F491391

General Info

Members Datasets Scaffolds Average Seq Length
1186 414 1140 300

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221605|2644040732
Length 353
Sequence VWVEHEGGAVKDATLSTVTAAAKLGEVHLLVAGQGVGGVADAAAKIAGVGKVHVADDAAYANALPENVAPLVVELMGHHDAFLAPATANGKXIAPRVAALLDVMQISEILSVESEDSFTRPTYAGATVQSSDAKKVITVRATAFEKAAREGGSGSVEAVSGKGDAGLSSFVGAEISKSERPELTSAKVIVSGGRALQNGENFHEIIEPLADKLGAAVGASRAAVXPGQPRRLEELFGLVIVSGGRALQNGENFHEIIEPLADKLGAAVGASRAAVXAGYVPNDYQVGQTGKIVAPEVYIAVGISGAIQHLAGMKDSKTIIAINKDEEAPIFQVADLGLVGDLFKVVPELTGKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
7 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
12 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
13 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
14 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
15 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
16 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
17 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
18 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
19 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
20 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
21 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
22 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
23 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
24 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
25 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
26 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
27 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
28 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
29 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
30 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
31 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
32 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
33 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
34 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
35 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
36 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
37 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
38 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
43 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
44 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
47 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
48 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
121 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
122 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
123 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
124 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
133 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
179 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
180 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
265 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
273 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
278 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
281 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
282 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
283 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
297 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
298 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
317 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
381 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
382 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
395 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
396 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
397 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
398 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
399 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
400 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
401 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
402 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
408 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
414 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0.25
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 8.18
Nodule 0.51
Rhizoplane 3.71
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2401412 2162886007 Eukaryota 56725
2 SwRhRL2b_contig_3660944 2162886007 Bacteria 20313
3 JGI24736J21556_1000001 3300001904 Bacteria 63863
4 JGI24736J21556_1000014 3300001904 Bacteria 29181
5 JGI24741J21665_1002462 3300001915 Bacteria 4798
6 JGI24752J21851_1000099 3300001976 Bacteria 11498
7 JGI24752J21851_1000837 3300001976 Bacteria 4165
8 JGI24740J21852_10002997 3300001979 Bacteria 7474
9 JGI24740J21852_10015018 3300001979 Bacteria 2839
10 JGI24740J21852_10015278 3300001979 Bacteria 2807
11 JGI24739J22299_10001158 3300001989 Bacteria 9857
12 JGI24739J22299_10006093 3300001989 Bacteria 4557
13 JGI24739J22299_10013801 3300001989 Bacteria 2945
14 JGI24737J22298_10009546 3300001990 Bacteria 3220
15 JGI24737J22298_10013918 3300001990 Bacteria 2616
16 JGI24737J22298_10021087 3300001990 Bacteria 2078
17 JGI24737J22298_10035213 3300001990 Bacteria 1549
18 JGI24743J22301_10011359 3300001991 Bacteria 1603
19 JGI24735J21928_10001152 3300002067 Bacteria 9454
20 JGI24735J21928_10006565 3300002067 Bacteria 3823
21 JGI24735J21928_10007993 3300002067 Bacteria 3435
22 JGI24735J21928_10009260 3300002067 Bacteria 3167
23 JGI24735J21928_10047060 3300002067 Bacteria 1250
24 JGI24738J21930_10001186 3300002075 Bacteria 7294
25 JGI24738J21930_10004607 3300002075 Bacteria 3363
26 JGI24749J21850_1000250 3300002076 Bacteria 8443
27 JGI24034J26672_10001749 3300002239 Bacteria 2922
28 JGI24751J29686_10001179 3300002459 Bacteria 5568
29 JGI24751J29686_10029286 3300002459 Bacteria 1143
30 JGI25150J39212_1000067 3300002774 Bacteria 63491
31 JGI25153J46596_10000073 3300003215 Bacteria 115166
32 JGI25153J46596_10042831 3300003215 Bacteria 1378
33 rootL2_10049419 3300003322 Bacteria 2822
34 Ga0055542_1008710 3300003762 Bacteria 1965
35 Ga0055542_1010209 3300003762 Bacteria 1728
36 Ga0055529_1005011 3300003763 Bacteria 1959
37 Ga0055526_1002635 3300003771 Bacteria 11987
38 Ga0055537_1000855 3300003773 Bacteria 14807
39 Ga0055537_1003353 3300003773 Bacteria 4953
40 Ga0055524_1000489 3300003775 Bacteria 31181
41 Ga0055536_1009244 3300003781 Bacteria 4107
42 Ga0055530_10000012 3300003791 Bacteria 164829
43 Ga0055530_10000915 3300003791 Bacteria 24243
44 Ga0055530_10007450 3300003791 Bacteria 4602
45 Ga0055540_1001979 3300003792 Bacteria 11458
46 Ga0055531_10001375 3300003794 Bacteria 18071
47 Ga0055531_10002076 3300003794 Bacteria 13773
48 Ga0055531_10010680 3300003794 Bacteria 4531
49 Ga0055531_10010691 3300003794 Bacteria 4527
50 Ga0055531_10011843 3300003794 Bacteria 4162
51 Ga0055531_10019236 3300003794 Bacteria 2775
52 Ga0065704_10070183 3300005289 Eukaryota 120256
53 Ga0065704_10070410 3300005289 Bacteria 26094
54 Ga0065704_10078581 3300005289 Bacteria 4388
55 Ga0065704_10080202 3300005289 Bacteria 3990
56 Ga0065704_10085713 3300005289 Bacteria 3193
57 Ga0065715_10000525 3300005293 Bacteria 18834
58 Ga0065707_10093150 3300005295 Bacteria 3667
59 Ga0065707_10098335 3300005295 Bacteria 3093
60 Ga0070658_10000492 3300005327 Bacteria 34327
61 Ga0070658_10002437 3300005327 Bacteria 15566
62 Ga0070658_10003145 3300005327 Bacteria 13618
63 Ga0070658_10004725 3300005327 Bacteria 11074
64 Ga0070658_10016748 3300005327 Bacteria 5867
65 Ga0070658_10128241 3300005327 Bacteria 2113
66 Ga0070658_10503319 3300005327 Bacteria 1046
67 Ga0070676_10000029 3300005328 Bacteria 43536
68 Ga0070676_10051976 3300005328 Bacteria 2407
69 Ga0070676_10064458 3300005328 Bacteria 2185
70 Ga0070683_100226595 3300005329 Bacteria 1776
71 Ga0070683_100501317 3300005329 Bacteria 1160
72 Ga0070690_100151851 3300005330 Bacteria 1581
73 Ga0070670_100000027 3300005331 Bacteria 186072
74 Ga0070670_100001338 3300005331 Bacteria 19696
75 Ga0070670_100002350 3300005331 Bacteria 15582
76 Ga0070670_100028850 3300005331 Bacteria 4776
77 Ga0070670_100056786 3300005331 Bacteria 3360
78 Ga0070670_100094261 3300005331 Bacteria 2575
79 Ga0070670_100207902 3300005331 Bacteria 1701
80 Ga0070677_10006520 3300005333 Bacteria 3879
81 Ga0068869_100000668 3300005334 Bacteria 19399
82 Ga0068869_100096737 3300005334 Bacteria 2229
83 Ga0070666_10000089 3300005335 Bacteria 64147
84 Ga0070666_10058133 3300005335 Bacteria 2614
85 Ga0070680_100001504 3300005336 Bacteria 16982
86 Ga0070680_100025496 3300005336 Bacteria 4726
87 Ga0070680_100045358 3300005336 Bacteria 3574
88 Ga0070680_100048827 3300005336 Bacteria 3449
89 Ga0070682_100073675 3300005337 Bacteria 2191
90 Ga0070682_100194291 3300005337 Bacteria 1427
91 Ga0068868_100000139 3300005338 Bacteria 46645
92 Ga0068868_100025889 3300005338 Bacteria 4466
93 Ga0068868_100179309 3300005338 Bacteria 1757
94 Ga0070660_100000017 3300005339 Bacteria 102283
95 Ga0070660_100005671 3300005339 Bacteria 8651
96 Ga0070660_100021489 3300005339 Bacteria 4761
97 Ga0070660_100120546 3300005339 Bacteria 2093
98 Ga0070660_100316740 3300005339 Bacteria 1281
99 Ga0070689_100037387 3300005340 Bacteria 3712
100 Ga0070691_10042850 3300005341 Bacteria 2143
101 Ga0070687_100009474 3300005343 Bacteria 4175
102 Ga0070661_100019204 3300005344 Bacteria 4868
103 Ga0070661_100029048 3300005344 Bacteria 3989
104 Ga0070661_100061123 3300005344 Bacteria 2765
105 Ga0070661_100065746 3300005344 Bacteria 2664
106 Ga0070692_10028039 3300005345 Bacteria 2797
107 Ga0070668_100000009 3300005347 Bacteria 136884
108 Ga0070668_100001726 3300005347 Bacteria 15886
109 Ga0070668_100007239 3300005347 Bacteria 8228
110 Ga0070668_100019447 3300005347 Bacteria 5111
111 Ga0070668_100024478 3300005347 Bacteria 4576
112 Ga0070668_100059003 3300005347 Bacteria 2970
113 Ga0070668_100076241 3300005347 Bacteria 2619
114 Ga0070668_100176014 3300005347 Bacteria 1745
115 Ga0070668_100254258 3300005347 Bacteria 1459
116 Ga0070668_100353942 3300005347 Bacteria 1243
117 Ga0070669_100000024 3300005353 Bacteria 173107
118 Ga0070669_100000610 3300005353 Bacteria 26599
119 Ga0070669_100000646 3300005353 Bacteria 25770
120 Ga0070669_100001807 3300005353 Bacteria 15406
121 Ga0070669_100018055 3300005353 Bacteria 5040
122 Ga0070675_100018279 3300005354 Bacteria 5579
123 Ga0070675_100024384 3300005354 Bacteria 4844
124 Ga0070675_100068100 3300005354 Bacteria 2947
125 Ga0070671_100000005 3300005355 Bacteria 256547
126 Ga0070671_100000006 3300005355 Bacteria 250635
127 Ga0070671_100000098 3300005355 Bacteria 55077
128 Ga0070671_100000864 3300005355 Bacteria 22133
129 Ga0070671_100004809 3300005355 Bacteria 10737
130 Ga0070671_100007364 3300005355 Bacteria 8790
131 Ga0070671_100075885 3300005355 Bacteria 2808
132 Ga0070671_100496505 3300005355 Bacteria 1050
133 Ga0070674_100010715 3300005356 Bacteria 5556
134 Ga0070674_100218124 3300005356 Bacteria 1483
135 Ga0070673_100000013 3300005364 Bacteria 137021
136 Ga0070673_100015714 3300005364 Bacteria 5326
137 Ga0070659_100068324 3300005366 Bacteria 2818
138 Ga0070659_100395683 3300005366 Bacteria 1166
139 Ga0070667_100000315 3300005367 Bacteria 54132
140 Ga0070667_100000513 3300005367 Bacteria 39042
141 Ga0070667_100001750 3300005367 Bacteria 19407
142 Ga0070667_100009388 3300005367 Bacteria 8114
143 Ga0070667_100013726 3300005367 Bacteria 6696
144 Ga0070667_100113539 3300005367 Bacteria 2351
145 Ga0070667_100114296 3300005367 Bacteria 2343
146 Ga0070667_100165074 3300005367 Bacteria 1953
147 Ga0070714_100000922 3300005435 Bacteria 20838
148 Ga0070705_100044993 3300005440 Bacteria 2538
149 Ga0070700_100094271 3300005441 Bacteria 1960
150 Ga0070694_100073343 3300005444 Bacteria 2364
151 Ga0070708_100000180 3300005445 Bacteria 45454
152 Ga0070708_100374285 3300005445 Bacteria 1343
153 Ga0070663_100017908 3300005455 Bacteria 4631
154 Ga0070678_100004619 3300005456 Bacteria 7826
155 Ga0070662_100000631 3300005457 Bacteria 21318
156 Ga0070662_100001553 3300005457 Bacteria 14170
157 Ga0070662_100017146 3300005457 Bacteria 4875
158 Ga0070662_100090723 3300005457 Bacteria 2294
159 Ga0070662_100101972 3300005457 Bacteria 2173
160 Ga0070662_100145686 3300005457 Bacteria 1839
161 Ga0070662_100161588 3300005457 Bacteria 1752
162 Ga0070681_10000473 3300005458 Bacteria 32789
163 Ga0070681_10005511 3300005458 Bacteria 12228
164 Ga0070681_10034434 3300005458 Bacteria 5085
165 Ga0070681_10055257 3300005458 Bacteria 3953
166 Ga0070681_10067156 3300005458 Bacteria 3555
167 Ga0070681_10107087 3300005458 Bacteria 2737
168 Ga0070681_10250387 3300005458 Bacteria 1684
169 Ga0070681_10359658 3300005458 Bacteria 1366
170 Ga0068867_100000009 3300005459 Bacteria 137021
171 Ga0068867_100010488 3300005459 Bacteria 6536
172 Ga0068867_100014480 3300005459 Bacteria 5589
173 Ga0068867_100141052 3300005459 Bacteria 1884
174 Ga0068867_100212467 3300005459 Bacteria 1554
175 Ga0070707_100002462 3300005468 Bacteria 17638
176 Ga0070698_100153526 3300005471 Bacteria 2249
177 Ga0070699_100018911 3300005518 Bacteria 5924
178 Ga0070699_100068978 3300005518 Bacteria 3072
179 Ga0070679_100028399 3300005530 Bacteria 5515
180 Ga0070679_100028853 3300005530 Bacteria 5473
181 Ga0070679_100031597 3300005530 Bacteria 5232
182 Ga0070679_100032305 3300005530 Bacteria 5176
183 Ga0070679_100078547 3300005530 Bacteria 3289
184 Ga0070679_100132969 3300005530 Bacteria 2469
185 Ga0070679_100321954 3300005530 Bacteria 1495
186 Ga0070679_100345940 3300005530 Bacteria 1435
187 Ga0070684_100027814 3300005535 Bacteria 4776
188 Ga0070697_100118843 3300005536 Bacteria 2209
189 Ga0070697_100229209 3300005536 Bacteria 1584
190 Ga0068853_100000490 3300005539 Bacteria 27013
191 Ga0068853_100001865 3300005539 Bacteria 15492
192 Ga0068853_100038328 3300005539 Bacteria 4081
193 Ga0068853_100154611 3300005539 Bacteria 2066
194 Ga0068853_100161664 3300005539 Bacteria 2021
195 Ga0070672_100002940 3300005543 Bacteria 10968
196 Ga0070672_100497323 3300005543 Bacteria 1054
197 Ga0070696_100003725 3300005546 Bacteria 10173
198 Ga0070696_100148847 3300005546 Archaea 1717
199 Ga0070693_100016243 3300005547 Bacteria 3849
200 Ga0070693_100205483 3300005547 Bacteria 1282
201 Ga0070665_100000079 3300005548 Bacteria 186925
202 Ga0070665_100053373 3300005548 Bacteria 4054
203 Ga0070665_100174748 3300005548 Bacteria 2149
204 Ga0070704_100242153 3300005549 Bacteria 1477
205 Ga0068855_100000040 3300005563 Bacteria 153617
206 Ga0068855_100006774 3300005563 Bacteria 13899
207 Ga0068855_100010819 3300005563 Bacteria 11018
208 Ga0068855_100013556 3300005563 Bacteria 9833
209 Ga0068855_100059685 3300005563 Bacteria 4462
210 Ga0068855_100092167 3300005563 Bacteria 3494
211 Ga0068855_100179588 3300005563 Bacteria 2394
212 Ga0068855_100376394 3300005563 Bacteria 1560
213 Ga0070664_100066229 3300005564 Bacteria 3084
214 Ga0070664_100102469 3300005564 Bacteria 2490
215 Ga0070664_100219990 3300005564 Bacteria 1699
216 Ga0070664_100224747 3300005564 Bacteria 1680
217 Ga0068857_100003398 3300005577 Bacteria 13258
218 Ga0068857_100036094 3300005577 Bacteria 4380
219 Ga0068857_100190133 3300005577 Bacteria 1870
220 Ga0068857_100234602 3300005577 Bacteria 1678
221 Ga0068857_100507083 3300005577 Bacteria 1133
222 Ga0068857_100523620 3300005577 Bacteria 1114
223 Ga0068854_100000259 3300005578 Bacteria 36169
224 Ga0068854_100009382 3300005578 Bacteria 6318
225 Ga0068854_100034186 3300005578 Bacteria 3549
226 Ga0068854_100037446 3300005578 Bacteria 3405
227 Ga0068854_100063354 3300005578 Bacteria 2684
228 Ga0068854_100151179 3300005578 Bacteria 1790
229 Ga0068854_100232983 3300005578 Bacteria 1462
230 Ga0068856_100003650 3300005614 Bacteria 15458
231 Ga0068856_100287513 3300005614 Bacteria 1661
232 Ga0068852_100004798 3300005616 Bacteria 9603
233 Ga0068852_100006128 3300005616 Bacteria 8672
234 Ga0068852_100017160 3300005616 Bacteria 5673
235 Ga0068852_100091137 3300005616 Bacteria 2728
236 Ga0068852_100162017 3300005616 Bacteria 2089
237 Ga0068852_100286571 3300005616 Bacteria 1589
238 Ga0068859_100000256 3300005617 Bacteria 52870
239 Ga0068859_100000442 3300005617 Bacteria 41408
240 Ga0068859_100009578 3300005617 Bacteria 9783
241 Ga0068859_100010242 3300005617 Bacteria 9436
242 Ga0068859_100015774 3300005617 Bacteria 7593
243 Ga0068859_100018998 3300005617 Bacteria 6902
244 Ga0068859_100029609 3300005617 Bacteria 5494
245 Ga0068859_100114703 3300005617 Bacteria 2758
246 Ga0068864_100000100 3300005618 Bacteria 85101
247 Ga0068864_100007063 3300005618 Bacteria 9218
248 Ga0068864_100008948 3300005618 Bacteria 8254
249 Ga0068864_100026684 3300005618 Bacteria 4871
250 Ga0068861_100000063 3300005719 Bacteria 51048
251 Ga0068861_100001909 3300005719 Bacteria 13415
252 Ga0068861_100011417 3300005719 Bacteria 6175
253 Ga0068851_10003428 3300005834 Bacteria 7056
254 Ga0068851_10024392 3300005834 Bacteria 2960
255 Ga0068851_10070258 3300005834 Bacteria 1810
256 Ga0068851_10092143 3300005834 Bacteria 1596
257 Ga0068851_10108531 3300005834 Bacteria 1480
258 Ga0068870_10013846 3300005840 Bacteria 3799
259 Ga0068863_100000025 3300005841 Bacteria 186072
260 Ga0068863_100000040 3300005841 Bacteria 158465
261 Ga0068863_100000576 3300005841 Bacteria 37385
262 Ga0068863_100001264 3300005841 Bacteria 25207
263 Ga0068863_100002638 3300005841 Bacteria 17757
264 Ga0068863_100006668 3300005841 Bacteria 11332
265 Ga0068863_100037797 3300005841 Bacteria 4594
266 Ga0068863_100143232 3300005841 Bacteria 2285
267 Ga0068858_100002936 3300005842 Bacteria 17158
268 Ga0068858_100004155 3300005842 Bacteria 14245
269 Ga0068858_100005425 3300005842 Bacteria 12494
270 Ga0068858_100028254 3300005842 Bacteria 5211
271 Ga0068858_100041218 3300005842 Bacteria 4282
272 Ga0068860_100000473 3300005843 Bacteria 49993
273 Ga0068860_100000812 3300005843 Bacteria 34919
274 Ga0068860_100010214 3300005843 Bacteria 9290
275 Ga0068860_100010895 3300005843 Bacteria 8967
276 Ga0068860_100030395 3300005843 Bacteria 5195
277 Ga0068860_100032158 3300005843 Bacteria 5043
278 Ga0068860_100118059 3300005843 Bacteria 2539
279 Ga0068862_100000014 3300005844 Bacteria 251552
280 Ga0068862_100000027 3300005844 Bacteria 186072
281 Ga0068862_100000310 3300005844 Bacteria 53315
282 Ga0068862_100021652 3300005844 Bacteria 5375
283 Ga0068862_100035470 3300005844 Bacteria 4225
284 Ga0068862_100051191 3300005844 Bacteria 3531
285 Ga0068862_100156221 3300005844 Bacteria 2033
286 Ga0068862_100267069 3300005844 Bacteria 1564
287 Ga0081455_10143107 3300005937 Bacteria 1854
288 Ga0081539_10041438 3300005985 Bacteria 2691
289 Ga0081539_10063347 3300005985 Bacteria 2018
290 Ga0070717_10251370 3300006028 Bacteria 1562
291 Ga0075364_10020342 3300006051 Bacteria 4174
292 Ga0075364_10024319 3300006051 Bacteria 3845
293 Ga0075432_10055756 3300006058 Bacteria 1400
294 Ga0070716_100001330 3300006173 Bacteria 10940
295 Ga0075362_10041739 3300006177 Bacteria 2024
