100002936 | Ga0068858_1000029366 | 284 |
| 221 | 3300005843 | Ga0068860_100010895 | Ga0068860_1000108956 | 284 |
| 222 | 3300005844 | Ga0068862_100000310 | Ga0068862_1000003103 | 284 |
| 223 | 3300005844 | Ga0068862_100035470 | Ga0068862_1000354705 | 284 |
| 224 | 3300006931 | Ga0097620_100000256 | Ga0097620_1000002568 | 284 |
| 225 | 3300009101 | Ga0105247_10011571 | Ga0105247_100115713 | 284 |
| 226 | 3300009174 | Ga0105241_10195252 | Ga0105241_101952522 | 284 |
| 227 | 3300009545 | Ga0105237_10350075 | Ga0105237_103500752 | 284 |
| 228 | 3300009553 | Ga0105249_10021831 | Ga0105249_100218316 | 284 |
| 229 | 3300013104 | Ga0157370_10024341 | Ga0157370_100243412 | 284 |
| 230 | 3300013306 | Ga0163162_10021139 | Ga0163162_100211395 | 284 |
| 231 | 3300014325 | Ga0163163_10094269 | Ga0163163_100942693 | 284 |
| 232 | 3300017792 | Ga0163161_10204056 | Ga0163161_102040562 | 284 |
| 233 | 3300025315 | Ga0207697_10001058 | Ga0207697_100010589 | 284 |
| 234 | 3300025900 | Ga0207710_10003921 | Ga0207710_100039215 | 284 |
| 235 | 3300025903 | Ga0207680_10000298 | Ga0207680_1000029820 | 284 |
| 236 | 3300025914 | Ga0207671_10000592 | Ga0207671_1000059247 | 284 |
| 237 | 3300025923 | Ga0207681_10000004 | Ga0207681_10000004293 | 284 |
| 238 | 3300025931 | Ga0207644_10000009 | Ga0207644_10000009117 | 284 |
| 239 | 3300025941 | Ga0207711_10062216 | Ga0207711_100622163 | 284 |
| 240 | 3300025961 | Ga0207712_10014244 | Ga0207712_100142442 | 284 |
| 241 | 3300025972 | Ga0207668_10005504 | Ga0207668_100055045 | 284 |
| 242 | 3300025986 | Ga0207658_10012726 | Ga0207658_100127262 | 284 |
| 243 | 3300026035 | Ga0207703_10002484 | Ga0207703_1000248416 | 284 |
| 244 | 3300026078 | Ga0207702_10000727 | Ga0207702_1000072715 | 284 |
| 245 | 3300026088 | Ga0207641_10111036 | Ga0207641_101110364 | 284 |
| 246 | 3300026118 | Ga0207675_100005808 | Ga0207675_10000580810 | 284 |
| 247 | 3300026142 | Ga0207698_10012219 | Ga0207698_100122192 | 284 |
| 248 | 3300028380 | Ga0268265_10001374 | Ga0268265_1000137417 | 284 |
| 249 | 3300028381 | Ga0268264_10000069 | Ga0268264_10000069129 | 284 |
| 250 | 3300048905 | Ga0496102_0334039 | Ga0496102_0334039_54_983 | 284 |
| 251 | 3300005578 | Ga0068854_100009382 | Ga0068854_1000093823 | 285 |
| 252 | 3300009093 | Ga0105240_10000867 | Ga0105240_1000086738 | 285 |
| 253 | 3300009545 | Ga0105237_10000303 | Ga0105237_1000030354 | 285 |
| 254 | 3300009551 | Ga0105238_10231489 | Ga0105238_102314892 | 285 |
| 255 | 3300010375 | Ga0105239_10000151 | Ga0105239_1000015182 | 285 |
| 256 | 3300025913 | Ga0207695_10005103 | Ga0207695_1000510310 | 285 |
| 257 | 3300025914 | Ga0207671_10000881 | Ga0207671_1000088110 | 285 |
| 258 | 3300025924 | Ga0207694_10112161 | Ga0207694_101121612 | 285 |
| 259 | 3300025981 | Ga0207640_10001543 | Ga0207640_100015434 | 285 |
| 260 | 3300031456 | Ga0307513_10011435 | Ga0307513_100114353 | 285 |
| 261 | 3300053125 | Ga0500618_000842 | Ga0500618_000842_12011_12943 | 285 |
| 262 | 3300003215 | JGI25153J46596_10042831 | JGI25153J46596_100428311 | 286 |
| 263 | 3300003773 | Ga0055537_1003353 | Ga0055537_10033532 | 286 |
| 264 | 3300003775 | Ga0055524_1000489 | Ga0055524_10004897 | 286 |
| 265 | 3300005328 | Ga0070676_10064458 | Ga0070676_100644582 | 286 |
| 266 | 3300005331 | Ga0070670_100207902 | Ga0070670_1002079022 | 286 |
| 267 | 3300005618 | Ga0068864_100008948 | Ga0068864_1000089483 | 286 |
| 268 | 3300005841 | Ga0068863_100037797 | Ga0068863_1000377972 | 286 |
| 269 | 3300025263 | Ga0209565_1000029 | Ga0209565_1000029172 | 286 |
| 270 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008781 | 286 |
| 271 | 3300025907 | Ga0207645_10152287 | Ga0207645_101522872 | 286 |
| 272 | 3300025981 | Ga0207640_10119803 | Ga0207640_101198033 | 286 |
| 273 | 3300026088 | Ga0207641_10000500 | Ga0207641_1000050027 | 286 |
| 274 | 3300026095 | Ga0207676_10023166 | Ga0207676_100231663 | 286 |
| 275 | 3300053153 | Ga0500616_0019037 | Ga0500616_0019037_451_1383 | 286 |
| 276 | 3300009545 | Ga0105237_10017167 | Ga0105237_100171672 | 287 |
| 277 | 3300025914 | Ga0207671_10006341 | Ga0207671_100063416 | 287 |
| 278 | 3300032004 | Ga0307414_10047611 | Ga0307414_100476113 | 287 |
| 279 | 3300005841 | Ga0068863_100000576 | Ga0068863_10000057614 | 288 |
| 280 | 3300005843 | Ga0068860_100000812 | Ga0068860_1000008123 | 288 |
| 281 | 3300005844 | Ga0068862_100000014 | Ga0068862_100000014192 | 288 |
| 282 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002205 | 288 |
| 283 | 3300014326 | Ga0157380_10106046 | Ga0157380_101060463 | 288 |
| 284 | 3300017792 | Ga0163161_10001166 | Ga0163161_1000116611 | 288 |
| 285 | 3300020069 | Ga0197907_10074559 | Ga0197907_100745591 | 288 |
| 286 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002577 | 288 |
| 287 | 3300026088 | Ga0207641_10001788 | Ga0207641_1000178811 | 288 |
| 288 | 3300028380 | Ga0268265_10000048 | Ga0268265_1000004861 | 288 |
| 289 | 3300028381 | Ga0268264_10007424 | Ga0268264_100074242 | 288 |
| 290 | 3300046525 | Ga0495663_0009419 | Ga0495663_0009419_1286_2215 | 288 |
| 291 | 3300046537 | Ga0495598_0053394 | Ga0495598_0053394_83_1012 | 288 |
| 292 | 3300046539 | Ga0495621_0006066 | Ga0495621_0006066_1108_2037 | 288 |
| 293 | 3300049575 | Ga0501039_0062198 | Ga0501039_0062198_64_993 | 288 |
| 294 | 3300026041 | Ga0207639_10046271 | Ga0207639_100462711 | 289 |
| 295 | 3300031911 | Ga0307412_10174817 | Ga0307412_101748172 | 289 |
| 296 | 3300048920 | Ga0496117_0043201 | Ga0496117_0043201_2086_3018 | 289 |
| 297 | 3300048921 | Ga0496118_0010136 | Ga0496118_0010136_4231_5163 | 289 |
| 298 | 3300048924 | Ga0496121_0007335 | Ga0496121_0007335_958_1887 | 289 |
| 299 | 3300005347 | Ga0070668_100076241 | Ga0070668_1000762412 | 290 |
| 300 | 3300005355 | Ga0070671_100075885 | Ga0070671_1000758852 | 290 |
| 301 | 3300048907 | Ga0496104_0236157 | Ga0496104_0236157_607_1539 | 290 |
| 302 | 3300049571 | Ga0501034_0042628 | Ga0501034_0042628_2780_3709 | 290 |
| 303 | 3300049574 | Ga0501038_0121385 | Ga0501038_0121385_997_1926 | 290 |
| 304 | 3300049823 | Ga0501044_0261059 | Ga0501044_0261059_308_1237 | 290 |
| 305 | 3300001915 | JGI24741J21665_1002462 | JGI24741J21665_10024622 | 291 |
| 306 | 3300005834 | Ga0068851_10092143 | Ga0068851_100921432 | 291 |
| 307 | 3300009093 | Ga0105240_10001331 | Ga0105240_1000133142 | 291 |
| 308 | 3300010375 | Ga0105239_10000271 | Ga0105239_100002718 | 291 |
| 309 | 3300020082 | Ga0206353_10399482 | Ga0206353_103994822 | 291 |
| 310 | 3300025321 | Ga0207656_10020092 | Ga0207656_100200923 | 291 |
| 311 | 3300025913 | Ga0207695_10005114 | Ga0207695_1000511416 | 291 |
| 312 | 3300025919 | Ga0207657_10203639 | Ga0207657_102036391 | 291 |
| 313 | 3300025949 | Ga0207667_10000001 | Ga0207667_100000011006 | 291 |
| 314 | 3300025949 | Ga0207667_10056456 | Ga0207667_100564563 | 291 |
| 315 | 3300025981 | Ga0207640_10036511 | Ga0207640_100365113 | 291 |
| 316 | 3300025981 | Ga0207640_10069894 | Ga0207640_100698942 | 291 |
| 317 | 3300026041 | Ga0207639_10163844 | Ga0207639_101638442 | 291 |
| 318 | 3300026116 | Ga0207674_10276710 | Ga0207674_102767102 | 291 |
| 319 | 3300026142 | Ga0207698_10020890 | Ga0207698_100208903 | 291 |
| 320 | 3300048907 | Ga0496104_0060220 | Ga0496104_0060220_2517_3449 | 291 |
| 321 | 3300048908 | Ga0496105_0010549 | Ga0496105_0010549_6110_7042 | 291 |
| 322 | 3300048924 | Ga0496121_0000949 | Ga0496121_0000949_38613_39542 | 291 |
| 323 | 3300005327 | Ga0070658_10002437 | Ga0070658_100024373 | 292 |
| 324 | 3300005329 | Ga0070683_100501317 | Ga0070683_1005013171 | 292 |
| 325 | 3300005334 | Ga0068869_100096737 | Ga0068869_1000967372 | 292 |
| 326 | 3300005338 | Ga0068868_100179309 | Ga0068868_1001793092 | 292 |
| 327 | 3300005347 | Ga0070668_100176014 | Ga0070668_1001760142 | 292 |
| 328 | 3300005617 | Ga0068859_100009578 | Ga0068859_1000095782 | 292 |
| 329 | 3300005617 | Ga0068859_100114703 | Ga0068859_1001147032 | 292 |
| 330 | 3300005618 | Ga0068864_100007063 | Ga0068864_1000070633 | 292 |
| 331 | 3300005841 | Ga0068863_100001264 | Ga0068863_1000012646 | 292 |
| 332 | 3300005842 | Ga0068858_100005425 | Ga0068858_10000542513 | 292 |
| 333 | 3300005843 | Ga0068860_100032158 | Ga0068860_1000321583 | 292 |
| 334 | 3300005844 | Ga0068862_100267069 | Ga0068862_1002670692 | 292 |
| 335 | 3300006931 | Ga0097620_100009578 | Ga0097620_10000957811 | 292 |
| 336 | 3300006931 | Ga0097620_100114704 | Ga0097620_1001147042 | 292 |
| 337 | 3300009092 | Ga0105250_10005152 | Ga0105250_100051527 | 292 |
| 338 | 3300009101 | Ga0105247_10000692 | Ga0105247_1000069226 | 292 |
| 339 | 3300009101 | Ga0105247_10011543 | Ga0105247_100115432 | 292 |
| 340 | 3300009174 | Ga0105241_10008644 | Ga0105241_1000864410 | 292 |
| 341 | 3300009177 | Ga0105248_10002368 | Ga0105248_100023684 | 292 |
| 342 | 3300009545 | Ga0105237_10133456 | Ga0105237_101334561 | 292 |
| 343 | 3300013102 | Ga0157371_10000062 | Ga0157371_10000062175 | 292 |
| 344 | 3300013105 | Ga0157369_10238530 | Ga0157369_102385302 | 292 |