296 Ga0075369_10018437 3300006186 Bacteria 2841
297 Ga0075366_10086130 3300006195 Bacteria 1880
298 Ga0075366_10129777 3300006195 Bacteria 1521
299 Ga0075370_10060482 3300006353 Bacteria 2158
300 Ga0075428_100191014 3300006844 Bacteria 2215
301 Ga0075431_100027520 3300006847 Bacteria 5836
302 Ga0075433_10026279 3300006852 Bacteria 4927
303 Ga0075434_100027782 3300006871 Bacteria 5555
304 Ga0068865_100000005 3300006881 Bacteria 213248
305 Ga0068865_100154166 3300006881 Bacteria 1746
306 Ga0075436_100029866 3300006914 Bacteria 3749
307 Ga0097620_100000256 3300006931 Bacteria 52870
308 Ga0097620_100000442 3300006931 Bacteria 41408
309 Ga0097620_100009578 3300006931 Bacteria 9783
310 Ga0097620_100010242 3300006931 Bacteria 9436
311 Ga0097620_100015774 3300006931 Bacteria 7593
312 Ga0097620_100018998 3300006931 Bacteria 6902
313 Ga0097620_100029609 3300006931 Bacteria 5494
314 Ga0097620_100114704 3300006931 Bacteria 2758
315 Ga0105251_10000159 3300009011 Bacteria 68974
316 Ga0105251_10000232 3300009011 Bacteria 56006
317 Ga0105250_10005152 3300009092 Bacteria 5900
318 Ga0105240_10000867 3300009093 Bacteria 54480
319 Ga0105240_10001331 3300009093 Bacteria 42512
320 Ga0105240_10002301 3300009093 Bacteria 30895
321 Ga0105240_10029739 3300009093 Bacteria 7109
322 Ga0105240_10041737 3300009093 Bacteria 5851
323 Ga0105240_10069217 3300009093 Bacteria 4369
324 Ga0105240_10069861 3300009093 Bacteria 4346
325 Ga0105240_10164425 3300009093 Bacteria 2633
326 Ga0105240_10244333 3300009093 Bacteria 2079
327 Ga0105240_10484320 3300009093 Bacteria 1378
328 Ga0105245_10007234 3300009098 Bacteria 9724
329 Ga0105247_10000692 3300009101 Bacteria 26532
330 Ga0105247_10005638 3300009101 Bacteria 7854
331 Ga0105247_10011543 3300009101 Bacteria 5320
332 Ga0105247_10011571 3300009101 Bacteria 5315
333 Ga0105247_10036943 3300009101 Bacteria 2979
334 Ga0114129_10407027 3300009147 Bacteria 1792
335 Ga0105243_10000032 3300009148 Bacteria 183324
336 Ga0105243_10042605 3300009148 Bacteria 3554
337 Ga0105241_10008644 3300009174 Bacteria 7486
338 Ga0105241_10059775 3300009174 Bacteria 2931
339 Ga0105241_10086848 3300009174 Bacteria 2460
340 Ga0105241_10195252 3300009174 Bacteria 1687
341 Ga0105241_10209539 3300009174 Bacteria 1632
342 Ga0105242_10000166 3300009176 Bacteria 49832
343 Ga0105248_10000026 3300009177 Bacteria 257155
344 Ga0105248_10000785 3300009177 Bacteria 35691
345 Ga0105248_10001383 3300009177 Bacteria 27020
346 Ga0105248_10002368 3300009177 Bacteria 20929
347 Ga0105248_10008545 3300009177 Bacteria 11240
348 Ga0105248_10138668 3300009177 Bacteria 2743
349 Ga0105248_10393016 3300009177 Bacteria 1561
350 Ga0105237_10000303 3300009545 Bacteria 68288
351 Ga0105237_10017167 3300009545 Bacteria 7507
352 Ga0105237_10023330 3300009545 Bacteria 6341
353 Ga0105237_10085934 3300009545 Bacteria 3136
354 Ga0105237_10133456 3300009545 Bacteria 2478
355 Ga0105237_10350075 3300009545 Bacteria 1482
356 Ga0105238_10002601 3300009551 Bacteria 17995
357 Ga0105238_10056205 3300009551 Bacteria 3949
358 Ga0105238_10059364 3300009551 Bacteria 3832
359 Ga0105238_10075403 3300009551 Bacteria 3365
360 Ga0105238_10231489 3300009551 Bacteria 1824
361 Ga0105249_10000002 3300009553 Bacteria 376207
362 Ga0105249_10000061 3300009553 Bacteria 153313
363 Ga0105249_10000110 3300009553 Bacteria 111292
364 Ga0105249_10019428 3300009553 Bacteria 6063
365 Ga0105249_10021831 3300009553 Bacteria 5732
366 Ga0105249_10064119 3300009553 Bacteria 3377
367 Ga0105249_10069928 3300009553 Bacteria 3240
368 Ga0105239_10000151 3300010375 Bacteria 99979
369 Ga0105239_10000271 3300010375 Bacteria 76812
370 Ga0105239_10123564 3300010375 Bacteria 2876
371 Ga0105239_10180266 3300010375 Bacteria 2363
372 Ga0105246_10000160 3300011119 Bacteria 32154
373 Ga0105246_10001368 3300011119 Bacteria 14374
374 Ga0157326_1000175 3300012513 Bacteria 7108
375 Ga0157373_10024313 3300013100 Bacteria 4390
376 Ga0157373_10047838 3300013100 Bacteria 3050
377 Ga0157373_10250440 3300013100 Bacteria 1253
378 Ga0157371_10000062 3300013102 Bacteria 169669
379 Ga0157371_10021298 3300013102 Bacteria 4761
380 Ga0157370_10024341 3300013104 Bacteria 5995
381 Ga0157370_10059080 3300013104 Bacteria 3645
382 Ga0157370_10207164 3300013104 Bacteria 1818
383 Ga0157369_10003257 3300013105 Bacteria 19330
384 Ga0157369_10018458 3300013105 Bacteria 7820
385 Ga0157369_10058845 3300013105 Bacteria 4144
386 Ga0157369_10076259 3300013105 Bacteria 3594
387 Ga0157369_10238530 3300013105 Bacteria 1899
388 Ga0157369_10275353 3300013105 Bacteria 1753
389 Ga0157374_10000134 3300013296 Bacteria 67433
390 Ga0157378_10009372 3300013297 Bacteria 8529
391 Ga0157378_10045278 3300013297 Bacteria 3909
392 Ga0163162_10021139 3300013306 Bacteria 6401
393 Ga0163162_10079336 3300013306 Bacteria 3349
394 Ga0163162_10298481 3300013306 Bacteria 1743
395 Ga0163162_10311287 3300013306 Bacteria 1707
396 Ga0157372_10129059 3300013307 Bacteria 2908
397 Ga0157372_10181482 3300013307 Bacteria 2437
398 Ga0157372_10501534 3300013307 Bacteria 1415
399 Ga0157372_10579879 3300013307 Bacteria 1307
400 Ga0157375_10000242 3300013308 Bacteria 50251
401 Ga0157375_10089002 3300013308 Bacteria 3143
402 Ga0163163_10000139 3300014325 Bacteria 75197
403 Ga0163163_10046351 3300014325 Bacteria 4271
404 Ga0163163_10086154 3300014325 Bacteria 3150
405 Ga0163163_10094269 3300014325 Bacteria 3011
406 Ga0157380_10001834 3300014326 Bacteria 14037
407 Ga0157380_10020143 3300014326 Bacteria 4983
408 Ga0157380_10106046 3300014326 Bacteria 2351
409 Ga0157380_10374770 3300014326 Bacteria 1341
410 Ga0182008_10005339 3300014497 Bacteria 7337
411 Ga0157379_10038845 3300014968 Bacteria 4246
412 Ga0157379_10042887 3300014968 Bacteria 4040
413 Ga0157379_10151323 3300014968 Bacteria 2093
414 Ga0157376_10000111 3300014969 Bacteria 58460
415 Ga0157376_10134214 3300014969 Bacteria 2213
416 Ga0157376_10290716 3300014969 Bacteria 1543
417 Ga0183363_1003 3300015690 Bacteria 421263
418 Ga0163161_10001166 3300017792 Bacteria 19753
419 Ga0163161_10025334 3300017792 Bacteria 4198
420 Ga0163161_10139979 3300017792 Bacteria 1832
421 Ga0163161_10204056 3300017792 Bacteria 1524
422 Ga0197907_10074559 3300020069 Eukaryota 1324
423 Ga0206353_10063925 3300020082 Bacteria 1096
424 Ga0206353_10399482 3300020082 Bacteria 1599
425 Ga0213873_10000016 3300021358 Bacteria 124829
426 Ga0213872_10007647 3300021361 Bacteria 5296
427 Ga0213872_10088520 3300021361 Bacteria 1386
428 Ga0213876_10000056 3300021384 Bacteria 135017
429 Ga0213876_10162713 3300021384 Bacteria 1187
430 Ga0213876_10189706 3300021384 Bacteria 1093
431 Ga0207425_1000005 3300025245 Bacteria 900502
432 Ga0209646_1011061 3300025246 Bacteria 1403
433 Ga0209677_107269 3300025253 Bacteria 2395
434 Ga0209148_1000160 3300025254 Bacteria 139522
435 Ga0209148_1001582 3300025254 Bacteria 10766
436 Ga0209129_1001349 3300025258 Bacteria 13861
437 Ga0209565_1000029 3300025263 Bacteria 340335
438 Ga0209565_1000272 3300025263 Bacteria 52468
439 Ga0209455_1000749 3300025272 Bacteria 18574
440 Ga0209673_1011390 3300025273 Bacteria 3672
441 Ga0209675_1000472 3300025291 Bacteria 30895
442 Ga0209676_1000226 3300025292 Bacteria 124004
443 Ga0209676_1000387 3300025292 Bacteria 80494
444 Ga0209676_1000760 3300025292 Bacteria 43458
445 Ga0209676_1005732 3300025292 Bacteria 6374
446 Ga0209025_1000477 3300025294 Bacteria 77692
447 Ga0209025_1014061 3300025294 Bacteria 4967
448 Ga0209564_1000949 3300025295 Bacteria 37130
449 Ga0209564_1018313 3300025295 Bacteria 2677
450 Ga0209758_1000002 3300025297 Bacteria 1400310
451 Ga0209050_1000001 3300025298 Bacteria 3563507
452 Ga0209050_1000167 3300025298 Bacteria 151608
453 Ga0209050_1000450 3300025298 Bacteria 74598
454 Ga0209050_1004367 3300025298 Bacteria 9601
455 Ga0209050_1012902 3300025298 Bacteria 3779
456 Ga0209050_1013829 3300025298 Bacteria 3543
457 Ga0209256_1000008 3300025299 Bacteria 975723
458 Ga0209051_1000472 3300025303 Bacteria 52350
459 Ga0209257_1000028 3300025304 Bacteria 699493
460 Ga0209257_1002265 3300025304 Bacteria 19641
461 Ga0209257_1002450 3300025304 Bacteria 18426
462 Ga0209257_1004307 3300025304 Bacteria 11188
463 Ga0209257_1005425 3300025304 Bacteria 8962
464 Ga0207697_10000312 3300025315 Bacteria 27160
465 Ga0207697_10001058 3300025315 Bacteria 15200
466 Ga0207656_10004486 3300025321 Bacteria 4880
467 Ga0207656_10020017 3300025321 Bacteria 2654
468 Ga0207656_10020092 3300025321 Bacteria 2650
469 Ga0207656_10034506 3300025321 Bacteria 2113
470 Ga0207713_1000491 3300025735 Bacteria 40778
471 Ga0207713_1001216 3300025735 Bacteria 21534
472 Ga0207682_10000353 3300025893 Bacteria 21055
473 Ga0207710_10002210 3300025900 Bacteria 9148
474 Ga0207710_10003921 3300025900 Bacteria 6572
475 Ga0207710_10006603 3300025900 Bacteria 4946
476 Ga0207710_10011439 3300025900 Bacteria 3737
477 Ga0207688_10033182 3300025901 Bacteria 2854
478 Ga0207688_10075641 3300025901 Bacteria 1917
479 Ga0207688_10103057 3300025901 Bacteria 1650
480 Ga0207680_10000298 3300025903 Bacteria 23556
481 Ga0207680_10049863 3300025903 Bacteria 2494
482 Ga0207647_10000301 3300025904 Bacteria 40628
483 Ga0207647_10000701 3300025904 Bacteria 26288
484 Ga0207647_10007823 3300025904 Bacteria 7693
485 Ga0207647_10095564 3300025904 Bacteria 1769
486 Ga0207647_10111901 3300025904 Bacteria 1614
487 Ga0207699_10167766 3300025906 Bacteria 1466
488 Ga0207645_10003327 3300025907 Bacteria 12262
489 Ga0207645_10003989 3300025907 Bacteria 11005
490 Ga0207645_10007479 3300025907 Bacteria 7710
491 Ga0207645_10066974 3300025907 Bacteria 2295
492 Ga0207645_10152287 3300025907 Bacteria 1510
493 Ga0207643_10048655 3300025908 Bacteria 2402
494 Ga0207643_10139735 3300025908 Bacteria 1446
495 Ga0207705_10000046 3300025909 Bacteria 177574
496 Ga0207705_10000073 3300025909 Bacteria 124226
497 Ga0207705_10000103 3300025909 Bacteria 97511
498 Ga0207705_10003277 3300025909 Bacteria 12330
499 Ga0207705_10010984 3300025909 Bacteria 6576
500 Ga0207705_10066862 3300025909 Bacteria 2600
501 Ga0207705_10127460 3300025909 Bacteria 1892
502 Ga0207654_10000150 3300025911 Bacteria 44134
503 Ga0207654_10000836 3300025911 Bacteria 16952
504 Ga0207654_10003282 3300025911 Bacteria 8177
505 Ga0207654_10062980 3300025911 Bacteria 2175
506 Ga0207654_10151892 3300025911 Bacteria 1487
507 Ga0207654_10297958 3300025911 Bacteria 1096
508 Ga0207707_10000423 3300025912 Bacteria 44206
509 Ga0207707_10004235 3300025912 Bacteria 12698
510 Ga0207707_10015113 3300025912 Bacteria 6720
511 Ga0207707_10019058 3300025912 Bacteria 5987
512 Ga0207707_10020753 3300025912 Bacteria 5738
513 Ga0207707_10028894 3300025912 Bacteria 4846
514 Ga0207707_10075505 3300025912 Bacteria 2941
515 Ga0207707_10264273 3300025912 Bacteria 1492
516 Ga0207707_10291043 3300025912 Bacteria 1413
517 Ga0207707_10293737 3300025912 Bacteria 1406
518 Ga0207695_10002890 3300025913 Bacteria 24889
519 Ga0207695_10005103 3300025913 Bacteria 17590
520 Ga0207695_10005114 3300025913 Bacteria 17565
521 Ga0207695_10008637 3300025913 Bacteria 12718
522 Ga0207695_10008997 3300025913 Bacteria 12425
523 Ga0207695_10012367 3300025913 Bacteria 10252
524 Ga0207695_10050060 3300025913 Bacteria 4398
525 Ga0207695_10111754 3300025913 Bacteria 2711
526 Ga0207695_10142285 3300025913 Bacteria 2346
527 Ga0207695_10151872 3300025913 Bacteria 2255
528 Ga0207695_10196709 3300025913 Bacteria 1932
529 Ga0207695_10227666 3300025913 Bacteria 1770
530 Ga0207671_10000592 3300025914 Bacteria 48411
531 Ga0207671_10000881 3300025914 Bacteria 37996
532 Ga0207671_10002796 3300025914 Bacteria 18194
533 Ga0207671_10006341 3300025914 Bacteria 10553
534 Ga0207671_10007591 3300025914 Bacteria 9385
535 Ga0207671_10039482 3300025914 Bacteria 3495
536 Ga0207660_10008593 3300025917 Bacteria 6607
537 Ga0207660_10029939 3300025917 Bacteria 3739
538 Ga0207660_10040194 3300025917 Bacteria 3273
539 Ga0207660_10053794 3300025917 Bacteria 2871
540 Ga0207660_10067313 3300025917 Bacteria 2594
541 Ga0207660_10080481 3300025917 Bacteria 2392
542 Ga0207660_10231439 3300025917 Bacteria 1453
543 Ga0207660_10397361 3300025917 Bacteria 1110
544 Ga0207662_10095943 3300025918 Bacteria 1831
545 Ga0207662_10120637 3300025918 Bacteria 1644
546 Ga0207657_10001746 3300025919 Bacteria 23433
547 Ga0207657_10005880 3300025919 Bacteria 12781
548 Ga0207657_10009564 3300025919 Bacteria 9730
549 Ga0207657_10026923 3300025919 Bacteria 5273
550 Ga0207657_10041643 3300025919 Bacteria 4059
551 Ga0207657_10044453 3300025919 Bacteria 3904
552 Ga0207657_10054674 3300025919 Bacteria 3451
553 Ga0207657_10081288 3300025919 Bacteria 2722
554 Ga0207657_10173587 3300025919 Bacteria 1745
555 Ga0207657_10203639 3300025919 Bacteria 1591
556 Ga0207657_10213794 3300025919 Bacteria 1547
557 Ga0207649_10002862 3300025920 Bacteria 9518
558 Ga0207649_10039967 3300025920 Bacteria 2847
559 Ga0207649_10060458 3300025920 Bacteria 2381
560 Ga0207649_10168566 3300025920 Bacteria 1523
561 Ga0207652_10001835 3300025921 Bacteria 18411
562 Ga0207652_10016980 3300025921 Bacteria 5953
563 Ga0207652_10022155 3300025921 Bacteria 5251
564 Ga0207652_10024980 3300025921 Bacteria 4962
565 Ga0207652_10074434 3300025921 Bacteria 2957
566 Ga0207652_10116860 3300025921 Bacteria 2370
567 Ga0207652_10172984 3300025921 Bacteria 1938
568 Ga0207652_10187730 3300025921 Bacteria 1858
569 Ga0207652_10198852 3300025921 Bacteria 1804
570 Ga0207652_10347530 3300025921 Bacteria 1339
571 Ga0207646_10001573 3300025922 Bacteria 27938
572 Ga0207681_10000004 3300025923 Bacteria 559005
573 Ga0207681_10000260 3300025923 Bacteria 40385
574 Ga0207681_10000274 3300025923 Bacteria 38677
575 Ga0207681_10004134 3300025923 Bacteria 9000
576 Ga0207681_10157179 3300025923 Bacteria 1710
577 Ga0207681_10226613 3300025923 Bacteria 1449
578 Ga0207694_10001416 3300025924 Bacteria 20546
579 Ga0207694_10003304 3300025924 Bacteria 12831
580 Ga0207694_10011065 3300025924 Bacteria 6814
581 Ga0207694_10050606 3300025924 Bacteria 3218
582 Ga0207694_10083568 3300025924 Bacteria 2511
583 Ga0207694_10101530 3300025924 Bacteria 2280
584 Ga0207694_10112161 3300025924 Bacteria 2170
585 Ga0207650_10000243 3300025925 Bacteria 59507
586 Ga0207650_10003098 3300025925 Bacteria 11452
587 Ga0207650_10026696 3300025925 Bacteria 4123
588 Ga0207687_10084324 3300025927 Bacteria 2303
589 Ga0207644_10000008 3300025931 Bacteria 354219
590 Ga0207644_10000009 3300025931 Bacteria 251643
591 Ga0207644_10000035 3300025931 Bacteria 131979
592 Ga0207644_10000301 3300025931 Bacteria 32173
593 Ga0207644_10018490 3300025931 Bacteria 4716
594 Ga0207644_10056208 3300025931 Bacteria 2839
595 Ga0207644_10098416 3300025931 Bacteria 2192
596 Ga0207690_10015458 3300025932 Bacteria 4626
597 Ga0207690_10092013 3300025932 Bacteria 2145
598 Ga0207690_10125324 3300025932 Bacteria 1872
599 Ga0207706_10000489 3300025933 Bacteria 42307
600 Ga0207706_10002195 3300025933 Bacteria 19021
601 Ga0207706_10006049 3300025933 Bacteria 11256
602 Ga0207706_10006210 3300025933 Bacteria 11101
603 Ga0207706_10124921 3300025933 Bacteria 2263
604 Ga0207686_10000250 3300025934 Bacteria 40936
605 Ga0207709_10000051 3300025935 Bacteria 227968
606 Ga0207709_10023531 3300025935 Bacteria 3507
607 Ga0207669_10063701 3300025937 Bacteria 2277
608 Ga0207704_10000001 3300025938 Bacteria 716296
609 Ga0207704_10042745 3300025938 Bacteria 2670
610 Ga0207704_10072732 3300025938 Bacteria 2187
611 Ga0207704_10193535 3300025938 Bacteria 1481
612 Ga0207665_10001828 3300025939 Bacteria 14321
613 Ga0207691_10000784 3300025940 Bacteria 31530
614 Ga0207691_10212909 3300025940 Bacteria 1678
615 Ga0207691_10662643 3300025940 Bacteria 881
616 Ga0207711_10000004 3300025941 Bacteria 870636
617 Ga0207711_10000571 3300025941 Bacteria 37524
618 Ga0207711_10000673 3300025941 Bacteria 33946
619 Ga0207711_10004144 3300025941 Bacteria 12419
620 Ga0207711_10016447 3300025941 Bacteria 6147
621 Ga0207711_10017131 3300025941 Bacteria 6018
622 Ga0207711_10042522 3300025941 Bacteria 3872
623 Ga0207711_10045371 3300025941 Bacteria 3756
624 Ga0207711_10062216 3300025941 Bacteria 3220
625 Ga0207711_10452027 3300025941 Bacteria 1196
626 Ga0207689_10000059 3300025942 Bacteria 85713
627 Ga0207689_10112111 3300025942 Bacteria 2242
628 Ga0207689_10235722 3300025942 Bacteria 1513
629 Ga0207661_10105349 3300025944 Bacteria 2376
630 Ga0207661_10298609 3300025944 Bacteria 1443
631 Ga0207679_10097854 3300025945 Bacteria 2286
632 Ga0207679_10263971 3300025945 Bacteria 1470
633 Ga0207679_10398710 3300025945 Bacteria 1210
634 Ga0207667_10000001 3300025949 Bacteria 1178522
635 Ga0207667_10000024 3300025949 Bacteria 355874
636 Ga0207667_10000716 3300025949 Bacteria 43016
637 Ga0207667_10000881 3300025949 Bacteria 38298
638 Ga0207667_10001580 3300025949 Bacteria 28640
639 Ga0207667_10002081 3300025949 Bacteria 25073
640 Ga0207667_10003709 3300025949 Bacteria 18842
641 Ga0207667_10004218 3300025949 Bacteria 17642
642 Ga0207667_10034948 3300025949 Bacteria 5394
643 Ga0207667_10055895 3300025949 Bacteria 4148
644 Ga0207667_10056456 3300025949 Bacteria 4125
645 Ga0207667_10070268 3300025949 Bacteria 3644
646 Ga0207667_10161957 3300025949 Bacteria 2301
647 Ga0207651_10000006 3300025960 Bacteria 227893
648 Ga0207651_10005055 3300025960 Bacteria 6728
649 Ga0207712_10000002 3300025961 Bacteria 706628
650 Ga0207712_10000144 3300025961 Bacteria 74254
651 Ga0207712_10000311 3300025961 Bacteria 44496
652 Ga0207712_10014244 3300025961 Bacteria 5109
653 Ga0207712_10298350 3300025961 Bacteria 1321
654 Ga0207668_10000147 3300025972 Bacteria 48279
655 Ga0207668_10002842 3300025972 Bacteria 10147
656 Ga0207668_10005504 3300025972 Bacteria 7464
657 Ga0207668_10006180 3300025972 Bacteria 7066
658 Ga0207668_10032968 3300025972 Bacteria 3429
659 Ga0207668_10046230 3300025972 Bacteria 2973
660 Ga0207668_10069145 3300025972 Bacteria 2513
661 Ga0207668_10070549 3300025972 Bacteria 2492
662 Ga0207640_10000254 3300025981 Bacteria 36224
663 Ga0207640_10001543 3300025981 Bacteria 12411
664 Ga0207640_10002074 3300025981 Bacteria 10800
665 Ga0207640_10012044 3300025981 Bacteria 4915
666 Ga0207640_10014644 3300025981 Bacteria 4519
667 Ga0207640_10036511 3300025981 Bacteria 3086
668 Ga0207640_10056542 3300025981 Bacteria 2576
669 Ga0207640_10062898 3300025981 Bacteria 2464
670 Ga0207640_10069894 3300025981 Bacteria 2359
671 Ga0207640_10119803 3300025981 Bacteria 1883
672 Ga0207640_10186160 3300025981 Bacteria 1561
673 Ga0207640_10381406 3300025981 Bacteria 1142
674 Ga0207658_10000287 3300025986 Bacteria 52758
675 Ga0207658_10001852 3300025986 Bacteria 15833
676 Ga0207658_10006778 3300025986 Bacteria 7800
677 Ga0207658_10009773 3300025986 Bacteria 6514
678 Ga0207658_10010486 3300025986 Bacteria 6293
679 Ga0207658_10011407 3300025986 Bacteria 6048
680 Ga0207658_10012640 3300025986 Bacteria 5766
681 Ga0207658_10012726 3300025986 Bacteria 5746
682 Ga0207658_10034186 3300025986 Bacteria 3631
683 Ga0207658_10097040 3300025986 Bacteria 2300
684 Ga0207658_10395802 3300025986 Bacteria 1213
685 Ga0207677_10111773 3300026023 Bacteria 2036
686 Ga0207677_10140350 3300026023 Bacteria 1849
687 Ga0207703_10002484 3300026035 Bacteria 15989
688 Ga0207703_10002643 3300026035 Bacteria 15438
689 Ga0207703_10042797 3300026035 Bacteria 3633
690 Ga0207703_10125579 3300026035 Bacteria 2208
691 Ga0207639_10005274 3300026041 Bacteria 8724
692 Ga0207639_10015767 3300026041 Bacteria 5333
693 Ga0207639_10029484 3300026041 Bacteria 4018
694 Ga0207639_10046271 3300026041 Bacteria 3282
695 Ga0207639_10133388 3300026041 Bacteria 2059
696 Ga0207639_10134557 3300026041 Bacteria 2051
697 Ga0207639_10163844 3300026041 Bacteria 1876
698 Ga0207639_10239306 3300026041 Bacteria 1577
699 Ga0207639_10249595 3300026041 Bacteria 1547
700 Ga0207678_10038375 3300026067 Bacteria 4162
701 Ga0207678_10080522 3300026067 Bacteria 2788
702 Ga0207678_10118381 3300026067 Bacteria 2260
703 Ga0207708_10146702 3300026075 Bacteria 1855
704 Ga0207708_10335931 3300026075 Bacteria 1236
705 Ga0207702_10000727 3300026078 Bacteria 35312
706 Ga0207702_10001637 3300026078 Bacteria 22151
707 Ga0207702_10009596 3300026078 Bacteria 8125
708 Ga0207702_10043031 3300026078 Bacteria 3790
709 Ga0207702_10055491 3300026078 Bacteria 3360
710 Ga0207702_10099945 3300026078 Bacteria 2558
711 Ga0207702_10340022 3300026078 Bacteria 1434
712 Ga0207641_10000018 3300026088 Bacteria 298209
713 Ga0207641_10000039 3300026088 Bacteria 199453
714 Ga0207641_10000098 3300026088 Bacteria 123514
715 Ga0207641_10000500 3300026088 Bacteria 44148
716 Ga0207641_10001788 3300026088 Bacteria 20704
717 Ga0207641_10006496 3300026088 Bacteria 9846
718 Ga0207641_10007735 3300026088 Bacteria 8934
719 Ga0207641_10111036 3300026088 Bacteria 2430
720 Ga0207648_10000022 3300026089 Bacteria 137000
721 Ga0207648_10018143 3300026089 Bacteria 6374
722 Ga0207648_10129184 3300026089 Bacteria 2224
723 Ga0207648_10382161 3300026089 Bacteria 1273
724 Ga0207676_10000027 3300026095 Bacteria 245868
725 Ga0207676_10001441 3300026095 Bacteria 17694
726 Ga0207676_10008948 3300026095 Bacteria 7124
727 Ga0207676_10023166 3300026095 Bacteria 4576
728 Ga0207676_10023901 3300026095 Bacteria 4516
729 Ga0207674_10001869 3300026116 Bacteria 26815
730 Ga0207674_10011227 3300026116 Bacteria 10066
731 Ga0207674_10011292 3300026116 Bacteria 10038
732 Ga0207674_10019862 3300026116 Bacteria 7270
733 Ga0207674_10099608 3300026116 Bacteria 2888
734 Ga0207674_10099843 3300026116 Bacteria 2884
735 Ga0207674_10170119 3300026116 Bacteria 2133
736 Ga0207674_10200621 3300026116 Bacteria 1944
737 Ga0207674_10249440 3300026116 Bacteria 1722
738 Ga0207674_10276710 3300026116 Bacteria 1626
739 Ga0207675_100000613 3300026118 Bacteria 34803
740 Ga0207675_100005808 3300026118 Bacteria 11793
741 Ga0207675_100011460 3300026118 Bacteria 8292
742 Ga0207675_100106354 3300026118 Bacteria 2645
743 Ga0207683_10012052 3300026121 Bacteria 7381
744 Ga0207683_10049848 3300026121 Bacteria 3666
745 Ga0207698_10000308 3300026142 Bacteria 29436
746 Ga0207698_10004831 3300026142 Bacteria 8254
747 Ga0207698_10008742 3300026142 Bacteria 6422
748 Ga0207698_10012219 3300026142 Bacteria 5608
749 Ga0207698_10020890 3300026142 Bacteria 4517
750 Ga0207698_10040422 3300026142 Bacteria 3465
751 Ga0207698_10265394 3300026142 Bacteria 1579
752 Ga0207698_10318589 3300026142 Bacteria 1455
753 Ga0207698_10329487 3300026142 Bacteria 1434
754 Ga0207698_10405887 3300026142 Bacteria 1303
755 Ga0209999_1003073 3300027543 Bacteria 2973
756 Ga0210002_1011448 3300027617 Bacteria 1370
757 Ga0209983_1014737 3300027665 Bacteria 1611
758 Ga0209974_10016711 3300027876 Bacteria 2435
759 Ga0207428_10054976 3300027907 Bacteria 3167
760 Ga0268266_10000175 3300028379 Bacteria 115897
761 Ga0268266_10330615 3300028379 Bacteria 1428
762 Ga0268265_10000042 3300028380 Bacteria 186086
763 Ga0268265_10000048 3300028380 Bacteria 178523
764 Ga0268265_10001374 3300028380 Bacteria 20668
765 Ga0268265_10023250 3300028380 Bacteria 4368
766 Ga0268265_10029848 3300028380 Bacteria 3921
767 Ga0268265_10059987 3300028380 Bacteria 2913
768 Ga0268265_10081867 3300028380 Bacteria 2550
769 Ga0268265_10103672 3300028380 Bacteria 2304
770 Ga0268264_10000069 3300028381 Bacteria 270492
771 Ga0268264_10000224 3300028381 Bacteria 110355
772 Ga0268264_10000743 3300028381 Bacteria 36984
773 Ga0268264_10006008 3300028381 Bacteria 10275
774 Ga0268264_10007424 3300028381 Bacteria 9155
775 Ga0268264_10018778 3300028381 Bacteria 5653
776 Ga0268264_10020235 3300028381 Bacteria 5439
777 Ga0268264_10027689 3300028381 Bacteria 4633
778 Ga0268264_10148564 3300028381 Bacteria 2099
779 Ga0265334_10056604 3300028573 Bacteria 1488
780 Ga0316182_1045715 3300030745 Bacteria 2682
781 Ga0307513_10011435 3300031456 Bacteria 11032
782 Ga0307408_100000067 3300031548 Bacteria 120790
783 Ga0307408_100011407 3300031548 Bacteria 5871
784 Ga0307408_100240539 3300031548 Bacteria 1487
785 Ga0307408_100292757 3300031548 Bacteria 1360
786 Ga0316579_10027068 3300031691 Bacteria 2600
787 Ga0307405_10004177 3300031731 Bacteria 6796
788 Ga0307405_10004673 3300031731 Bacteria 6508
789 Ga0307405_10013215 3300031731 Bacteria 4399
790 Ga0307405_10038349 3300031731 Bacteria 2887
791 Ga0307405_10102745 3300031731 Bacteria 1920
792 Ga0307405_10108448 3300031731 Bacteria 1876
793 Ga0307405_10124309 3300031731 Bacteria 1771
794 Ga0307405_10155505 3300031731 Bacteria 1613
795 Ga0307405_10158867 3300031731 Bacteria 1598
796 Ga0307405_10292087 3300031731 Bacteria 1232
797 Ga0307405_10383749 3300031731 Bacteria 1094
798 Ga0307413_10002129 3300031824 Bacteria 7947
799 Ga0307413_10003908 3300031824 Bacteria 6376
800 Ga0307413_10026545 3300031824 Bacteria 3193
801 Ga0307413_10057655 3300031824 Bacteria 2376
802 Ga0307413_10115736 3300031824 Bacteria 1805
803 Ga0307413_10141680 3300031824 Bacteria 1662
804 Ga0307413_10148402 3300031824 Bacteria 1631
805 Ga0307410_10029066 3300031852 Bacteria 3515
806 Ga0307410_10092179 3300031852 Bacteria 2153
807 Ga0307410_10093005 3300031852 Bacteria 2145
808 Ga0307410_10162412 3300031852 Bacteria 1675
809 Ga0307410_10170549 3300031852 Bacteria 1639
810 Ga0307410_10239030 3300031852 Bacteria 1406
811 Ga0307410_10276584 3300031852 Bacteria 1315
812 Ga0307406_10025473 3300031901 Bacteria 3542
813 Ga0307406_10027321 3300031901 Bacteria 3437
814 Ga0307406_10085005 3300031901 Bacteria 2114
815 Ga0307406_10239859 3300031901 Bacteria 1359
816 Ga0307406_10288367 3300031901 Bacteria 1255
817 Ga0307407_10028585 3300031903 Bacteria 2982
818 Ga0307407_10035819 3300031903 Bacteria 2730
819 Ga0307407_10077303 3300031903 Bacteria 2001
820 Ga0307407_10136573 3300031903 Bacteria 1576
821 Ga0307412_10000252 3300031911 Bacteria 34826
822 Ga0307412_10000540 3300031911 Bacteria 22480
823 Ga0307412_10007524 3300031911 Bacteria 6185
824 Ga0307412_10025962 3300031911 Bacteria 3635
825 Ga0307412_10027378 3300031911 Bacteria 3553
826 Ga0307412_10030738 3300031911 Bacteria 3385
827 Ga0307412_10049612 3300031911 Bacteria 2766
828 Ga0307412_10064345 3300031911 Bacteria 2478
829 Ga0307412_10139622 3300031911 Bacteria 1772
830 Ga0307412_10174817 3300031911 Bacteria 1609
831 Ga0307412_10226057 3300031911 Bacteria 1438
832 Ga0307409_100016478 3300031995 Bacteria 4891
833 Ga0307409_100039050 3300031995 Bacteria 3518
834 Ga0307409_100128373 3300031995 Bacteria 2161
835 Ga0307409_100152307 3300031995 Bacteria 2009
836 Ga0307409_100165435 3300031995 Bacteria 1940
837 Ga0307409_100302523 3300031995 Bacteria 1488
838 Ga0307409_100416179 3300031995 Bacteria 1288
839 Ga0307416_100020872 3300032002 Bacteria 4685
840 Ga0307416_100118645 3300032002 Bacteria 2351
841 Ga0307416_100275533 3300032002 Bacteria 1655
842 Ga0307416_100350597 3300032002 Bacteria 1493
843 Ga0307414_10000185 3300032004 Bacteria 42230
844 Ga0307414_10000398 3300032004 Bacteria 23554
845 Ga0307414_10003403 3300032004 Bacteria 8491
846 Ga0307414_10004530 3300032004 Bacteria 7557
847 Ga0307414_10007234 3300032004 Bacteria 6233
848 Ga0307414_10047611 3300032004 Bacteria 2952
849 Ga0307414_10157704 3300032004 Bacteria 1799
850 Ga0307414_10181692 3300032004 Bacteria 1692
851 Ga0307414_10240795 3300032004 Bacteria 1497
852 Ga0307414_10531306 3300032004 Bacteria 1045
853 Ga0307411_10002515 3300032005 Bacteria 8154
854 Ga0307411_10010490 3300032005 Bacteria 4942
855 Ga0307411_10033556 3300032005 Bacteria 3184
856 Ga0307411_10038405 3300032005 Bacteria 3020
857 Ga0307411_10046252 3300032005 Bacteria 2804
858 Ga0307411_10064838 3300032005 Bacteria 2447
859 Ga0307411_10086206 3300032005 Bacteria 2178
860 Ga0307411_10104058 3300032005 Bacteria 2015
861 Ga0307411_10182144 3300032005 Bacteria 1595
862 Ga0307415_100007852 3300032126 Bacteria 5867
863 Ga0307415_100098253 3300032126 Bacteria 2139
864 Ga0307415_100226331 3300032126 Bacteria 1503
865 Ga0316583_10005519 3300032133 Bacteria 4538
866 Ga0373948_0019815 3300034817 Bacteria 1276
867 Ga0373959_0004818 3300034820 Bacteria 2193
868 Ga0373940_0024327 3300035088 Bacteria 1569
869 Ga0373932_0006608 3300035112 Bacteria 2745
870 Ga0373941_0016082 3300035115 Bacteria 2027
871 Ga0373931_0028779 3300035691 Bacteria 2848
872 Ga0316582_0024908 3300036647 Bacteria 3586
873 Ga0316582_0233046 3300036647 Bacteria 1260
874 Ga0316584_0078234 3300036712 Bacteria 2477
875 Ga0395899_0047146 3300037312 Bacteria 3208
876 Ga0395900_0000380 3300037418 Bacteria 64150
877 Ga0395900_0021446 3300037418 Bacteria 6604
878 Ga0395900_0024980 3300037418 Bacteria 6115
879 Ga0395900_0028914 3300037418 Bacteria 5682
880 Ga0395900_0231169 3300037418 Bacteria 1859
881 Ga0395898_0020952 3300037466 Bacteria 6633
882 Ga0395898_0147210 3300037466 Bacteria 2254
883 Ga0395905_0001357 3300037471 Bacteria 29810
884 Ga0395905_0006585 3300037471 Bacteria 11667
885 Ga0395905_0009993 3300037471 Bacteria 9250
886 Ga0395905_0016465 3300037471 Bacteria 7028
887 Ga0395905_0024923 3300037471 Bacteria 5644
888 Ga0395905_0031754 3300037471 Bacteria 4969
889 Ga0395905_0124451 3300037471 Bacteria 2424
890 Ga0395905_0132126 3300037471 Bacteria 2348
891 Ga0395901_0003571 3300038443 Bacteria 15683
892 Ga0395901_0253429 3300038443 Bacteria 1833
893 Ga0395901_0393239 3300038443 Bacteria 1425
894 Ga0436365_0594533 3300039437 Bacteria 37835
895 Ga0436365_1385090 3300039437 Bacteria 1093
896 Ga0436365_1821495 3300039437 Bacteria 1908
897 Ga0436361_0330351 3300039447 Bacteria 13498
898 Ga0436361_0443819 3300039447 Bacteria 9532
899 Ga0436361_1020396 3300039447 Bacteria 1520
900 Ga0436362_0580304 3300039453 Bacteria 124869
901 Ga0439464_0004701 3300042439 Bacteria 3499
902 Ga0466973_0087873 3300044659 Bacteria 2691
903 Ga0466966_0000041 3300044684 Bacteria 97092
904 Ga0466966_0005296 3300044684 Bacteria 8481
905 Ga0466961_0092149 3300044693 Bacteria 1913
906 Ga0466970_0030510 3300044765 Bacteria 2843
907 Ga0466970_0040694 3300044765 Bacteria 2468
908 Ga0466957_0010185 3300044842 Bacteria 5383
909 Ga0466959_0006808 3300045049 Bacteria 7962
910 Ga0466967_0033536 3300045976 Bacteria 4347
911 Ga0495627_000598 3300046453 Bacteria 28785
912 Ga0495629_0000049 3300046459 Bacteria 109116
913 Ga0495638_0011014 3300046460 Bacteria 6249
914 Ga0495638_0034250 3300046460 Bacteria 3243
915 Ga0495653_0002923 3300046463 Bacteria 13669
916 Ga0495650_0012931 3300046471 Bacteria 4452
917 Ga0495580_0002459 3300046472 Bacteria 16192
918 Ga0495580_0005345 3300046472 Bacteria 10640
919 Ga0495585_0087990 3300046492 Bacteria 1676
920 Ga0495596_0000016 3300046500 Bacteria 117489
921 Ga0495596_0000247 3300046500 Bacteria 36077
922 Ga0495583_0000474 3300046506 Bacteria 58751
923 Ga0495583_0000577 3300046506 Bacteria 50418
924 Ga0495583_0004192 3300046506 Bacteria 10500
925 Ga0495606_0041089 3300046507 Bacteria 3103
926 Ga0495606_0128040 3300046507 Bacteria 1512
927 Ga0495610_0035531 3300046512 Bacteria 2557
928 Ga0495610_0052202 3300046512 Bacteria 1986
929 Ga0495620_0000761 3300046515 Bacteria 19766
930 Ga0495637_0000085 3300046520 Bacteria 72965
931 Ga0495643_0000555 3300046522 Bacteria 46241
932 Ga0495643_0000806 3300046522 Bacteria 34503
933 Ga0495643_0002033 3300046522 Bacteria 16829
934 Ga0495643_0008791 3300046522 Bacteria 6362
935 Ga0495648_0000114 3300046524 Bacteria 98677
936 Ga0495648_0022564 3300046524 Bacteria 4329
937 Ga0495663_0007342 3300046525 Bacteria 3044
938 Ga0495663_0009419 3300046525 Bacteria 2708
939 Ga0495663_0049882 3300046525 Bacteria 1293
940 Ga0495663_0054255 3300046525 Bacteria 1248
941 Ga0495642_0003949 3300046528 Bacteria 5802
942 Ga0495654_0030806 3300046530 Bacteria 2727
943 Ga0495654_0068032 3300046530 Bacteria 1694
944 Ga0495654_0095026 3300046530 Bacteria 1378
945 Ga0495598_0013057 3300046537 Bacteria 2051
946 Ga0495598_0053394 3300046537 Bacteria 1224
947 Ga0495609_0018276 3300046538 Bacteria 3249
948 Ga0495621_0002637 3300046539 Bacteria 4851
949 Ga0495621_0006066 3300046539 Bacteria 3510
950 Ga0495633_0000847 3300046558 Bacteria 26761
951 Ga0495633_0068583 3300046558 Bacteria 1655
952 Ga0495633_0081824 3300046558 Bacteria 1502
953 Ga0495633_0141236 3300046558 Bacteria 1113
954 Ga0495668_0000004 3300046616 Bacteria 574236
955 Ga0495668_0019846 3300046616 Bacteria 3868
956 Ga0495668_0209515 3300046616 Bacteria 1067
957 Ga0495625_0001219 3300046660 Bacteria 32635
958 Ga0495625_0001605 3300046660 Bacteria 26691
959 Ga0495625_0012265 3300046660 Bacteria 6950
960 Ga0495625_0056411 3300046660 Bacteria 2796
961 Ga0495661_0058386 3300046665 Bacteria 2300
962 Ga0495669_0025550 3300046684 Bacteria 2576
963 Ga0495669_0049749 3300046684 Bacteria 1878
964 Ga0495669_0089557 3300046684 Bacteria 1419
965 Ga0495624_0000070 3300046690 Bacteria 66024
966 Ga0495670_0000016 3300046691 Bacteria 128045
967 Ga0495670_0064401 3300046691 Bacteria 1847
968 Ga0495671_0000249 3300046692 Bacteria 46241
969 Ga0495671_0017383 3300046692 Bacteria 3829
970 Ga0495600_0009002 3300046809 Bacteria 6150
971 Ga0495674_0000123 3300047319 Bacteria 58638
972 Ga0495677_0073744 3300047445 Bacteria 1273
973 Ga0495673_0040173 3300047469 Bacteria 2116
974 Ga0495681_0002495 3300047470 Bacteria 13127
975 Ga0495681_0005245 3300047470 Bacteria 8704
976 Ga0495686_0000100 3300047472 Bacteria 180492
977 Ga0495593_0000610 3300047673 Bacteria 20414
978 Ga0495615_0000012 3300048090 Bacteria 64858
979 Ga0496100_0026550 3300048903 Bacteria 3551
980 Ga0496101_0050962 3300048904 Bacteria 2981
981 Ga0496101_0123697 3300048904 Bacteria 1958
982 Ga0496102_0000022 3300048905 Bacteria 246314
983 Ga0496102_0000321 3300048905 Bacteria 60110
984 Ga0496102_0053503 3300048905 Bacteria 3679
985 Ga0496102_0334039 3300048905 Bacteria 1427
986 Ga0496102_0731208 3300048905 Bacteria 912
987 Ga0496103_0000167 3300048906 Bacteria 68561
988 Ga0496103_0000199 3300048906 Bacteria 60032
989 Ga0496103_0148434 3300048906 Bacteria 1501
990 Ga0496104_0019331 3300048907 Bacteria 6229
991 Ga0496104_0060220 3300048907 Bacteria 3597
992 Ga0496104_0089183 3300048907 Bacteria 2946
993 Ga0496104_0236157 3300048907 Bacteria 1740
994 Ga0496105_0000847 3300048908 Bacteria 20846
995 Ga0496105_0010549 3300048908 Bacteria 7268
996 Ga0496105_0039344 3300048908 Bacteria 3898
997 Ga0496105_0055319 3300048908 Bacteria 3276
998 Ga0496105_0267698 3300048908 Bacteria 1381
999 Ga0496106_0007150 3300048909 Bacteria 8245
1000 Ga0496107_0025054 3300048910 Bacteria 4222
1001 Ga0496108_0000162 3300048911 Bacteria 63296
1002 Ga0496108_0124850 3300048911 Bacteria 2209
1003 Ga0496109_0000939 3300048912 Bacteria 24123
1004 Ga0496109_0399177 3300048912 Bacteria 1299
1005 Ga0496110_0087800 3300048913 Bacteria 2777
1006 Ga0496110_0098914 3300048913 Bacteria 2615
1007 Ga0496110_0103597 3300048913 Bacteria 2552
1008 Ga0496110_0225473 3300048913 Bacteria 1704
1009 Ga0496111_0093320 3300048914 Bacteria 2206
1010 Ga0496112_0000394 3300048915 Bacteria 28507
1011 Ga0496112_0001985 3300048915 Bacteria 16179
1012 Ga0496112_0061314 3300048915 Bacteria 3707
1013 Ga0496113_0000082 3300048916 Bacteria 41671
1014 Ga0496113_0002634 3300048916 Bacteria 10503
1015 Ga0496114_0007983 3300048917 Bacteria 8374
1016 Ga0496114_0008871 3300048917 Bacteria 7972
1017 Ga0496114_0016127 3300048917 Bacteria 6013
1018 Ga0496114_0190704 3300048917 Bacteria 1793
1019 Ga0496114_0386218 3300048917 Bacteria 1240
1020 Ga0496115_0000029 3300048918 Bacteria 141359
1021 Ga0496115_0004979 3300048918 Bacteria 9643
1022 Ga0496116_0000648 3300048919 Bacteria 45494
1023 Ga0496116_0018949 3300048919 Bacteria 5285
1024 Ga0496116_0025177 3300048919 Bacteria 4380
1025 Ga0496116_0027942 3300048919 Unclassified 4097
1026 Ga0496116_0061976 3300048919 Bacteria 2417
1027 Ga0496116_0083341 3300048919 Bacteria 1974
1028 Ga0496116_0192978 3300048919 Unclassified 1076
1029 Ga0496117_0000260 3300048920 Bacteria 99636
1030 Ga0496117_0000584 3300048920 Bacteria 60140
1031 Ga0496117_0007303 3300048920 Bacteria 10848
1032 Ga0496117_0043201 3300048920 Bacteria 3280
1033 Ga0496118_0000039 3300048921 Bacteria 305458
1034 Ga0496118_0000588 3300048921 Bacteria 60153
1035 Ga0496118_0000689 3300048921 Bacteria 54897
1036 Ga0496118_0009536 3300048921 Bacteria 9779
1037 Ga0496118_0010136 3300048921 Bacteria 9365
1038 Ga0496118_0042162 3300048921 Bacteria 3603
1039 Ga0496118_0092055 3300048921 Bacteria 2082
1040 Ga0496118_0139245 3300048921 Bacteria 1542
1041 Ga0496119_0034760 3300048922 Bacteria 3311
1042 Ga0496120_0006949 3300048923 Bacteria 8536
1043 Ga0496120_0045488 3300048923 Bacteria 2542
1044 Ga0496121_0000683 3300048924 Bacteria 63257
1045 Ga0496121_0000949 3300048924 Bacteria 52413
1046 Ga0496121_0002864 3300048924 Bacteria 25422
1047 Ga0496121_0005909 3300048924 Bacteria 15486
1048 Ga0496121_0007120 3300048924 Bacteria 13576
1049 Ga0496121_0007335 3300048924 Bacteria 13332
1050 Ga0496121_0056386 3300048924 Bacteria 3264
1051 Ga0496121_0098452 3300048924 Bacteria 2263
1052 Ga0496122_0000033 3300048925 Bacteria 324104
1053 Ga0496122_0000218 3300048925 Bacteria 127770
1054 Ga0496122_0006049 3300048925 Bacteria 14104
1055 Ga0496122_0050313 3300048925 Unclassified 3179
1056 Ga0496122_0101374 3300048925 Bacteria 1923
1057 Ga0496123_0000089 3300048926 Bacteria 179941
1058 Ga0496123_0000741 3300048926 Bacteria 52871
1059 Ga0496123_0002070 3300048926 Bacteria 25866
1060 Ga0496123_0010286 3300048926 Bacteria 8299
1061 Ga0496123_0060612 3300048926 Bacteria 2438
1062 Ga0496123_0155476 3300048926 Unclassified 1227
1063 Ga0496124_0000076 3300048927 Bacteria 215767
1064 Ga0496124_0000387 3300048927 Bacteria 80517
1065 Ga0496124_0007325 3300048927 Bacteria 11758
1066 Ga0496124_0011763 3300048927 Bacteria 8725
1067 Ga0496124_0021172 3300048927 Bacteria 5995
1068 Ga0496124_0139411 3300048927 Bacteria 1915
1069 Ga0496125_0000117 3300048928 Bacteria 176766