| 345 | 3300013306 | Ga0163162_10079336 | Ga0163162_100793363 | 292 |
| 346 | 3300014325 | Ga0163163_10000139 | Ga0163163_1000013976 | 292 |
| 347 | 3300014968 | Ga0157379_10038845 | Ga0157379_100388452 | 292 |
| 348 | 3300025900 | Ga0207710_10002210 | Ga0207710_100022106 | 292 |
| 349 | 3300025900 | Ga0207710_10006603 | Ga0207710_100066033 | 292 |
| 350 | 3300025909 | Ga0207705_10000103 | Ga0207705_1000010341 | 292 |
| 351 | 3300025911 | Ga0207654_10000150 | Ga0207654_1000015012 | 292 |
| 352 | 3300025914 | Ga0207671_10039482 | Ga0207671_100394823 | 292 |
| 353 | 3300025924 | Ga0207694_10050606 | Ga0207694_100506063 | 292 |
| 354 | 3300025941 | Ga0207711_10000673 | Ga0207711_1000067318 | 292 |
| 355 | 3300025942 | Ga0207689_10112111 | Ga0207689_101121113 | 292 |
| 356 | 3300025945 | Ga0207679_10398710 | Ga0207679_103987101 | 292 |
| 357 | 3300025960 | Ga0207651_10005055 | Ga0207651_100050558 | 292 |
| 358 | 3300025972 | Ga0207668_10032968 | Ga0207668_100329683 | 292 |
| 359 | 3300025986 | Ga0207658_10011407 | Ga0207658_100114075 | 292 |
| 360 | 3300026023 | Ga0207677_10140350 | Ga0207677_101403502 | 292 |
| 361 | 3300026035 | Ga0207703_10042797 | Ga0207703_100427974 | 292 |
| 362 | 3300026078 | Ga0207702_10043031 | Ga0207702_100430313 | 292 |
| 363 | 3300026088 | Ga0207641_10006496 | Ga0207641_100064966 | 292 |
| 364 | 3300026095 | Ga0207676_10001441 | Ga0207676_1000144118 | 292 |
| 365 | 3300028380 | Ga0268265_10103672 | Ga0268265_101036722 | 292 |
| 366 | 3300028381 | Ga0268264_10020235 | Ga0268264_100202355 | 292 |
| 367 | 3300031911 | Ga0307412_10025962 | Ga0307412_100259623 | 292 |
| 368 | 3300053177 | Ga0500636_0006756 | Ga0500636_0006756_5270_6202 | 292 |
| 369 | 3300005367 | Ga0070667_100000513 | Ga0070667_1000005132 | 293 |
| 370 | 3300005457 | Ga0070662_100145686 | Ga0070662_1001456862 | 293 |
| 371 | 3300005564 | Ga0070664_100219990 | Ga0070664_1002199902 | 293 |
| 372 | 3300025920 | Ga0207649_10002862 | Ga0207649_1000286210 | 293 |
| 373 | 3300025986 | Ga0207658_10006778 | Ga0207658_100067787 | 293 |
| 374 | 3300028381 | Ga0268264_10018778 | Ga0268264_100187782 | 293 |
| 375 | 3300031731 | Ga0307405_10383749 | Ga0307405_103837492 | 293 |
| 376 | 3300031852 | Ga0307410_10093005 | Ga0307410_100930052 | 293 |
| 377 | 3300048905 | Ga0496102_0000022 | Ga0496102_0000022_114155_115087 | 293 |
| 378 | 3300048906 | Ga0496103_0000167 | Ga0496103_0000167_67604_68536 | 293 |
| 379 | 3300048908 | Ga0496105_0000847 | Ga0496105_0000847_1136_2068 | 293 |
| 380 | 3300048917 | Ga0496114_0386218 | Ga0496114_0386218_253_1185 | 293 |
| 381 | 3300048918 | Ga0496115_0000029 | Ga0496115_0000029_72487_73419 | 293 |
| 382 | 3300048919 | Ga0496116_0083341 | Ga0496116_0083341_886_1818 | 293 |
| 383 | 3300048920 | Ga0496117_0000260 | Ga0496117_0000260_36873_37805 | 293 |
| 384 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_205049_205981 | 293 |
| 385 | 3300048924 | Ga0496121_0000683 | Ga0496121_0000683_61882_62817 | 293 |
| 386 | 3300048927 | Ga0496124_0000076 | Ga0496124_0000076_100387_101319 | 293 |
| 387 | 3300048929 | Ga0496126_0000469 | Ga0496126_0000469_67850_68782 | 293 |
| 388 | 3300049668 | Ga0501233_003600 | Ga0501233_003600_361_1290 | 293 |
| 389 | 3300005327 | Ga0070658_10003145 | Ga0070658_1000314516 | 294 |
| 390 | 3300005336 | Ga0070680_100048827 | Ga0070680_1000488273 | 294 |
| 391 | 3300005341 | Ga0070691_10042850 | Ga0070691_100428502 | 294 |
| 392 | 3300005457 | Ga0070662_100001553 | Ga0070662_1000015532 | 294 |
| 393 | 3300005458 | Ga0070681_10005511 | Ga0070681_1000551111 | 294 |
| 394 | 3300005530 | Ga0070679_100028853 | Ga0070679_1000288533 | 294 |
| 395 | 3300005563 | Ga0068855_100006774 | Ga0068855_10000677412 | 294 |
| 396 | 3300005563 | Ga0068855_100059685 | Ga0068855_1000596852 | 294 |
| 397 | 3300005616 | Ga0068852_100017160 | Ga0068852_1000171604 | 294 |
| 398 | 3300005618 | Ga0068864_100026684 | Ga0068864_1000266843 | 294 |
| 399 | 3300005841 | Ga0068863_100002638 | Ga0068863_1000026383 | 294 |
| 400 | 3300009093 | Ga0105240_10041737 | Ga0105240_100417373 | 294 |
| 401 | 3300009177 | Ga0105248_10393016 | Ga0105248_103930161 | 294 |
| 402 | 3300011119 | Ga0105246_10000160 | Ga0105246_1000016024 | 294 |
| 403 | 3300013100 | Ga0157373_10047838 | Ga0157373_100478383 | 294 |
| 404 | 3300025909 | Ga0207705_10010984 | Ga0207705_100109844 | 294 |
| 405 | 3300025912 | Ga0207707_10019058 | Ga0207707_100190582 | 294 |
| 406 | 3300025913 | Ga0207695_10142285 | Ga0207695_101422852 | 294 |
| 407 | 3300025917 | Ga0207660_10231439 | Ga0207660_102314392 | 294 |
| 408 | 3300025933 | Ga0207706_10006210 | Ga0207706_100062108 | 294 |
| 409 | 3300025945 | Ga0207679_10097854 | Ga0207679_100978541 | 294 |
| 410 | 3300025949 | Ga0207667_10001580 | Ga0207667_1000158017 | 294 |
| 411 | 3300025949 | Ga0207667_10034948 | Ga0207667_100349484 | 294 |
| 412 | 3300025972 | Ga0207668_10070549 | Ga0207668_100705492 | 294 |
| 413 | 3300025981 | Ga0207640_10381406 | Ga0207640_103814062 | 294 |
| 414 | 3300026041 | Ga0207639_10133388 | Ga0207639_101333881 | 294 |
| 415 | 3300026088 | Ga0207641_10000098 | Ga0207641_1000009823 | 294 |
| 416 | 3300026095 | Ga0207676_10008948 | Ga0207676_100089487 | 294 |
| 417 | 3300026116 | Ga0207674_10019862 | Ga0207674_100198624 | 294 |
| 418 | 3300027617 | Ga0210002_1011448 | Ga0210002_10114482 | 294 |
| 419 | 3300027665 | Ga0209983_1014737 | Ga0209983_10147372 | 294 |
| 420 | 3300046512 | Ga0495610_0035531 | Ga0495610_0035531_548_1483 | 294 |
| 421 | 3300046515 | Ga0495620_0000761 | Ga0495620_0000761_10594_11529 | 294 |
| 422 | 3300046520 | Ga0495637_0000085 | Ga0495637_0000085_17922_18851 | 294 |
| 423 | 3300046522 | Ga0495643_0000555 | Ga0495643_0000555_26025_26954 | 294 |
| 424 | 3300046558 | Ga0495633_0000847 | Ga0495633_0000847_20889_21818 | 294 |
| 425 | 3300046692 | Ga0495671_0000249 | Ga0495671_0000249_26025_26954 | 294 |
| 426 | 3300047470 | Ga0495681_0002495 | Ga0495681_0002495_3479_4408 | 294 |
| 427 | 3300053111 | Ga0500572_015101 | Ga0500572_015101_825_1754 | 294 |
| 428 | 3300001979 | JGI24740J21852_10015018 | JGI24740J21852_100150183 | 295 |
| 429 | 3300005289 | Ga0065704_10078581 | Ga0065704_100785812 | 295 |
| 430 | 3300005367 | Ga0070667_100013726 | Ga0070667_1000137264 | 295 |
| 431 | 3300005843 | Ga0068860_100118059 | Ga0068860_1001180593 | 295 |
| 432 | 3300009553 | Ga0105249_10000110 | Ga0105249_1000011040 | 295 |
| 433 | 3300013102 | Ga0157371_10021298 | Ga0157371_100212985 | 295 |
| 434 | 3300014968 | Ga0157379_10151323 | Ga0157379_101513231 | 295 |
| 435 | 3300025932 | Ga0207690_10015458 | Ga0207690_100154585 | 295 |
| 436 | 3300025961 | Ga0207712_10000311 | Ga0207712_1000031134 | 295 |
| 437 | 3300025986 | Ga0207658_10009773 | Ga0207658_100097733 | 295 |
| 438 | 3300026116 | Ga0207674_10200621 | Ga0207674_102006212 | 295 |
| 439 | 3300028381 | Ga0268264_10148564 | Ga0268264_101485642 | 295 |
| 440 | 3300031911 | Ga0307412_10000252 | Ga0307412_1000025222 | 295 |
| 441 | 3300031911 | Ga0307412_10030738 | Ga0307412_100307382 | 295 |
| 442 | 3300032004 | Ga0307414_10004530 | Ga0307414_100045302 | 295 |
| 443 | 3300044659 | Ga0466973_0087873 | Ga0466973_0087873_1531_2460 | 295 |
| 444 | 3300046453 | Ga0495627_000598 | Ga0495627_000598_1586_2515 | 295 |
| 445 | 3300046471 | Ga0495650_0012931 | Ga0495650_0012931_1598_2527 | 295 |
| 446 | 3300046500 | Ga0495596_0000016 | Ga0495596_0000016_77958_78887 | 295 |
| 447 | 3300046500 | Ga0495596_0000247 | Ga0495596_0000247_2119_3048 | 295 |
| 448 | 3300046506 | Ga0495583_0004192 | Ga0495583_0004192_6463_7392 | 295 |
| 449 | 3300046512 | Ga0495610_0052202 | Ga0495610_0052202_510_1439 | 295 |
| 450 | 3300046530 | Ga0495654_0068032 | Ga0495654_0068032_658_1587 | 295 |
| 451 | 3300046660 | Ga0495625_0012265 | Ga0495625_0012265_2012_2941 | 295 |
| 452 | 3300047470 | Ga0495681_0005245 | Ga0495681_0005245_1618_2547 | 295 |
| 453 | 3300048090 | Ga0495615_0000012 | Ga0495615_0000012_12441_13370 | 295 |
| 454 | 3300048922 | Ga0496119_0034760 | Ga0496119_0034760_2035_2925 | 295 |
| 455 | 3300049568 | Ga0501031_0216850 | Ga0501031_0216850_75_1004 | 295 |
| 456 | 3300049570 | Ga0501033_0059716 | Ga0501033_0059716_779_1708 | 295 |
| 457 | 3300049571 | Ga0501034_0407314 | Ga0501034_0407314_93_1028 | 295 |
| 458 | 3300049579 | Ga0501043_0063181 | Ga0501043_0063181_468_1397 | 295 |
| 459 | 3300049580 | Ga0501046_0088564 | Ga0501046_0088564_748_1677 | 295 |
| 460 | 3300049581 | Ga0501047_0000864 | Ga0501047_0000864_5719_6648 | 295 |
| 461 | 3300049581 | Ga0501047_0026935 | Ga0501047_0026935_1827_2756 | 295 |
| 462 | 3300049586 | Ga0501070_0314275 | Ga0501070_0314275_41_976 | 295 |
| 463 | 3300049822 | Ga0501035_0037003 | Ga0501035_0037003_2780_3709 | 295 |
| 464 | 3300049822 | Ga0501035_0116757 | Ga0501035_0116757_444_1373 | 295 |
| 465 | 3300049823 | Ga0501044_0070436 | Ga0501044_0070436_885_1814 | 295 |
| 466 | 3300053087 | Ga0500643_003982 | Ga0500643_003982_2434_3366 | 295 |