1070 Ga0496125_0071439 3300048928 Unclassified 2711
1071 Ga0496125_0086716 3300048928 Bacteria 2366
1072 Ga0496126_0000469 3300048929 Bacteria 80156
1073 Ga0496126_0008764 3300048929 Unclassified 10857
1074 Ga0496126_0179803 3300048929 Bacteria 1797
1075 Ga0496126_0239104 3300048929 Bacteria 1518
1076 Ga0501031_0216850 3300049568 Bacteria 1247
1077 Ga0501033_0059716 3300049570 Bacteria 2815
1078 Ga0501034_0042628 3300049571 Bacteria 4594
1079 Ga0501034_0407314 3300049571 Bacteria 1282
1080 Ga0501034_0423429 3300049571 Bacteria 1252
1081 Ga0501037_0247914 3300049573 Bacteria 1247
1082 Ga0501038_0121385 3300049574 Bacteria 2154
1083 Ga0501039_0062198 3300049575 Bacteria 2892
1084 Ga0501043_0055003 3300049579 Bacteria 3126
1085 Ga0501043_0063181 3300049579 Bacteria 2907
1086 Ga0501046_0088564 3300049580 Bacteria 2384
1087 Ga0501047_0000864 3300049581 Bacteria 30960
1088 Ga0501047_0026935 3300049581 Bacteria 5535
1089 Ga0501047_0073181 3300049581 Bacteria 3299
1090 Ga0501047_0441956 3300049581 Bacteria 1130
1091 Ga0501070_0314275 3300049586 Bacteria 1275
1092 Ga0501073_0197340 3300049589 Bacteria 1392
1093 Ga0501233_003600 3300049668 Bacteria 2792
1094 Ga0501225_0010631 3300049705 Bacteria 2605
1095 Ga0501281_03626 3300049777 Bacteria 1101
1096 Ga0501035_0037003 3300049822 Bacteria 4421
1097 Ga0501035_0116757 3300049822 Bacteria 2335
1098 Ga0501044_0070436 3300049823 Bacteria 3556
1099 Ga0501044_0152694 3300049823 Bacteria 2291
1100 Ga0501044_0261059 3300049823 Bacteria 1670
1101 nmdc:mga00v17_7478_c1 3300050491 Bacteria 5831
1102 nmdc:mga0k408_6415_c1 3300050493 Bacteria 4278
1103 nmdc:mga0k408_90392_c1 3300050493 Bacteria 1798
1104 nmdc:mga07m45_91046_c1 3300050496 Bacteria 1747
1105 nmdc:mga05p37_69169_c1 3300050507 Bacteria 4342
1106 nmdc:mga08y16_1605_c2 3300050511 Bacteria 21111
1107 nmdc:mga08x19_224069_c1 3300050514 Bacteria 1293
1108 nmdc:mga0sz30_125788_c1 3300050516 Bacteria 1128
1109 Ga0500643_000005 3300053087 Bacteria 539775
1110 Ga0500643_001098 3300053087 Bacteria 16256
1111 Ga0500643_003982 3300053087 Bacteria 6833
1112 Ga0500641_0000927 3300053096 Bacteria 10472
1113 Ga0500555_000457 3300053103 Bacteria 16951
1114 Ga0500556_0000522 3300053104 Bacteria 26239
1115 Ga0500556_0054774 3300053104 Bacteria 1453
1116 Ga0500562_048154 3300053108 Bacteria 1138
1117 Ga0500572_015101 3300053111 Bacteria 1942
1118 Ga0500592_012209 3300053116 Bacteria 1373
1119 Ga0500597_013253 3300053120 Bacteria 3052
1120 Ga0500607_001228 3300053121 Bacteria 23562
1121 Ga0500618_000711 3300053125 Bacteria 19286
1122 Ga0500618_000842 3300053125 Bacteria 16615
1123 Ga0500618_011359 3300053125 Bacteria 2364
1124 Ga0500642_0000007 3300053130 Bacteria 294238
1125 Ga0500658_0001207 3300053134 Bacteria 10507
1126 Ga0500568_0002901 3300053139 Bacteria 9847
1127 Ga0500574_013783 3300053141 Bacteria 1890
1128 Ga0500616_0019037 3300053153 Bacteria 3876
1129 Ga0500624_000007 3300053157 Bacteria 184487
1130 Ga0500624_000050 3300053157 Bacteria 80450
1131 Ga0500627_0000017 3300053158 Bacteria 119507
1132 Ga0500627_0028673 3300053158 Bacteria 2314
1133 Ga0500627_0079275 3300053158 Bacteria 1462
1134 Ga0500638_100469 3300053162 Bacteria 1350
1135 Ga0500636_0003403 3300053177 Bacteria 8947
1136 Ga0500636_0006756 3300053177 Bacteria 6604
1137 Ga0500637_0000061 3300053178 Bacteria 38370
1138 Ga0500645_000038 3300053730 Bacteria 112786
1139 Ga0500645_000637 3300053730 Bacteria 22300
1140 Ga0500645_004200 3300053730 Bacteria 5602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10098416 Ga0207644_100984162 235
2 3300048917 Ga0496114_0190704 Ga0496114_0190704_787_1716 235
3 3300048918 Ga0496115_0004979 Ga0496115_0004979_6040_6969 235
4 3300006051 Ga0075364_10024319 Ga0075364_100243192 236
5 3300050491 nmdc:mga00v17_7478_c1 nmdc:mga00v17_7478_c1_2349_3278 236
6 3300005563 Ga0068855_100013556 Ga0068855_1000135568 237
7 3300025949 Ga0207667_10000881 Ga0207667_1000088134 237
8 3300014969 Ga0157376_10134214 Ga0157376_101342143 238
9 3300005355 Ga0070671_100004809 Ga0070671_10000480910 240
10 3300025931 Ga0207644_10018490 Ga0207644_100184902 240
11 3300048911 Ga0496108_0124850 Ga0496108_0124850_1145_2077 240
12 3300048913 Ga0496110_0087800 Ga0496110_0087800_903_1835 240
13 3300048917 Ga0496114_0016127 Ga0496114_0016127_1352_2284 240
14 3300048925 Ga0496122_0101374 Ga0496122_0101374_922_1857 240
15 3300005335 Ga0070666_10058133 Ga0070666_100581332 241
16 3300025940 Ga0207691_10662643 Ga0207691_106626431 242
17 3300012513 Ga0157326_1000175 Ga0157326_10001756 244
18 3300053125 Ga0500618_000711 Ga0500618_000711_18076_19014 248
19 3300005842 Ga0068858_100041218 Ga0068858_1000412181 250
20 3300006195 Ga0075366_10129777 Ga0075366_101297772 250
21 3300025941 Ga0207711_10017131 Ga0207711_100171312 250
22 3300026035 Ga0207703_10002643 Ga0207703_100026437 250
23 3300050493 nmdc:mga0k408_6415_c1 nmdc:mga0k408_6415_c1_366_1298 250
24 3300005616 Ga0068852_100162017 Ga0068852_1001620171 251
25 3300021361 Ga0213872_10088520 Ga0213872_100885202 253
26 3300039447 Ga0436361_0330351 Ga0436361_0330351_2721_3650 253
27 3300001979 JGI24740J21852_10002997 JGI24740J21852_100029973 254
28 3300005327 Ga0070658_10000492 Ga0070658_1000049211 254
29 3300005578 Ga0068854_100000259 Ga0068854_10000025921 254
30 3300005614 Ga0068856_100003650 Ga0068856_1000036508 254
31 3300005616 Ga0068852_100004798 Ga0068852_1000047982 254
32 3300005834 Ga0068851_10108531 Ga0068851_101085312 254
33 3300009093 Ga0105240_10002301 Ga0105240_1000230114 254
34 3300025321 Ga0207656_10034506 Ga0207656_100345062 254
35 3300025904 Ga0207647_10007823 Ga0207647_100078236 254
36 3300025909 Ga0207705_10000073 Ga0207705_100000739 254
37 3300025913 Ga0207695_10008997 Ga0207695_100089974 254
38 3300025981 Ga0207640_10000254 Ga0207640_100002542 254
39 3300025981 Ga0207640_10062898 Ga0207640_100628982 254
40 3300026041 Ga0207639_10134557 Ga0207639_101345573 254
41 3300026078 Ga0207702_10009596 Ga0207702_100095968 254
42 3300026116 Ga0207674_10099843 Ga0207674_100998432 254
43 3300026142 Ga0207698_10000308 Ga0207698_100003084 254
44 3300048921 Ga0496118_0139245 Ga0496118_0139245_161_1093 254
45 3300048924 Ga0496121_0002864 Ga0496121_0002864_18532_19464 254
46 3300002459 JGI24751J29686_10001179 JGI24751J29686_100011794 255
47 3300005577 Ga0068857_100190133 Ga0068857_1001901332 255
48 3300026116 Ga0207674_10170119 Ga0207674_101701192 255
49 3300048905 Ga0496102_0731208 Ga0496102_0731208_128_901 257
50 3300005367 Ga0070667_100001750 Ga0070667_10000175013 259
51 3300005843 Ga0068860_100000473 Ga0068860_10000047345 259
52 3300025986 Ga0207658_10001852 Ga0207658_100018528 259
53 3300028381 Ga0268264_10000224 Ga0268264_1000022496 259
54 3300002067 JGI24735J21928_10047060 JGI24735J21928_100470602 261
55 3300005339 Ga0070660_100316740 Ga0070660_1003167401 261
56 3300005354 Ga0070675_100024384 Ga0070675_1000243844 261
57 3300005366 Ga0070659_100068324 Ga0070659_1000683242 261
58 3300005456 Ga0070678_100004619 Ga0070678_1000046194 261
59 3300005543 Ga0070672_100497323 Ga0070672_1004973231 261
60 3300025901 Ga0207688_10033182 Ga0207688_100331822 261
61 3300025904 Ga0207647_10095564 Ga0207647_100955642 261
62 3300025919 Ga0207657_10044453 Ga0207657_100444532 261
63 3300025932 Ga0207690_10092013 Ga0207690_100920131 261
64 3300025940 Ga0207691_10212909 Ga0207691_102129092 261
65 3300026121 Ga0207683_10012052 Ga0207683_100120522 261
66 3300005347 Ga0070668_100024478 Ga0070668_1000244783 262
67 3300005355 Ga0070671_100496505 Ga0070671_1004965051 262
68 3300025972 Ga0207668_10069145 Ga0207668_100691453 262
69 3300003794 Ga0055531_10019236 Ga0055531_100192362 268
70 3300005339 Ga0070660_100000017 Ga0070660_1000000173 268
71 3300005366 Ga0070659_100395683 Ga0070659_1003956832 268
72 3300005563 Ga0068855_100376394 Ga0068855_1003763942 268
73 3300010375 Ga0105239_10123564 Ga0105239_101235642 268
74 3300025292 Ga0209676_1000760 Ga0209676_100076037 268
75 3300025304 Ga0209257_1002450 Ga0209257_10024504 268
76 3300025904 Ga0207647_10111901 Ga0207647_101119012 268
77 3300025919 Ga0207657_10001746 Ga0207657_100017463 268
78 3300025949 Ga0207667_10055895 Ga0207667_100558952 268
79 3300003763 Ga0055529_1005011 Ga0055529_10050112 270
80 3300005334 Ga0068869_100000668 Ga0068869_1000006687 270
81 3300005338 Ga0068868_100000139 Ga0068868_10000013921 270
82 3300009553 Ga0105249_10019428 Ga0105249_100194282 270
83 3300011119 Ga0105246_10001368 Ga0105246_100013688 270
84 3300017792 Ga0163161_10139979 Ga0163161_101399792 270
85 3300025254 Ga0209148_1001582 Ga0209148_10015824 270
86 3300025272 Ga0209455_1000749 Ga0209455_10007496 270
87 3300025942 Ga0207689_10000059 Ga0207689_1000005936 270
88 3300048921 Ga0496118_0009536 Ga0496118_0009536_2891_3826 270
89 3300048923 Ga0496120_0045488 Ga0496120_0045488_1419_2354 270
90 3300002067 JGI24735J21928_10006565 JGI24735J21928_100065652 271
91 3300003762 Ga0055542_1008710 Ga0055542_10087101 271
92 3300003762 Ga0055542_1010209 Ga0055542_10102092 271
93 3300005458 Ga0070681_10359658 Ga0070681_103596582 271
94 3300005530 Ga0070679_100345940 Ga0070679_1003459402 271
95 3300005539 Ga0068853_100038328 Ga0068853_1000383283 271
96 3300005616 Ga0068852_100091137 Ga0068852_1000911374 271
97 3300009093 Ga0105240_10029739 Ga0105240_100297394 271
98 3300009551 Ga0105238_10056205 Ga0105238_100562055 271
99 3300025254 Ga0209148_1000160 Ga0209148_100016028 271
100 3300025909 Ga0207705_10003277 Ga0207705_100032774 271
101 3300025912 Ga0207707_10293737 Ga0207707_102937372 271
102 3300025913 Ga0207695_10008637 Ga0207695_100086375 271
103 3300025917 Ga0207660_10080481 Ga0207660_100804812 271
104 3300025919 Ga0207657_10173587 Ga0207657_101735872 271
105 3300025921 Ga0207652_10347530 Ga0207652_103475302 271
106 3300025924 Ga0207694_10083568 Ga0207694_100835684 271
107 3300025949 Ga0207667_10002081 Ga0207667_100020813 271
108 3300026041 Ga0207639_10029484 Ga0207639_100294845 271
109 3300026078 Ga0207702_10055491 Ga0207702_100554913 271
110 3300044765 Ga0466970_0040694 Ga0466970_0040694_44_979 271
111 3300048921 Ga0496118_0092055 Ga0496118_0092055_473_1408 271
112 3300048924 Ga0496121_0007120 Ga0496121_0007120_2375_3310 271
113 3300005353 Ga0070669_100000610 Ga0070669_10000061017 272
114 3300005842 Ga0068858_100004155 Ga0068858_10000415513 272
115 3300013105 Ga0157369_10275353 Ga0157369_102753532 272
116 3300025923 Ga0207681_10000260 Ga0207681_1000026031 272
117 3300025941 Ga0207711_10042522 Ga0207711_100425223 272
118 3300037466 Ga0395898_0147210 Ga0395898_0147210_619_1554 272
119 3300048913 Ga0496110_0098914 Ga0496110_0098914_1539_2471 272
120 3300048914 Ga0496111_0093320 Ga0496111_0093320_1204_2136 272
121 3300001991 JGI24743J22301_10011359 JGI24743J22301_100113592 274
122 3300005328 Ga0070676_10000029 Ga0070676_1000002923 274
123 3300005364 Ga0070673_100000013 Ga0070673_10000001342 274
124 3300005459 Ga0068867_100000009 Ga0068867_10000000984 274
125 3300006881 Ga0068865_100000005 Ga0068865_10000000527 274
126 3300009148 Ga0105243_10000032 Ga0105243_1000003242 274
127 3300009176 Ga0105242_10000166 Ga0105242_1000016610 274
128 3300013296 Ga0157374_10000134 Ga0157374_1000013437 274
129 3300013308 Ga0157375_10000242 Ga0157375_1000024242 274
130 3300014969 Ga0157376_10000111 Ga0157376_1000011138 274
131 3300025907 Ga0207645_10007479 Ga0207645_100074793 274
132 3300025934 Ga0207686_10000250 Ga0207686_100002502 274
133 3300025935 Ga0207709_10000051 Ga0207709_10000051198 274
134 3300025938 Ga0207704_10000001 Ga0207704_1000000142 274
135 3300025960 Ga0207651_10000006 Ga0207651_10000006197 274
136 3300026089 Ga0207648_10000022 Ga0207648_1000002287 274
137 3300037471 Ga0395905_0024923 Ga0395905_0024923_4017_4946 274
138 3300044684 Ga0466966_0000041 Ga0466966_0000041_89408_90337 274
139 3300005455 Ga0070663_100017908 Ga0070663_1000179083 275
140 3300013105 Ga0157369_10003257 Ga0157369_100032579 275
141 3300025920 Ga0207649_10039967 Ga0207649_100399673 275
142 3300025949 Ga0207667_10003709 Ga0207667_100037099 275
143 3300026067 Ga0207678_10080522 Ga0207678_100805223 275
144 3300026142 Ga0207698_10008742 Ga0207698_100087421 275
145 3300005353 Ga0070669_100018055 Ga0070669_1000180552 277
146 3300006847 Ga0075431_100027520 Ga0075431_1000275205 277
147 3300025923 Ga0207681_10226613 Ga0207681_102266132 277
148 3300028380 Ga0268265_10029848 Ga0268265_100298484 277
149 3300031731 Ga0307405_10124309 Ga0307405_101243091 277
150 3300031901 Ga0307406_10239859 Ga0307406_102398592 277
151 3300046525 Ga0495663_0049882 Ga0495663_0049882_242_1171 277
152 3300046537 Ga0495598_0013057 Ga0495598_0013057_413_1342 277
153 3300046539 Ga0495621_0002637 Ga0495621_0002637_1802_2731 277
154 3300025919 Ga0207657_10213794 Ga0207657_102137942 278
155 3300003322 rootL2_10049419 rootL2_100494193 279
156 3300031731 Ga0307405_10004673 Ga0307405_100046732 279
157 3300031911 Ga0307412_10000540 Ga0307412_1000054015 279
158 3300032004 Ga0307414_10000185 Ga0307414_100001859 279
159 3300048909 Ga0496106_0007150 Ga0496106_0007150_6951_7883 279
160 3300053121 Ga0500607_001228 Ga0500607_001228_332_1264 279
161 3300002067 JGI24735J21928_10007993 JGI24735J21928_100079934 280
162 3300005563 Ga0068855_100000040 Ga0068855_10000004045 280
163 3300025949 Ga0207667_10000024 Ga0207667_1000002456 280
164 3300031731 Ga0307405_10108448 Ga0307405_101084481 280
165 3300031911 Ga0307412_10226057 Ga0307412_102260572 280
166 3300032005 Ga0307411_10104058 Ga0307411_101040582 280
167 3300046691 Ga0495670_0000016 Ga0495670_0000016_101547_102476 280
168 3300005295 Ga0065707_10093150 Ga0065707_100931502 281
169 3300013306 Ga0163162_10311287 Ga0163162_103112872 281
170 3300014326 Ga0157380_10001834 Ga0157380_100018343 281
171 3300044693 Ga0466961_0092149 Ga0466961_0092149_815_1750 281
172 3300001990 JGI24737J22298_10009546 JGI24737J22298_100095462 282
173 3300005355 Ga0070671_100000005 Ga0070671_1000000052 282
174 3300025903 Ga0207680_10049863 Ga0207680_100498632 282
175 3300025931 Ga0207644_10000008 Ga0207644_10000008321 282
176 3300037471 Ga0395905_0124451 Ga0395905_0124451_1464_2393 282
177 3300048903 Ga0496100_0026550 Ga0496100_0026550_751_1683 282
178 3300048905 Ga0496102_0053503 Ga0496102_0053503_1166_2098 282
179 3300048907 Ga0496104_0019331 Ga0496104_0019331_1533_2465 282
180 3300048908 Ga0496105_0055319 Ga0496105_0055319_1593_2525 282
181 3300048910 Ga0496107_0025054 Ga0496107_0025054_2467_3399 282
182 3300048915 Ga0496112_0061314 Ga0496112_0061314_123_1055 282
183 3300048916 Ga0496113_0002634 Ga0496113_0002634_5497_6429 282
184 2162886007 SwRhRL2b_contig_3660944 SwRhRL2b_0919.00005060 283
185 3300001904 JGI24736J21556_1000014 JGI24736J21556_100001418 283
186 3300001989 JGI24739J22299_10006093 JGI24739J22299_100060933 283
187 3300002067 JGI24735J21928_10009260 JGI24735J21928_100092602 283
188 3300002075 JGI24738J21930_10001186 JGI24738J21930_100011867 283
189 3300005289 Ga0065704_10070410 Ga0065704_100704107 283
190 3300005327 Ga0070658_10016748 Ga0070658_100167484 283
191 3300005344 Ga0070661_100029048 Ga0070661_1000290482 283
192 3300005834 Ga0068851_10070258 Ga0068851_100702582 283
193 3300025321 Ga0207656_10004486 Ga0207656_100044864 283
194 3300025904 Ga0207647_10000301 Ga0207647_1000030130 283
195 3300025909 Ga0207705_10066862 Ga0207705_100668622 283
196 3300025911 Ga0207654_10003282 Ga0207654_100032826 283
197 3300025913 Ga0207695_10002890 Ga0207695_1000289029 283
198 3300025919 Ga0207657_10026923 Ga0207657_100269232 283
199 3300025924 Ga0207694_10003304 Ga0207694_100033049 283
200 3300025949 Ga0207667_10000716 Ga0207667_1000071628 283
201 3300025981 Ga0207640_10186160 Ga0207640_101861602 283
202 3300026067 Ga0207678_10038375 Ga0207678_100383752 283
203 3300026116 Ga0207674_10249440 Ga0207674_102494402 283
204 3300053134 Ga0500658_0001207 Ga0500658_0001207_3496_4425 283
205 3300001976 JGI24752J21851_1000837 JGI24752J21851_10008374 284
206 3300002459 JGI24751J29686_10029286 JGI24751J29686_100292861 284
207 3300005295 Ga0065707_10098335 Ga0065707_100983353 284
208 3300005331 Ga0070670_100028850 Ga0070670_1000288502 284
209 3300005335 Ga0070666_10000089 Ga0070666_1000008962 284
210 3300005347 Ga0070668_100254258 Ga0070668_1002542582 284
211 3300005353 Ga0070669_100000024 Ga0070669_100000024119 284
212 3300005355 Ga0070671_100000006 Ga0070671_100000006133 284
213 3300005367 Ga0070667_100113539 Ga0070667_1001135393 284
214 3300005440 Ga0070705_100044993 Ga0070705_1000449934 284
215 3300005445 Ga0070708_100374285 Ga0070708_1003742852 284
216 3300005539 Ga0068853_100161664 Ga0068853_1001616642 284
217 3300005617 Ga0068859_100000256 Ga0068859_1000002568 284
218 3300005719 Ga0068861_100011417 Ga0068861_1000114172 284
219 3300005841 Ga0068863_100143232 Ga0068863_1001432323 284
220 3300005842 Ga0068858_100002936 Ga0068858_1000029366 284
221 3300005843 Ga0068860_100010895 Ga0068860_1000108956 284
222 3300005844 Ga0068862_100000310 Ga0068862_1000003103 284
223 3300005844 Ga0068862_100035470 Ga0068862_1000354705 284
224 3300006931 Ga0097620_100000256 Ga0097620_1000002568 284
225 3300009101 Ga0105247_10011571 Ga0105247_100115713 284
226 3300009174 Ga0105241_10195252 Ga0105241_101952522 284
227 3300009545 Ga0105237_10350075 Ga0105237_103500752 284
228 3300009553 Ga0105249_10021831 Ga0105249_100218316 284
229 3300013104 Ga0157370_10024341 Ga0157370_100243412 284
230 3300013306 Ga0163162_10021139 Ga0163162_100211395 284
231 3300014325 Ga0163163_10094269 Ga0163163_100942693 284
232 3300017792 Ga0163161_10204056 Ga0163161_102040562 284
233 3300025315 Ga0207697_10001058 Ga0207697_100010589 284
234 3300025900 Ga0207710_10003921 Ga0207710_100039215 284
235 3300025903 Ga0207680_10000298 Ga0207680_1000029820 284
236 3300025914 Ga0207671_10000592 Ga0207671_1000059247 284
237 3300025923 Ga0207681_10000004 Ga0207681_10000004293 284
238 3300025931 Ga0207644_10000009 Ga0207644_10000009117 284
239 3300025941 Ga0207711_10062216 Ga0207711_100622163 284
240 3300025961 Ga0207712_10014244 Ga0207712_100142442 284
241 3300025972 Ga0207668_10005504 Ga0207668_100055045 284
242 3300025986 Ga0207658_10012726 Ga0207658_100127262 284
243 3300026035 Ga0207703_10002484 Ga0207703_1000248416 284
244 3300026078 Ga0207702_10000727 Ga0207702_1000072715 284
245 3300026088 Ga0207641_10111036 Ga0207641_101110364 284
246 3300026118 Ga0207675_100005808 Ga0207675_10000580810 284
247 3300026142 Ga0207698_10012219 Ga0207698_100122192 284
248 3300028380 Ga0268265_10001374 Ga0268265_1000137417 284
249 3300028381 Ga0268264_10000069 Ga0268264_10000069129 284
250 3300048905 Ga0496102_0334039 Ga0496102_0334039_54_983 284
251 3300005578 Ga0068854_100009382 Ga0068854_1000093823 285
252 3300009093 Ga0105240_10000867 Ga0105240_1000086738 285
253 3300009545 Ga0105237_10000303 Ga0105237_1000030354 285
254 3300009551 Ga0105238_10231489 Ga0105238_102314892 285