| 467 | 3300001976 | JGI24752J21851_1000099 | JGI24752J21851_10000995 | 296 |
| 468 | 3300005327 | Ga0070658_10004725 | Ga0070658_100047256 | 296 |
| 469 | 3300005331 | Ga0070670_100000027 | Ga0070670_10000002726 | 296 |
| 470 | 3300005354 | Ga0070675_100068100 | Ga0070675_1000681002 | 296 |
| 471 | 3300005367 | Ga0070667_100000315 | Ga0070667_10000031513 | 296 |
| 472 | 3300005530 | Ga0070679_100132969 | Ga0070679_1001329694 | 296 |
| 473 | 3300005617 | Ga0068859_100018998 | Ga0068859_1000189983 | 296 |
| 474 | 3300005618 | Ga0068864_100000100 | Ga0068864_10000010077 | 296 |
| 475 | 3300005841 | Ga0068863_100000025 | Ga0068863_100000025187 | 296 |
| 476 | 3300005844 | Ga0068862_100000027 | Ga0068862_10000002726 | 296 |
| 477 | 3300006931 | Ga0097620_100018998 | Ga0097620_1000189986 | 296 |
| 478 | 3300009011 | Ga0105251_10000159 | Ga0105251_1000015953 | 296 |
| 479 | 3300009101 | Ga0105247_10005638 | Ga0105247_100056383 | 296 |
| 480 | 3300009147 | Ga0114129_10407027 | Ga0114129_104070272 | 296 |
| 481 | 3300009177 | Ga0105248_10000026 | Ga0105248_10000026202 | 296 |
| 482 | 3300021384 | Ga0213876_10162713 | Ga0213876_101627131 | 296 |
| 483 | 3300025253 | Ga0209677_107269 | Ga0209677_1072692 | 296 |
| 484 | 3300025735 | Ga0207713_1000491 | Ga0207713_10004916 | 296 |
| 485 | 3300025900 | Ga0207710_10011439 | Ga0207710_100114393 | 296 |
| 486 | 3300025909 | Ga0207705_10000046 | Ga0207705_1000004636 | 296 |
| 487 | 3300025925 | Ga0207650_10000243 | Ga0207650_1000024348 | 296 |
| 488 | 3300025938 | Ga0207704_10193535 | Ga0207704_101935352 | 296 |
| 489 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004217 | 296 |
| 490 | 3300025986 | Ga0207658_10000287 | Ga0207658_100002873 | 296 |
| 491 | 3300026088 | Ga0207641_10000018 | Ga0207641_10000018137 | 296 |
| 492 | 3300026095 | Ga0207676_10000027 | Ga0207676_1000002782 | 296 |
| 493 | 3300028380 | Ga0268265_10000042 | Ga0268265_1000004224 | 296 |
| 494 | 3300039437 | Ga0436365_1821495 | Ga0436365_1821495_664_1593 | 296 |
| 495 | 3300039447 | Ga0436361_1020396 | Ga0436361_1020396_418_1347 | 296 |
| 496 | 3300048904 | Ga0496101_0123697 | Ga0496101_0123697_672_1601 | 296 |
| 497 | 3300048920 | Ga0496117_0007303 | Ga0496117_0007303_7694_8623 | 296 |
| 498 | 3300048921 | Ga0496118_0000689 | Ga0496118_0000689_13912_14841 | 296 |
| 499 | 3300048924 | Ga0496121_0056386 | Ga0496121_0056386_2149_3078 | 296 |
| 500 | 3300049705 | Ga0501225_0010631 | Ga0501225_0010631_254_1183 | 296 |
| 501 | 3300049777 | Ga0501281_03626 | Ga0501281_03626_13_942 | 296 |
| 502 | 3300003794 | Ga0055531_10011843 | Ga0055531_100118434 | 297 |
| 503 | 3300031824 | Ga0307413_10141680 | Ga0307413_101416801 | 297 |
| 504 | 3300031852 | Ga0307410_10092179 | Ga0307410_100921792 | 297 |
| 505 | 3300031901 | Ga0307406_10288367 | Ga0307406_102883672 | 297 |
| 506 | 3300031995 | Ga0307409_100165435 | Ga0307409_1001654353 | 297 |
| 507 | 3300032002 | Ga0307416_100275533 | Ga0307416_1002755332 | 297 |
| 508 | 3300032005 | Ga0307411_10038405 | Ga0307411_100384052 | 297 |
| 509 | 3300044842 | Ga0466957_0010185 | Ga0466957_0010185_1784_2713 | 297 |
| 510 | 3300045976 | Ga0466967_0033536 | Ga0466967_0033536_1534_2463 | 297 |
| 511 | 3300053108 | Ga0500562_048154 | Ga0500562_048154_40_969 | 297 |
| 512 | 3300005539 | Ga0068853_100000490 | Ga0068853_10000049020 | 298 |
| 513 | 3300005577 | Ga0068857_100003398 | Ga0068857_1000033983 | 298 |
| 514 | 3300005614 | Ga0068856_100287513 | Ga0068856_1002875132 | 298 |
| 515 | 3300005834 | Ga0068851_10003428 | Ga0068851_100034284 | 298 |
| 516 | 3300009551 | Ga0105238_10075403 | Ga0105238_100754034 | 298 |
| 517 | 3300025321 | Ga0207656_10020017 | Ga0207656_100200173 | 298 |
| 518 | 3300026041 | Ga0207639_10015767 | Ga0207639_100157674 | 298 |
| 519 | 3300026078 | Ga0207702_10340022 | Ga0207702_103400222 | 298 |
| 520 | 3300026116 | Ga0207674_10001869 | Ga0207674_100018696 | 298 |
| 521 | 3300026118 | Ga0207675_100106354 | Ga0207675_1001063543 | 298 |
| 522 | 3300046530 | Ga0495654_0095026 | Ga0495654_0095026_336_1265 | 298 |
| 523 | 3300046660 | Ga0495625_0001219 | Ga0495625_0001219_31581_32510 | 298 |
| 524 | 3300046809 | Ga0495600_0009002 | Ga0495600_0009002_632_1564 | 298 |
| 525 | 3300048912 | Ga0496109_0399177 | Ga0496109_0399177_244_1143 | 298 |
| 526 | 3300053104 | Ga0500556_0054774 | Ga0500556_0054774_503_1432 | 298 |
| 527 | 3300053158 | Ga0500627_0028673 | Ga0500627_0028673_148_1077 | 298 |
| 528 | 3300002774 | JGI25150J39212_1000067 | JGI25150J39212_100006741 | 299 |
| 529 | 3300003215 | JGI25153J46596_10000073 | JGI25153J46596_1000007326 | 299 |
| 530 | 3300005347 | Ga0070668_100353942 | Ga0070668_1003539422 | 299 |
| 531 | 3300005844 | Ga0068862_100051191 | Ga0068862_1000511913 | 299 |
| 532 | 3300009553 | Ga0105249_10000061 | Ga0105249_1000006136 | 299 |
| 533 | 3300014969 | Ga0157376_10290716 | Ga0157376_102907161 | 299 |
| 534 | 3300015690 | Ga0183363_1003 | Ga0183363_1003151 | 299 |
| 535 | 3300021384 | Ga0213876_10189706 | Ga0213876_101897061 | 299 |
| 536 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005797 | 299 |
| 537 | 3300025258 | Ga0209129_1001349 | Ga0209129_10013494 | 299 |
| 538 | 3300025294 | Ga0209025_1000477 | Ga0209025_100047782 | 299 |
| 539 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002548 | 299 |
| 540 | 3300025961 | Ga0207712_10000144 | Ga0207712_1000014450 | 299 |
| 541 | 3300025986 | Ga0207658_10097040 | Ga0207658_100970402 | 299 |
| 542 | 3300028380 | Ga0268265_10023250 | Ga0268265_100232503 | 299 |
| 543 | 3300028573 | Ga0265334_10056604 | Ga0265334_100566042 | 299 |
| 544 | 3300039437 | Ga0436365_1385090 | Ga0436365_1385090_28_957 | 299 |
| 545 | 3300046616 | Ga0495668_0209515 | Ga0495668_0209515_17_946 | 299 |
| 546 | 3300048919 | Ga0496116_0192978 | Ga0496116_0192978_22_984 | 299 |
| 547 | 3300005548 | Ga0070665_100174748 | Ga0070665_1001747482 | 300 |
| 548 | 3300025938 | Ga0207704_10072732 | Ga0207704_100727321 | 300 |
| 549 | 3300028379 | Ga0268266_10330615 | Ga0268266_103306152 | 300 |
| 550 | 3300031995 | Ga0307409_100416179 | Ga0307409_1004161792 | 300 |
| 551 | 3300032004 | Ga0307414_10240795 | Ga0307414_102407952 | 300 |
| 552 | 3300046558 | Ga0495633_0081824 | Ga0495633_0081824_520_1449 | 300 |
| 553 | 3300046616 | Ga0495668_0019846 | Ga0495668_0019846_272_1201 | 300 |
| 554 | 3300053116 | Ga0500592_012209 | Ga0500592_012209_119_1048 | 300 |
| 555 | 3300053157 | Ga0500624_000007 | Ga0500624_000007_153030_153959 | 300 |
| 556 | 3300005331 | Ga0070670_100056786 | Ga0070670_1000567863 | 301 |
| 557 | 3300005347 | Ga0070668_100001726 | Ga0070668_10000172610 | 301 |
| 558 | 3300005347 | Ga0070668_100059003 | Ga0070668_1000590033 | 301 |
| 559 | 3300005353 | Ga0070669_100000646 | Ga0070669_10000064613 | 301 |
| 560 | 3300005548 | Ga0070665_100000079 | Ga0070665_10000007963 | 301 |
| 561 | 3300009011 | Ga0105251_10000232 | Ga0105251_100002323 | 301 |
| 562 | 3300009101 | Ga0105247_10036943 | Ga0105247_100369432 | 301 |
| 563 | 3300025735 | Ga0207713_1001216 | Ga0207713_10012164 | 301 |
| 564 | 3300025923 | Ga0207681_10000274 | Ga0207681_1000027413 | 301 |
| 565 | 3300025972 | Ga0207668_10006180 | Ga0207668_100061802 | 301 |
| 566 | 3300025972 | Ga0207668_10046230 | Ga0207668_100462303 | 301 |
| 567 | 3300028379 | Ga0268266_10000175 | Ga0268266_1000017594 | 301 |
| 568 | 3300028380 | Ga0268265_10081867 | Ga0268265_100818673 | 301 |
| 569 | 3300031548 | Ga0307408_100011407 | Ga0307408_1000114074 | 301 |
| 570 | 3300031731 | Ga0307405_10013215 | Ga0307405_100132152 | 301 |
| 571 | 3300031824 | Ga0307413_10026545 | Ga0307413_100265454 | 301 |
| 572 | 3300031824 | Ga0307413_10057655 | Ga0307413_100576553 | 301 |
| 573 | 3300031824 | Ga0307413_10148402 | Ga0307413_101484022 | 301 |
| 574 | 3300031901 | Ga0307406_10025473 | Ga0307406_100254732 | 301 |
| 575 | 3300031903 | Ga0307407_10035819 | Ga0307407_100358192 | 301 |
| 576 | 3300031911 | Ga0307412_10007524 | Ga0307412_100075245 | 301 |
| 577 | 3300032002 | Ga0307416_100020872 | Ga0307416_1000208723 | 301 |
| 578 | 3300032005 | Ga0307411_10010490 | Ga0307411_100104904 | 301 |
| 579 | 3300032005 | Ga0307411_10064838 | Ga0307411_100648384 | 301 |
| 580 | 3300032126 | Ga0307415_100007852 | Ga0307415_1000078524 | 301 |
| 581 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_536493_537422 | 301 |
| 582 | 3300046684 | Ga0495669_0025550 | Ga0495669_0025550_1199_2128 | 301 |
| 583 | 3300049573 | Ga0501037_0247914 | Ga0501037_0247914_59_994 | 301 |
| 584 | 3300049581 | Ga0501047_0073181 | Ga0501047_0073181_943_1878 | 301 |
| 585 | iso_pu_bacteria | 2510065045 | 2510247472 | 301 |
| 586 | iso_pu_bacteria | 2643221605 | 2644040732 | 301 |
| 587 | iso_pu_bacteria | 2718217991 | 2719638352 | 301 |
| 588 | iso_pu_bacteria | 8055266321 | 8055267709 | 301 |
| 589 | iso_pu_bacteria | 8055301274 | 8055308914 | 301 |
| 590 | 3300001904 | JGI24736J21556_1000001 | JGI24736J21556_100000122 | 302 |