255 3300010375 Ga0105239_10000151 Ga0105239_1000015182 285
256 3300025913 Ga0207695_10005103 Ga0207695_1000510310 285
257 3300025914 Ga0207671_10000881 Ga0207671_1000088110 285
258 3300025924 Ga0207694_10112161 Ga0207694_101121612 285
259 3300025981 Ga0207640_10001543 Ga0207640_100015434 285
260 3300031456 Ga0307513_10011435 Ga0307513_100114353 285
261 3300053125 Ga0500618_000842 Ga0500618_000842_12011_12943 285
262 3300003215 JGI25153J46596_10042831 JGI25153J46596_100428311 286
263 3300003773 Ga0055537_1003353 Ga0055537_10033532 286
264 3300003775 Ga0055524_1000489 Ga0055524_10004897 286
265 3300005328 Ga0070676_10064458 Ga0070676_100644582 286
266 3300005331 Ga0070670_100207902 Ga0070670_1002079022 286
267 3300005618 Ga0068864_100008948 Ga0068864_1000089483 286
268 3300005841 Ga0068863_100037797 Ga0068863_1000377972 286
269 3300025263 Ga0209565_1000029 Ga0209565_1000029172 286
270 3300025299 Ga0209256_1000008 Ga0209256_1000008781 286
271 3300025907 Ga0207645_10152287 Ga0207645_101522872 286
272 3300025981 Ga0207640_10119803 Ga0207640_101198033 286
273 3300026088 Ga0207641_10000500 Ga0207641_1000050027 286
274 3300026095 Ga0207676_10023166 Ga0207676_100231663 286
275 3300053153 Ga0500616_0019037 Ga0500616_0019037_451_1383 286
276 3300009545 Ga0105237_10017167 Ga0105237_100171672 287
277 3300025914 Ga0207671_10006341 Ga0207671_100063416 287
278 3300032004 Ga0307414_10047611 Ga0307414_100476113 287
279 3300005841 Ga0068863_100000576 Ga0068863_10000057614 288
280 3300005843 Ga0068860_100000812 Ga0068860_1000008123 288
281 3300005844 Ga0068862_100000014 Ga0068862_100000014192 288
282 3300009553 Ga0105249_10000002 Ga0105249_10000002205 288
283 3300014326 Ga0157380_10106046 Ga0157380_101060463 288
284 3300017792 Ga0163161_10001166 Ga0163161_1000116611 288
285 3300020069 Ga0197907_10074559 Ga0197907_100745591 288
286 3300025961 Ga0207712_10000002 Ga0207712_10000002577 288
287 3300026088 Ga0207641_10001788 Ga0207641_1000178811 288
288 3300028380 Ga0268265_10000048 Ga0268265_1000004861 288
289 3300028381 Ga0268264_10007424 Ga0268264_100074242 288
290 3300046525 Ga0495663_0009419 Ga0495663_0009419_1286_2215 288
291 3300046537 Ga0495598_0053394 Ga0495598_0053394_83_1012 288
292 3300046539 Ga0495621_0006066 Ga0495621_0006066_1108_2037 288
293 3300049575 Ga0501039_0062198 Ga0501039_0062198_64_993 288
294 3300026041 Ga0207639_10046271 Ga0207639_100462711 289
295 3300031911 Ga0307412_10174817 Ga0307412_101748172 289
296 3300048920 Ga0496117_0043201 Ga0496117_0043201_2086_3018 289
297 3300048921 Ga0496118_0010136 Ga0496118_0010136_4231_5163 289
298 3300048924 Ga0496121_0007335 Ga0496121_0007335_958_1887 289
299 3300005347 Ga0070668_100076241 Ga0070668_1000762412 290
300 3300005355 Ga0070671_100075885 Ga0070671_1000758852 290
301 3300048907 Ga0496104_0236157 Ga0496104_0236157_607_1539 290
302 3300049571 Ga0501034_0042628 Ga0501034_0042628_2780_3709 290
303 3300049574 Ga0501038_0121385 Ga0501038_0121385_997_1926 290
304 3300049823 Ga0501044_0261059 Ga0501044_0261059_308_1237 290
305 3300001915 JGI24741J21665_1002462 JGI24741J21665_10024622 291
306 3300005834 Ga0068851_10092143 Ga0068851_100921432 291
307 3300009093 Ga0105240_10001331 Ga0105240_1000133142 291
308 3300010375 Ga0105239_10000271 Ga0105239_100002718 291
309 3300020082 Ga0206353_10399482 Ga0206353_103994822 291
310 3300025321 Ga0207656_10020092 Ga0207656_100200923 291
311 3300025913 Ga0207695_10005114 Ga0207695_1000511416 291
312 3300025919 Ga0207657_10203639 Ga0207657_102036391 291
313 3300025949 Ga0207667_10000001 Ga0207667_100000011006 291
314 3300025949 Ga0207667_10056456 Ga0207667_100564563 291
315 3300025981 Ga0207640_10036511 Ga0207640_100365113 291
316 3300025981 Ga0207640_10069894 Ga0207640_100698942 291
317 3300026041 Ga0207639_10163844 Ga0207639_101638442 291
318 3300026116 Ga0207674_10276710 Ga0207674_102767102 291
319 3300026142 Ga0207698_10020890 Ga0207698_100208903 291
320 3300048907 Ga0496104_0060220 Ga0496104_0060220_2517_3449 291
321 3300048908 Ga0496105_0010549 Ga0496105_0010549_6110_7042 291
322 3300048924 Ga0496121_0000949 Ga0496121_0000949_38613_39542 291
323 3300005327 Ga0070658_10002437 Ga0070658_100024373 292
324 3300005329 Ga0070683_100501317 Ga0070683_1005013171 292
325 3300005334 Ga0068869_100096737 Ga0068869_1000967372 292
326 3300005338 Ga0068868_100179309 Ga0068868_1001793092 292
327 3300005347 Ga0070668_100176014 Ga0070668_1001760142 292
328 3300005617 Ga0068859_100009578 Ga0068859_1000095782 292
329 3300005617 Ga0068859_100114703 Ga0068859_1001147032 292
330 3300005618 Ga0068864_100007063 Ga0068864_1000070633 292
331 3300005841 Ga0068863_100001264 Ga0068863_1000012646 292
332 3300005842 Ga0068858_100005425 Ga0068858_10000542513 292
333 3300005843 Ga0068860_100032158 Ga0068860_1000321583 292
334 3300005844 Ga0068862_100267069 Ga0068862_1002670692 292
335 3300006931 Ga0097620_100009578 Ga0097620_10000957811 292
336 3300006931 Ga0097620_100114704 Ga0097620_1001147042 292
337 3300009092 Ga0105250_10005152 Ga0105250_100051527 292
338 3300009101 Ga0105247_10000692 Ga0105247_1000069226 292
339 3300009101 Ga0105247_10011543 Ga0105247_100115432 292
340 3300009174 Ga0105241_10008644 Ga0105241_1000864410 292
341 3300009177 Ga0105248_10002368 Ga0105248_100023684 292
342 3300009545 Ga0105237_10133456 Ga0105237_101334561 292
343 3300013102 Ga0157371_10000062 Ga0157371_10000062175 292
344 3300013105 Ga0157369_10238530 Ga0157369_102385302 292
345 3300013306 Ga0163162_10079336 Ga0163162_100793363 292
346 3300014325 Ga0163163_10000139 Ga0163163_1000013976 292
347 3300014968 Ga0157379_10038845 Ga0157379_100388452 292
348 3300025900 Ga0207710_10002210 Ga0207710_100022106 292
349 3300025900 Ga0207710_10006603 Ga0207710_100066033 292
350 3300025909 Ga0207705_10000103 Ga0207705_1000010341 292
351 3300025911 Ga0207654_10000150 Ga0207654_1000015012 292
352 3300025914 Ga0207671_10039482 Ga0207671_100394823 292
353 3300025924 Ga0207694_10050606 Ga0207694_100506063 292
354 3300025941 Ga0207711_10000673 Ga0207711_1000067318 292
355 3300025942 Ga0207689_10112111 Ga0207689_101121113 292
356 3300025945 Ga0207679_10398710 Ga0207679_103987101 292
357 3300025960 Ga0207651_10005055 Ga0207651_100050558 292
358 3300025972 Ga0207668_10032968 Ga0207668_100329683 292
359 3300025986 Ga0207658_10011407 Ga0207658_100114075 292
360 3300026023 Ga0207677_10140350 Ga0207677_101403502 292
361 3300026035 Ga0207703_10042797 Ga0207703_100427974 292
362 3300026078 Ga0207702_10043031 Ga0207702_100430313 292
363 3300026088 Ga0207641_10006496 Ga0207641_100064966 292
364 3300026095 Ga0207676_10001441 Ga0207676_1000144118 292
365 3300028380 Ga0268265_10103672 Ga0268265_101036722 292
366 3300028381 Ga0268264_10020235 Ga0268264_100202355 292
367 3300031911 Ga0307412_10025962 Ga0307412_100259623 292
368 3300053177 Ga0500636_0006756 Ga0500636_0006756_5270_6202 292
369 3300005367 Ga0070667_100000513 Ga0070667_1000005132 293
370 3300005457 Ga0070662_100145686 Ga0070662_1001456862 293
371 3300005564 Ga0070664_100219990 Ga0070664_1002199902 293
372 3300025920 Ga0207649_10002862 Ga0207649_1000286210 293
373 3300025986 Ga0207658_10006778 Ga0207658_100067787 293
374 3300028381 Ga0268264_10018778 Ga0268264_100187782 293
375 3300031731 Ga0307405_10383749 Ga0307405_103837492 293
376 3300031852 Ga0307410_10093005 Ga0307410_100930052 293
377 3300048905 Ga0496102_0000022 Ga0496102_0000022_114155_115087 293
378 3300048906 Ga0496103_0000167 Ga0496103_0000167_67604_68536 293
379 3300048908 Ga0496105_0000847 Ga0496105_0000847_1136_2068 293
380 3300048917 Ga0496114_0386218 Ga0496114_0386218_253_1185 293
381 3300048918 Ga0496115_0000029 Ga0496115_0000029_72487_73419 293
382 3300048919 Ga0496116_0083341 Ga0496116_0083341_886_1818 293
383 3300048920 Ga0496117_0000260 Ga0496117_0000260_36873_37805 293
384 3300048921 Ga0496118_0000039 Ga0496118_0000039_205049_205981 293
385 3300048924 Ga0496121_0000683 Ga0496121_0000683_61882_62817 293
386 3300048927 Ga0496124_0000076 Ga0496124_0000076_100387_101319 293
387 3300048929 Ga0496126_0000469 Ga0496126_0000469_67850_68782 293
388 3300049668 Ga0501233_003600 Ga0501233_003600_361_1290 293
389 3300005327 Ga0070658_10003145 Ga0070658_1000314516 294
390 3300005336 Ga0070680_100048827 Ga0070680_1000488273 294
391 3300005341 Ga0070691_10042850 Ga0070691_100428502 294
392 3300005457 Ga0070662_100001553 Ga0070662_1000015532 294
393 3300005458 Ga0070681_10005511 Ga0070681_1000551111 294
394 3300005530 Ga0070679_100028853 Ga0070679_1000288533 294
395 3300005563 Ga0068855_100006774 Ga0068855_10000677412 294
396 3300005563 Ga0068855_100059685 Ga0068855_1000596852 294
397 3300005616 Ga0068852_100017160 Ga0068852_1000171604 294
398 3300005618 Ga0068864_100026684 Ga0068864_1000266843 294
399 3300005841 Ga0068863_100002638 Ga0068863_1000026383 294
400 3300009093 Ga0105240_10041737 Ga0105240_100417373 294
401 3300009177 Ga0105248_10393016 Ga0105248_103930161 294
402 3300011119 Ga0105246_10000160 Ga0105246_1000016024 294
403 3300013100 Ga0157373_10047838 Ga0157373_100478383 294
404 3300025909 Ga0207705_10010984 Ga0207705_100109844 294
405 3300025912 Ga0207707_10019058 Ga0207707_100190582 294
406 3300025913 Ga0207695_10142285 Ga0207695_101422852 294
407 3300025917 Ga0207660_10231439 Ga0207660_102314392 294
408 3300025933 Ga0207706_10006210 Ga0207706_100062108 294
409 3300025945 Ga0207679_10097854 Ga0207679_100978541 294
410 3300025949 Ga0207667_10001580 Ga0207667_1000158017 294
411 3300025949 Ga0207667_10034948 Ga0207667_100349484 294
412 3300025972 Ga0207668_10070549 Ga0207668_100705492 294
413 3300025981 Ga0207640_10381406 Ga0207640_103814062 294
414 3300026041 Ga0207639_10133388 Ga0207639_101333881 294
415 3300026088 Ga0207641_10000098 Ga0207641_1000009823 294
416 3300026095 Ga0207676_10008948 Ga0207676_100089487 294
417 3300026116 Ga0207674_10019862 Ga0207674_100198624 294
418 3300027617 Ga0210002_1011448 Ga0210002_10114482 294
419 3300027665 Ga0209983_1014737 Ga0209983_10147372 294
420 3300046512 Ga0495610_0035531 Ga0495610_0035531_548_1483 294
421 3300046515 Ga0495620_0000761 Ga0495620_0000761_10594_11529 294
422 3300046520 Ga0495637_0000085 Ga0495637_0000085_17922_18851 294
423 3300046522 Ga0495643_0000555 Ga0495643_0000555_26025_26954 294
424 3300046558 Ga0495633_0000847 Ga0495633_0000847_20889_21818 294
425 3300046692 Ga0495671_0000249 Ga0495671_0000249_26025_26954 294
426 3300047470 Ga0495681_0002495 Ga0495681_0002495_3479_4408 294
427 3300053111 Ga0500572_015101 Ga0500572_015101_825_1754 294
428 3300001979 JGI24740J21852_10015018 JGI24740J21852_100150183 295
429 3300005289 Ga0065704_10078581 Ga0065704_100785812 295
430 3300005367 Ga0070667_100013726 Ga0070667_1000137264 295
431 3300005843 Ga0068860_100118059 Ga0068860_1001180593 295
432 3300009553 Ga0105249_10000110 Ga0105249_1000011040 295
433 3300013102 Ga0157371_10021298 Ga0157371_100212985 295
434 3300014968 Ga0157379_10151323 Ga0157379_101513231 295
435 3300025932 Ga0207690_10015458 Ga0207690_100154585 295
436 3300025961 Ga0207712_10000311 Ga0207712_1000031134 295
437 3300025986 Ga0207658_10009773 Ga0207658_100097733 295
438 3300026116 Ga0207674_10200621 Ga0207674_102006212 295
439 3300028381 Ga0268264_10148564 Ga0268264_101485642 295
440 3300031911 Ga0307412_10000252 Ga0307412_1000025222 295
441 3300031911 Ga0307412_10030738 Ga0307412_100307382 295
442 3300032004 Ga0307414_10004530 Ga0307414_100045302 295
443 3300044659 Ga0466973_0087873 Ga0466973_0087873_1531_2460 295
444 3300046453 Ga0495627_000598 Ga0495627_000598_1586_2515 295
445 3300046471 Ga0495650_0012931 Ga0495650_0012931_1598_2527 295
446 3300046500 Ga0495596_0000016 Ga0495596_0000016_77958_78887 295
447 3300046500 Ga0495596_0000247 Ga0495596_0000247_2119_3048 295
448 3300046506 Ga0495583_0004192 Ga0495583_0004192_6463_7392 295
449 3300046512 Ga0495610_0052202 Ga0495610_0052202_510_1439 295
450 3300046530 Ga0495654_0068032 Ga0495654_0068032_658_1587 295
451 3300046660 Ga0495625_0012265 Ga0495625_0012265_2012_2941 295
452 3300047470 Ga0495681_0005245 Ga0495681_0005245_1618_2547 295
453 3300048090 Ga0495615_0000012 Ga0495615_0000012_12441_13370 295
454 3300048922 Ga0496119_0034760 Ga0496119_0034760_2035_2925 295
455 3300049568 Ga0501031_0216850 Ga0501031_0216850_75_1004 295
456 3300049570 Ga0501033_0059716 Ga0501033_0059716_779_1708 295
457 3300049571 Ga0501034_0407314 Ga0501034_0407314_93_1028 295
458 3300049579 Ga0501043_0063181 Ga0501043_0063181_468_1397 295
459 3300049580 Ga0501046_0088564 Ga0501046_0088564_748_1677 295
460 3300049581 Ga0501047_0000864 Ga0501047_0000864_5719_6648 295
461 3300049581 Ga0501047_0026935 Ga0501047_0026935_1827_2756 295
462 3300049586 Ga0501070_0314275 Ga0501070_0314275_41_976 295
463 3300049822 Ga0501035_0037003 Ga0501035_0037003_2780_3709 295
464 3300049822 Ga0501035_0116757 Ga0501035_0116757_444_1373 295
465 3300049823 Ga0501044_0070436 Ga0501044_0070436_885_1814 295
466 3300053087 Ga0500643_003982 Ga0500643_003982_2434_3366 295
467 3300001976 JGI24752J21851_1000099 JGI24752J21851_10000995 296
468 3300005327 Ga0070658_10004725 Ga0070658_100047256 296
469 3300005331 Ga0070670_100000027 Ga0070670_10000002726 296
470 3300005354 Ga0070675_100068100 Ga0070675_1000681002 296
471 3300005367 Ga0070667_100000315 Ga0070667_10000031513 296
472 3300005530 Ga0070679_100132969 Ga0070679_1001329694 296
473 3300005617 Ga0068859_100018998 Ga0068859_1000189983 296
474 3300005618 Ga0068864_100000100 Ga0068864_10000010077 296
475 3300005841 Ga0068863_100000025 Ga0068863_100000025187 296
476 3300005844 Ga0068862_100000027 Ga0068862_10000002726 296
477 3300006931 Ga0097620_100018998 Ga0097620_1000189986 296
478 3300009011 Ga0105251_10000159 Ga0105251_1000015953 296
479 3300009101 Ga0105247_10005638 Ga0105247_100056383 296
480 3300009147 Ga0114129_10407027 Ga0114129_104070272 296
481 3300009177 Ga0105248_10000026 Ga0105248_10000026202 296
482 3300021384 Ga0213876_10162713 Ga0213876_101627131 296
483 3300025253 Ga0209677_107269 Ga0209677_1072692 296
484 3300025735 Ga0207713_1000491 Ga0207713_10004916 296
485 3300025900 Ga0207710_10011439 Ga0207710_100114393 296
486 3300025909 Ga0207705_10000046 Ga0207705_1000004636 296
487 3300025925 Ga0207650_10000243 Ga0207650_1000024348 296
488 3300025938 Ga0207704_10193535 Ga0207704_101935352 296
489 3300025941 Ga0207711_10000004 Ga0207711_10000004217 296
490 3300025986 Ga0207658_10000287 Ga0207658_100002873 296
491 3300026088 Ga0207641_10000018 Ga0207641_10000018137 296
492 3300026095 Ga0207676_10000027 Ga0207676_1000002782 296
493 3300028380 Ga0268265_10000042 Ga0268265_1000004224 296
494 3300039437 Ga0436365_1821495 Ga0436365_1821495_664_1593 296
495 3300039447 Ga0436361_1020396 Ga0436361_1020396_418_1347 296
496 3300048904 Ga0496101_0123697 Ga0496101_0123697_672_1601 296
497 3300048920 Ga0496117_0007303 Ga0496117_0007303_7694_8623 296
498 3300048921 Ga0496118_0000689 Ga0496118_0000689_13912_14841 296
499 3300048924 Ga0496121_0056386 Ga0496121_0056386_2149_3078 296
500 3300049705 Ga0501225_0010631 Ga0501225_0010631_254_1183 296
501 3300049777 Ga0501281_03626 Ga0501281_03626_13_942 296
502 3300003794 Ga0055531_10011843 Ga0055531_100118434 297
503 3300031824 Ga0307413_10141680 Ga0307413_101416801 297
504 3300031852 Ga0307410_10092179 Ga0307410_100921792 297
505 3300031901 Ga0307406_10288367 Ga0307406_102883672 297
506 3300031995 Ga0307409_100165435 Ga0307409_1001654353 297
507 3300032002 Ga0307416_100275533 Ga0307416_1002755332 297
508 3300032005 Ga0307411_10038405 Ga0307411_100384052 297
509 3300044842 Ga0466957_0010185 Ga0466957_0010185_1784_2713 297
510 3300045976 Ga0466967_0033536 Ga0466967_0033536_1534_2463 297
511 3300053108 Ga0500562_048154 Ga0500562_048154_40_969 297
512 3300005539 Ga0068853_100000490 Ga0068853_10000049020 298
513 3300005577 Ga0068857_100003398 Ga0068857_1000033983 298
514 3300005614 Ga0068856_100287513 Ga0068856_1002875132 298
515 3300005834 Ga0068851_10003428 Ga0068851_100034284 298
516 3300009551 Ga0105238_10075403 Ga0105238_100754034 298
517 3300025321 Ga0207656_10020017 Ga0207656_100200173 298
518 3300026041 Ga0207639_10015767 Ga0207639_100157674 298
519 3300026078 Ga0207702_10340022 Ga0207702_103400222 298
520 3300026116 Ga0207674_10001869 Ga0207674_100018696 298
521 3300026118 Ga0207675_100106354 Ga0207675_1001063543 298
522 3300046530 Ga0495654_0095026 Ga0495654_0095026_336_1265 298
523 3300046660 Ga0495625_0001219 Ga0495625_0001219_31581_32510 298
524 3300046809 Ga0495600_0009002 Ga0495600_0009002_632_1564 298
525 3300048912 Ga0496109_0399177 Ga0496109_0399177_244_1143 298
526 3300053104 Ga0500556_0054774 Ga0500556_0054774_503_1432 298
527 3300053158 Ga0500627_0028673 Ga0500627_0028673_148_1077 298
528 3300002774 JGI25150J39212_1000067 JGI25150J39212_100006741 299
529 3300003215 JGI25153J46596_10000073 JGI25153J46596_1000007326 299
530 3300005347 Ga0070668_100353942 Ga0070668_1003539422 299
531 3300005844 Ga0068862_100051191 Ga0068862_1000511913 299
532 3300009553 Ga0105249_10000061 Ga0105249_1000006136 299
533 3300014969 Ga0157376_10290716 Ga0157376_102907161 299
534 3300015690 Ga0183363_1003 Ga0183363_1003151 299
535 3300021384 Ga0213876_10189706 Ga0213876_101897061 299
536 3300025245 Ga0207425_1000005 Ga0207425_1000005797 299
537 3300025258 Ga0209129_1001349 Ga0209129_10013494 299
538 3300025294 Ga0209025_1000477 Ga0209025_100047782 299
539 3300025297 Ga0209758_1000002 Ga0209758_1000002548 299
540 3300025961 Ga0207712_10000144 Ga0207712_1000014450 299
541 3300025986 Ga0207658_10097040 Ga0207658_100970402 299
542 3300028380 Ga0268265_10023250 Ga0268265_100232503 299
543 3300028573 Ga0265334_10056604 Ga0265334_100566042 299
544 3300039437 Ga0436365_1385090 Ga0436365_1385090_28_957 299
545 3300046616 Ga0495668_0209515 Ga0495668_0209515_17_946 299
546 3300048919 Ga0496116_0192978 Ga0496116_0192978_22_984 299
547 3300005548 Ga0070665_100174748 Ga0070665_1001747482 300
548 3300025938 Ga0207704_10072732 Ga0207704_100727321 300
549 3300028379 Ga0268266_10330615 Ga0268266_103306152 300
550 3300031995 Ga0307409_100416179 Ga0307409_1004161792 300
551 3300032004 Ga0307414_10240795 Ga0307414_102407952 300
552 3300046558 Ga0495633_0081824 Ga0495633_0081824_520_1449 300
553 3300046616 Ga0495668_0019846 Ga0495668_0019846_272_1201 300
554 3300053116 Ga0500592_012209 Ga0500592_012209_119_1048 300
555 3300053157 Ga0500624_000007 Ga0500624_000007_153030_153959 300
556 3300005331 Ga0070670_100056786 Ga0070670_1000567863 301
557 3300005347 Ga0070668_100001726 Ga0070668_10000172610 301
558 3300005347 Ga0070668_100059003 Ga0070668_1000590033 301
559 3300005353 Ga0070669_100000646 Ga0070669_10000064613 301
560 3300005548 Ga0070665_100000079 Ga0070665_10000007963 301
561 3300009011 Ga0105251_10000232 Ga0105251_100002323 301
562 3300009101 Ga0105247_10036943 Ga0105247_100369432 301
563 3300025735 Ga0207713_1001216 Ga0207713_10012164 301
564 3300025923 Ga0207681_10000274 Ga0207681_1000027413 301
565 3300025972 Ga0207668_10006180 Ga0207668_100061802 301
566 3300025972 Ga0207668_10046230 Ga0207668_100462303 301
567 3300028379 Ga0268266_10000175 Ga0268266_1000017594 301
568 3300028380 Ga0268265_10081867 Ga0268265_100818673 301
569 3300031548 Ga0307408_100011407 Ga0307408_1000114074 301
570 3300031731 Ga0307405_10013215 Ga0307405_100132152 301
571 3300031824 Ga0307413_10026545 Ga0307413_100265454 301
572 3300031824 Ga0307413_10057655 Ga0307413_100576553 301
573 3300031824 Ga0307413_10148402 Ga0307413_101484022 301
574 3300031901 Ga0307406_10025473 Ga0307406_100254732 301
575 3300031903 Ga0307407_10035819 Ga0307407_100358192 301
576 3300031911 Ga0307412_10007524 Ga0307412_100075245 301
577 3300032002 Ga0307416_100020872 Ga0307416_1000208723 301
578 3300032005 Ga0307411_10010490 Ga0307411_100104904 301
579 3300032005 Ga0307411_10064838 Ga0307411_100648384 301
580 3300032126 Ga0307415_100007852 Ga0307415_1000078524 301
581 3300046616 Ga0495668_0000004 Ga0495668_0000004_536493_537422 301
582 3300046684 Ga0495669_0025550 Ga0495669_0025550_1199_2128 301
583 3300049573 Ga0501037_0247914 Ga0501037_0247914_59_994 301
584 3300049581 Ga0501047_0073181 Ga0501047_0073181_943_1878 301
585 iso_pu_bacteria 2510065045 2510247472 301
586 iso_pu_bacteria 2643221605 2644040732 301
587 iso_pu_bacteria 2718217991 2719638352 301
588 iso_pu_bacteria 8055266321 8055267709 301
589 iso_pu_bacteria 8055301274 8055308914 301
590 3300001904 JGI24736J21556_1000001 JGI24736J21556_100000122 302
591 3300001979 JGI24740J21852_10015278 JGI24740J21852_100152782 302
592 3300001989 JGI24739J22299_10013801 JGI24739J22299_100138013 302
593 3300001990 JGI24737J22298_10021087 JGI24737J22298_100210872 302
594 3300002075 JGI24738J21930_10004607 JGI24738J21930_100046074 302
595 3300005339 Ga0070660_100005671 Ga0070660_1000056715 302
596 3300005344 Ga0070661_100065746 Ga0070661_1000657461 302
597 3300005457 Ga0070662_100101972 Ga0070662_1001019723 302
598 3300005539 Ga0068853_100154611 Ga0068853_1001546112 302
599 3300005563 Ga0068855_100179588 Ga0068855_1001795883 302
600 3300005564 Ga0070664_100102469 Ga0070664_1001024691 302
601 3300005577 Ga0068857_100234602 Ga0068857_1002346021 302
602 3300005578 Ga0068854_100034186 Ga0068854_1000341862 302
603 3300005617 Ga0068859_100000442 Ga0068859_10000044228 302
604 3300005834 Ga0068851_10024392 Ga0068851_100243921 302
605 3300006058 Ga0075432_10055756 Ga0075432_100557562 302
606 3300006931 Ga0097620_100000442 Ga0097620_10000044211 302
607 3300009174 Ga0105241_10209539 Ga0105241_102095391 302
608 3300009177 Ga0105248_10000785 Ga0105248_1000078532 302
609 3300009545 Ga0105237_10085934 Ga0105237_100859341 302
610 3300013105 Ga0157369_10058845 Ga0157369_100588453 302
611 3300021358 Ga0213873_10000016 Ga0213873_10000016104 302
612 3300021384 Ga0213876_10000056 Ga0213876_1000005634 302
613 3300025904 Ga0207647_10000701 Ga0207647_1000070116 302
614 3300025911 Ga0207654_10000836 Ga0207654_1000083613 302
615 3300025913 Ga0207695_10012367 Ga0207695_100123676 302
616 3300025914 Ga0207671_10002796 Ga0207671_1000279612 302
617 3300025919 Ga0207657_10054674 Ga0207657_100546742 302
618 3300025920 Ga0207649_10168566 Ga0207649_101685662 302
619 3300025924 Ga0207694_10001416 Ga0207694_100014164 302
620 3300025924 Ga0207694_10101530 Ga0207694_101015301 302
621 3300025933 Ga0207706_10124921 Ga0207706_101249213 302
622 3300025941 Ga0207711_10000571 Ga0207711_1000057131 302
623 3300025949 Ga0207667_10004218 Ga0207667_1000421812 302
624 3300025949 Ga0207667_10161957 Ga0207667_101619573 302
625 3300025981 Ga0207640_10056542 Ga0207640_100565421 302
626 3300026041 Ga0207639_10239306 Ga0207639_102393062 302
627 3300026078 Ga0207702_10001637 Ga0207702_1000163716 302
628 3300026142 Ga0207698_10040422 Ga0207698_100404221 302
629 3300027907 Ga0207428_10054976 Ga0207428_100549762 302
630 3300039437 Ga0436365_0594533 Ga0436365_0594533_2592_3521 302
631 3300039453 Ga0436362_0580304 Ga0436362_0580304_89626_90555 302
632 3300013297 Ga0157378_10045278 Ga0157378_100452783 303
633 3300031911 Ga0307412_10139622 Ga0307412_101396222 303
634 3300031995 Ga0307409_100016478 Ga0307409_1000164784 303
635 3300046525 Ga0495663_0054255 Ga0495663_0054255_248_1162 303
636 3300005289 Ga0065704_10085713 Ga0065704_100857135 304
637 iso_pu_bacteria 2510917021 2511127331 304
638 iso_pu_bacteria 2599185359 2600227006 304
639 iso_pu_bacteria 2643221563 2643836460 304
640 iso_pu_bacteria 2643221608 2644052936 304
641 iso_pu_bacteria 2643221622 2644127396 304
642 iso_pu_bacteria 2739367865 2740029703 304
643 iso_pu_bacteria 2808606401 2809064000 304
644 iso_pu_bacteria 2808606404 2809079968 304
645 iso_pu_bacteria 2808606405 2809084333 304
646 iso_pu_bacteria 2818991466 2819715542 304
647 iso_pu_bacteria 2879163058 2879163445 304
648 iso_pu_bacteria 2880518877 2880522859 304
649 iso_pu_bacteria 2882806704 2882809363 304
650 iso_pu_bacteria 2895880812 2895881152 304
651 iso_pu_bacteria 2928027323 2928029032 304
652 iso_pu_bacteria 2928027323 2928029388 304
653 iso_pu_bacteria 2928526807 2928529561 304
654 iso_pu_bacteria 2928968154 2928970951 304
655 iso_pu_bacteria 2984555340 2984556585 304
656 iso_pu_bacteria 2984555340 2984557733 304
657 iso_pu_bacteria 2984564862 2984565244 304
658 iso_pu_bacteria 2984564862 2984567900 304
659 iso_pu_bacteria 2990265787 2990268239 304
660 iso_pu_bacteria 2993356040 2993356318 304
661 iso_pu_bacteria 2993356040 2993358949 304
662 iso_pu_bacteria 2993693658 2993696729 304
663 iso_pu_bacteria 8055266321 8055267755 304
664 3300044684 Ga0466966_0005296 Ga0466966_0005296_3966_4904 305
665 3300045049 Ga0466959_0006808 Ga0466959_0006808_3185_4123 305
666 3300046472 Ga0495580_0002459 Ga0495580_0002459_12638_13579 305
667 iso_pu_bacteria 2513237166 2514052433 305
668 iso_pu_bacteria 2600255067 2600810049 305
669 iso_pu_bacteria 2643221560 2643820613 305
670 iso_pu_bacteria 2738541275 2738712994 305
671 iso_pu_bacteria 2738541301 2738851418 305
672 iso_pu_bacteria 2738541304 2738867148 305
673 iso_pu_bacteria 2738543022 2739299665 305
674 iso_pu_bacteria 2738543033 2739361344 305
675 iso_pu_bacteria 2904615490 2904621995 305
676 iso_pu_bacteria 2928100450 2928100854 305
677 iso_pu_bacteria 2928100450 2928104484 305
678 iso_pu_bacteria 2928100450 2928104760 305
679 iso_pu_bacteria 2928959182 2928960919 305
680 iso_pu_bacteria 2928959182 2928963052 305
681 3300005329 Ga0070683_100226595 Ga0070683_1002265952 307
682 3300005340 Ga0070689_100037387 Ga0070689_1000373872 307
683 3300005367 Ga0070667_100165074 Ga0070667_1001650742 307
684 3300006195 Ga0075366_10086130 Ga0075366_100861302 307
685 3300025908 Ga0207643_10139735 Ga0207643_101397351 307
686 3300025961 Ga0207712_10298350 Ga0207712_102983502 307
687 3300025986 Ga0207658_10012640 Ga0207658_100126402 307
688 3300028381 Ga0268264_10027689 Ga0268264_100276894 307
689 3300050493 nmdc:mga0k408_90392_c1 nmdc:mga0k408_90392_c1_326_1258 307
690 3300001989 JGI24739J22299_10001158 JGI24739J22299_100011588 308
691 3300001990 JGI24737J22298_10013918 JGI24737J22298_100139183 308
692 3300001990 JGI24737J22298_10035213 JGI24737J22298_100352132 308
693 3300002067 JGI24735J21928_10001152 JGI24735J21928_100011524 308
694 3300002076 JGI24749J21850_1000250 JGI24749J21850_10002506 308
695 3300002239 JGI24034J26672_10001749 JGI24034J26672_100017492 308
696 3300003771 Ga0055526_1002635 Ga0055526_100263513 308
697 3300003773 Ga0055537_1000855 Ga0055537_10008559 308
698 3300003781 Ga0055536_1009244 Ga0055536_10092443 308
699 3300003791 Ga0055530_10000915 Ga0055530_1000091511 308
700 3300003791 Ga0055530_10007450 Ga0055530_100074506 308
701 3300003792 Ga0055540_1001979 Ga0055540_10019797 308
702 3300003794 Ga0055531_10001375 Ga0055531_1000137518 308
703 3300003794 Ga0055531_10010680 Ga0055531_100106801 308
704 3300003794 Ga0055531_10010691 Ga0055531_100106911 308
705 3300005289 Ga0065704_10080202 Ga0065704_100802023 308
706 3300005293 Ga0065715_10000525 Ga0065715_1000052511 308
707 3300005327 Ga0070658_10503319 Ga0070658_105033191 308
708 3300005328 Ga0070676_10051976 Ga0070676_100519762 308
709 3300005330 Ga0070690_100151851 Ga0070690_1001518512 308
710 3300005331 Ga0070670_100001338 Ga0070670_1000013385 308
711 3300005331 Ga0070670_100002350 Ga0070670_10000235014 308
712 3300005331 Ga0070670_100094261 Ga0070670_1000942612 308
713 3300005333 Ga0070677_10006520 Ga0070677_100065203 308
714 3300005339 Ga0070660_100021489 Ga0070660_1000214895 308
715 3300005347 Ga0070668_100000009 Ga0070668_10000000946 308
716 3300005347 Ga0070668_100007239 Ga0070668_1000072397 308
717 3300005347 Ga0070668_100019447 Ga0070668_1000194473 308
718 3300005353 Ga0070669_100001807 Ga0070669_1000018076 308
719 3300005354 Ga0070675_100018279 Ga0070675_1000182795 308
720 3300005355 Ga0070671_100000098 Ga0070671_10000009840 308
721 3300005355 Ga0070671_100000864 Ga0070671_1000008644 308
722 3300005355 Ga0070671_100007364 Ga0070671_1000073642 308
723 3300005356 Ga0070674_100010715 Ga0070674_1000107153 308
724 3300005364 Ga0070673_100015714 Ga0070673_1000157143 308
725 3300005367 Ga0070667_100009388 Ga0070667_1000093884 308
726 3300005367 Ga0070667_100114296 Ga0070667_1001142962 308
727 3300005441 Ga0070700_100094271 Ga0070700_1000942712 308
728 3300005457 Ga0070662_100000631 Ga0070662_1000006319 308
729 3300005457 Ga0070662_100090723 Ga0070662_1000907231 308
730 3300005457 Ga0070662_100161588 Ga0070662_1001615881 308
731 3300005459 Ga0068867_100014480 Ga0068867_1000144805 308
732 3300005530 Ga0070679_100028399 Ga0070679_1000283992 308
733 3300005543 Ga0070672_100002940 Ga0070672_1000029402 308
734 3300005548 Ga0070665_100053373 Ga0070665_1000533735 308
735 3300005564 Ga0070664_100066229 Ga0070664_1000662292 308
736 3300005564 Ga0070664_100224747 Ga0070664_1002247472 308
737 3300005577 Ga0068857_100036094 Ga0068857_1000360944 308
738 3300005577 Ga0068857_100507083 Ga0068857_1005070832 308
739 3300005577 Ga0068857_100523620 Ga0068857_1005236202 308
740 3300005578 Ga0068854_100037446 Ga0068854_1000374464 308
741 3300005578 Ga0068854_100232983 Ga0068854_1002329831 308
742 3300005616 Ga0068852_100286571 Ga0068852_1002865711 308
743 3300005617 Ga0068859_100010242 Ga0068859_1000102424 308
744 3300005617 Ga0068859_100015774 Ga0068859_1000157742 308
745 3300005617 Ga0068859_100029609 Ga0068859_1000296095 308
746 3300005719 Ga0068861_100000063 Ga0068861_10000006324 308
747 3300005719 Ga0068861_100001909 Ga0068861_1000019097 308
748 3300005840 Ga0068870_10013846 Ga0068870_100138462 308
749 3300005841 Ga0068863_100000040 Ga0068863_10000004046 308
750 3300005841 Ga0068863_100006668 Ga0068863_1000066686 308
751 3300005842 Ga0068858_100028254 Ga0068858_1000282543 308
752 3300005843 Ga0068860_100010214 Ga0068860_1000102143 308
753 3300005843 Ga0068860_100030395 Ga0068860_1000303953 308
754 3300005844 Ga0068862_100021652 Ga0068862_1000216522 308
755 3300005844 Ga0068862_100156221 Ga0068862_1001562212 308
756 3300005937 Ga0081455_10143107 Ga0081455_101431072 308
757 3300005985 Ga0081539_10041438 Ga0081539_100414383 308
758 3300005985 Ga0081539_10063347 Ga0081539_100633472 308
759 3300006051 Ga0075364_10020342 Ga0075364_100203424 308
760 3300006353 Ga0075370_10060482 Ga0075370_100604822 308
761 3300006844 Ga0075428_100191014 Ga0075428_1001910143 308
762 3300006881 Ga0068865_100154166 Ga0068865_1001541662 308
763 3300006931 Ga0097620_100010242 Ga0097620_1000102424 308
764 3300006931 Ga0097620_100015774 Ga0097620_1000157747 308
765 3300006931 Ga0097620_100029609 Ga0097620_1000296092 308
766 3300009093 Ga0105240_10069217 Ga0105240_100692174 308
767 3300009093 Ga0105240_10164425 Ga0105240_101644253 308
768 3300009093 Ga0105240_10244333 Ga0105240_102443332 308
769 3300009093 Ga0105240_10484320 Ga0105240_104843201 308
770 3300009148 Ga0105243_10042605 Ga0105243_100426052 308
771 3300009174 Ga0105241_10086848 Ga0105241_100868483 308
772 3300009177 Ga0105248_10001383 Ga0105248_1000138314 308
773 3300009177 Ga0105248_10008545 Ga0105248_100085453 308
774 3300009177 Ga0105248_10138668 Ga0105248_101386682 308
775 3300009545 Ga0105237_10023330 Ga0105237_100233307 308
776 3300009551 Ga0105238_10059364 Ga0105238_100593644 308
777 3300009553 Ga0105249_10064119 Ga0105249_100641193 308
778 3300009553 Ga0105249_10069928 Ga0105249_100699283 308
779 3300010375 Ga0105239_10180266 Ga0105239_101802662 308
780 3300013104 Ga0157370_10207164 Ga0157370_102071642 308
781 3300013105 Ga0157369_10076259 Ga0157369_100762592 308
782 3300013306 Ga0163162_10298481 Ga0163162_102984812 308
783 3300013307 Ga0157372_10501534 Ga0157372_105015341 308
784 3300013307 Ga0157372_10579879 Ga0157372_105798792 308
785 3300013308 Ga0157375_10089002 Ga0157375_100890022 308
786 3300014325 Ga0163163_10086154 Ga0163163_100861543 308
787 3300014326 Ga0157380_10020143 Ga0157380_100201433 308
788 3300014326 Ga0157380_10374770 Ga0157380_103747702 308
789 3300014968 Ga0157379_10042887 Ga0157379_100428872 308
790 3300017792 Ga0163161_10025334 Ga0163161_100253342 308
791 3300021361 Ga0213872_10007647 Ga0213872_100076476 308
792 3300025246 Ga0209646_1011061 Ga0209646_10110612 308
793 3300025263 Ga0209565_1000272 Ga0209565_100027225 308
794 3300025273 Ga0209673_1011390 Ga0209673_10113903 308
795 3300025291 Ga0209675_1000472 Ga0209675_100047213 308
796 3300025292 Ga0209676_1000226 Ga0209676_100022696 308
797 3300025292 Ga0209676_1005732 Ga0209676_10057322 308
798 3300025294 Ga0209025_1014061 Ga0209025_10140612 308
799 3300025295 Ga0209564_1000949 Ga0209564_100094922 308
800 3300025295 Ga0209564_1018313 Ga0209564_10183132 308
801 3300025298 Ga0209050_1000001 Ga0209050_1000001497 308
802 3300025298 Ga0209050_1000167 Ga0209050_100016775 308
803 3300025298 Ga0209050_1004367 Ga0209050_10043673 308
804 3300025298 Ga0209050_1012902 Ga0209050_10129021 308
805 3300025298 Ga0209050_1013829 Ga0209050_10138294 308
806 3300025303 Ga0209051_1000472 Ga0209051_10004727 308
807 3300025304 Ga0209257_1000028 Ga0209257_1000028661 308
808 3300025304 Ga0209257_1004307 Ga0209257_10043076 308
809 3300025304 Ga0209257_1005425 Ga0209257_10054257 308
810 3300025315 Ga0207697_10000312 Ga0207697_1000031217 308
811 3300025893 Ga0207682_10000353 Ga0207682_1000035311 308
812 3300025901 Ga0207688_10075641 Ga0207688_100756412 308
813 3300025907 Ga0207645_10003989 Ga0207645_1000398911 308
814 3300025907 Ga0207645_10066974 Ga0207645_100669742 308
815 3300025908 Ga0207643_10048655 Ga0207643_100486552 308
816 3300025909 Ga0207705_10127460 Ga0207705_101274602 308
817 3300025911 Ga0207654_10151892 Ga0207654_101518921 308
818 3300025911 Ga0207654_10297958 Ga0207654_102979581 308
819 3300025913 Ga0207695_10050060 Ga0207695_100500603 308
820 3300025913 Ga0207695_10111754 Ga0207695_101117541 308
821 3300025913 Ga0207695_10196709 Ga0207695_101967092 308
822 3300025914 Ga0207671_10007591 Ga0207671_100075914 308
823 3300025918 Ga0207662_10120637 Ga0207662_101206372 308
824 3300025919 Ga0207657_10005880 Ga0207657_100058803 308
825 3300025919 Ga0207657_10041643 Ga0207657_100416434 308
826 3300025921 Ga0207652_10198852 Ga0207652_101988522 308
827 3300025923 Ga0207681_10004134 Ga0207681_100041342 308
828 3300025923 Ga0207681_10157179 Ga0207681_101571791 308
829 3300025924 Ga0207694_10011065 Ga0207694_100110655 308
830 3300025925 Ga0207650_10003098 Ga0207650_100030987 308
831 3300025925 Ga0207650_10026696 Ga0207650_100266962 308
832 3300025931 Ga0207644_10000035 Ga0207644_1000003546 308
833 3300025931 Ga0207644_10000301 Ga0207644_100003013 308
834 3300025931 Ga0207644_10056208 Ga0207644_100562082 308
835 3300025932 Ga0207690_10125324 Ga0207690_101253242 308
836 3300025933 Ga0207706_10000489 Ga0207706_1000048925 308
837 3300025933 Ga0207706_10006049 Ga0207706_100060492 308
838 3300025935 Ga0207709_10023531 Ga0207709_100235313 308
839 3300025937 Ga0207669_10063701 Ga0207669_100637012 308
840 3300025938 Ga0207704_10042745 Ga0207704_100427453 308
841 3300025940 Ga0207691_10000784 Ga0207691_100007848 308
842 3300025941 Ga0207711_10004144 Ga0207711_100041442 308
843 3300025941 Ga0207711_10016447 Ga0207711_100164473 308
844 3300025941 Ga0207711_10045371 Ga0207711_100453713 308
845 3300025941 Ga0207711_10452027 Ga0207711_104520272 308
846 3300025945 Ga0207679_10263971 Ga0207679_102639712 308
847 3300025972 Ga0207668_10000147 Ga0207668_1000014732 308
848 3300025972 Ga0207668_10002842 Ga0207668_100028422 308
849 3300025981 Ga0207640_10002074 Ga0207640_100020748 308
850 3300025981 Ga0207640_10014644 Ga0207640_100146445 308
851 3300025986 Ga0207658_10010486 Ga0207658_100104862 308
852 3300025986 Ga0207658_10034186 Ga0207658_100341863 308
853 3300025986 Ga0207658_10395802 Ga0207658_103958022 308
854 3300026035 Ga0207703_10125579 Ga0207703_101255791 308
855 3300026041 Ga0207639_10249595 Ga0207639_102495952 308
856 3300026075 Ga0207708_10146702 Ga0207708_101467022 308
857 3300026078 Ga0207702_10099945 Ga0207702_100999452 308
858 3300026088 Ga0207641_10000039 Ga0207641_10000039140 308
859 3300026088 Ga0207641_10007735 Ga0207641_100077355 308
860 3300026116 Ga0207674_10011227 Ga0207674_100112276 308
861 3300026116 Ga0207674_10011292 Ga0207674_100112927 308
862 3300026116 Ga0207674_10099608 Ga0207674_100996082 308
863 3300026118 Ga0207675_100000613 Ga0207675_10000061321 308
864 3300026118 Ga0207675_100011460 Ga0207675_1000114607 308
865 3300026121 Ga0207683_10049848 Ga0207683_100498481 308
866 3300026142 Ga0207698_10265394 Ga0207698_102653942 308
867 3300026142 Ga0207698_10318589 Ga0207698_103185892 308
868 3300026142 Ga0207698_10405887 Ga0207698_104058871 308
869 3300027876 Ga0209974_10016711 Ga0209974_100167112 308
870 3300028380 Ga0268265_10059987 Ga0268265_100599871 308
871 3300028381 Ga0268264_10000743 Ga0268264_1000074331 308
872 3300028381 Ga0268264_10006008 Ga0268264_100060084 308
873 3300030745 Ga0316182_1045715 Ga0316182_10457153 308
874 3300031548 Ga0307408_100000067 Ga0307408_10000006766 308
875 3300031548 Ga0307408_100240539 Ga0307408_1002405391 308
876 3300031548 Ga0307408_100292757 Ga0307408_1002927571 308
877 3300031691 Ga0316579_10027068 Ga0316579_100270683 308
878 3300031731 Ga0307405_10004177 Ga0307405_100041772 308
879 3300031731 Ga0307405_10038349 Ga0307405_100383492 308
880 3300031731 Ga0307405_10102745 Ga0307405_101027452 308
881 3300031731 Ga0307405_10155505 Ga0307405_101555051 308
882 3300031731 Ga0307405_10158867 Ga0307405_101588672 308
883 3300031731 Ga0307405_10292087 Ga0307405_102920871 308
884 3300031824 Ga0307413_10002129 Ga0307413_100021295 308
885 3300031824 Ga0307413_10003908 Ga0307413_100039087 308
886 3300031824 Ga0307413_10115736 Ga0307413_101157362 308
887 3300031852 Ga0307410_10029066 Ga0307410_100290663 308
888 3300031852 Ga0307410_10162412 Ga0307410_101624121 308