| 591 | 3300001979 | JGI24740J21852_10015278 | JGI24740J21852_100152782 | 302 |
| 592 | 3300001989 | JGI24739J22299_10013801 | JGI24739J22299_100138013 | 302 |
| 593 | 3300001990 | JGI24737J22298_10021087 | JGI24737J22298_100210872 | 302 |
| 594 | 3300002075 | JGI24738J21930_10004607 | JGI24738J21930_100046074 | 302 |
| 595 | 3300005339 | Ga0070660_100005671 | Ga0070660_1000056715 | 302 |
| 596 | 3300005344 | Ga0070661_100065746 | Ga0070661_1000657461 | 302 |
| 597 | 3300005457 | Ga0070662_100101972 | Ga0070662_1001019723 | 302 |
| 598 | 3300005539 | Ga0068853_100154611 | Ga0068853_1001546112 | 302 |
| 599 | 3300005563 | Ga0068855_100179588 | Ga0068855_1001795883 | 302 |
| 600 | 3300005564 | Ga0070664_100102469 | Ga0070664_1001024691 | 302 |
| 601 | 3300005577 | Ga0068857_100234602 | Ga0068857_1002346021 | 302 |
| 602 | 3300005578 | Ga0068854_100034186 | Ga0068854_1000341862 | 302 |
| 603 | 3300005617 | Ga0068859_100000442 | Ga0068859_10000044228 | 302 |
| 604 | 3300005834 | Ga0068851_10024392 | Ga0068851_100243921 | 302 |
| 605 | 3300006058 | Ga0075432_10055756 | Ga0075432_100557562 | 302 |
| 606 | 3300006931 | Ga0097620_100000442 | Ga0097620_10000044211 | 302 |
| 607 | 3300009174 | Ga0105241_10209539 | Ga0105241_102095391 | 302 |
| 608 | 3300009177 | Ga0105248_10000785 | Ga0105248_1000078532 | 302 |
| 609 | 3300009545 | Ga0105237_10085934 | Ga0105237_100859341 | 302 |
| 610 | 3300013105 | Ga0157369_10058845 | Ga0157369_100588453 | 302 |
| 611 | 3300021358 | Ga0213873_10000016 | Ga0213873_10000016104 | 302 |
| 612 | 3300021384 | Ga0213876_10000056 | Ga0213876_1000005634 | 302 |
| 613 | 3300025904 | Ga0207647_10000701 | Ga0207647_1000070116 | 302 |
| 614 | 3300025911 | Ga0207654_10000836 | Ga0207654_1000083613 | 302 |
| 615 | 3300025913 | Ga0207695_10012367 | Ga0207695_100123676 | 302 |
| 616 | 3300025914 | Ga0207671_10002796 | Ga0207671_1000279612 | 302 |
| 617 | 3300025919 | Ga0207657_10054674 | Ga0207657_100546742 | 302 |
| 618 | 3300025920 | Ga0207649_10168566 | Ga0207649_101685662 | 302 |
| 619 | 3300025924 | Ga0207694_10001416 | Ga0207694_100014164 | 302 |
| 620 | 3300025924 | Ga0207694_10101530 | Ga0207694_101015301 | 302 |
| 621 | 3300025933 | Ga0207706_10124921 | Ga0207706_101249213 | 302 |
| 622 | 3300025941 | Ga0207711_10000571 | Ga0207711_1000057131 | 302 |
| 623 | 3300025949 | Ga0207667_10004218 | Ga0207667_1000421812 | 302 |
| 624 | 3300025949 | Ga0207667_10161957 | Ga0207667_101619573 | 302 |
| 625 | 3300025981 | Ga0207640_10056542 | Ga0207640_100565421 | 302 |
| 626 | 3300026041 | Ga0207639_10239306 | Ga0207639_102393062 | 302 |
| 627 | 3300026078 | Ga0207702_10001637 | Ga0207702_1000163716 | 302 |
| 628 | 3300026142 | Ga0207698_10040422 | Ga0207698_100404221 | 302 |
| 629 | 3300027907 | Ga0207428_10054976 | Ga0207428_100549762 | 302 |
| 630 | 3300039437 | Ga0436365_0594533 | Ga0436365_0594533_2592_3521 | 302 |
| 631 | 3300039453 | Ga0436362_0580304 | Ga0436362_0580304_89626_90555 | 302 |
| 632 | 3300013297 | Ga0157378_10045278 | Ga0157378_100452783 | 303 |
| 633 | 3300031911 | Ga0307412_10139622 | Ga0307412_101396222 | 303 |
| 634 | 3300031995 | Ga0307409_100016478 | Ga0307409_1000164784 | 303 |
| 635 | 3300046525 | Ga0495663_0054255 | Ga0495663_0054255_248_1162 | 303 |
| 636 | 3300005289 | Ga0065704_10085713 | Ga0065704_100857135 | 304 |
| 637 | iso_pu_bacteria | 2510917021 | 2511127331 | 304 |
| 638 | iso_pu_bacteria | 2599185359 | 2600227006 | 304 |
| 639 | iso_pu_bacteria | 2643221563 | 2643836460 | 304 |
| 640 | iso_pu_bacteria | 2643221608 | 2644052936 | 304 |
| 641 | iso_pu_bacteria | 2643221622 | 2644127396 | 304 |
| 642 | iso_pu_bacteria | 2739367865 | 2740029703 | 304 |
| 643 | iso_pu_bacteria | 2808606401 | 2809064000 | 304 |
| 644 | iso_pu_bacteria | 2808606404 | 2809079968 | 304 |
| 645 | iso_pu_bacteria | 2808606405 | 2809084333 | 304 |
| 646 | iso_pu_bacteria | 2818991466 | 2819715542 | 304 |
| 647 | iso_pu_bacteria | 2879163058 | 2879163445 | 304 |
| 648 | iso_pu_bacteria | 2880518877 | 2880522859 | 304 |
| 649 | iso_pu_bacteria | 2882806704 | 2882809363 | 304 |
| 650 | iso_pu_bacteria | 2895880812 | 2895881152 | 304 |
| 651 | iso_pu_bacteria | 2928027323 | 2928029032 | 304 |
| 652 | iso_pu_bacteria | 2928027323 | 2928029388 | 304 |
| 653 | iso_pu_bacteria | 2928526807 | 2928529561 | 304 |
| 654 | iso_pu_bacteria | 2928968154 | 2928970951 | 304 |
| 655 | iso_pu_bacteria | 2984555340 | 2984556585 | 304 |
| 656 | iso_pu_bacteria | 2984555340 | 2984557733 | 304 |
| 657 | iso_pu_bacteria | 2984564862 | 2984565244 | 304 |
| 658 | iso_pu_bacteria | 2984564862 | 2984567900 | 304 |
| 659 | iso_pu_bacteria | 2990265787 | 2990268239 | 304 |
| 660 | iso_pu_bacteria | 2993356040 | 2993356318 | 304 |
| 661 | iso_pu_bacteria | 2993356040 | 2993358949 | 304 |
| 662 | iso_pu_bacteria | 2993693658 | 2993696729 | 304 |
| 663 | iso_pu_bacteria | 8055266321 | 8055267755 | 304 |
| 664 | 3300044684 | Ga0466966_0005296 | Ga0466966_0005296_3966_4904 | 305 |
| 665 | 3300045049 | Ga0466959_0006808 | Ga0466959_0006808_3185_4123 | 305 |
| 666 | 3300046472 | Ga0495580_0002459 | Ga0495580_0002459_12638_13579 | 305 |
| 667 | iso_pu_bacteria | 2513237166 | 2514052433 | 305 |
| 668 | iso_pu_bacteria | 2600255067 | 2600810049 | 305 |
| 669 | iso_pu_bacteria | 2643221560 | 2643820613 | 305 |
| 670 | iso_pu_bacteria | 2738541275 | 2738712994 | 305 |
| 671 | iso_pu_bacteria | 2738541301 | 2738851418 | 305 |
| 672 | iso_pu_bacteria | 2738541304 | 2738867148 | 305 |
| 673 | iso_pu_bacteria | 2738543022 | 2739299665 | 305 |
| 674 | iso_pu_bacteria | 2738543033 | 2739361344 | 305 |
| 675 | iso_pu_bacteria | 2904615490 | 2904621995 | 305 |
| 676 | iso_pu_bacteria | 2928100450 | 2928100854 | 305 |
| 677 | iso_pu_bacteria | 2928100450 | 2928104484 | 305 |
| 678 | iso_pu_bacteria | 2928100450 | 2928104760 | 305 |
| 679 | iso_pu_bacteria | 2928959182 | 2928960919 | 305 |
| 680 | iso_pu_bacteria | 2928959182 | 2928963052 | 305 |
| 681 | 3300005329 | Ga0070683_100226595 | Ga0070683_1002265952 | 307 |
| 682 | 3300005340 | Ga0070689_100037387 | Ga0070689_1000373872 | 307 |
| 683 | 3300005367 | Ga0070667_100165074 | Ga0070667_1001650742 | 307 |
| 684 | 3300006195 | Ga0075366_10086130 | Ga0075366_100861302 | 307 |
| 685 | 3300025908 | Ga0207643_10139735 | Ga0207643_101397351 | 307 |
| 686 | 3300025961 | Ga0207712_10298350 | Ga0207712_102983502 | 307 |
| 687 | 3300025986 | Ga0207658_10012640 | Ga0207658_100126402 | 307 |
| 688 | 3300028381 | Ga0268264_10027689 | Ga0268264_100276894 | 307 |
| 689 | 3300050493 | nmdc:mga0k408_90392_c1 | nmdc:mga0k408_90392_c1_326_1258 | 307 |
| 690 | 3300001989 | JGI24739J22299_10001158 | JGI24739J22299_100011588 | 308 |
| 691 | 3300001990 | JGI24737J22298_10013918 | JGI24737J22298_100139183 | 308 |
| 692 | 3300001990 | JGI24737J22298_10035213 | JGI24737J22298_100352132 | 308 |
| 693 | 3300002067 | JGI24735J21928_10001152 | JGI24735J21928_100011524 | 308 |
| 694 | 3300002076 | JGI24749J21850_1000250 | JGI24749J21850_10002506 | 308 |
| 695 | 3300002239 | JGI24034J26672_10001749 | JGI24034J26672_100017492 | 308 |
| 696 | 3300003771 | Ga0055526_1002635 | Ga0055526_100263513 | 308 |
| 697 | 3300003773 | Ga0055537_1000855 | Ga0055537_10008559 | 308 |
| 698 | 3300003781 | Ga0055536_1009244 | Ga0055536_10092443 | 308 |
| 699 | 3300003791 | Ga0055530_10000915 | Ga0055530_1000091511 | 308 |
| 700 | 3300003791 | Ga0055530_10007450 | Ga0055530_100074506 | 308 |
| 701 | 3300003792 | Ga0055540_1001979 | Ga0055540_10019797 | 308 |
| 702 | 3300003794 | Ga0055531_10001375 | Ga0055531_1000137518 | 308 |
| 703 | 3300003794 | Ga0055531_10010680 | Ga0055531_100106801 | 308 |
| 704 | 3300003794 | Ga0055531_10010691 | Ga0055531_100106911 | 308 |
| 705 | 3300005289 | Ga0065704_10080202 | Ga0065704_100802023 | 308 |
| 706 | 3300005293 | Ga0065715_10000525 | Ga0065715_1000052511 | 308 |
| 707 | 3300005327 | Ga0070658_10503319 | Ga0070658_105033191 | 308 |
| 708 | 3300005328 | Ga0070676_10051976 | Ga0070676_100519762 | 308 |
| 709 | 3300005330 | Ga0070690_100151851 | Ga0070690_1001518512 | 308 |
| 710 | 3300005331 | Ga0070670_100001338 | Ga0070670_1000013385 | 308 |
| 711 | 3300005331 | Ga0070670_100002350 | Ga0070670_10000235014 | 308 |
| 712 | 3300005331 | Ga0070670_100094261 | Ga0070670_1000942612 | 308 |
| 713 | 3300005333 | Ga0070677_10006520 | Ga0070677_100065203 | 308 |
| 714 | 3300005339 | Ga0070660_100021489 | Ga0070660_1000214895 | 308 |
| 715 | 3300005347 | Ga0070668_100000009 | Ga0070668_10000000946 | 308 |
| 716 | 3300005347 | Ga0070668_100007239 | Ga0070668_1000072397 | 308 |
| 717 | 3300005347 | Ga0070668_100019447 | Ga0070668_1000194473 | 308 |
| 718 | 3300005353 | Ga0070669_100001807 | Ga0070669_1000018076 | 308 |
| 719 | 3300005354 | Ga0070675_100018279 | Ga0070675_1000182795 | 308 |
| 720 | 3300005355 | Ga0070671_100000098 | Ga0070671_10000009840 | 308 |
| 721 | 3300005355 | Ga0070671_100000864 | Ga0070671_1000008644 | 308 |
| 722 | 3300005355 | Ga0070671_100007364 | Ga0070671_1000073642 | 308 |