889 3300031852 Ga0307410_10170549 Ga0307410_101705492 308
890 3300031852 Ga0307410_10239030 Ga0307410_102390302 308
891 3300031852 Ga0307410_10276584 Ga0307410_102765841 308
892 3300031901 Ga0307406_10027321 Ga0307406_100273213 308
893 3300031901 Ga0307406_10085005 Ga0307406_100850052 308
894 3300031903 Ga0307407_10028585 Ga0307407_100285852 308
895 3300031903 Ga0307407_10077303 Ga0307407_100773032 308
896 3300031903 Ga0307407_10136573 Ga0307407_101365732 308
897 3300031911 Ga0307412_10027378 Ga0307412_100273783 308
898 3300031911 Ga0307412_10049612 Ga0307412_100496124 308
899 3300031911 Ga0307412_10064345 Ga0307412_100643453 308
900 3300031995 Ga0307409_100039050 Ga0307409_1000390502 308
901 3300031995 Ga0307409_100128373 Ga0307409_1001283732 308
902 3300031995 Ga0307409_100152307 Ga0307409_1001523073 308
903 3300031995 Ga0307409_100302523 Ga0307409_1003025232 308
904 3300032002 Ga0307416_100350597 Ga0307416_1003505972 308
905 3300032004 Ga0307414_10000398 Ga0307414_1000039820 308
906 3300032004 Ga0307414_10003403 Ga0307414_100034038 308
907 3300032004 Ga0307414_10007234 Ga0307414_100072347 308
908 3300032004 Ga0307414_10157704 Ga0307414_101577042 308
909 3300032004 Ga0307414_10181692 Ga0307414_101816922 308
910 3300032004 Ga0307414_10531306 Ga0307414_105313062 308
911 3300032005 Ga0307411_10002515 Ga0307411_100025154 308
912 3300032005 Ga0307411_10033556 Ga0307411_100335563 308
913 3300032005 Ga0307411_10046252 Ga0307411_100462524 308
914 3300032005 Ga0307411_10086206 Ga0307411_100862062 308
915 3300032005 Ga0307411_10182144 Ga0307411_101821442 308
916 3300032126 Ga0307415_100098253 Ga0307415_1000982532 308
917 3300032126 Ga0307415_100226331 Ga0307415_1002263312 308
918 3300032133 Ga0316583_10005519 Ga0316583_100055191 308
919 3300034817 Ga0373948_0019815 Ga0373948_0019815_272_1207 308
920 3300035112 Ga0373932_0006608 Ga0373932_0006608_1450_2385 308
921 3300036647 Ga0316582_0024908 Ga0316582_0024908_793_1725 308
922 3300036647 Ga0316582_0233046 Ga0316582_0233046_49_978 308
923 3300036712 Ga0316584_0078234 Ga0316584_0078234_44_973 308
924 3300037312 Ga0395899_0047146 Ga0395899_0047146_1477_2406 308
925 3300037418 Ga0395900_0000380 Ga0395900_0000380_38449_39378 308
926 3300037418 Ga0395900_0021446 Ga0395900_0021446_5118_6047 308
927 3300037418 Ga0395900_0024980 Ga0395900_0024980_2125_3054 308
928 3300037418 Ga0395900_0231169 Ga0395900_0231169_120_1049 308
929 3300037466 Ga0395898_0020952 Ga0395898_0020952_3489_4418 308
930 3300037471 Ga0395905_0001357 Ga0395905_0001357_8044_8973 308
931 3300037471 Ga0395905_0006585 Ga0395905_0006585_10299_11228 308
932 3300037471 Ga0395905_0016465 Ga0395905_0016465_535_1464 308
933 3300037471 Ga0395905_0031754 Ga0395905_0031754_1904_2833 308
934 3300037471 Ga0395905_0132126 Ga0395905_0132126_447_1382 308
935 3300038443 Ga0395901_0253429 Ga0395901_0253429_382_1311 308
936 3300038443 Ga0395901_0393239 Ga0395901_0393239_68_997 308
937 3300039447 Ga0436361_0443819 Ga0436361_0443819_6677_7606 308
938 3300042439 Ga0439464_0004701 Ga0439464_0004701_1099_2028 308
939 3300044765 Ga0466970_0030510 Ga0466970_0030510_1639_2568 308
940 3300046460 Ga0495638_0011014 Ga0495638_0011014_5143_6078 308
941 3300046460 Ga0495638_0034250 Ga0495638_0034250_534_1469 308
942 3300046492 Ga0495585_0087990 Ga0495585_0087990_693_1625 308
943 3300046506 Ga0495583_0000474 Ga0495583_0000474_24667_25602 308
944 3300046506 Ga0495583_0000577 Ga0495583_0000577_14011_14946 308
945 3300046507 Ga0495606_0041089 Ga0495606_0041089_403_1332 308
946 3300046507 Ga0495606_0128040 Ga0495606_0128040_52_987 308
947 3300046522 Ga0495643_0000806 Ga0495643_0000806_6523_7452 308
948 3300046522 Ga0495643_0002033 Ga0495643_0002033_14568_15500 308
949 3300046522 Ga0495643_0008791 Ga0495643_0008791_76_1008 308
950 3300046524 Ga0495648_0000114 Ga0495648_0000114_20227_21159 308
951 3300046525 Ga0495663_0007342 Ga0495663_0007342_451_1380 308
952 3300046528 Ga0495642_0003949 Ga0495642_0003949_4326_5258 308
953 3300046530 Ga0495654_0030806 Ga0495654_0030806_1275_2204 308
954 3300046538 Ga0495609_0018276 Ga0495609_0018276_2278_3207 308
955 3300046558 Ga0495633_0068583 Ga0495633_0068583_457_1386 308
956 3300046660 Ga0495625_0001605 Ga0495625_0001605_2555_3487 308
957 3300046660 Ga0495625_0056411 Ga0495625_0056411_458_1387 308
958 3300046665 Ga0495661_0058386 Ga0495661_0058386_1221_2156 308
959 3300046684 Ga0495669_0049749 Ga0495669_0049749_907_1836 308
960 3300046684 Ga0495669_0089557 Ga0495669_0089557_462_1391 308
961 3300046691 Ga0495670_0064401 Ga0495670_0064401_340_1269 308
962 3300046692 Ga0495671_0017383 Ga0495671_0017383_1068_1997 308
963 3300047445 Ga0495677_0073744 Ga0495677_0073744_101_1033 308
964 3300047469 Ga0495673_0040173 Ga0495673_0040173_83_1012 308
965 3300047472 Ga0495686_0000100 Ga0495686_0000100_132398_133327 308
966 3300048904 Ga0496101_0050962 Ga0496101_0050962_1753_2682 308
967 3300048905 Ga0496102_0000321 Ga0496102_0000321_36858_37787 308
968 3300048906 Ga0496103_0000199 Ga0496103_0000199_36780_37709 308
969 3300048906 Ga0496103_0148434 Ga0496103_0148434_445_1374 308
970 3300048908 Ga0496105_0267698 Ga0496105_0267698_407_1336 308
971 3300048913 Ga0496110_0225473 Ga0496110_0225473_738_1667 308
972 3300048917 Ga0496114_0007983 Ga0496114_0007983_3657_4586 308
973 3300048917 Ga0496114_0008871 Ga0496114_0008871_466_1395 308
974 3300048919 Ga0496116_0000648 Ga0496116_0000648_7903_8832 308
975 3300048919 Ga0496116_0018949 Ga0496116_0018949_1380_2309 308
976 3300048919 Ga0496116_0025177 Ga0496116_0025177_1663_2592 308
977 3300048919 Ga0496116_0061976 Ga0496116_0061976_1192_2121 308
978 3300048920 Ga0496117_0000584 Ga0496117_0000584_22324_23253 308
979 3300048921 Ga0496118_0000588 Ga0496118_0000588_22324_23253 308
980 3300048921 Ga0496118_0042162 Ga0496118_0042162_2459_3388 308
981 3300048923 Ga0496120_0006949 Ga0496120_0006949_1563_2492 308
982 3300048924 Ga0496121_0005909 Ga0496121_0005909_4039_4968 308
983 3300048924 Ga0496121_0098452 Ga0496121_0098452_796_1725 308
984 3300048925 Ga0496122_0000033 Ga0496122_0000033_114190_115119 308
985 3300048925 Ga0496122_0000218 Ga0496122_0000218_119156_120085 308
986 3300048925 Ga0496122_0006049 Ga0496122_0006049_11269_12213 308
987 3300048926 Ga0496123_0000089 Ga0496123_0000089_150732_151661 308
988 3300048926 Ga0496123_0000741 Ga0496123_0000741_24151_25080 308
989 3300048926 Ga0496123_0002070 Ga0496123_0002070_20379_21323 308
990 3300048926 Ga0496123_0010286 Ga0496123_0010286_728_1657 308
991 3300048926 Ga0496123_0060612 Ga0496123_0060612_838_1767 308
992 3300048927 Ga0496124_0000387 Ga0496124_0000387_57601_58530 308
993 3300048927 Ga0496124_0007325 Ga0496124_0007325_10777_11706 308
994 3300048927 Ga0496124_0011763 Ga0496124_0011763_4179_5108 308
995 3300048927 Ga0496124_0139411 Ga0496124_0139411_65_994 308
996 3300048928 Ga0496125_0000117 Ga0496125_0000117_154057_154986 308
997 3300048928 Ga0496125_0086716 Ga0496125_0086716_458_1387 308
998 3300048929 Ga0496126_0179803 Ga0496126_0179803_382_1311 308
999 3300048929 Ga0496126_0239104 Ga0496126_0239104_458_1387 308
1000 3300049571 Ga0501034_0423429 Ga0501034_0423429_123_1055 308
1001 3300049579 Ga0501043_0055003 Ga0501043_0055003_1968_2897 308
1002 3300049581 Ga0501047_0441956 Ga0501047_0441956_46_975 308
1003 3300049823 Ga0501044_0152694 Ga0501044_0152694_441_1370 308
1004 3300050496 nmdc:mga07m45_91046_c1 nmdc:mga07m45_91046_c1_534_1463 308
1005 3300053087 Ga0500643_000005 Ga0500643_000005_405355_406284 308
1006 3300053096 Ga0500641_0000927 Ga0500641_0000927_5263_6192 308
1007 3300053103 Ga0500555_000457 Ga0500555_000457_6030_6965 308
1008 3300053104 Ga0500556_0000522 Ga0500556_0000522_8879_9808 308
1009 3300053120 Ga0500597_013253 Ga0500597_013253_1002_1931 308
1010 3300053130 Ga0500642_0000007 Ga0500642_0000007_11614_12543 308
1011 3300053139 Ga0500568_0002901 Ga0500568_0002901_6898_7827 308
1012 3300053157 Ga0500624_000050 Ga0500624_000050_22450_23379 308
1013 3300053158 Ga0500627_0000017 Ga0500627_0000017_78980_79909 308
1014 3300053158 Ga0500627_0079275 Ga0500627_0079275_428_1357 308
1015 3300053178 Ga0500637_0000061 Ga0500637_0000061_22397_23326 308
1016 3300053730 Ga0500645_000038 Ga0500645_000038_58771_59703 308
1017 3300053730 Ga0500645_000637 Ga0500645_000637_13947_14876 308
1018 3300053730 Ga0500645_004200 Ga0500645_004200_4101_5030 308
1019 3300003791 Ga0055530_10000012 Ga0055530_10000012121 309
1020 3300003794 Ga0055531_10002076 Ga0055531_1000207611 309
1021 3300005338 Ga0068868_100025889 Ga0068868_1000258892 309
1022 3300005343 Ga0070687_100009474 Ga0070687_1000094744 309
1023 3300005345 Ga0070692_10028039 Ga0070692_100280393 309
1024 3300005356 Ga0070674_100218124 Ga0070674_1002181242 309
1025 3300005444 Ga0070694_100073343 Ga0070694_1000733432 309
1026 3300005445 Ga0070708_100000180 Ga0070708_10000018033 309
1027 3300005457 Ga0070662_100017146 Ga0070662_1000171465 309
1028 3300005459 Ga0068867_100010488 Ga0068867_1000104885 309
1029 3300005459 Ga0068867_100141052 Ga0068867_1001410521 309
1030 3300005468 Ga0070707_100002462 Ga0070707_1000024625 309
1031 3300005471 Ga0070698_100153526 Ga0070698_1001535262 309
1032 3300005518 Ga0070699_100068978 Ga0070699_1000689782 309
1033 3300005536 Ga0070697_100229209 Ga0070697_1002292091 309
1034 3300005546 Ga0070696_100148847 Ga0070696_1001488472 309
1035 3300005547 Ga0070693_100016243 Ga0070693_1000162432 309
1036 3300005547 Ga0070693_100205483 Ga0070693_1002054831 309
1037 3300005549 Ga0070704_100242153 Ga0070704_1002421532 309
1038 3300006177 Ga0075362_10041739 Ga0075362_100417392 309
1039 3300006186 Ga0075369_10018437 Ga0075369_100184372 309
1040 3300009098 Ga0105245_10007234 Ga0105245_100072349 309
1041 3300013100 Ga0157373_10250440 Ga0157373_102504402 309
1042 3300013297 Ga0157378_10009372 Ga0157378_100093725 309
1043 3300025292 Ga0209676_1000387 Ga0209676_100038742 309
1044 3300025298 Ga0209050_1000450 Ga0209050_100045038 309
1045 3300025304 Ga0209257_1002265 Ga0209257_10022653 309
1046 3300025901 Ga0207688_10103057 Ga0207688_101030572 309
1047 3300025907 Ga0207645_10003327 Ga0207645_100033272 309
1048 3300025912 Ga0207707_10075505 Ga0207707_100755052 309
1049 3300025912 Ga0207707_10264273 Ga0207707_102642732 309
1050 3300025917 Ga0207660_10397361 Ga0207660_103973611 309
1051 3300025918 Ga0207662_10095943 Ga0207662_100959432 309
1052 3300025922 Ga0207646_10001573 Ga0207646_100015736 309
1053 3300025927 Ga0207687_10084324 Ga0207687_100843242 309
1054 3300025933 Ga0207706_10002195 Ga0207706_100021959 309
1055 3300025942 Ga0207689_10235722 Ga0207689_102357222 309
1056 3300026023 Ga0207677_10111773 Ga0207677_101117732 309
1057 3300026075 Ga0207708_10335931 Ga0207708_103359312 309
1058 3300026089 Ga0207648_10018143 Ga0207648_100181432 309
1059 3300026089 Ga0207648_10129184 Ga0207648_101291842 309
1060 3300032002 Ga0307416_100118645 Ga0307416_1001186452 309
1061 3300046459 Ga0495629_0000049 Ga0495629_0000049_11925_12863 309
1062 3300046463 Ga0495653_0002923 Ga0495653_0002923_11900_12838 309
1063 3300046472 Ga0495580_0005345 Ga0495580_0005345_2821_3759 309
1064 3300046558 Ga0495633_0141236 Ga0495633_0141236_50_982 309
1065 3300046690 Ga0495624_0000070 Ga0495624_0000070_53162_54100 309
1066 3300047319 Ga0495674_0000123 Ga0495674_0000123_52777_53715 309
1067 3300047673 Ga0495593_0000610 Ga0495593_0000610_10801_11739 309
1068 3300048927 Ga0496124_0021172 Ga0496124_0021172_3244_4176 309
1069 3300050516 nmdc:mga0sz30_125788_c1 nmdc:mga0sz30_125788_c1_22_954 309
1070 3300053087 Ga0500643_001098 Ga0500643_001098_11106_12038 309
1071 3300053125 Ga0500618_011359 Ga0500618_011359_355_1287 309
1072 3300053141 Ga0500574_013783 Ga0500574_013783_575_1507 309
1073 3300053162 Ga0500638_100469 Ga0500638_100469_380_1312 309
1074 3300053177 Ga0500636_0003403 Ga0500636_0003403_7774_8706 309
1075 3300005327 Ga0070658_10128241 Ga0070658_101282412 310
1076 3300005336 Ga0070680_100001504 Ga0070680_1000015048 310
1077 3300005336 Ga0070680_100025496 Ga0070680_1000254964 310
1078 3300005336 Ga0070680_100045358 Ga0070680_1000453583 310
1079 3300005337 Ga0070682_100073675 Ga0070682_1000736752 310
1080 3300005337 Ga0070682_100194291 Ga0070682_1001942912 310
1081 3300005339 Ga0070660_100120546 Ga0070660_1001205462 310
1082 3300005344 Ga0070661_100019204 Ga0070661_1000192042 310
1083 3300005344 Ga0070661_100061123 Ga0070661_1000611232 310
1084 3300005435 Ga0070714_100000922 Ga0070714_10000092210 310
1085 3300005458 Ga0070681_10000473 Ga0070681_1000047311 310
1086 3300005458 Ga0070681_10034434 Ga0070681_100344343 310
1087 3300005458 Ga0070681_10055257 Ga0070681_100552572 310
1088 3300005458 Ga0070681_10067156 Ga0070681_100671563 310
1089 3300005458 Ga0070681_10107087 Ga0070681_101070873 310
1090 3300005458 Ga0070681_10250387 Ga0070681_102503872 310
1091 3300005459 Ga0068867_100212467 Ga0068867_1002124672 310
1092 3300005518 Ga0070699_100018911 Ga0070699_1000189113 310
1093 3300005530 Ga0070679_100031597 Ga0070679_1000315973 310
1094 3300005530 Ga0070679_100032305 Ga0070679_1000323054 310
1095 3300005530 Ga0070679_100078547 Ga0070679_1000785472 310
1096 3300005530 Ga0070679_100321954 Ga0070679_1003219542 310
1097 3300005535 Ga0070684_100027814 Ga0070684_1000278142 310
1098 3300005536 Ga0070697_100118843 Ga0070697_1001188432 310
1099 3300005539 Ga0068853_100001865 Ga0068853_10000186513 310
1100 3300005546 Ga0070696_100003725 Ga0070696_10000372511 310
1101 3300005563 Ga0068855_100010819 Ga0068855_1000108195 310
1102 3300005563 Ga0068855_100092167 Ga0068855_1000921673 310
1103 3300005578 Ga0068854_100063354 Ga0068854_1000633543 310
1104 3300005578 Ga0068854_100151179 Ga0068854_1001511792 310
1105 3300005616 Ga0068852_100006128 Ga0068852_1000061283 310
1106 3300006028 Ga0070717_10251370 Ga0070717_102513702 310
1107 3300006173 Ga0070716_100001330 Ga0070716_1000013302 310
1108 3300006852 Ga0075433_10026279 Ga0075433_100262792 310
1109 3300006871 Ga0075434_100027782 Ga0075434_1000277826 310
1110 3300006914 Ga0075436_100029866 Ga0075436_1000298662 310
1111 3300009093 Ga0105240_10069861 Ga0105240_100698612 310
1112 3300009174 Ga0105241_10059775 Ga0105241_100597753 310
1113 3300009551 Ga0105238_10002601 Ga0105238_100026013 310
1114 3300013100 Ga0157373_10024313 Ga0157373_100243135 310
1115 3300013104 Ga0157370_10059080 Ga0157370_100590803 310
1116 3300013105 Ga0157369_10018458 Ga0157369_100184585 310
1117 3300013307 Ga0157372_10129059 Ga0157372_101290592 310
1118 3300013307 Ga0157372_10181482 Ga0157372_101814822 310
1119 3300014325 Ga0163163_10046351 Ga0163163_100463514 310
1120 3300014497 Ga0182008_10005339 Ga0182008_100053395 310
1121 3300020082 Ga0206353_10063925 Ga0206353_100639251 310
1122 3300025906 Ga0207699_10167766 Ga0207699_101677661 310
1123 3300025911 Ga0207654_10062980 Ga0207654_100629802 310
1124 3300025912 Ga0207707_10000423 Ga0207707_1000042327 310
1125 3300025912 Ga0207707_10004235 Ga0207707_100042353 310
1126 3300025912 Ga0207707_10015113 Ga0207707_100151138 310
1127 3300025912 Ga0207707_10020753 Ga0207707_100207534 310
1128 3300025912 Ga0207707_10028894 Ga0207707_100288945 310
1129 3300025912 Ga0207707_10291043 Ga0207707_102910432 310
1130 3300025913 Ga0207695_10151872 Ga0207695_101518722 310
1131 3300025913 Ga0207695_10227666 Ga0207695_102276662 310
1132 3300025917 Ga0207660_10008593 Ga0207660_100085936 310
1133 3300025917 Ga0207660_10029939 Ga0207660_100299393 310
1134 3300025917 Ga0207660_10040194 Ga0207660_100401942 310
1135 3300025917 Ga0207660_10053794 Ga0207660_100537943 310
1136 3300025917 Ga0207660_10067313 Ga0207660_100673132 310
1137 3300025919 Ga0207657_10009564 Ga0207657_100095642 310
1138 3300025919 Ga0207657_10081288 Ga0207657_100812883 310
1139 3300025920 Ga0207649_10060458 Ga0207649_100604582 310
1140 3300025921 Ga0207652_10001835 Ga0207652_100018351 310
1141 3300025921 Ga0207652_10016980 Ga0207652_100169804 310
1142 3300025921 Ga0207652_10022155 Ga0207652_100221554 310
1143 3300025921 Ga0207652_10024980 Ga0207652_100249802 310
1144 3300025921 Ga0207652_10074434 Ga0207652_100744342 310
1145 3300025921 Ga0207652_10116860 Ga0207652_101168602 310
1146 3300025921 Ga0207652_10172984 Ga0207652_101729842 310
1147 3300025921 Ga0207652_10187730 Ga0207652_101877301 310
1148 3300025939 Ga0207665_10001828 Ga0207665_100018282 310
1149 3300025944 Ga0207661_10105349 Ga0207661_101053491 310
1150 3300025944 Ga0207661_10298609 Ga0207661_102986091 310
1151 3300025949 Ga0207667_10070268 Ga0207667_100702682 310
1152 3300025981 Ga0207640_10012044 Ga0207640_100120443 310
1153 3300026041 Ga0207639_10005274 Ga0207639_100052745 310
1154 3300026067 Ga0207678_10118381 Ga0207678_101183812 310
1155 3300026089 Ga0207648_10382161 Ga0207648_103821611 310
1156 3300026095 Ga0207676_10023901 Ga0207676_100239014 310
1157 3300026142 Ga0207698_10004831 Ga0207698_100048312 310
1158 3300026142 Ga0207698_10329487 Ga0207698_103294871 310
1159 3300027543 Ga0209999_1003073 Ga0209999_10030732 310
1160 3300034820 Ga0373959_0004818 Ga0373959_0004818_305_1294 310
1161 3300035088 Ga0373940_0024327 Ga0373940_0024327_378_1364 310
1162 3300035115 Ga0373941_0016082 Ga0373941_0016082_819_1808 310
1163 3300035691 Ga0373931_0028779 Ga0373931_0028779_1692_2678 310
1164 3300037418 Ga0395900_0028914 Ga0395900_0028914_890_1879 310
1165 3300037471 Ga0395905_0009993 Ga0395905_0009993_7361_8350 310
1166 3300038443 Ga0395901_0003571 Ga0395901_0003571_13752_14741 310
1167 3300048907 Ga0496104_0089183 Ga0496104_0089183_834_1820 310
1168 3300048908 Ga0496105_0039344 Ga0496105_0039344_2513_3499 310
1169 3300048911 Ga0496108_0000162 Ga0496108_0000162_24844_25830 310
1170 3300048912 Ga0496109_0000939 Ga0496109_0000939_6752_7738 310
1171 3300048913 Ga0496110_0103597 Ga0496110_0103597_93_1079 310
1172 3300048915 Ga0496112_0000394 Ga0496112_0000394_25815_26801 310
1173 3300048915 Ga0496112_0001985 Ga0496112_0001985_1371_2360 310
1174 3300048916 Ga0496113_0000082 Ga0496113_0000082_36033_37019 310
1175 3300049589 Ga0501073_0197340 Ga0501073_0197340_171_1157 310
1176 3300050507 nmdc:mga05p37_69169_c1 nmdc:mga05p37_69169_c1_2184_3173 310
1177 3300050511 nmdc:mga08y16_1605_c2 nmdc:mga08y16_1605_c2_19443_20423 310
1178 3300050514 nmdc:mga08x19_224069_c1 nmdc:mga08x19_224069_c1_53_1042 310
1179 3300046524 Ga0495648_0022564 Ga0495648_0022564_3347_4288 312
1180 3300048919 Ga0496116_0027942 Ga0496116_0027942_2225_3238 321
1181 3300048925 Ga0496122_0050313 Ga0496122_0050313_1341_2354 321
1182 3300048926 Ga0496123_0155476 Ga0496123_0155476_84_1097 321
1183 3300048928 Ga0496125_0071439 Ga0496125_0071439_874_1887 321
1184 3300048929 Ga0496126_0008764 Ga0496126_0008764_8986_9999 321
1185 2162886007 SwRhRL2b_contig_2401412 SwRhRL2b_0150.00009130 331
1186 3300005289 Ga0065704_10070183 Ga0065704_1007018321 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

237

314

0.98

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

182

232

0.94

PF01012

ETF

Electron transfer flavoprotein domain

1

162

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9312 19 203
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9215 19 203
1efv-assembly1.cif.gz_A three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution 0.9181 19 330
1efp-assembly2.cif.gz_C electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9165 20 331
1efp-assembly2.cif.gz_C electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9108 20 331
ID Description Score Start End Superfamily
af_A0A1D8PQF9_17_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9763 18 204 3.40.50.620
af_A0A1D8PQF9_17_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9711 18 204 3.40.50.620
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9681 20 204 3.40.50.620
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9636 204 330 3.40.50.1220
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9578 20 204 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A848G2Z6-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9852 217 331 GO:0009055
GO:0033539
GO:0050660
AF-A0A812U3Y7-F1-model_v4 ETFA protein 0.9827 215 331 GO:0005739
GO:0009055
GO:0033539
GO:0050660
AF-A0A7W8L6A7-F1-model_v4 Electron transfer flavoprotein alpha subunit 0.9823 221 330 GO:0009055
GO:0033539
GO:0050660
AF-A0A1C5DSN9-F1-model_v4 Electron transfer flavoprotein alpha subunit apoprotein 0.9803 211 330 GO:0009055
GO:0033539
GO:0050660
AF-A0A355RCY1-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9775 224 331 GO:0009055
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
88.67 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map