| 723 | 3300005356 | Ga0070674_100010715 | Ga0070674_1000107153 | 308 |
| 724 | 3300005364 | Ga0070673_100015714 | Ga0070673_1000157143 | 308 |
| 725 | 3300005367 | Ga0070667_100009388 | Ga0070667_1000093884 | 308 |
| 726 | 3300005367 | Ga0070667_100114296 | Ga0070667_1001142962 | 308 |
| 727 | 3300005441 | Ga0070700_100094271 | Ga0070700_1000942712 | 308 |
| 728 | 3300005457 | Ga0070662_100000631 | Ga0070662_1000006319 | 308 |
| 729 | 3300005457 | Ga0070662_100090723 | Ga0070662_1000907231 | 308 |
| 730 | 3300005457 | Ga0070662_100161588 | Ga0070662_1001615881 | 308 |
| 731 | 3300005459 | Ga0068867_100014480 | Ga0068867_1000144805 | 308 |
| 732 | 3300005530 | Ga0070679_100028399 | Ga0070679_1000283992 | 308 |
| 733 | 3300005543 | Ga0070672_100002940 | Ga0070672_1000029402 | 308 |
| 734 | 3300005548 | Ga0070665_100053373 | Ga0070665_1000533735 | 308 |
| 735 | 3300005564 | Ga0070664_100066229 | Ga0070664_1000662292 | 308 |
| 736 | 3300005564 | Ga0070664_100224747 | Ga0070664_1002247472 | 308 |
| 737 | 3300005577 | Ga0068857_100036094 | Ga0068857_1000360944 | 308 |
| 738 | 3300005577 | Ga0068857_100507083 | Ga0068857_1005070832 | 308 |
| 739 | 3300005577 | Ga0068857_100523620 | Ga0068857_1005236202 | 308 |
| 740 | 3300005578 | Ga0068854_100037446 | Ga0068854_1000374464 | 308 |
| 741 | 3300005578 | Ga0068854_100232983 | Ga0068854_1002329831 | 308 |
| 742 | 3300005616 | Ga0068852_100286571 | Ga0068852_1002865711 | 308 |
| 743 | 3300005617 | Ga0068859_100010242 | Ga0068859_1000102424 | 308 |
| 744 | 3300005617 | Ga0068859_100015774 | Ga0068859_1000157742 | 308 |
| 745 | 3300005617 | Ga0068859_100029609 | Ga0068859_1000296095 | 308 |
| 746 | 3300005719 | Ga0068861_100000063 | Ga0068861_10000006324 | 308 |
| 747 | 3300005719 | Ga0068861_100001909 | Ga0068861_1000019097 | 308 |
| 748 | 3300005840 | Ga0068870_10013846 | Ga0068870_100138462 | 308 |
| 749 | 3300005841 | Ga0068863_100000040 | Ga0068863_10000004046 | 308 |
| 750 | 3300005841 | Ga0068863_100006668 | Ga0068863_1000066686 | 308 |
| 751 | 3300005842 | Ga0068858_100028254 | Ga0068858_1000282543 | 308 |
| 752 | 3300005843 | Ga0068860_100010214 | Ga0068860_1000102143 | 308 |
| 753 | 3300005843 | Ga0068860_100030395 | Ga0068860_1000303953 | 308 |
| 754 | 3300005844 | Ga0068862_100021652 | Ga0068862_1000216522 | 308 |
| 755 | 3300005844 | Ga0068862_100156221 | Ga0068862_1001562212 | 308 |
| 756 | 3300005937 | Ga0081455_10143107 | Ga0081455_101431072 | 308 |
| 757 | 3300005985 | Ga0081539_10041438 | Ga0081539_100414383 | 308 |
| 758 | 3300005985 | Ga0081539_10063347 | Ga0081539_100633472 | 308 |
| 759 | 3300006051 | Ga0075364_10020342 | Ga0075364_100203424 | 308 |
| 760 | 3300006353 | Ga0075370_10060482 | Ga0075370_100604822 | 308 |
| 761 | 3300006844 | Ga0075428_100191014 | Ga0075428_1001910143 | 308 |
| 762 | 3300006881 | Ga0068865_100154166 | Ga0068865_1001541662 | 308 |
| 763 | 3300006931 | Ga0097620_100010242 | Ga0097620_1000102424 | 308 |
| 764 | 3300006931 | Ga0097620_100015774 | Ga0097620_1000157747 | 308 |
| 765 | 3300006931 | Ga0097620_100029609 | Ga0097620_1000296092 | 308 |
| 766 | 3300009093 | Ga0105240_10069217 | Ga0105240_100692174 | 308 |
| 767 | 3300009093 | Ga0105240_10164425 | Ga0105240_101644253 | 308 |
| 768 | 3300009093 | Ga0105240_10244333 | Ga0105240_102443332 | 308 |
| 769 | 3300009093 | Ga0105240_10484320 | Ga0105240_104843201 | 308 |
| 770 | 3300009148 | Ga0105243_10042605 | Ga0105243_100426052 | 308 |
| 771 | 3300009174 | Ga0105241_10086848 | Ga0105241_100868483 | 308 |
| 772 | 3300009177 | Ga0105248_10001383 | Ga0105248_1000138314 | 308 |
| 773 | 3300009177 | Ga0105248_10008545 | Ga0105248_100085453 | 308 |
| 774 | 3300009177 | Ga0105248_10138668 | Ga0105248_101386682 | 308 |
| 775 | 3300009545 | Ga0105237_10023330 | Ga0105237_100233307 | 308 |
| 776 | 3300009551 | Ga0105238_10059364 | Ga0105238_100593644 | 308 |
| 777 | 3300009553 | Ga0105249_10064119 | Ga0105249_100641193 | 308 |
| 778 | 3300009553 | Ga0105249_10069928 | Ga0105249_100699283 | 308 |
| 779 | 3300010375 | Ga0105239_10180266 | Ga0105239_101802662 | 308 |
| 780 | 3300013104 | Ga0157370_10207164 | Ga0157370_102071642 | 308 |
| 781 | 3300013105 | Ga0157369_10076259 | Ga0157369_100762592 | 308 |
| 782 | 3300013306 | Ga0163162_10298481 | Ga0163162_102984812 | 308 |
| 783 | 3300013307 | Ga0157372_10501534 | Ga0157372_105015341 | 308 |
| 784 | 3300013307 | Ga0157372_10579879 | Ga0157372_105798792 | 308 |
| 785 | 3300013308 | Ga0157375_10089002 | Ga0157375_100890022 | 308 |
| 786 | 3300014325 | Ga0163163_10086154 | Ga0163163_100861543 | 308 |
| 787 | 3300014326 | Ga0157380_10020143 | Ga0157380_100201433 | 308 |
| 788 | 3300014326 | Ga0157380_10374770 | Ga0157380_103747702 | 308 |
| 789 | 3300014968 | Ga0157379_10042887 | Ga0157379_100428872 | 308 |
| 790 | 3300017792 | Ga0163161_10025334 | Ga0163161_100253342 | 308 |
| 791 | 3300021361 | Ga0213872_10007647 | Ga0213872_100076476 | 308 |
| 792 | 3300025246 | Ga0209646_1011061 | Ga0209646_10110612 | 308 |
| 793 | 3300025263 | Ga0209565_1000272 | Ga0209565_100027225 | 308 |
| 794 | 3300025273 | Ga0209673_1011390 | Ga0209673_10113903 | 308 |
| 795 | 3300025291 | Ga0209675_1000472 | Ga0209675_100047213 | 308 |
| 796 | 3300025292 | Ga0209676_1000226 | Ga0209676_100022696 | 308 |
| 797 | 3300025292 | Ga0209676_1005732 | Ga0209676_10057322 | 308 |
| 798 | 3300025294 | Ga0209025_1014061 | Ga0209025_10140612 | 308 |
| 799 | 3300025295 | Ga0209564_1000949 | Ga0209564_100094922 | 308 |
| 800 | 3300025295 | Ga0209564_1018313 | Ga0209564_10183132 | 308 |
| 801 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001497 | 308 |
| 802 | 3300025298 | Ga0209050_1000167 | Ga0209050_100016775 | 308 |
| 803 | 3300025298 | Ga0209050_1004367 | Ga0209050_10043673 | 308 |
| 804 | 3300025298 | Ga0209050_1012902 | Ga0209050_10129021 | 308 |
| 805 | 3300025298 | Ga0209050_1013829 | Ga0209050_10138294 | 308 |
| 806 | 3300025303 | Ga0209051_1000472 | Ga0209051_10004727 | 308 |
| 807 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028661 | 308 |
| 808 | 3300025304 | Ga0209257_1004307 | Ga0209257_10043076 | 308 |
| 809 | 3300025304 | Ga0209257_1005425 | Ga0209257_10054257 | 308 |
| 810 | 3300025315 | Ga0207697_10000312 | Ga0207697_1000031217 | 308 |
| 811 | 3300025893 | Ga0207682_10000353 | Ga0207682_1000035311 | 308 |
| 812 | 3300025901 | Ga0207688_10075641 | Ga0207688_100756412 | 308 |
| 813 | 3300025907 | Ga0207645_10003989 | Ga0207645_1000398911 | 308 |
| 814 | 3300025907 | Ga0207645_10066974 | Ga0207645_100669742 | 308 |
| 815 | 3300025908 | Ga0207643_10048655 | Ga0207643_100486552 | 308 |
| 816 | 3300025909 | Ga0207705_10127460 | Ga0207705_101274602 | 308 |
| 817 | 3300025911 | Ga0207654_10151892 | Ga0207654_101518921 | 308 |
| 818 | 3300025911 | Ga0207654_10297958 | Ga0207654_102979581 | 308 |
| 819 | 3300025913 | Ga0207695_10050060 | Ga0207695_100500603 | 308 |
| 820 | 3300025913 | Ga0207695_10111754 | Ga0207695_101117541 | 308 |
| 821 | 3300025913 | Ga0207695_10196709 | Ga0207695_101967092 | 308 |
| 822 | 3300025914 | Ga0207671_10007591 | Ga0207671_100075914 | 308 |
| 823 | 3300025918 | Ga0207662_10120637 | Ga0207662_101206372 | 308 |
| 824 | 3300025919 | Ga0207657_10005880 | Ga0207657_100058803 | 308 |
| 825 | 3300025919 | Ga0207657_10041643 | Ga0207657_100416434 | 308 |
| 826 | 3300025921 | Ga0207652_10198852 | Ga0207652_101988522 | 308 |
| 827 | 3300025923 | Ga0207681_10004134 | Ga0207681_100041342 | 308 |
| 828 | 3300025923 | Ga0207681_10157179 | Ga0207681_101571791 | 308 |
| 829 | 3300025924 | Ga0207694_10011065 | Ga0207694_100110655 | 308 |
| 830 | 3300025925 | Ga0207650_10003098 | Ga0207650_100030987 | 308 |
| 831 | 3300025925 | Ga0207650_10026696 | Ga0207650_100266962 | 308 |
| 832 | 3300025931 | Ga0207644_10000035 | Ga0207644_1000003546 | 308 |
| 833 | 3300025931 | Ga0207644_10000301 | Ga0207644_100003013 | 308 |
| 834 | 3300025931 | Ga0207644_10056208 | Ga0207644_100562082 | 308 |
| 835 | 3300025932 | Ga0207690_10125324 | Ga0207690_101253242 | 308 |
| 836 | 3300025933 | Ga0207706_10000489 | Ga0207706_1000048925 | 308 |
| 837 | 3300025933 | Ga0207706_10006049 | Ga0207706_100060492 | 308 |
| 838 | 3300025935 | Ga0207709_10023531 | Ga0207709_100235313 | 308 |
| 839 | 3300025937 | Ga0207669_10063701 | Ga0207669_100637012 | 308 |
| 840 | 3300025938 | Ga0207704_10042745 | Ga0207704_100427453 | 308 |
| 841 | 3300025940 | Ga0207691_10000784 | Ga0207691_100007848 | 308 |
| 842 | 3300025941 | Ga0207711_10004144 | Ga0207711_100041442 | 308 |
| 843 | 3300025941 | Ga0207711_10016447 | Ga0207711_100164473 | 308 |
| 844 | 3300025941 | Ga0207711_10045371 | Ga0207711_100453713 | 308 |
| 845 | 3300025941 | Ga0207711_10452027 | Ga0207711_104520272 | 308 |
| 846 | 3300025945 | Ga0207679_10263971 | Ga0207679_102639712 | 308 |
| 847 | 3300025972 | Ga0207668_10000147 | Ga0207668_1000014732 | 308 |
| 848 | 3300025972 | Ga0207668_10002842 | Ga0207668_100028422 | 308 |
| 849 | 3300025981 | Ga0207640_10002074 | Ga0207640_100020748 | 308 |
| 850 | 3300025981 | Ga0207640_10014644 | Ga0207640_100146445 | 308 |
| 851 | 3300025986 | Ga0207658_10010486 | Ga0207658_100104862 | 308 |
| 852 | 3300025986 | Ga0207658_10034186 | Ga0207658_100341863 | 308 |
| 853 | 3300025986 | Ga0207658_10395802 | Ga0207658_103958022 | 308 |
| 854 | 3300026035 | Ga0207703_10125579 | Ga0207703_101255791 | 308 |
| 855 | 3300026041 | Ga0207639_10249595 | Ga0207639_102495952 | 308 |
| 856 | 3300026075 | Ga0207708_10146702 | Ga0207708_101467022 | 308 |
| 857 | 3300026078 | Ga0207702_10099945 | Ga0207702_100999452 | 308 |
| 858 | 3300026088 | Ga0207641_10000039 | Ga0207641_10000039140 | 308 |
| 859 | 3300026088 | Ga0207641_10007735 | Ga0207641_100077355 | 308 |
| 860 | 3300026116 | Ga0207674_10011227 | Ga0207674_100112276 | 308 |
| 861 | 3300026116 | Ga0207674_10011292 | Ga0207674_100112927 | 308 |
| 862 | 3300026116 | Ga0207674_10099608 | Ga0207674_100996082 | 308 |
| 863 | 3300026118 | Ga0207675_100000613 | Ga0207675_10000061321 | 308 |
| 864 | 3300026118 | Ga0207675_100011460 | Ga0207675_1000114607 | 308 |
| 865 | 3300026121 | Ga0207683_10049848 | Ga0207683_100498481 | 308 |
| 866 | 3300026142 | Ga0207698_10265394 | Ga0207698_102653942 | 308 |
| 867 | 3300026142 | Ga0207698_10318589 | Ga0207698_103185892 | 308 |
| 868 | 3300026142 | Ga0207698_10405887 | Ga0207698_104058871 | 308 |
| 869 | 3300027876 | Ga0209974_10016711 | Ga0209974_100167112 | 308 |
| 870 | 3300028380 | Ga0268265_10059987 | Ga0268265_100599871 | 308 |
| 871 | 3300028381 | Ga0268264_10000743 | Ga0268264_1000074331 | 308 |
| 872 | 3300028381 | Ga0268264_10006008 | Ga0268264_100060084 | 308 |
| 873 | 3300030745 | Ga0316182_1045715 | Ga0316182_10457153 | 308 |
| 874 | 3300031548 | Ga0307408_100000067 | Ga0307408_10000006766 | 308 |
| 875 | 3300031548 | Ga0307408_100240539 | Ga0307408_1002405391 | 308 |
| 876 | 3300031548 | Ga0307408_100292757 | Ga0307408_1002927571 | 308 |
| 877 | 3300031691 | Ga0316579_10027068 | Ga0316579_100270683 | 308 |
| 878 | 3300031731 | Ga0307405_10004177 | Ga0307405_100041772 | 308 |
| 879 | 3300031731 | Ga0307405_10038349 | Ga0307405_100383492 | 308 |
| 880 | 3300031731 | Ga0307405_10102745 | Ga0307405_101027452 | 308 |
| 881 | 3300031731 | Ga0307405_10155505 | Ga0307405_101555051 | 308 |
| 882 | 3300031731 | Ga0307405_10158867 | Ga0307405_101588672 | 308 |
| 883 | 3300031731 | Ga0307405_10292087 | Ga0307405_102920871 | 308 |
| 884 | 3300031824 | Ga0307413_10002129 | Ga0307413_100021295 | 308 |
| 885 | 3300031824 | Ga0307413_10003908 | Ga0307413_100039087 | 308 |
| 886 | 3300031824 | Ga0307413_10115736 | Ga0307413_101157362 | 308 |
| 887 | 3300031852 | Ga0307410_10029066 | Ga0307410_100290663 | 308 |
| 888 | 3300031852 | Ga0307410_10162412 | Ga0307410_101624121 | 308 |
| 889 | 3300031852 | Ga0307410_10170549 | Ga0307410_101705492 | 308 |
| 890 | 3300031852 | Ga0307410_10239030 | Ga0307410_102390302 | 308 |
| 891 | 3300031852 | Ga0307410_10276584 | Ga0307410_102765841 | 308 |
| 892 | 3300031901 | Ga0307406_10027321 | Ga0307406_100273213 | 308 |
| 893 | 3300031901 | Ga0307406_10085005 | Ga0307406_100850052 | 308 |
| 894 | 3300031903 | Ga0307407_10028585 | Ga0307407_100285852 | 308 |
| 895 | 3300031903 | Ga0307407_10077303 | Ga0307407_100773032 | 308 |
| 896 | 3300031903 | Ga0307407_10136573 | Ga0307407_101365732 | 308 |
| 897 | 3300031911 | Ga0307412_10027378 | Ga0307412_100273783 | 308 |
| 898 | 3300031911 | Ga0307412_10049612 | Ga0307412_100496124 | 308 |
| 899 | 3300031911 | Ga0307412_10064345 | Ga0307412_100643453 | 308 |
| 900 | 3300031995 | Ga0307409_100039050 | Ga0307409_1000390502 | 308 |
| 901 | 3300031995 | Ga0307409_100128373 | Ga0307409_1001283732 | 308 |
| 902 | 3300031995 | Ga0307409_100152307 | Ga0307409_1001523073 | 308 |
| 903 | 3300031995 | Ga0307409_100302523 | Ga0307409_1003025232 | 308 |
| 904 | 3300032002 | Ga0307416_100350597 | Ga0307416_1003505972 | 308 |
| 905 | 3300032004 | Ga0307414_10000398 | Ga0307414_1000039820 | 308 |
| 906 | 3300032004 | Ga0307414_10003403 | Ga0307414_100034038 | 308 |
| 907 | 3300032004 | Ga0307414_10007234 | Ga0307414_100072347 | 308 |
| 908 | 3300032004 | Ga0307414_10157704 | Ga0307414_101577042 | 308 |
| 909 | 3300032004 | Ga0307414_10181692 | Ga0307414_101816922 | 308 |
| 910 | 3300032004 | Ga0307414_10531306 | Ga0307414_105313062 | 308 |
| 911 | 3300032005 | Ga0307411_10002515 | Ga0307411_100025154 | 308 |
| 912 | 3300032005 | Ga0307411_10033556 | Ga0307411_100335563 | 308 |
| 913 | 3300032005 | Ga0307411_10046252 | Ga0307411_100462524 | 308 |
| 914 | 3300032005 | Ga0307411_10086206 | Ga0307411_100862062 | 308 |
| 915 | 3300032005 | Ga0307411_10182144 | Ga0307411_101821442 | 308 |
| 916 | 3300032126 | Ga0307415_100098253 | Ga0307415_1000982532 | 308 |
| 917 | 3300032126 | Ga0307415_100226331 | Ga0307415_1002263312 | 308 |
| 918 | 3300032133 | Ga0316583_10005519 | Ga0316583_100055191 | 308 |
| 919 | 3300034817 | Ga0373948_0019815 | Ga0373948_0019815_272_1207 | 308 |
| 920 | 3300035112 | Ga0373932_0006608 | Ga0373932_0006608_1450_2385 | 308 |
| 921 | 3300036647 | Ga0316582_0024908 | Ga0316582_0024908_793_1725 | 308 |
| 922 | 3300036647 | Ga0316582_0233046 | Ga0316582_0233046_49_978 | 308 |
| 923 | 3300036712 | Ga0316584_0078234 | Ga0316584_0078234_44_973 | 308 |
| 924 | 3300037312 | Ga0395899_0047146 | Ga0395899_0047146_1477_2406 | 308 |
| 925 | 3300037418 | Ga0395900_0000380 | Ga0395900_0000380_38449_39378 | 308 |
| 926 | 3300037418 | Ga0395900_0021446 | Ga0395900_0021446_5118_6047 | 308 |
| 927 | 3300037418 | Ga0395900_0024980 | Ga0395900_0024980_2125_3054 | 308 |
| 928 | 3300037418 | Ga0395900_0231169 | Ga0395900_0231169_120_1049 | 308 |
| 929 | 3300037466 | Ga0395898_0020952 | Ga0395898_0020952_3489_4418 | 308 |
| 930 | 3300037471 | Ga0395905_0001357 | Ga0395905_0001357_8044_8973 | 308 |
| 931 | 3300037471 | Ga0395905_0006585 | Ga0395905_0006585_10299_11228 | 308 |
| 932 | 3300037471 | Ga0395905_0016465 | Ga0395905_0016465_535_1464 | 308 |
| 933 | 3300037471 | Ga0395905_0031754 | Ga0395905_0031754_1904_2833 | 308 |
| 934 | 3300037471 | Ga0395905_0132126 | Ga0395905_0132126_447_1382 | 308 |
| 935 | 3300038443 | Ga0395901_0253429 | Ga0395901_0253429_382_1311 | 308 |
| 936 | 3300038443 | Ga0395901_0393239 | Ga0395901_0393239_68_997 | 308 |
| 937 | 3300039447 | Ga0436361_0443819 | Ga0436361_0443819_6677_7606 | 308 |
| 938 | 3300042439 | Ga0439464_0004701 | Ga0439464_0004701_1099_2028 | 308 |
| 939 | 3300044765 | Ga0466970_0030510 | Ga0466970_0030510_1639_2568 | 308 |
| 940 | 3300046460 | Ga0495638_0011014 | Ga0495638_0011014_5143_6078 | 308 |
| 941 | 3300046460 | Ga0495638_0034250 | Ga0495638_0034250_534_1469 | 308 |
| 942 | 3300046492 | Ga0495585_0087990 | Ga0495585_0087990_693_1625 | 308 |
| 943 | 3300046506 | Ga0495583_0000474 | Ga0495583_0000474_24667_25602 | 308 |
| 944 | 3300046506 | Ga0495583_0000577 | Ga0495583_0000577_14011_14946 | 308 |
| 945 | 3300046507 | Ga0495606_0041089 | Ga0495606_0041089_403_1332 | 308 |
| 946 | 3300046507 | Ga0495606_0128040 | Ga0495606_0128040_52_987 | 308 |
| 947 | 3300046522 | Ga0495643_0000806 | Ga0495643_0000806_6523_7452 | 308 |
| 948 | 3300046522 | Ga0495643_0002033 | Ga0495643_0002033_14568_15500 | 308 |
| 949 | 3300046522 | Ga0495643_0008791 | Ga0495643_0008791_76_1008 | 308 |
| 950 | 3300046524 | Ga0495648_0000114 | Ga0495648_0000114_20227_21159 | 308 |
| 951 | 3300046525 | Ga0495663_0007342 | Ga0495663_0007342_451_1380 | 308 |
| 952 | 3300046528 | Ga0495642_0003949 | Ga0495642_0003949_4326_5258 | 308 |
| 953 | 3300046530 | Ga0495654_0030806 | Ga0495654_0030806_1275_2204 | 308 |
| 954 | 3300046538 | Ga0495609_0018276 | Ga0495609_0018276_2278_3207 | 308 |
| 955 | 3300046558 | Ga0495633_0068583 | Ga0495633_0068583_457_1386 | 308 |
| 956 | 3300046660 | Ga0495625_0001605 | Ga0495625_0001605_2555_3487 | 308 |
| 957 | 3300046660 | Ga0495625_0056411 | Ga0495625_0056411_458_1387 | 308 |
| 958 | 3300046665 | Ga0495661_0058386 | Ga0495661_0058386_1221_2156 | 308 |
| 959 | 3300046684 | Ga0495669_0049749 | Ga0495669_0049749_907_1836 | 308 |
| 960 | 3300046684 | Ga0495669_0089557 | Ga0495669_0089557_462_1391 | 308 |
| 961 | 3300046691 | Ga0495670_0064401 | Ga0495670_0064401_340_1269 | 308 |
| 962 | 3300046692 | Ga0495671_0017383 | Ga0495671_0017383_1068_1997 | 308 |
| 963 | 3300047445 | Ga0495677_0073744 | Ga0495677_0073744_101_1033 | 308 |
| 964 | 3300047469 | Ga0495673_0040173 | Ga0495673_0040173_83_1012 | 308 |
| 965 | 3300047472 | Ga0495686_0000100 | Ga0495686_0000100_132398_133327 | 308 |
| 966 | 3300048904 | Ga0496101_0050962 | Ga0496101_0050962_1753_2682 | 308 |
| 967 | 3300048905 | Ga0496102_0000321 | Ga0496102_0000321_36858_37787 | 308 |
| 968 | 3300048906 | Ga0496103_0000199 | Ga0496103_0000199_36780_37709 | 308 |
| 969 | 3300048906 | Ga0496103_0148434 | Ga0496103_0148434_445_1374 | 308 |
| 970 | 3300048908 | Ga0496105_0267698 | Ga0496105_0267698_407_1336 | 308 |
| 971 | 3300048913 | Ga0496110_0225473 | Ga0496110_0225473_738_1667 | 308 |
| 972 | 3300048917 | Ga0496114_0007983 | Ga0496114_0007983_3657_4586 | 308 |
| 973 | 3300048917 | Ga0496114_0008871 | Ga0496114_0008871_466_1395 | 308 |
| 974 | 3300048919 | Ga0496116_0000648 | Ga0496116_0000648_7903_8832 | 308 |
| 975 | 3300048919 | Ga0496116_0018949 | Ga0496116_0018949_1380_2309 | 308 |
| 976 | 3300048919 | Ga0496116_0025177 | Ga0496116_0025177_1663_2592 | 308 |
| 977 | 3300048919 | Ga0496116_0061976 | Ga0496116_0061976_1192_2121 | 308 |
| 978 | 3300048920 | Ga0496117_0000584 | Ga0496117_0000584_22324_23253 | 308 |
| 979 | 3300048921 | Ga0496118_0000588 | Ga0496118_0000588_22324_23253 | 308 |
| 980 | 3300048921 | Ga0496118_0042162 | Ga0496118_0042162_2459_3388 | 308 |
| 981 | 3300048923 | Ga0496120_0006949 | Ga0496120_0006949_1563_2492 | 308 |
| 982 | 3300048924 | Ga0496121_0005909 | Ga0496121_0005909_4039_4968 | 308 |
| 983 | 3300048924 | Ga0496121_0098452 | Ga0496121_0098452_796_1725 | 308 |
| 984 | 3300048925 | Ga0496122_0000033 | Ga0496122_0000033_114190_115119 | 308 |
| 985 | 3300048925 | Ga0496122_0000218 | Ga0496122_0000218_119156_120085 | 308 |
| 986 | 3300048925 | Ga0496122_0006049 | Ga0496122_0006049_11269_12213 | 308 |
| 987 | 3300048926 | Ga0496123_0000089 | Ga0496123_0000089_150732_151661 | 308 |
| 988 | 3300048926 | Ga0496123_0000741 | Ga0496123_0000741_24151_25080 | 308 |
| 989 | 3300048926 | Ga0496123_0002070 | Ga0496123_0002070_20379_21323 | 308 |
| 990 | 3300048926 | Ga0496123_0010286 | Ga0496123_0010286_728_1657 | 308 |
| 991 | 3300048926 | Ga0496123_0060612 | Ga0496123_0060612_838_1767 | 308 |
| 992 | 3300048927 | Ga0496124_0000387 | Ga0496124_0000387_57601_58530 | 308 |
| 993 | 3300048927 | Ga0496124_0007325 | Ga0496124_0007325_10777_11706 | 308 |
| 994 | 3300048927 | Ga0496124_0011763 | Ga0496124_0011763_4179_5108 | 308 |
| 995 | 3300048927 | Ga0496124_0139411 | Ga0496124_0139411_65_994 | 308 |
| 996 | 3300048928 | Ga0496125_0000117 | Ga0496125_0000117_154057_154986 | 308 |
| 997 | 3300048928 | Ga0496125_0086716 | Ga0496125_0086716_458_1387 | 308 |
| 998 | 3300048929 | Ga0496126_0179803 | Ga0496126_0179803_382_1311 | 308 |
| 999 | 3300048929 | Ga0496126_0239104 | Ga0496126_0239104_458_1387 | 308 |
| 1000 | 3300049571 | Ga0501034_0423429 | Ga0501034_0423429_123_1055 | 308 |
| 1001 | 3300049579 | Ga0501043_0055003 | Ga0501043_0055003_1968_2897 | 308 |
| 1002 | 3300049581 | Ga0501047_0441956 | Ga0501047_0441956_46_975 | 308 |
| 1003 | 3300049823 | Ga0501044_0152694 | Ga0501044_0152694_441_1370 | 308 |
| 1004 | 3300050496 | nmdc:mga07m45_91046_c1 | nmdc:mga07m45_91046_c1_534_1463 | 308 |
| 1005 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_405355_406284 | 308 |
| 1006 | 3300053096 | Ga0500641_0000927 | Ga0500641_0000927_5263_6192 | 308 |
| 1007 | 3300053103 | Ga0500555_000457 | Ga0500555_000457_6030_6965 | 308 |
| 1008 | 3300053104 | Ga0500556_0000522 | Ga0500556_0000522_8879_9808 | 308 |
| 1009 | 3300053120 | Ga0500597_013253 | Ga0500597_013253_1002_1931 | 308 |
| 1010 | 3300053130 | Ga0500642_0000007 | Ga0500642_0000007_11614_12543 | 308 |
| 1011 | 3300053139 | Ga0500568_0002901 | Ga0500568_0002901_6898_7827 | 308 |
| 1012 | 3300053157 | Ga0500624_000050 | Ga0500624_000050_22450_23379 | 308 |
| 1013 | 3300053158 | Ga0500627_0000017 | Ga0500627_0000017_78980_79909 | 308 |
| 1014 | 3300053158 | Ga0500627_0079275 | Ga0500627_0079275_428_1357 | 308 |
| 1015 | 3300053178 | Ga0500637_0000061 | Ga0500637_0000061_22397_23326 | 308 |
| 1016 | 3300053730 | Ga0500645_000038 | Ga0500645_000038_58771_59703 | 308 |
| 1017 | 3300053730 | Ga0500645_000637 | Ga0500645_000637_13947_14876 | 308 |
| 1018 | 3300053730 | Ga0500645_004200 | Ga0500645_004200_4101_5030 | 308 |
| 1019 | 3300003791 | Ga0055530_10000012 | Ga0055530_10000012121 | 309 |
| 1020 | 3300003794 | Ga0055531_10002076 | Ga0055531_1000207611 | 309 |
| 1021 | 3300005338 | Ga0068868_100025889 | Ga0068868_1000258892 | 309 |
| 1022 | 3300005343 | Ga0070687_100009474 | Ga0070687_1000094744 | 309 |
| 1023 | 3300005345 | Ga0070692_10028039 | Ga0070692_100280393 | 309 |
| 1024 | 3300005356 | Ga0070674_100218124 | Ga0070674_1002181242 | 309 |
| 1025 | 3300005444 | Ga0070694_100073343 | Ga0070694_1000733432 | 309 |
| 1026 | 3300005445 | Ga0070708_100000180 | Ga0070708_10000018033 | 309 |
| 1027 | 3300005457 | Ga0070662_100017146 | Ga0070662_1000171465 | 309 |
| 1028 | 3300005459 | Ga0068867_100010488 | Ga0068867_1000104885 | 309 |
| 1029 | 3300005459 | Ga0068867_100141052 | Ga0068867_1001410521 | 309 |
| 1030 | 3300005468 | Ga0070707_100002462 | Ga0070707_1000024625 | 309 |
| 1031 | 3300005471 | Ga0070698_100153526 | Ga0070698_1001535262 | 309 |
| 1032 | 3300005518 | Ga0070699_100068978 | Ga0070699_1000689782 | 309 |
| 1033 | 3300005536 | Ga0070697_100229209 | Ga0070697_1002292091 | 309 |
| 1034 | 3300005546 | Ga0070696_100148847 | Ga0070696_1001488472 | 309 |
| 1035 | 3300005547 | Ga0070693_100016243 | Ga0070693_1000162432 | 309 |
| 1036 | 3300005547 | Ga0070693_100205483 | Ga0070693_1002054831 | 309 |
| 1037 | 3300005549 | Ga0070704_100242153 | Ga0070704_1002421532 | 309 |
| 1038 | 3300006177 | Ga0075362_10041739 | Ga0075362_100417392 | 309 |
| 1039 | 3300006186 | Ga0075369_10018437 | Ga0075369_100184372 | 309 |
| 1040 | 3300009098 | Ga0105245_10007234 | Ga0105245_100072349 | 309 |
| 1041 | 3300013100 | Ga0157373_10250440 | Ga0157373_102504402 | 309 |
| 1042 | 3300013297 | Ga0157378_10009372 | Ga0157378_100093725 | 309 |
| 1043 | 3300025292 | Ga0209676_1000387 | Ga0209676_100038742 | 309 |
| 1044 | 3300025298 | Ga0209050_1000450 | Ga0209050_100045038 | 309 |
| 1045 | 3300025304 | Ga0209257_1002265 | Ga0209257_10022653 | 309 |
| 1046 | 3300025901 | Ga0207688_10103057 | Ga0207688_101030572 | 309 |
| 1047 | 3300025907 | Ga0207645_10003327 | Ga0207645_100033272 | 309 |
| 1048 | 3300025912 | Ga0207707_10075505 | Ga0207707_100755052 | 309 |
| 1049 | 3300025912 | Ga0207707_10264273 | Ga0207707_102642732 | 309 |
| 1050 | 3300025917 | Ga0207660_10397361 | Ga0207660_103973611 | 309 |
| 1051 | 3300025918 | Ga0207662_10095943 | Ga0207662_100959432 | 309 |
| 1052 | 3300025922 | Ga0207646_10001573 | Ga0207646_100015736 | 309 |
| 1053 | 3300025927 | Ga0207687_10084324 | Ga0207687_100843242 | 309 |
| 1054 | 3300025933 | Ga0207706_10002195 | Ga0207706_100021959 | 309 |
| 1055 | 3300025942 | Ga0207689_10235722 | Ga0207689_102357222 | 309 |
| 1056 | 3300026023 | Ga0207677_10111773 | Ga0207677_101117732 | 309 |
| 1057 | 3300026075 | Ga0207708_10335931 | Ga0207708_103359312 | 309 |
| 1058 | 3300026089 | Ga0207648_10018143 | Ga0207648_100181432 | 309 |
| 1059 | 3300026089 | Ga0207648_10129184 | Ga0207648_101291842 | 309 |
| 1060 | 3300032002 | Ga0307416_100118645 | Ga0307416_1001186452 | 309 |
| 1061 | 3300046459 | Ga0495629_0000049 | Ga0495629_0000049_11925_12863 | 309 |
| 1062 | 3300046463 | Ga0495653_0002923 | Ga0495653_0002923_11900_12838 | 309 |
| 1063 | 3300046472 | Ga0495580_0005345 | Ga0495580_0005345_2821_3759 | 309 |
| 1064 | 3300046558 | Ga0495633_0141236 | Ga0495633_0141236_50_982 | 309 |
| 1065 | 3300046690 | Ga0495624_0000070 | Ga0495624_0000070_53162_54100 | 309 |
| 1066 | 3300047319 | Ga0495674_0000123 | Ga0495674_0000123_52777_53715 | 309 |
| 1067 | 3300047673 | Ga0495593_0000610 | Ga0495593_0000610_10801_11739 | 309 |
| 1068 | 3300048927 | Ga0496124_0021172 | Ga0496124_0021172_3244_4176 | 309 |
| 1069 | 3300050516 | nmdc:mga0sz30_125788_c1 | nmdc:mga0sz30_125788_c1_22_954 | 309 |
| 1070 | 3300053087 | Ga0500643_001098 | Ga0500643_001098_11106_12038 | 309 |
| 1071 | 3300053125 | Ga0500618_011359 | Ga0500618_011359_355_1287 | 309 |
| 1072 | 3300053141 | Ga0500574_013783 | Ga0500574_013783_575_1507 | 309 |
| 1073 | 3300053162 | Ga0500638_100469 | Ga0500638_100469_380_1312 | 309 |
| 1074 | 3300053177 | Ga0500636_0003403 | Ga0500636_0003403_7774_8706 | 309 |
| 1075 | 3300005327 | Ga0070658_10128241 | Ga0070658_101282412 | 310 |
| 1076 | 3300005336 | Ga0070680_100001504 | Ga0070680_1000015048 | 310 |
| 1077 | 3300005336 | Ga0070680_100025496 | Ga0070680_1000254964 | 310 |
| 1078 | 3300005336 | Ga0070680_100045358 | Ga0070680_1000453583 | 310 |
| 1079 | 3300005337 | Ga0070682_100073675 | Ga0070682_1000736752 | 310 |
| 1080 | 3300005337 | Ga0070682_100194291 | Ga0070682_1001942912 | 310 |
| 1081 | 3300005339 | Ga0070660_100120546 | Ga0070660_1001205462 | 310 |
| 1082 | 3300005344 | Ga0070661_100019204 | Ga0070661_1000192042 | 310 |
| 1083 | 3300005344 | Ga0070661_100061123 | Ga0070661_1000611232 | 310 |
| 1084 | 3300005435 | Ga0070714_100000922 | Ga0070714_10000092210 | 310 |
| 1085 | 3300005458 | Ga0070681_10000473 | Ga0070681_1000047311 | 310 |
| 1086 | 3300005458 | Ga0070681_10034434 | Ga0070681_100344343 | 310 |
| 1087 | 3300005458 | Ga0070681_10055257 | Ga0070681_100552572 | 310 |
| 1088 | 3300005458 | Ga0070681_10067156 | Ga0070681_100671563 | 310 |
| 1089 | 3300005458 | Ga0070681_10107087 | Ga0070681_101070873 | 310 |
| 1090 | 3300005458 | Ga0070681_10250387 | Ga0070681_102503872 | 310 |
| 1091 | 3300005459 | Ga0068867_100212467 | Ga0068867_1002124672 | 310 |
| 1092 | 3300005518 | Ga0070699_100018911 | Ga0070699_1000189113 | 310 |
| 1093 | 3300005530 | Ga0070679_100031597 | Ga0070679_1000315973 | 310 |
| 1094 | 3300005530 | Ga0070679_100032305 | Ga0070679_1000323054 | 310 |
| 1095 | 3300005530 | Ga0070679_100078547 | Ga0070679_1000785472 | 310 |
| 1096 | 3300005530 | Ga0070679_100321954 | Ga0070679_1003219542 | 310 |
| 1097 | 3300005535 | Ga0070684_100027814 | Ga0070684_1000278142 | 310 |
| 1098 | 3300005536 | Ga0070697_100118843 | Ga0070697_1001188432 | 310 |
| 1099 | 3300005539 | Ga0068853_100001865 | Ga0068853_10000186513 | 310 |
| 1100 | 3300005546 | Ga0070696_100003725 | Ga0070696_10000372511 | 310 |
| 1101 | 3300005563 | Ga0068855_100010819 | Ga0068855_1000108195 | 310 |
| 1102 | 3300005563 | Ga0068855_100092167 | Ga0068855_1000921673 | 310 |
| 1103 | 3300005578 | Ga0068854_100063354 | Ga0068854_1000633543 | 310 |
| 1104 | 3300005578 | Ga0068854_100151179 | Ga0068854_1001511792 | 310 |
| 1105 | 3300005616 | Ga0068852_100006128 | Ga0068852_1000061283 | 310 |
| 1106 | 3300006028 | Ga0070717_10251370 | Ga0070717_102513702 | 310 |
| 1107 | 3300006173 | Ga0070716_100001330 | Ga0070716_1000013302 | 310 |
| 1108 | 3300006852 | Ga0075433_10026279 | Ga0075433_100262792 | 310 |
| 1109 | 3300006871 | Ga0075434_100027782 | Ga0075434_1000277826 | 310 |
| 1110 | 3300006914 | Ga0075436_100029866 | Ga0075436_1000298662 | 310 |
| 1111 | 3300009093 | Ga0105240_10069861 | Ga0105240_100698612 | 310 |
| 1112 | 3300009174 | Ga0105241_10059775 | Ga0105241_100597753 | 310 |
| 1113 | 3300009551 | Ga0105238_10002601 | Ga0105238_100026013 | 310 |
| 1114 | 3300013100 | Ga0157373_10024313 | Ga0157373_100243135 | 310 |
| 1115 | 3300013104 | Ga0157370_10059080 | Ga0157370_100590803 | 310 |
| 1116 | 3300013105 | Ga0157369_10018458 | Ga0157369_100184585 | 310 |
| 1117 | 3300013307 | Ga0157372_10129059 | Ga0157372_101290592 | 310 |
| 1118 | 3300013307 | Ga0157372_10181482 | Ga0157372_101814822 | 310 |
| 1119 | 3300014325 | Ga0163163_10046351 | Ga0163163_100463514 | 310 |
| 1120 | 3300014497 | Ga0182008_10005339 | Ga0182008_100053395 | 310 |
| 1121 | 3300020082 | Ga0206353_10063925 | Ga0206353_100639251 | 310 |
| 1122 | 3300025906 | Ga0207699_10167766 | Ga0207699_101677661 | 310 |
| 1123 | 3300025911 | Ga0207654_10062980 | Ga0207654_100629802 | 310 |
| 1124 | 3300025912 | Ga0207707_10000423 | Ga0207707_1000042327 | 310 |
| 1125 | 3300025912 | Ga0207707_10004235 | Ga0207707_100042353 | 310 |
| 1126 | 3300025912 | Ga0207707_10015113 | Ga0207707_100151138 | 310 |
| 1127 | 3300025912 | Ga0207707_10020753 | Ga0207707_100207534 | 310 |
| 1128 | 3300025912 | Ga0207707_10028894 | Ga0207707_100288945 | 310 |
| 1129 | 3300025912 | Ga0207707_10291043 | Ga0207707_102910432 | 310 |
| 1130 | 3300025913 | Ga0207695_10151872 | Ga0207695_101518722 | 310 |
| 1131 | 3300025913 | Ga0207695_10227666 | Ga0207695_102276662 | 310 |
| 1132 | 3300025917 | Ga0207660_10008593 | Ga0207660_100085936 | 310 |
| 1133 | 3300025917 | Ga0207660_10029939 | Ga0207660_100299393 | 310 |
| 1134 | 3300025917 | Ga0207660_10040194 | Ga0207660_100401942 | 310 |
| 1135 | 3300025917 | Ga0207660_10053794 | Ga0207660_100537943 | 310 |
| 1136 | 3300025917 | Ga0207660_10067313 | Ga0207660_100673132 | 310 |
| 1137 | 3300025919 | Ga0207657_10009564 | Ga0207657_100095642 | 310 |
| 1138 | 3300025919 | Ga0207657_10081288 | Ga0207657_100812883 | 310 |
| 1139 | 3300025920 | Ga0207649_10060458 | Ga0207649_100604582 | 310 |
| 1140 | 3300025921 | Ga0207652_10001835 | Ga0207652_100018351 | 310 |
| 1141 | 3300025921 | Ga0207652_10016980 | Ga0207652_100169804 | 310 |
| 1142 | 3300025921 | Ga0207652_10022155 | Ga0207652_100221554 | 310 |
| 1143 | 3300025921 | Ga0207652_10024980 | Ga0207652_100249802 | 310 |
| 1144 | 3300025921 | Ga0207652_10074434 | Ga0207652_100744342 | 310 |
| 1145 | 3300025921 | Ga0207652_10116860 | Ga0207652_101168602 | 310 |
| 1146 | 3300025921 | Ga0207652_10172984 | Ga0207652_101729842 | 310 |
| 1147 | 3300025921 | Ga0207652_10187730 | Ga0207652_101877301 | 310 |
| 1148 | 3300025939 | Ga0207665_10001828 | Ga0207665_100018282 | 310 |
| 1149 | 3300025944 | Ga0207661_10105349 | Ga0207661_101053491 | 310 |
| 1150 | 3300025944 | Ga0207661_10298609 | Ga0207661_102986091 | 310 |
| 1151 | 3300025949 | Ga0207667_10070268 | Ga0207667_100702682 | 310 |
| 1152 | 3300025981 | Ga0207640_10012044 | Ga0207640_100120443 | 310 |
| 1153 | 3300026041 | Ga0207639_10005274 | Ga0207639_100052745 | 310 |
| 1154 | 3300026067 | Ga0207678_10118381 | Ga0207678_101183812 | 310 |
| 1155 | 3300026089 | Ga0207648_10382161 | Ga0207648_103821611 | 310 |
| 1156 | 3300026095 | Ga0207676_10023901 | Ga0207676_100239014 | 310 |
| 1157 | 3300026142 | Ga0207698_10004831 | Ga0207698_100048312 | 310 |
| 1158 | 3300026142 | Ga0207698_10329487 | Ga0207698_103294871 | 310 |
| 1159 | 3300027543 | Ga0209999_1003073 | Ga0209999_10030732 | 310 |
| 1160 | 3300034820 | Ga0373959_0004818 | Ga0373959_0004818_305_1294 | 310 |
| 1161 | 3300035088 | Ga0373940_0024327 | Ga0373940_0024327_378_1364 | 310 |
| 1162 | 3300035115 | Ga0373941_0016082 | Ga0373941_0016082_819_1808 | 310 |
| 1163 | 3300035691 | Ga0373931_0028779 | Ga0373931_0028779_1692_2678 | 310 |
| 1164 | 3300037418 | Ga0395900_0028914 | Ga0395900_0028914_890_1879 | 310 |
| 1165 | 3300037471 | Ga0395905_0009993 | Ga0395905_0009993_7361_8350 | 310 |
| 1166 | 3300038443 | Ga0395901_0003571 | Ga0395901_0003571_13752_14741 | 310 |
| 1167 | 3300048907 | Ga0496104_0089183 | Ga0496104_0089183_834_1820 | 310 |
| 1168 | 3300048908 | Ga0496105_0039344 | Ga0496105_0039344_2513_3499 | 310 |
| 1169 | 3300048911 | Ga0496108_0000162 | Ga0496108_0000162_24844_25830 | 310 |
| 1170 | 3300048912 | Ga0496109_0000939 | Ga0496109_0000939_6752_7738 | 310 |
| 1171 | 3300048913 | Ga0496110_0103597 | Ga0496110_0103597_93_1079 | 310 |
| 1172 | 3300048915 | Ga0496112_0000394 | Ga0496112_0000394_25815_26801 | 310 |
| 1173 | 3300048915 | Ga0496112_0001985 | Ga0496112_0001985_1371_2360 | 310 |
| 1174 | 3300048916 | Ga0496113_0000082 | Ga0496113_0000082_36033_37019 | 310 |
| 1175 | 3300049589 | Ga0501073_0197340 | Ga0501073_0197340_171_1157 | 310 |
| 1176 | 3300050507 | nmdc:mga05p37_69169_c1 | nmdc:mga05p37_69169_c1_2184_3173 | 310 |
| 1177 | 3300050511 | nmdc:mga08y16_1605_c2 | nmdc:mga08y16_1605_c2_19443_20423 | 310 |
| 1178 | 3300050514 | nmdc:mga08x19_224069_c1 | nmdc:mga08x19_224069_c1_53_1042 | 310 |
| 1179 | 3300046524 | Ga0495648_0022564 | Ga0495648_0022564_3347_4288 | 312 |
| 1180 | 3300048919 | Ga0496116_0027942 | Ga0496116_0027942_2225_3238 | 321 |
| 1181 | 3300048925 | Ga0496122_0050313 | Ga0496122_0050313_1341_2354 | 321 |
| 1182 | 3300048926 | Ga0496123_0155476 | Ga0496123_0155476_84_1097 | 321 |
| 1183 | 3300048928 | Ga0496125_0071439 | Ga0496125_0071439_874_1887 | 321 |
| 1184 | 3300048929 | Ga0496126_0008764 | Ga0496126_0008764_8986_9999 | 321 |
| 1185 | 2162886007 | SwRhRL2b_contig_2401412 | SwRhRL2b_0150.00009130 | 331 |
| 1186 | 3300005289 | Ga0065704_10070183 | Ga0065704_1007018321 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.9312 | 19 | 203 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.9215 | 19 | 203 |
| 1efv-assembly1.cif.gz_A | three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution | 0.9181 | 19 | 330 |
| 1efp-assembly2.cif.gz_C | electron transfer flavoprotein (etf) from paracoccus denitrificans | 0.9165 | 20 | 331 |
| 1efp-assembly2.cif.gz_C | electron transfer flavoprotein (etf) from paracoccus denitrificans | 0.9108 | 20 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PQF9_17_202_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9763 | 18 | 204 | 3.40.50.620 |
| af_A0A1D8PQF9_17_202_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9711 | 18 | 204 | 3.40.50.620 |
| af_Q4DG52_12_193_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9681 | 20 | 204 | 3.40.50.620 |
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9636 | 204 | 330 | 3.40.50.1220 |
| af_Q4DG52_12_193_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9578 | 20 | 204 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848G2Z6-F1-model_v4 | Electron transfer flavoprotein subunit alpha/FixB family protein | 0.9852 | 217 | 331 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A812U3Y7-F1-model_v4 | ETFA protein | 0.9827 | 215 | 331 |
GO:0005739
GO:0009055 GO:0033539 GO:0050660 |
| AF-A0A7W8L6A7-F1-model_v4 | Electron transfer flavoprotein alpha subunit | 0.9823 | 221 | 330 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A1C5DSN9-F1-model_v4 | Electron transfer flavoprotein alpha subunit apoprotein | 0.9803 | 211 | 330 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A355RCY1-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9775 | 224 | 331 |
GO:0009055
GO:0033539 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar