metagRoot

F491388

General Info

Members	Datasets	Scaffolds	Average Seq Length
1186	604	954	331

Family's Representative Sequence

Representative Sequence	3300048919\|Ga0496116_0001263\|Ga0496116_0001263_1987_3126
Length	379
Sequence	MPGTAEFSSTALILSPRPRHSSTPDDTAQQHRNAPATLLTTAKSRTTMKAFLIDRYGKNTGRIGEAPAPVVGAHDVLIEVHASSVNVLDSKISSGEFKLILPYALPLILGNDLAGVVVEVGSQVTRFKPGDEVYARPPETRIGTFAEWIAVDENAVARKPANTSMAQAASLPLVALTAWQVLIETAQLKKGQKVLIHAGSGGVGSIAIQLARHLGAFVATTTSTANVEWVKALGADLVIDYKQQDFESVLHDYDVVLNSLGPDVLQKSLKVLKPGGQLISISGPPTAQFAQEQGLSWPLQQVMRLLSFGIRRKARKQAVNYTFVFMRANGAQLQKIATLVEEAIIRPVIDRSFSFASTAEALKYVEQGRAKGKVVVTLK

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
5	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
6	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
7	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
8	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
9	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
10	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
11	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
12	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
13	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
14	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
15	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
16	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
17	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
18	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
19	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
20	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
21	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
22	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
23	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
24	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
25	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
26	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
27	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
28	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
29	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
30	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
31	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
32	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
33	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
34	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
35	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
36	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
37	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
38	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
39	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
40	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
41	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
42	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
43	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
44	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
45	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
46	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
47	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
48	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
49	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
50	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
51	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
52	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
53	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
54	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
55	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
56	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
57	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
58	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
59	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
60	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
61	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
62	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
63	2643221543	Paenibacillus sp. Root52	Isolate	Unclassified
64	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
65	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
66	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
67	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
68	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
69	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
70	2643221683	Variovorax sp. Root473	Isolate	Unclassified
71	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
72	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
73	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
74	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
75	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
76	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
77	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
78	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
79	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
80	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
81	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
82	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
83	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
84	2738541295	Bacillus sp. OK085	Isolate	Unclassified
85	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
86	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
87	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
88	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
89	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
90	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
91	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
92	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
93	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
94	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
95	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
96	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
97	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
98	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
99	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
100	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
101	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
102	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
103	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
104	2816332186	Peribacillus frigoritolerans 3612	Isolate	Unclassified
105	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
106	2818991446	Variovorax sp. 1180	Isolate	Unclassified
107	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
108	2818991463	Streptomyces argenteolus 3259	Isolate	Rhizosphere
109	2821111986	Paenibacillus illinoisensis 582	Isolate	Unclassified
110	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
111	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
112	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
113	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
114	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
115	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
116	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
117	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
118	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
119	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
120	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
121	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
122	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
123	2842682962	Bacillus sp. R-72492	Isolate	Unclassified
124	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
125	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
126	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
127	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
128	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
129	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
130	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
131	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
132	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
133	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
134	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
135	2847085930	Erwinia persicina B64	Isolate	Bulb
136	2849139964	Bacillus sp. R-71875	Isolate	Unclassified
137	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
138	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
139	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
140	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
141	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
142	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
143	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
144	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
145	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
146	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
147	2864733723	Paenibacillus sp. JGP012	Isolate	Rhizosphere
148	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
149	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
150	2873151551	Streptomyces silaceus ACCC40021	Isolate	Rhizosphere
151	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
152	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
153	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
154	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
155	2885526491	Paenibacillus sp. LK1	Isolate	Rhizosphere
156	2889042446	Paenibacillus sp. 37	Isolate	Rhizosphere
157	2899924645	Variovorax sp. 369	Isolate	Unclassified
158	2903895155	Flavobacterium sp. HBTb2-11-1	Isolate	Rhizosphere
159	2904162308	Paenibacillus sp. AD87	Isolate	Unclassified
160	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
161	2904490793	Paenibacillus sp. 1295	Isolate	Rhizosphere
162	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
163	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
164	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
165	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
166	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
167	2919160200	Paenibacillus sp. 2003	Isolate	Unclassified
168	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
169	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
170	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
171	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
172	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
173	2928037797	Variovorax sp. 1126	Isolate	Unclassified
174	2928044640	Variovorax sp. 1128	Isolate	Unclassified
175	2928051484	Variovorax sp. 1133	Isolate	Unclassified
176	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
177	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
178	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
179	2929177148	Chitinophaga sp. R-72269 Hybrid assembly	Isolate	Unclassified
180	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
181	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
182	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
183	2931384279	Paenibacillus sp. DR312	Isolate	Rhizosphere
184	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
185	2932082852	Mucilaginibacter sp. 3215	Isolate	Rhizosphere
186	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
187	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
188	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
189	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
190	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
191	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
192	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
193	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
194	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
195	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
196	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
197	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
198	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
199	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
200	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
201	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
202	2939679117	Paenibacillus sp. 4624	Isolate	Rhizosphere
203	2941479691
204	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
205	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
206	2945977869	Chitinophaga sp. W2I13	Isolate	Rhizosphere
207	2945991243	Paenibacillus sp. B21a W2I17	Isolate	Rhizosphere
208	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
209	2946013367	Chitinophaga sp. W3I9	Isolate	Rhizosphere
210	2946053406	Paenibacillus sp. W4I10	Isolate	Rhizosphere
211	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
212	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
213	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
214	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
215	2977254563	Bacillus sp. SORGH_AS 510	Isolate	Unclassified
216	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
217	3006973921	Bacillus sp. FJAT-49736	Isolate	Rhizosphere
218	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
219	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
220	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
221	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
222	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
223	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
224	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
225	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
226	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
227	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
228	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
229	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
230	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
231	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
232	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
233	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
234	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
235	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
236	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
237	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
238	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
239	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
240	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
241	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
242	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
243	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
244	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
245	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
246	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
247	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
248	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
249	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
250	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
251	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
252	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
253	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
254	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
255	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
256	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
257	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
258	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
259	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
260	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
261	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
262	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
263	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
264	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
265	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
266	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
267	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
268	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
269	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
270	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
271	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
272	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
273	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
274	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
275	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
276	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
277	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
278	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
279	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
280	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
281	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
282	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
283	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
284	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
285	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
286	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
287	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
288	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
289	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
290	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
291	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
292	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
293	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
294	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
295	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
296	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
297	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
298	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
299	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
300	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
301	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
302	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
303	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
304	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
305	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
306	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
307	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
308	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
309	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
310	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
311	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
312	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
313	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
314	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
315	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
316	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
317	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
318	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
319	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
320	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
321	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
322	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
323	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
324	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
325	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
326	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
327	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
328	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
329	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
330	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
331	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
332	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
334	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
335	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
336	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
337	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
338	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
339	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
340	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
341	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
342	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
343	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
344	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
345	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
346	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
347	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
348	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
349	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
350	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
351	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
352	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
353	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
354	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
355	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
356	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
357	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
358	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
359	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
360	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
361	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
391	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
392	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
393	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
394	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
395	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
396	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
397	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
398	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
399	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
400	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
401	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
402	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
403	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
404	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
405	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
406	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
407	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
408	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
409	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
410	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
411	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
412	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
413	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
414	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
415	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
416	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
417	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
418	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
419	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
420	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
421	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
422	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
423	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
424	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
425	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
426	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
427	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
428	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
429	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
430	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
431	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
432	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
433	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
434	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
435	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
436	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
437	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
438	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
439	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
440	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
441	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
442	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
443	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
444	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
445	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
446	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
447	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
448	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
449	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
450	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
451	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
452	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
453	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
454	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
455	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
456	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
457	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
458	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
459	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
460	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
461	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
462	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
463	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
464	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
465	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
466	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
467	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
468	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
469	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
470	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
471	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
472	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
473	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
474	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
475	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
476	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
477	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
478	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
479	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
480	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
481	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
482	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
483	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
484	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
485	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
486	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
487	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
488	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
489	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
490	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
491	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
492	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
493	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
494	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
495	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
496	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
497	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
498	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
499	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
500	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
501	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
502	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
503	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
504	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
505	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
506	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
507	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
508	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
509	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
510	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
511	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
512	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
513	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
514	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
515	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
516	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
517	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
518	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
519	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
520	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
521	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
522	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
523	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
524	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
525	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
526	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
527	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
528	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
529	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
530	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
531	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
532	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
533	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
534	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
535	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
536	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
537	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
538	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
539	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
540	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
541	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
542	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
543	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
544	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
545	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
546	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
547	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
548	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
549	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
550	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
551	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
552	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
553	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
554	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
555	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
556	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
557	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
558	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
559	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
560	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
561	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
562	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
563	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
564	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
565	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
566	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
567	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
568	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
569	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
570	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
571	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
572	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
573	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
574	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
575	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
576	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
577	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
578	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
579	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
580	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
581	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
582	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
583	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
584	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
585	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
586	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
587	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
588	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
589	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
590	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
591	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
592	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
593	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
594	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
595	8022948649	Bacillus endophyticus FH5	Isolate	Rhizosphere
596	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
597	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
598	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
599	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
600	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
601	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
602	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
603	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
604	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	80.44
Metatranscriptomes	0
Isolates	19.56

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0.08
Endosphere	14.5
Nodule	3.2
Rhizoplane	5.14
Rhizosphere	60.03
Stem	0
Stem Tuber	0.17
Unclassified	16.86

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_53	2124908027	Bacteria	22763
2	MRS2a_Contig_7102	2124908027	Bacteria	3870
3	SwRhRL2b_contig_1366508	2162886007	Bacteria	5332
4	SwRhRL2b_contig_3393433	2162886007	Unclassified	2518
5	SwRhRL2b_contig_41922	2162886007	Bacteria	2204
6	SwRhRL2b_contig_51000	2162886007	Bacteria	2580
7	SwRhRL2b_contig_623336	2162886007	Bacteria	4659
8	MRS1b_contig_9404902	2162886011	Bacteria	2256
9	JGI24740J21852_10001985	3300001979	Bacteria	9352
10	JGI24735J21928_10013344	3300002067	Bacteria	2585
11	JGI24742J22300_10005371	3300002244	Archaea	2107
12	JGI25162J39368_1000004	3300002737	Bacteria	441040
13	JGI25162J39368_1000005	3300002737	Bacteria	435925
14	JGI25162J39368_1000045	3300002737	Bacteria	170731
15	JGI25158J39367_1001527	3300002739	Bacteria	4024
16	JGI25163J39215_1001144	3300002771	Bacteria	5212
17	JGI25163J39215_1001518	3300002771	Bacteria	3652
18	JGI25164J39214_1000026	3300002772	Bacteria	156863
19	JGI25164J39214_1000068	3300002772	Bacteria	103192
20	JGI25152J39213_1000073	3300002773	Bacteria	66515
21	JGI25150J39212_1000062	3300002774	Bacteria	64560
22	JGI25150J39212_1006623	3300002774	Bacteria	2376
23	JGI25150J39212_1006965	3300002774	Bacteria	2299
24	JGI25159J45721_1000212	3300002987	Bacteria	27374
25	JGI25159J45721_1009535	3300002987	Bacteria	2553
26	JGI25151J46595_10000255	3300003187	Bacteria	62389
27	JGI25165J46597_1000011	3300003214	Bacteria	441040
28	JGI25165J46597_1000086	3300003214	Bacteria	170731
29	JGI25153J46596_10000165	3300003215	Bacteria	66515
30	rootH2_10067062	3300003320	Bacteria	1589
31	rootL2_10139457	3300003322	Bacteria	2077
32	rootH1_10081472	3300003323	Bacteria	8539
33	JGI25160J50197_1000410	3300003354	Bacteria	27374
34	JGI25161J50226_1000688	3300003374	Bacteria	13295
35	Ga0055538_1000027	3300003751	Bacteria	216576
36	Ga0055539_1000036	3300003752	Bacteria	216576
37	Ga0055533_1000046	3300003756	Bacteria	216576
38	Ga0055532_1000032	3300003758	Bacteria	216568
39	Ga0055525_1000217	3300003759	Bacteria	62978
40	Ga0055526_1000046	3300003771	Bacteria	120614
41	Ga0055526_1000146	3300003771	Bacteria	62389
42	Ga0055526_1000586	3300003771	Bacteria	28650
43	Ga0055526_1001245	3300003771	Bacteria	18276
44	Ga0055526_1003546	3300003771	Bacteria	9841
45	Ga0055537_1000090	3300003773	Bacteria	66515
46	Ga0055537_1000185	3300003773	Bacteria	46470
47	Ga0055537_1008078	3300003773	Bacteria	2463
48	Ga0055524_1000195	3300003775	Bacteria	66515
49	Ga0055524_1000742	3300003775	Bacteria	22287
50	Ga0055536_1000009	3300003781	Bacteria	311572
51	Ga0055536_1000013	3300003781	Bacteria	240693
52	Ga0055536_1000032	3300003781	Bacteria	150527
53	Ga0055536_1000398	3300003781	Bacteria	31589
54	Ga0055536_1013921	3300003781	Bacteria	2863
55	Ga0055534_1000101	3300003784	Bacteria	66515
56	Ga0055534_1000172	3300003784	Bacteria	47998
57	Ga0055528_1000111	3300003790	Bacteria	66515
58	Ga0055528_1000137	3300003790	Bacteria	58854
59	Ga0055528_1000409	3300003790	Bacteria	34789
60	Ga0055528_1001427	3300003790	Bacteria	14616
61	Ga0055528_1011701	3300003790	Bacteria	3460
62	Ga0055530_10000004	3300003791	Bacteria	231465
63	Ga0055530_10000029	3300003791	Bacteria	127049
64	Ga0055530_10000062	3300003791	Bacteria	94942
65	Ga0055530_10000648	3300003791	Bacteria	29930
66	Ga0055540_1000008	3300003792	Bacteria	309635
67	Ga0055540_1000017	3300003792	Bacteria	231465
68	Ga0055540_1000166	3300003792	Bacteria	65613
69	Ga0055540_1003475	3300003792	Bacteria	7603
70	Ga0055531_10000242	3300003794	Bacteria	59638
71	Ga0055541_1000024	3300003841	Bacteria	216576
72	Ga0055541_1000279	3300003841	Bacteria	17660
73	Ga0055543_1000585	3300004625	Bacteria	20123
74	Ga0065165_1001334	3300005262	Bacteria	27412
75	Ga0065714_10000918	3300005288	Bacteria	2300
76	Ga0065714_10002302	3300005288	Bacteria	45300
77	Ga0065714_10004350	3300005288	Bacteria	7650
78	Ga0065714_10010287	3300005288	Bacteria	2818
79	Ga0065704_10004287	3300005289	Unclassified	4692
80	Ga0065704_10021112	3300005289	Bacteria	1439
81	Ga0065704_10070262	3300005289	Bacteria	45316
82	Ga0065704_10071259	3300005289	Bacteria	12164
83	Ga0065704_10073317	3300005289	Bacteria	7320
84	Ga0065704_10077761	3300005289	Bacteria	4630
85	Ga0065704_10095544	3300005289	Bacteria	2483
86	Ga0065712_10067887	3300005290	Bacteria	22896
87	Ga0065712_10071558	3300005290	Bacteria	5190
88	Ga0065712_10129706	3300005290	Bacteria	1565
89	Ga0065715_10156801	3300005293	Bacteria	1667
90	Ga0065707_10096139	3300005295	Unclassified	3300
91	Ga0070683_100078659	3300005329	Bacteria	3085
92	Ga0070690_100234054	3300005330	Bacteria	1293
93	Ga0070670_100000034	3300005331	Bacteria	158067
94	Ga0070670_100000381	3300005331	Bacteria	36865
95	Ga0070670_100079470	3300005331	Bacteria	2819
96	Ga0068869_100141663	3300005334	Bacteria	1857
97	Ga0068869_100178240	3300005334	Bacteria	1665
98	Ga0070682_100234087	3300005337	Bacteria	1315
99	Ga0070661_100000140	3300005344	Bacteria	60039
100	Ga0070669_100000259	3300005353	Bacteria	43326
101	Ga0070674_100232260	3300005356	Archaea	1440
102	Ga0070709_10101161	3300005434	Bacteria	1920
103	Ga0070713_100064989	3300005436	Bacteria	3063
104	Ga0070710_10041369	3300005437	Bacteria	2544
105	Ga0070711_100224914	3300005439	Bacteria	1460
106	Ga0070700_100218754	3300005441	Bacteria	1348
107	Ga0070700_100382556	3300005441	Archaea	1053
108	Ga0070694_100017455	3300005444	Bacteria	4537
109	Ga0070708_100010333	3300005445	Bacteria	7559
110	Ga0070678_100025883	3300005456	Bacteria	3957
111	Ga0070678_100375659	3300005456	Archaea	1228
112	Ga0070662_100002140	3300005457	Bacteria	12105
113	Ga0070681_10161388	3300005458	Bacteria	2166
114	Ga0070706_100128363	3300005467	Bacteria	2365
115	Ga0070706_100302195	3300005467	Bacteria	1493
116	Ga0070707_100035949	3300005468	Bacteria	4727
117	Ga0070707_100057997	3300005468	Bacteria	3714
118	Ga0070699_100109471	3300005518	Bacteria	2424
119	Ga0070684_100049889	3300005535	Bacteria	3634
120	Ga0070686_100164579	3300005544	Archaea	1564
121	Ga0070665_100069820	3300005548	Bacteria	3521
122	Ga0070665_100109473	3300005548	Bacteria	2765
123	Ga0068855_100063492	3300005563	Bacteria	4310
124	Ga0070664_100000201	3300005564	Bacteria	42562
125	Ga0070664_100032383	3300005564	Bacteria	4372
126	Ga0070664_100199460	3300005564	Bacteria	1785
127	Ga0068856_100023294	3300005614	Bacteria	6022
128	Ga0068856_100038127	3300005614	Bacteria	4717
129	Ga0068864_100057694	3300005618	Bacteria	3354
130	Ga0068858_100028701	3300005842	Bacteria	5167
131	Ga0068862_100059224	3300005844	Bacteria	3288
132	Ga0075365_10003444	3300006038	Bacteria	8153
133	Ga0075365_10116853	3300006038	Bacteria	1837
134	Ga0075364_10128252	3300006051	Bacteria	1702
135	Ga0075432_10000821	3300006058	Bacteria	9721
136	Ga0075432_10004723	3300006058	Unclassified	4638
137	Ga0075432_10005619	3300006058	Bacteria	4271
138	Ga0070716_100142507	3300006173	Bacteria	1530
139	Ga0070712_100187924	3300006175	Bacteria	1614
140	Ga0070712_100231028	3300006175	Bacteria	1469
141	Ga0075367_10075458	3300006178	Bacteria	2033
142	Ga0075367_10082318	3300006178	Bacteria	1948
143	Ga0075369_10003691	3300006186	Bacteria	5597
144	Ga0075431_100102182	3300006847	Unclassified	2958
145	Ga0075429_100133802	3300006880	Bacteria	2169
146	Ga0079104_1004485	3300006946	Bacteria	5946
147	Ga0099826_10022319	3300006948	Bacteria	4732
148	Ga0105251_10000207	3300009011	Bacteria	59294
149	Ga0105251_10008072	3300009011	Bacteria	6377
150	Ga0105251_10011506	3300009011	Bacteria	5052
151	Ga0105251_10028303	3300009011	Bacteria	2833
152	Ga0105244_10001462	3300009036	Bacteria	19073
153	Ga0105244_10003328	3300009036	Bacteria	11559
154	Ga0105244_10008660	3300009036	Bacteria	6332
155	Ga0105244_10013572	3300009036	Bacteria	4753
156	Ga0105244_10018340	3300009036	Bacteria	3928
157	Ga0105244_10021986	3300009036	Bacteria	3516
158	Ga0105244_10023151	3300009036	Bacteria	3410
159	Ga0105244_10024647	3300009036	Bacteria	3281
160	Ga0105244_10030690	3300009036	Bacteria	2858
161	Ga0105244_10031259	3300009036	Bacteria	2826
162	Ga0105244_10033000	3300009036	Bacteria	2734
163	Ga0105244_10093780	3300009036	Bacteria	1474
164	Ga0105244_10141714	3300009036	Bacteria	1156
165	Ga0105250_10000353	3300009092	Bacteria	35144
166	Ga0105250_10017372	3300009092	Bacteria	2926
167	Ga0105250_10045731	3300009092	Bacteria	1755
168	Ga0105240_10341144	3300009093	Bacteria	1702
169	Ga0111539_10118824	3300009094	Unclassified	3098
170	Ga0111539_10243422	3300009094	Archaea	2094
171	Ga0111539_10560553	3300009094	Archaea	1330
172	Ga0105245_10106599	3300009098	Bacteria	2600
173	Ga0114129_10076409	3300009147	Unclassified	4663
174	Ga0105243_10000170	3300009148	Bacteria	74646
175	Ga0105243_10000604	3300009148	Bacteria	35803
176	Ga0105243_10002467	3300009148	Bacteria	15446
177	Ga0105243_10044749	3300009148	Bacteria	3475
178	Ga0105243_10089683	3300009148	Bacteria	2529
179	Ga0105241_10028977	3300009174	Unclassified	4126
180	Ga0105242_10002140	3300009176	Bacteria	15594
181	Ga0105237_10000413	3300009545	Bacteria	60829
182	Ga0105237_10053509	3300009545	Bacteria	4049
183	Ga0105237_10083475	3300009545	Bacteria	3186
184	Ga0105237_10134646	3300009545	Unclassified	2465
185	Ga0105237_10183592	3300009545	Bacteria	2092
186	Ga0105239_10062976	3300010375	Bacteria	4071
187	Ga0105239_10121819	3300010375	Bacteria	2897
188	Ga0105246_10000151	3300011119	Bacteria	32865
189	Ga0105246_10099201	3300011119	Bacteria	2117
190	Ga0105246_10123287	3300011119	Bacteria	1924
191	Ga0157347_1002562	3300012502	Bacteria	1568
192	Ga0157373_10002818	3300013100	Bacteria	13148
193	Ga0157373_10004724	3300013100	Bacteria	10242
194	Ga0157373_10014652	3300013100	Bacteria	5749
195	Ga0157373_10015520	3300013100	Bacteria	5569
196	Ga0157373_10020266	3300013100	Bacteria	4836
197	Ga0157373_10061134	3300013100	Bacteria	2668
198	Ga0157373_10088366	3300013100	Bacteria	2183
199	Ga0157373_10106220	3300013100	Bacteria	1974
200	Ga0157373_10186699	3300013100	Bacteria	1460
201	Ga0157371_10000012	3300013102	Bacteria	355318
202	Ga0157371_10001339	3300013102	Bacteria	25928
203	Ga0157371_10002985	3300013102	Bacteria	15712
204	Ga0157371_10011312	3300013102	Bacteria	6887
205	Ga0157371_10017488	3300013102	Bacteria	5325
206	Ga0157370_10000070	3300013104	Bacteria	112014
207	Ga0157370_10000187	3300013104	Bacteria	77559
208	Ga0157370_10000929	3300013104	Bacteria	37165
209	Ga0157370_10004641	3300013104	Bacteria	15702
210	Ga0157370_10019782	3300013104	Bacteria	6739
211	Ga0157370_10068703	3300013104	Bacteria	3348
212	Ga0157370_10081653	3300013104	Bacteria	3041
213	Ga0157370_10153518	3300013104	Bacteria	2142
214	Ga0157370_10202775	3300013104	Bacteria	1840
215	Ga0157370_10215721	3300013104	Bacteria	1778
216	Ga0157370_10235891	3300013104	Bacteria	1693
217	Ga0157370_10599304	3300013104	Bacteria	1009
218	Ga0157369_10004478	3300013105	Bacteria	16460
219	Ga0157369_10021100	3300013105	Bacteria	7282
220	Ga0157369_10035026	3300013105	Bacteria	5505
221	Ga0157369_10056204	3300013105	Bacteria	4247
222	Ga0157374_10296280	3300013296	Bacteria	1600
223	Ga0157378_10022123	3300013297	Bacteria	5595
224	Ga0163162_10112114	3300013306	Bacteria	2826
225	Ga0163162_10132585	3300013306	Bacteria	2601
226	Ga0157372_10000821	3300013307	Bacteria	33625
227	Ga0157375_10000466	3300013308	Bacteria	36856
228	Ga0157375_10000987	3300013308	Bacteria	24606
229	Ga0157375_10072798	3300013308	Bacteria	3454
230	Ga0163163_10000163	3300014325	Bacteria	69522
231	Ga0163163_10063356	3300014325	Bacteria	3666
232	Ga0157380_10313172	3300014326	Archaea	1452
233	Ga0182008_10000429	3300014497	Bacteria	32349
234	Ga0182008_10007005	3300014497	Bacteria	6250
235	Ga0182008_10019916	3300014497	Bacteria	3458
236	Ga0182008_10069257	3300014497	Bacteria	1736
237	Ga0157377_10018080	3300014745	Archaea	3659
238	Ga0182006_1001013	3300015261	Bacteria	18374
239	Ga0182006_1005590	3300015261	Bacteria	5967
240	Ga0182006_1006763	3300015261	Bacteria	5296
241	Ga0182006_1006842	3300015261	Bacteria	5262
242	Ga0182006_1007269	3300015261	Bacteria	5082
243	Ga0182006_1012336	3300015261	Bacteria	3736
244	Ga0182007_10000766	3300015262	Bacteria	18016
245	Ga0182007_10026034	3300015262	Bacteria	2032
246	Ga0182005_1000355	3300015265	Bacteria	25795
247	Ga0182005_1000891	3300015265	Bacteria	13110
248	Ga0182005_1002698	3300015265	Bacteria	6225
249	Ga0182005_1010563	3300015265	Bacteria	2652
250	Ga0182005_1025501	3300015265	Bacteria	1613
251	Ga0163161_10006451	3300017792	Bacteria	8122
252	Ga0163161_10007535	3300017792	Bacteria	7524
253	Ga0163161_10011334	3300017792	Bacteria	6180
254	Ga0163161_10022604	3300017792	Bacteria	4429
255	Ga0163161_10024161	3300017792	Bacteria	4292
256	Ga0163161_10028069	3300017792	Bacteria	3994
257	Ga0163161_10030055	3300017792	Bacteria	3864
258	Ga0163161_10058097	3300017792	Bacteria	2811
259	Ga0209760_100019	3300025207	Bacteria	170806
260	Ga0209760_100105	3300025207	Bacteria	64565
261	Ga0209436_100619	3300025208	Bacteria	15188
262	Ga0209784_100017	3300025224	Bacteria	472003
263	Ga0209566_100014	3300025225	Bacteria	472003
264	Ga0209566_101366	3300025225	Bacteria	7627
265	Ga0209674_100028	3300025226	Bacteria	472003
266	Ga0209147_100038	3300025229	Bacteria	314497
267	Ga0209563_100032	3300025230	Bacteria	472003
268	Ga0207427_100003	3300025231	Bacteria	1035004
269	Ga0207427_100011	3300025231	Bacteria	640076
270	Ga0209437_100002	3300025233	Bacteria	1574801
271	Ga0209437_100044	3300025233	Bacteria	430619
272	Ga0209437_100392	3300025233	Bacteria	42195
273	Ga0209437_111655	3300025233	Bacteria	1307
274	Ga0209258_100197	3300025242	Bacteria	124028
275	Ga0207425_1000042	3300025245	Bacteria	210165
276	Ga0207425_1002384	3300025245	Bacteria	6657
277	Ga0207425_1004551	3300025245	Bacteria	4124
278	Ga0209646_1000171	3300025246	Bacteria	84951
279	Ga0209026_1002815	3300025250	Bacteria	6161
280	Ga0209677_100018	3300025253	Bacteria	472003
281	Ga0209129_1000058	3300025258	Bacteria	252258
282	Ga0209129_1005200	3300025258	Bacteria	4722
283	Ga0209129_1005205	3300025258	Bacteria	4716
284	Ga0209233_1000004	3300025261	Bacteria	1574798
285	Ga0209233_1000057	3300025261	Bacteria	430619
286	Ga0209565_1000024	3300025263	Bacteria	379907
287	Ga0209565_1000027	3300025263	Bacteria	360545
288	Ga0209565_1002381	3300025263	Bacteria	6836
289	Ga0209673_1000023	3300025273	Bacteria	411385
290	Ga0209673_1000031	3300025273	Bacteria	347560
291	Ga0209673_1000237	3300025273	Bacteria	106342
292	Ga0209673_1000558	3300025273	Bacteria	59885
293	Ga0209673_1001691	3300025273	Bacteria	18770
294	Ga0209130_1000025	3300025284	Bacteria	336491
295	Ga0209675_1000011	3300025291	Bacteria	520597
296	Ga0209675_1000064	3300025291	Bacteria	177063
297	Ga0209675_1002987	3300025291	Bacteria	8330
298	Ga0209675_1012045	3300025291	Bacteria	2815
299	Ga0209676_1000002	3300025292	Bacteria	1732948
300	Ga0209676_1000003	3300025292	Bacteria	1454178
301	Ga0209676_1000120	3300025292	Bacteria	200565
302	Ga0209676_1000190	3300025292	Bacteria	140482
303	Ga0209676_1001065	3300025292	Bacteria	31352
304	Ga0209676_1001876	3300025292	Bacteria	17214
305	Ga0209676_1003558	3300025292	Bacteria	9416
306	Ga0209025_1000075	3300025294	Bacteria	275717
307	Ga0209564_1000040	3300025295	Bacteria	411388
308	Ga0209564_1000100	3300025295	Bacteria	224016
309	Ga0209564_1000128	3300025295	Bacteria	196532
310	Ga0209564_1000277	3300025295	Bacteria	105818
311	Ga0209564_1000490	3300025295	Bacteria	65811
312	Ga0209564_1034873	3300025295	Bacteria	1467
313	Ga0209758_1000050	3300025297	Bacteria	345008
314	Ga0209758_1001740	3300025297	Bacteria	24262
315	Ga0209758_1001767	3300025297	Bacteria	23967
316	Ga0209050_1000004	3300025298	Bacteria	1600040
317	Ga0209050_1000006	3300025298	Bacteria	1359702
318	Ga0209050_1000037	3300025298	Bacteria	415612
319	Ga0209050_1000536	3300025298	Bacteria	62968
320	Ga0209050_1025227	3300025298	Bacteria	2027
321	Ga0209050_1028072	3300025298	Bacteria	1835
322	Ga0209256_1000023	3300025299	Bacteria	461150
323	Ga0209256_1000221	3300025299	Bacteria	105907
324	Ga0209256_1000658	3300025299	Bacteria	46924
325	Ga0209256_1004393	3300025299	Bacteria	8898
326	Ga0209256_1014403	3300025299	Bacteria	2848
327	Ga0207426_1000118	3300025302	Bacteria	223341
328	Ga0209051_1000001	3300025303	Bacteria	1732974
329	Ga0209051_1000040	3300025303	Bacteria	315055
330	Ga0209051_1000052	3300025303	Bacteria	283346
331	Ga0209051_1001497	3300025303	Bacteria	19533
332	Ga0209051_1017918	3300025303	Bacteria	3151
333	Ga0209257_1000029	3300025304	Bacteria	695617
334	Ga0209257_1000188	3300025304	Bacteria	154074
335	Ga0209257_1002953	3300025304	Bacteria	15600
336	Ga0207656_10000034	3300025321	Bacteria	66750
337	Ga0207696_1000002	3300025711	Bacteria	1098043
338	Ga0207696_1000108	3300025711	Bacteria	157445
339	Ga0207696_1002028	3300025711	Bacteria	10253
340	Ga0207696_1011178	3300025711	Bacteria	3247
341	Ga0207655_1000140	3300025728	Bacteria	139110
342	Ga0207655_1000141	3300025728	Bacteria	138956
343	Ga0207655_1000520	3300025728	Bacteria	49037
344	Ga0207655_1002113	3300025728	Bacteria	16620
345	Ga0207655_1006557	3300025728	Bacteria	7687
346	Ga0207655_1007497	3300025728	Bacteria	7070
347	Ga0207655_1011607	3300025728	Bacteria	5228
348	Ga0207655_1021576	3300025728	Bacteria	3263
349	Ga0207655_1021624	3300025728	Bacteria	3257
350	Ga0207655_1022375	3300025728	Bacteria	3170
351	Ga0207713_1000122	3300025735	Bacteria	122196
352	Ga0207713_1001144	3300025735	Bacteria	22477
353	Ga0207713_1001298	3300025735	Bacteria	20557
354	Ga0207713_1006129	3300025735	Bacteria	7392
355	Ga0207713_1007532	3300025735	Bacteria	6404
356	Ga0207713_1007837	3300025735	Bacteria	6229
357	Ga0207713_1007845	3300025735	Bacteria	6224
358	Ga0207688_10088066	3300025901	Bacteria	1780
359	Ga0207680_10044249	3300025903	Bacteria	2617
360	Ga0207684_10130041	3300025910	Bacteria	2161
361	Ga0207654_10053643	3300025911	Unclassified	2328
362	Ga0207695_10241289	3300025913	Bacteria	1708
363	Ga0207671_10001061	3300025914	Bacteria	33340
364	Ga0207671_10053532	3300025914	Bacteria	2991
365	Ga0207671_10058842	3300025914	Bacteria	2849
366	Ga0207671_10166369	3300025914	Unclassified	1710
367	Ga0207693_10005229	3300025915	Bacteria	10859
368	Ga0207693_10009747	3300025915	Bacteria	7822
369	Ga0207649_10000183	3300025920	Bacteria	51125
370	Ga0207681_10000215	3300025923	Bacteria	45747
371	Ga0207650_10000066	3300025925	Bacteria	140329
372	Ga0207650_10000272	3300025925	Bacteria	54462
373	Ga0207664_10161179	3300025929	Bacteria	1913
374	Ga0207706_10007035	3300025933	Bacteria	10402
375	Ga0207706_10021587	3300025933	Bacteria	5780
376	Ga0207686_10023090	3300025934	Bacteria	3588
377	Ga0207709_10000004	3300025935	Bacteria	825156
378	Ga0207709_10000411	3300025935	Bacteria	41804
379	Ga0207709_10004673	3300025935	Bacteria	7877
380	Ga0207709_10025258	3300025935	Bacteria	3400
381	Ga0207709_10037848	3300025935	Bacteria	2868
382	Ga0207709_10039430	3300025935	Bacteria	2821
383	Ga0207709_10133198	3300025935	Bacteria	1697
384	Ga0207669_10323629	3300025937	Archaea	1181
385	Ga0207665_10190989	3300025939	Bacteria	1488
386	Ga0207689_10106270	3300025942	Bacteria	2306
387	Ga0207661_10083475	3300025944	Bacteria	2644
388	Ga0207679_10000016	3300025945	Bacteria	253494
389	Ga0207679_10010647	3300025945	Bacteria	5927
390	Ga0207679_10066811	3300025945	Bacteria	2696
391	Ga0207679_10150036	3300025945	Bacteria	1896
392	Ga0207658_10136774	3300025986	Bacteria	1977
393	Ga0207677_10165123	3300026023	Bacteria	1725
394	Ga0207639_10066713	3300026041	Bacteria	2798
395	Ga0207676_10019984	3300026095	Bacteria	4893
396	Ga0207674_10055336	3300026116	Bacteria	4034
397	Ga0207683_10046840	3300026121	Bacteria	3785
398	Ga0207683_10189937	3300026121	Archaea	1865
399	Ga0209281_1006092	3300027111	Bacteria	3203
400	Ga0207428_10000225	3300027907	Archaea	78396
401	Ga0207428_10023325	3300027907	Bacteria	5205
402	Ga0307515_10000174	3300028794	Bacteria	157501
403	Ga0307515_10085550	3300028794	Bacteria	4033
404	Ga0307515_10137656	3300028794	Bacteria	2642
405	Ga0316178_1157838	3300030735	Bacteria	5384
406	Ga0316181_1238654	3300030744	Bacteria	4692
407	Ga0307513_10018000	3300031456	Bacteria	8458
408	Ga0307408_100001576	3300031548	Bacteria	16846
409	Ga0307408_100003629	3300031548	Bacteria	10518
410	Ga0307408_100008360	3300031548	Bacteria	6833
411	Ga0307408_100031974	3300031548	Bacteria	3667
412	Ga0307508_10037533	3300031616	Bacteria	4356
413	Ga0316575_10000320	3300031665	Bacteria	13519
414	Ga0307405_10000137	3300031731	Bacteria	28468
415	Ga0307405_10040077	3300031731	Bacteria	2835
416	Ga0307405_10044327	3300031731	Bacteria	2720
417	Ga0307405_10073717	3300031731	Bacteria	2205
418	Ga0307405_10114110	3300031731	Bacteria	1835
419	Ga0307405_10119124	3300031731	Bacteria	1803
420	Ga0307405_10140430	3300031731	Bacteria	1683
421	Ga0307410_10121573	3300031852	Bacteria	1905
422	Ga0307406_10008975	3300031901	Bacteria	5591
423	Ga0307412_10000124	3300031911	Bacteria	57526
424	Ga0307412_10001043	3300031911	Bacteria	15825
425	Ga0307412_10144534	3300031911	Bacteria	1746
426	Ga0307414_10199159	3300032004	Bacteria	1627
427	Ga0307411_10020132	3300032005	Bacteria	3872
428	Ga0316583_10001991	3300032133	Bacteria	6987
429	Ga0373946_0100059	3300035171	Bacteria	1299
430	Ga0373947_0041936	3300035725	Bacteria	2731
431	Ga0395905_0006135	3300037471	Bacteria	12132
432	Ga0237819_01805	3300038705	Bacteria	4990
433	Ga0439436_0010594	3300041404	Bacteria	2810
434	Ga0439438_000390	3300041405	Bacteria	19561
435	Ga0439438_000979	3300041405	Bacteria	12767
436	Ga0439438_001292	3300041405	Bacteria	11079
437	Ga0439438_002520	3300041405	Bacteria	7771
438	Ga0439438_021516	3300041405	Bacteria	1797
439	Ga0439447_007833	3300041407	Bacteria	3352
440	Ga0439447_015203	3300041407	Bacteria	2140
441	Ga0439466_0000184	3300041411	Bacteria	25053
442	Ga0439466_0000514	3300041411	Bacteria	14609
443	Ga0439466_0001065	3300041411	Bacteria	10597
444	Ga0439466_0003466	3300041411	Bacteria	6113
445	Ga0439466_0005163	3300041411	Bacteria	5002
446	Ga0439465_0002423	3300041413	Bacteria	6110
447	Ga0439431_0000048	3300041997	Bacteria	17878
448	Ga0439433_0001888	3300041999	Bacteria	4381
449	Ga0439445_0002382	3300042004	Bacteria	4185
450	Ga0439448_0000193	3300042005	Bacteria	12632
451	Ga0439448_0003026	3300042005	Bacteria	4619
452	Ga0439432_000667	3300042006	Bacteria	12828
453	Ga0439432_001831	3300042006	Bacteria	7983
454	Ga0439432_004610	3300042006	Bacteria	5022
455	Ga0439451_000431	3300042009	Bacteria	8193
456	Ga0439451_007241	3300042009	Bacteria	2264
457	Ga0439452_000024	3300042010	Bacteria	230396
458	Ga0439452_001785	3300042010	Bacteria	8384
459	Ga0439452_003858	3300042010	Bacteria	5142
460	Ga0439452_004120	3300042010	Bacteria	4939
461	Ga0439452_008576	3300042010	Bacteria	3066
462	Ga0439455_0003863	3300042012	Bacteria	2912
463	Ga0439455_0021628	3300042012	Bacteria	1535
464	Ga0439456_003890	3300042013	Bacteria	3032
465	Ga0439456_004728	3300042013	Bacteria	2754
466	Ga0439456_010726	3300042013	Bacteria	1895
467	Ga0439463_013919	3300042016	Bacteria	1982
468	Ga0439463_026516	3300042016	Bacteria	1455
469	Ga0450911_000030	3300042115	Bacteria	75536
470	Ga0450911_000070	3300042115	Bacteria	42451
471	Ga0450911_000297	3300042115	Bacteria	18050
472	Ga0450911_001667	3300042115	Bacteria	4916
473	Ga0450919_000226	3300042121	Bacteria	6294
474	Ga0450920_003671	3300042122	Bacteria	2668
475	Ga0450922_000576	3300042124	Bacteria	3846
476	Ga0450898_001443	3300042134	Bacteria	3135
477	Ga0450903_003413	3300042138	Bacteria	2754
478	Ga0450904_001386	3300042139	Bacteria	3462
479	Ga0450906_000016	3300042145	Bacteria	32476
480	Ga0450906_002462	3300042145	Bacteria	4049
481	Ga0450907_000039	3300042146	Bacteria	57175
482	Ga0450907_001750	3300042146	Bacteria	4498
483	Ga0450907_005465	3300042146	Bacteria	2141
484	Ga0450910_000003	3300042147	Bacteria	81243
485	Ga0450910_003972	3300042147	Bacteria	1985
486	Ga0439446_0000458	3300042156	Bacteria	8062
487	Ga0439446_0011200	3300042156	Bacteria	2431
488	Ga0450908_000492	3300042184	Bacteria	7594
489	Ga0450908_004043	3300042184	Bacteria	2833
490	Ga0450909_001586	3300042185	Bacteria	3175
491	Ga0450909_006888	3300042185	Bacteria	1638
492	Ga0439434_0000441	3300042435	Bacteria	11875
493	Ga0439434_0071416	3300042435	Bacteria	1093
494	Ga0439464_0016003	3300042439	Bacteria	2027
495	Ga0450901_000416	3300042533	Bacteria	5137
496	Ga0439440_0000389	3300042993	Bacteria	7365
497	Ga0439440_0006241	3300042993	Bacteria	2394
498	Ga0466961_0204571	3300044693	Unclassified	1220
499	Ga0453684_0010387	3300044712	Bacteria	15932
500	Ga0451576_0008343	3300045051	Bacteria	12177
501	Ga0451576_0009888	3300045051	Bacteria	11017
502	Ga0495617_000047	3300046452	Bacteria	115291
503	Ga0495617_001900	3300046452	Bacteria	8793
504	Ga0495617_004806	3300046452	Bacteria	4869
505	Ga0495617_013438	3300046452	Bacteria	2787
506	Ga0495617_019900	3300046452	Bacteria	2268
507	Ga0495627_000271	3300046453	Bacteria	52886
508	Ga0495627_000538	3300046453	Bacteria	31227
509	Ga0495627_012947	3300046453	Bacteria	2945
510	Ga0495592_0027191	3300046454	Bacteria	4337
511	Ga0495603_0001797	3300046455	Bacteria	12664
512	Ga0495590_0000153	3300046457	Bacteria	41540
513	Ga0495590_0002976	3300046457	Bacteria	6954
514	Ga0495590_0006220	3300046457	Bacteria	4673
515	Ga0495590_0006342	3300046457	Bacteria	4624
516	Ga0495591_000139	3300046458	Bacteria	78636
517	Ga0495591_000144	3300046458	Bacteria	75817
518	Ga0495591_000277	3300046458	Bacteria	47800
519	Ga0495591_000834	3300046458	Bacteria	21805
520	Ga0495591_009352	3300046458	Bacteria	3905
521	Ga0495591_011664	3300046458	Bacteria	3311
522	Ga0495591_035649	3300046458	Bacteria	1454
523	Ga0495629_0001914	3300046459	Bacteria	16216
524	Ga0495629_0006452	3300046459	Bacteria	8693
525	Ga0495629_0268094	3300046459	Bacteria	1173
526	Ga0495638_0000124	3300046460	Bacteria	125417
527	Ga0495638_0002792	3300046460	Bacteria	14015
528	Ga0495638_0022269	3300046460	Bacteria	4160
529	Ga0495638_0039075	3300046460	Bacteria	3014
530	Ga0495638_0059813	3300046460	Bacteria	2358
531	Ga0495638_0133487	3300046460	Bacteria	1456
532	Ga0495651_0000663	3300046462	Bacteria	26690
533	Ga0495653_0003966	3300046463	Bacteria	11951
534	Ga0495653_0024563	3300046463	Bacteria	4854
535	Ga0495653_0070855	3300046463	Bacteria	2607
536	Ga0495653_0173785	3300046463	Bacteria	1484
537	Ga0495650_0001138	3300046471	Bacteria	28825
538	Ga0495650_0001218	3300046471	Bacteria	26948
539	Ga0495650_0001374	3300046471	Bacteria	24014
540	Ga0495580_0019261	3300046472	Bacteria	5070
541	Ga0495582_0008582	3300046473	Bacteria	5634
542	Ga0495605_0001055	3300046474	Bacteria	18389
543	Ga0495605_0001243	3300046474	Bacteria	16956
544	Ga0495605_0002751	3300046474	Bacteria	10739
545	Ga0495605_0007746	3300046474	Bacteria	6086
546	Ga0495639_0000066	3300046475	Bacteria	48162
547	Ga0495664_0152191	3300046477	Bacteria	1403
548	Ga0495584_0000352	3300046491	Bacteria	31967
549	Ga0495584_0000362	3300046491	Bacteria	31686
550	Ga0495584_0000978	3300046491	Bacteria	17902
551	Ga0495584_0073339	3300046491	Bacteria	1720
552	Ga0495585_0000054	3300046492	Bacteria	114916
553	Ga0495585_0012751	3300046492	Bacteria	4945
554	Ga0495585_0018499	3300046492	Bacteria	4018
555	Ga0495585_0020167	3300046492	Bacteria	3835
556	Ga0495585_0028412	3300046492	Bacteria	3190
557	Ga0495585_0029878	3300046492	Bacteria	3101
558	Ga0495585_0035717	3300046492	Bacteria	2807
559	Ga0495594_0005760	3300046499	Bacteria	6363
560	Ga0495594_0015269	3300046499	Bacteria	4032
561	Ga0495607_0000259	3300046501	Bacteria	56558
562	Ga0495607_0000768	3300046501	Bacteria	30781
563	Ga0495607_0001194	3300046501	Bacteria	23467
564	Ga0495607_0003561	3300046501	Bacteria	11849
565	Ga0495607_0015873	3300046501	Bacteria	4870
566	Ga0495607_0018449	3300046501	Bacteria	4449
567	Ga0495607_0021884	3300046501	Bacteria	4021
568	Ga0495607_0037588	3300046501	Bacteria	2906
569	Ga0495583_0040106	3300046506	Bacteria	2201
570	Ga0495606_0002688	3300046507	Bacteria	20103
571	Ga0495606_0003459	3300046507	Bacteria	16749
572	Ga0495606_0024048	3300046507	Bacteria	4401
573	Ga0495608_0051896	3300046511	Bacteria	2716
574	Ga0495610_0000173	3300046512	Bacteria	72402
575	Ga0495610_0000564	3300046512	Bacteria	37165
576	Ga0495610_0001317	3300046512	Bacteria	22057
577	Ga0495610_0021415	3300046512	Bacteria	3556
578	Ga0495610_0037474	3300046512	Bacteria	2467
579	Ga0495616_0000101	3300046513	Bacteria	73493
580	Ga0495616_0000142	3300046513	Bacteria	62829
581	Ga0495616_0000203	3300046513	Bacteria	49328
582	Ga0495616_0000867	3300046513	Bacteria	21976
583	Ga0495616_0000938	3300046513	Bacteria	20979
584	Ga0495616_0013082	3300046513	Bacteria	4691
585	Ga0495620_0021167	3300046515	Bacteria	3162
586	Ga0495628_0013219	3300046516	Bacteria	6941
587	Ga0495628_0034474	3300046516	Bacteria	4071
588	Ga0495630_0011955	3300046517	Bacteria	6294
589	Ga0495630_0018426	3300046517	Bacteria	5128
590	Ga0495630_0024105	3300046517	Bacteria	4500
591	Ga0495631_0000793	3300046518	Bacteria	20196
592	Ga0495631_0010567	3300046518	Bacteria	4565
593	Ga0495631_0019664	3300046518	Bacteria	3165
594	Ga0495632_0000104	3300046519	Bacteria	86556
595	Ga0495632_0001558	3300046519	Bacteria	18918
596	Ga0495632_0002308	3300046519	Bacteria	14681
597	Ga0495632_0011725	3300046519	Bacteria	5103
598	Ga0495632_0015974	3300046519	Bacteria	4189
599	Ga0495637_0005411	3300046520	Bacteria	6512
600	Ga0495637_0068647	3300046520	Bacteria	1435
601	Ga0495637_0068650	3300046520	Bacteria	1435
602	Ga0495643_0004021	3300046522	Bacteria	10496
603	Ga0495643_0026570	3300046522	Bacteria	3264
604	Ga0495643_0044063	3300046522	Bacteria	2425
605	Ga0495643_0053632	3300046522	Bacteria	2161
606	Ga0495644_0000030	3300046523	Bacteria	66319
607	Ga0495644_0009211	3300046523	Bacteria	3804
608	Ga0495648_0000042	3300046524	Bacteria	179918
609	Ga0495648_0000495	3300046524	Bacteria	42433
610	Ga0495648_0001223	3300046524	Bacteria	25711
611	Ga0495648_0012060	3300046524	Bacteria	6472
612	Ga0495648_0013854	3300046524	Bacteria	5938
613	Ga0495648_0018323	3300046524	Bacteria	4962
614	Ga0495648_0023915	3300046524	Bacteria	4172
615	Ga0495648_0045858	3300046524	Bacteria	2715
616	Ga0495648_0062020	3300046524	Bacteria	2216
617	Ga0495663_0000553	3300046525	Bacteria	13188
618	Ga0495666_0004144	3300046526	Bacteria	7310
619	Ga0495666_0013970	3300046526	Bacteria	4004
620	Ga0495666_0051174	3300046526	Bacteria	1985
621	Ga0495666_0087408	3300046526	Bacteria	1472
622	Ga0495642_0000082	3300046528	Bacteria	55424
623	Ga0495642_0000181	3300046528	Bacteria	37092
624	Ga0495652_0006428	3300046529	Bacteria	10928
625	Ga0495654_0000145	3300046530	Bacteria	73703
626	Ga0495654_0005434	3300046530	Bacteria	7400
627	Ga0495654_0025182	3300046530	Bacteria	3067
628	Ga0495654_0038118	3300046530	Bacteria	2405
629	Ga0495654_0089785	3300046530	Bacteria	1427
630	Ga0495586_0048065	3300046535	Bacteria	2304
631	Ga0495587_0000089	3300046536	Bacteria	70764
632	Ga0495587_0040621	3300046536	Bacteria	2779
633	Ga0495609_0000198	3300046538	Bacteria	59995
634	Ga0495609_0000316	3300046538	Bacteria	43165
635	Ga0495609_0001713	3300046538	Bacteria	14212
636	Ga0495609_0008107	3300046538	Bacteria	5171
637	Ga0495621_0020479	3300046539	Bacteria	2171
638	Ga0495597_0000792	3300046542	Bacteria	24970
639	Ga0495597_0014860	3300046542	Bacteria	3701
640	Ga0495645_0049680	3300046543	Bacteria	3054
641	Ga0495645_0057111	3300046543	Bacteria	2834
642	Ga0495645_0086614	3300046543	Bacteria	2241
643	Ga0495622_0000922	3300046557	Bacteria	15881
644	Ga0495622_0001200	3300046557	Bacteria	13381
645	Ga0495622_0005762	3300046557	Bacteria	5745
646	Ga0495633_0000181	3300046558	Bacteria	82164
647	Ga0495633_0001936	3300046558	Bacteria	15058
648	Ga0495633_0002253	3300046558	Bacteria	13811
649	Ga0495633_0002852	3300046558	Bacteria	11878
650	Ga0495656_0009096	3300046615	Bacteria	3565
651	Ga0495656_0012951	3300046615	Bacteria	3091
652	Ga0495656_0042127	3300046615	Unclassified	1910
653	Ga0495656_0087099	3300046615	Bacteria	1422
654	Ga0495668_0004783	3300046616	Bacteria	9447
655	Ga0495668_0117518	3300046616	Bacteria	1454
656	Ga0495668_0199527	3300046616	Bacteria	1095
657	Ga0495634_0001522	3300046642	Bacteria	20497
658	Ga0495634_0027195	3300046642	Bacteria	3980
659	Ga0495611_0000045	3300046648	Bacteria	92047
660	Ga0495611_0001284	3300046648	Bacteria	12844
661	Ga0495611_0003059	3300046648	Bacteria	7435
662	Ga0495611_0014576	3300046648	Bacteria	3361
663	Ga0495625_0005136	3300046660	Bacteria	12086
664	Ga0495625_0006501	3300046660	Bacteria	10383
665	Ga0495625_0007517	3300046660	Bacteria	9469
666	Ga0495625_0018045	3300046660	Bacteria	5515
667	Ga0495625_0037690	3300046660	Bacteria	3543
668	Ga0495625_0107075	3300046660	Bacteria	1913
669	Ga0495635_0004174	3300046663	Bacteria	10023
670	Ga0495661_0000037	3300046665	Bacteria	164234
671	Ga0495661_0000047	3300046665	Bacteria	146326
672	Ga0495661_0000660	3300046665	Bacteria	34588
673	Ga0495661_0002600	3300046665	Bacteria	13839
674	Ga0495661_0036432	3300046665	Bacteria	3081
675	Ga0495661_0065991	3300046665	Bacteria	2131
676	Ga0495661_0071839	3300046665	Unclassified	2021
677	Ga0495661_0110781	3300046665	Bacteria	1530
678	Ga0495588_0030158	3300046674	Bacteria	2725
679	Ga0495623_0000644	3300046679	Bacteria	23149
680	Ga0495623_0019679	3300046679	Bacteria	4363
681	Ga0495646_0001803	3300046680	Bacteria	12852
682	Ga0495646_0001903	3300046680	Bacteria	12547
683	Ga0495646_0006219	3300046680	Bacteria	7572
684	Ga0495646_0026663	3300046680	Bacteria	3627
685	Ga0495669_0000895	3300046684	Bacteria	12544
686	Ga0495613_0001014	3300046689	Bacteria	21335
687	Ga0495613_0004820	3300046689	Bacteria	10119
688	Ga0495613_0023754	3300046689	Bacteria	4568
689	Ga0495624_0001651	3300046690	Bacteria	17117
690	Ga0495624_0005155	3300046690	Bacteria	9438
691	Ga0495670_0000053	3300046691	Bacteria	60401
692	Ga0495670_0000722	3300046691	Bacteria	15757
693	Ga0495670_0027684	3300046691	Bacteria	2809
694	Ga0495670_0038522	3300046691	Bacteria	2383
695	Ga0495671_0000160	3300046692	Bacteria	59259
696	Ga0495671_0003635	3300046692	Bacteria	9397
697	Ga0495671_0006086	3300046692	Bacteria	7005
698	Ga0495671_0007838	3300046692	Bacteria	6044
699	Ga0495671_0008889	3300046692	Bacteria	5640
700	Ga0495671_0013022	3300046692	Bacteria	4523
701	Ga0495649_0000473	3300046694	Bacteria	34619
702	Ga0495649_0004478	3300046694	Bacteria	9122
703	Ga0495649_0007192	3300046694	Bacteria	6827
704	Ga0495589_0000168	3300046794	Bacteria	59857
705	Ga0495589_0001005	3300046794	Bacteria	17108
706	Ga0495589_0003672	3300046794	Bacteria	8289
707	Ga0495600_0038808	3300046809	Bacteria	3100
708	Ga0495600_0040139	3300046809	Bacteria	3048
709	Ga0495600_0088543	3300046809	Bacteria	2019
710	Ga0495660_0001910	3300046810	Bacteria	13610
711	Ga0495660_0008826	3300046810	Bacteria	5887
712	Ga0495660_0013136	3300046810	Bacteria	4799
713	Ga0495660_0021757	3300046810	Bacteria	3668
714	Ga0495660_0039539	3300046810	Bacteria	2619
715	Ga0495581_0084142	3300047315	Bacteria	1843
716	Ga0495604_0002079	3300047317	Bacteria	16141
717	Ga0495604_0082637	3300047317	Bacteria	2401
718	Ga0495636_0079703	3300047318	Bacteria	1408
719	Ga0495636_0164568	3300047318	Bacteria	1000
720	Ga0495674_0002864	3300047319	Bacteria	16763
721	Ga0495672_0001945	3300047320	Bacteria	19530
722	Ga0495672_0006019	3300047320	Bacteria	9490
723	Ga0495672_0013454	3300047320	Bacteria	5645
724	Ga0495676_0002798	3300047321	Bacteria	15711
725	Ga0495676_0031920	3300047321	Bacteria	4449
726	Ga0495676_0095574	3300047321	Bacteria	2211
727	Ga0495676_0112299	3300047321	Bacteria	1997
728	Ga0495680_0002988	3300047322	Bacteria	16883
729	Ga0495680_0045953	3300047322	Bacteria	3445
730	Ga0495683_0000022	3300047323	Bacteria	163268
731	Ga0495683_0000268	3300047323	Bacteria	46160
732	Ga0495683_0012180	3300047323	Bacteria	4520
733	Ga0495683_0013807	3300047323	Bacteria	4216
734	Ga0495683_0019719	3300047323	Bacteria	3480
735	Ga0495683_0033186	3300047323	Bacteria	2628
736	Ga0495687_000313	3300047443	Bacteria	63173
737	Ga0495687_000692	3300047443	Bacteria	38222
738	Ga0495687_000784	3300047443	Bacteria	34187
739	Ga0495687_000983	3300047443	Bacteria	28695
740	Ga0495675_0027384	3300047444	Bacteria	3631
741	Ga0495677_0000062	3300047445	Bacteria	60952
742	Ga0495677_0001731	3300047445	Bacteria	8746
743	Ga0495677_0014185	3300047445	Bacteria	2902
744	Ga0495679_002750	3300047446	Bacteria	8754
745	Ga0495679_003259	3300047446	Bacteria	7871
746	Ga0495679_005202	3300047446	Bacteria	5814
747	Ga0495685_001947	3300047447	Bacteria	6398
748	Ga0495673_0001186	3300047469	Bacteria	21914
749	Ga0495673_0002142	3300047469	Bacteria	14337
750	Ga0495673_0003466	3300047469	Bacteria	10382
751	Ga0495673_0004351	3300047469	Bacteria	8893
752	Ga0495673_0005975	3300047469	Bacteria	7244
753	Ga0495673_0023924	3300047469	Bacteria	2961
754	Ga0495673_0036997	3300047469	Bacteria	2233
755	Ga0495681_0000109	3300047470	Bacteria	71558
756	Ga0495681_0020517	3300047470	Bacteria	3584
757	Ga0495681_0029657	3300047470	Bacteria	2797
758	Ga0495681_0062262	3300047470	Bacteria	1716
759	Ga0495684_0036953	3300047471	Bacteria	3744
760	Ga0495686_0000378	3300047472	Bacteria	71459
761	Ga0495686_0009549	3300047472	Bacteria	6978
762	Ga0495686_0144381	3300047472	Bacteria	1402
763	Ga0495593_0001352	3300047673	Bacteria	14314
764	Ga0495593_0027915	3300047673	Bacteria	3103
765	Ga0495593_0028976	3300047673	Bacteria	3039
766	Ga0495593_0152009	3300047673	Bacteria	1170
767	Ga0495602_0036190	3300048088	Bacteria	4596
768	Ga0495602_0167434	3300048088	Bacteria	1709
769	Ga0495614_0001300	3300048089	Bacteria	10760
770	Ga0495614_0089077	3300048089	Bacteria	1341
771	Ga0495626_0000224	3300048091	Bacteria	66775
772	Ga0495626_0000253	3300048091	Bacteria	61301
773	Ga0495626_0000519	3300048091	Bacteria	38597
774	Ga0495626_0000671	3300048091	Bacteria	32949
775	Ga0495626_0001614	3300048091	Bacteria	17536
776	Ga0495626_0013803	3300048091	Bacteria	4189
777	Ga0495626_0083670	3300048091	Bacteria	1413
778	Ga0496100_0168269	3300048903	Bacteria	1576
779	Ga0496101_0193780	3300048904	Bacteria	1569
780	Ga0496102_0000038	3300048905	Bacteria	198844
781	Ga0496102_0109912	3300048905	Bacteria	2569
782	Ga0496104_0005199	3300048907	Bacteria	11378
783	Ga0496104_0096303	3300048907	Bacteria	2831
784	Ga0496105_0040063	3300048908	Bacteria	3862
785	Ga0496106_0000493	3300048909	Bacteria	27947
786	Ga0496108_0167918	3300048911	Bacteria	1898
787	Ga0496110_0037891	3300048913	Bacteria	4192
788	Ga0496110_0166587	3300048913	Bacteria	1998
789	Ga0496111_0145917	3300048914	Bacteria	1754
790	Ga0496113_0021009	3300048916	Bacteria	4600
791	Ga0496114_0315074	3300048917	Bacteria	1382
792	Ga0496115_0000044	3300048918	Bacteria	115745
793	Ga0496115_0200956	3300048918	Bacteria	1646
794	Ga0496116_0000038	3300048919	Bacteria	370217
795	Ga0496116_0000081	3300048919	Bacteria	224170
796	Ga0496116_0000312	3300048919	Bacteria	80868
797	Ga0496116_0000593	3300048919	Bacteria	48320
798	Ga0496116_0000630	3300048919	Bacteria	46270
799	Ga0496116_0000646	3300048919	Bacteria	45529
800	Ga0496116_0001263	3300048919	Bacteria	29190
801	Ga0496116_0001789	3300048919	Bacteria	23375
802	Ga0496116_0009525	3300048919	Bacteria	8271
803	Ga0496116_0032863	3300048919	Bacteria	3691
804	Ga0496116_0042745	3300048919	Bacteria	3094
805	Ga0496116_0044158	3300048919	Bacteria	3030
806	Ga0496116_0047937	3300048919	Bacteria	2871
807	Ga0496117_0000597	3300048920	Bacteria	59321
808	Ga0496117_0000807	3300048920	Bacteria	48627
809	Ga0496117_0001329	3300048920	Bacteria	36378
810	Ga0496117_0004196	3300048920	Bacteria	16096
811	Ga0496117_0004650	3300048920	Bacteria	14934
812	Ga0496117_0009361	3300048920	Bacteria	9123
813	Ga0496117_0024859	3300048920	Bacteria	4721
814	Ga0496117_0039081	3300048920	Bacteria	3506
815	Ga0496117_0043042	3300048920	Bacteria	3289
816	Ga0496117_0043258	3300048920	Bacteria	3277
817	Ga0496117_0080799	3300048920	Bacteria	2136
818	Ga0496118_0000074	3300048921	Bacteria	196515
819	Ga0496118_0000663	3300048921	Bacteria	56234
820	Ga0496118_0001066	3300048921	Bacteria	42810
821	Ga0496118_0004397	3300048921	Bacteria	16746
822	Ga0496118_0004887	3300048921	Bacteria	15588
823	Ga0496118_0011575	3300048921	Bacteria	8593
824	Ga0496118_0018588	3300048921	Bacteria	6260
825	Ga0496118_0020919	3300048921	Bacteria	5783
826	Ga0496118_0056586	3300048921	Bacteria	2947
827	Ga0496118_0087744	3300048921	Bacteria	2156
828	Ga0496118_0097673	3300048921	Bacteria	1997
829	Ga0496118_0099856	3300048921	Bacteria	1965
830	Ga0496119_0000053	3300048922	Bacteria	182875
831	Ga0496119_0003729	3300048922	Bacteria	15607
832	Ga0496119_0033505	3300048922	Bacteria	3403
833	Ga0496119_0057832	3300048922	Bacteria	2341
834	Ga0496119_0104939	3300048922	Bacteria	1579
835	Ga0496120_0002470	3300048923	Bacteria	18618
836	Ga0496120_0003005	3300048923	Bacteria	15993
837	Ga0496120_0014947	3300048923	Bacteria	5143
838	Ga0496121_0000373	3300048924	Bacteria	92338
839	Ga0496121_0000377	3300048924	Bacteria	91399
840	Ga0496121_0000614	3300048924	Bacteria	66384
841	Ga0496121_0001424	3300048924	Bacteria	40476
842	Ga0496121_0019621	3300048924	Bacteria	6751
843	Ga0496121_0038397	3300048924	Bacteria	4242
844	Ga0496121_0112145	3300048924	Bacteria	2078
845	Ga0496121_0126332	3300048924	Bacteria	1921
846	Ga0496121_0242391	3300048924	Bacteria	1255
847	Ga0496122_0000806	3300048925	Bacteria	60153
848	Ga0496122_0001605	3300048925	Bacteria	35364
849	Ga0496122_0002359	3300048925	Bacteria	27157
850	Ga0496122_0013533	3300048925	Bacteria	7978
851	Ga0496122_0017184	3300048925	Bacteria	6782
852	Ga0496122_0021067	3300048925	Bacteria	5855
853	Ga0496122_0026984	3300048925	Bacteria	4928
854	Ga0496122_0052527	3300048925	Bacteria	3083
855	Ga0496122_0062402	3300048925	Bacteria	2728
856	Ga0496122_0074444	3300048925	Bacteria	2402
857	Ga0496122_0243195	3300048925	Bacteria	1013
858	Ga0496123_0000108	3300048926	Bacteria	166102
859	Ga0496123_0000881	3300048926	Bacteria	47635
860	Ga0496123_0001020	3300048926	Bacteria	42738
861	Ga0496123_0001515	3300048926	Bacteria	32169
862	Ga0496123_0003847	3300048926	Bacteria	16337
863	Ga0496123_0013256	3300048926	Bacteria	6943
864	Ga0496123_0026615	3300048926	Bacteria	4328
865	Ga0496123_0028038	3300048926	Bacteria	4178
866	Ga0496123_0029152	3300048926	Bacteria	4072
867	Ga0496123_0035017	3300048926	Bacteria	3586
868	Ga0496123_0042503	3300048926	Bacteria	3135
869	Ga0496123_0087794	3300048926	Bacteria	1859
870	Ga0496124_0000312	3300048927	Bacteria	89996
871	Ga0496124_0000460	3300048927	Bacteria	70590
872	Ga0496124_0000747	3300048927	Bacteria	53318
873	Ga0496124_0001209	3300048927	Bacteria	39976
874	Ga0496124_0002788	3300048927	Bacteria	22164
875	Ga0496124_0007420	3300048927	Bacteria	11657
876	Ga0496124_0024312	3300048927	Bacteria	5512
877	Ga0496124_0036107	3300048927	Bacteria	4315
878	Ga0496124_0050551	3300048927	Bacteria	3541
879	Ga0496124_0088913	3300048927	Bacteria	2523
880	Ga0496124_0091243	3300048927	Bacteria	2483
881	Ga0496124_0338042	3300048927	Bacteria	1070
882	Ga0496125_0000095	3300048928	Bacteria	208094
883	Ga0496125_0000465	3300048928	Bacteria	72631
884	Ga0496125_0001332	3300048928	Bacteria	36457
885	Ga0496125_0005891	3300048928	Bacteria	13436
886	Ga0496125_0006657	3300048928	Bacteria	12437
887	Ga0496125_0013150	3300048928	Bacteria	8156
888	Ga0496125_0030170	3300048928	Bacteria	4854
889	Ga0496125_0044185	3300048928	Bacteria	3771
890	Ga0496125_0046946	3300048928	Bacteria	3617
891	Ga0496125_0048096	3300048928	Bacteria	3560
892	Ga0496125_0052393	3300048928	Bacteria	3356
893	Ga0496125_0125334	3300048928	Bacteria	1821
894	Ga0496125_0182086	3300048928	Bacteria	1398
895	Ga0496125_0197316	3300048928	Bacteria	1322
896	Ga0496126_0001120	3300048929	Bacteria	44884
897	Ga0496126_0004738	3300048929	Bacteria	16040
898	Ga0496126_0058654	3300048929	Bacteria	3469
899	Ga0496126_0212736	3300048929	Bacteria	1627
900	Ga0496126_0415878	3300048929	Bacteria	1088
901	Ga0495678_000441	3300049459	Bacteria	41428
902	Ga0495678_002732	3300049459	Bacteria	11598
903	Ga0495678_004290	3300049459	Bacteria	8316
904	Ga0495678_008151	3300049459	Bacteria	5330
905	Ga0495682_0000430	3300049460	Bacteria	29408
906	Ga0495682_0000629	3300049460	Bacteria	23620
907	Ga0495682_0017364	3300049460	Bacteria	2716
908	Ga0495682_0031004	3300049460	Bacteria	1977
909	Ga0495682_0033593	3300049460	Bacteria	1893
910	Ga0495682_0039975	3300049460	Bacteria	1720
911	Ga0501046_0374554	3300049580	Unclassified	1031
912	Ga0501238_002693	3300049671	Bacteria	2141
913	Ga0501083_0055419	3300049744	Bacteria	2658
914	Ga0501241_000070	3300049758	Bacteria	23842
915	nmdc:mga03683_81973_c1	3300050489	Bacteria	1394
916	nmdc:mga0yw44_266145_c1	3300050492	Bacteria	1143
917	nmdc:mga0yw44_30502_c1	3300050492	Bacteria	3125
918	nmdc:mga06z11_99558_c1	3300050494	Bacteria	1592
919	nmdc:mga07m45_14745_c1	3300050496	Bacteria	4171
920	nmdc:mga05p37_119532_c1	3300050507	Unclassified	3238
921	nmdc:mga09592_12781_c1	3300050508	Bacteria	6843
922	nmdc:mga0qj67_241118_c1	3300050509	Unclassified	1467
923	nmdc:mga06r32_108455_c1	3300050510	Unclassified	2730
924	nmdc:mga08y16_1099_c1	3300050511	Archaea	26635
925	nmdc:mga08y16_406752_c1	3300050511	Archaea	1392
926	nmdc:mga0n895_2258_c1	3300050512	Archaea	14927
927	nmdc:mga0a205_37230_c1	3300050515	Unclassified	4679
928	Ga0500610_0000239	3300053079	Bacteria	16590
929	Ga0500610_0000575	3300053079	Bacteria	11291
930	Ga0500578_0045565	3300053086	Bacteria	2813
931	Ga0500643_002749	3300053087	Bacteria	8808
932	Ga0500593_000078	3300053117	Bacteria	36294
933	Ga0500594_0000365	3300053118	Bacteria	10095
934	Ga0500595_001262	3300053119	Bacteria	13909
935	Ga0500607_000025	3300053121	Bacteria	95473
936	Ga0500608_002213	3300053122	Bacteria	7015
937	Ga0500658_0000166	3300053134	Bacteria	31883
938	Ga0500658_0000725	3300053134	Bacteria	13612
939	Ga0500559_0008519	3300053136	Bacteria	4488
940	Ga0500559_0037630	3300053136	Bacteria	2098
941	Ga0500568_0000425	3300053139	Bacteria	31900
942	Ga0500568_0001031	3300053139	Bacteria	19068
943	Ga0500568_0013306	3300053139	Unclassified	3753
944	Ga0500574_012850	3300053141	Bacteria	1930
945	Ga0500616_0000278	3300053153	Bacteria	75900
946	Ga0500616_0083772	3300053153	Bacteria	1596
947	Ga0500619_022793	3300053154	Bacteria	1822
948	Ga0500622_0000195	3300053156	Bacteria	64428
949	Ga0500627_0007737	3300053158	Bacteria	3768
950	Ga0500634_0000172	3300053161	Bacteria	21425
951	Ga0500634_0001428	3300053161	Bacteria	9272
952	Ga0500634_0001595	3300053161	Bacteria	8944
953	Ga0500645_000048	3300053730	Bacteria	103273
954	Ga0501082_0313730	3300060353	Unclassified	1366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050511	nmdc:mga08y16_406752_c1	nmdc:mga08y16_406752_c1_605_1381	255
2	3300047318	Ga0495636_0164568	Ga0495636_0164568_46_891	256
3	iso_pu_bacteria	2864733723	2864739215	287
4	iso_pu_bacteria	2511231026	2511386774	299
5	iso_pu_bacteria	2821111986	2821114988	301
6	iso_pu_bacteria	2885526491	2885532167	301
7	iso_pu_bacteria	2889042446	2889047118	301
8	iso_pu_bacteria	2904162308	2904162904	301
9	iso_pu_bacteria	2919160200	2919163115	301
10	iso_pu_bacteria	2945991243	2945997200	301
11	iso_pu_bacteria	2946053406	2946059837	301
12	3300006946	Ga0079104_1004485	Ga0079104_10044855	303
13	3300025303	Ga0209051_1017918	Ga0209051_10179182	303
14	3300046460	Ga0495638_0039075	Ga0495638_0039075_1121_2122	303
15	3300046522	Ga0495643_0044063	Ga0495643_0044063_692_1693	303
16	3300046523	Ga0495644_0009211	Ga0495644_0009211_722_1720	303
17	3300046542	Ga0495597_0014860	Ga0495597_0014860_2083_3084	303
18	3300046810	Ga0495660_0013136	Ga0495660_0013136_2010_3011	303
19	3300053086	Ga0500578_0045565	Ga0500578_0045565_1121_2122	303
20	3300053134	Ga0500658_0000725	Ga0500658_0000725_8469_9470	303
21	3300046491	Ga0495584_0000978	Ga0495584_0000978_7776_8777	304
22	3300046519	Ga0495632_0000104	Ga0495632_0000104_53062_54063	304
23	3300046528	Ga0495642_0000181	Ga0495642_0000181_3660_4661	304
24	3300046538	Ga0495609_0001713	Ga0495609_0001713_7552_8553	304
25	3300046694	Ga0495649_0000473	Ga0495649_0000473_2563_3564	304
26	3300047320	Ga0495672_0001945	Ga0495672_0001945_9173_10174	304
27	3300047443	Ga0495687_000692	Ga0495687_000692_12155_13156	304
28	3300048091	Ga0495626_0000519	Ga0495626_0000519_29695_30696	304
29	3300049459	Ga0495678_000441	Ga0495678_000441_7564_8565	304
30	iso_pu_bacteria	2929177148	2929182305	304
31	iso_pu_bacteria	2945977869	2945978223	304
32	iso_pu_bacteria	2946013367	2946015917	304
33	iso_pu_bacteria	3006973921	3006975344	304
34	3300009036	Ga0105244_10021986	Ga0105244_100219864	305
35	3300025225	Ga0209566_101366	Ga0209566_1013664	305
36	3300025233	Ga0209437_100392	Ga0209437_10039218	305
37	3300025728	Ga0207655_1021624	Ga0207655_10216242	305
38	3300031665	Ga0316575_10000320	Ga0316575_100003209	305
39	3300032133	Ga0316583_10001991	Ga0316583_100019917	305
40	3300048919	Ga0496116_0001789	Ga0496116_0001789_3991_5001	305
41	3300048919	Ga0496116_0042745	Ga0496116_0042745_956_1882	305
42	3300048924	Ga0496121_0242391	Ga0496121_0242391_239_1165	305
43	3300048925	Ga0496122_0013533	Ga0496122_0013533_6806_7732	305
44	3300048927	Ga0496124_0091243	Ga0496124_0091243_1200_2210	305
45	iso_pu_bacteria	2643221543	2643740498	305
46	iso_pu_bacteria	2885374607	2885374774	305
47	iso_pu_bacteria	2904490793	2904494044	305
48	iso_pu_bacteria	2931384279	2931390641	305
49	iso_pu_bacteria	2939679117	2939679352	305
50	3300003790	Ga0055528_1011701	Ga0055528_10117011	306
51	3300025273	Ga0209673_1001691	Ga0209673_100169111	306
52	3300025299	Ga0209256_1014403	Ga0209256_10144032	306
53	3300044712	Ga0453684_0010387	Ga0453684_0010387_8572_9528	306
54	3300045051	Ga0451576_0008343	Ga0451576_0008343_802_1758	306
55	3300046616	Ga0495668_0117518	Ga0495668_0117518_226_1227	306
56	3300002244	JGI24742J22300_10005371	JGI24742J22300_100053712	307
57	3300005330	Ga0070690_100234054	Ga0070690_1002340542	307
58	3300005337	Ga0070682_100234087	Ga0070682_1002340872	307
59	3300005356	Ga0070674_100232260	Ga0070674_1002322601	307
60	3300005441	Ga0070700_100382556	Ga0070700_1003825561	307
61	3300005456	Ga0070678_100375659	Ga0070678_1003756592	307
62	3300005544	Ga0070686_100164579	Ga0070686_1001645791	307
63	3300009094	Ga0111539_10243422	Ga0111539_102434221	307
64	3300009094	Ga0111539_10560553	Ga0111539_105605531	307
65	3300013104	Ga0157370_10599304	Ga0157370_105993041	307
66	3300014326	Ga0157380_10313172	Ga0157380_103131721	307
67	3300014745	Ga0157377_10018080	Ga0157377_100180801	307
68	3300025937	Ga0207669_10323629	Ga0207669_103236291	307
69	3300026121	Ga0207683_10189937	Ga0207683_101899371	307
70	3300046452	Ga0495617_000047	Ga0495617_000047_20927_21928	307
71	3300046457	Ga0495590_0002976	Ga0495590_0002976_1362_2363	307
72	3300046471	Ga0495650_0001138	Ga0495650_0001138_7835_8836	307
73	3300046474	Ga0495605_0001243	Ga0495605_0001243_7932_8933	307
74	3300046492	Ga0495585_0028412	Ga0495585_0028412_1501_2502	307
75	3300046501	Ga0495607_0001194	Ga0495607_0001194_6710_7711	307
76	3300046513	Ga0495616_0000867	Ga0495616_0000867_20882_21883	307
77	3300046522	Ga0495643_0004021	Ga0495643_0004021_1879_2880	307
78	3300046524	Ga0495648_0012060	Ga0495648_0012060_2156_3157	307
79	3300046648	Ga0495611_0001284	Ga0495611_0001284_5009_6010	307
80	3300046794	Ga0495589_0001005	Ga0495589_0001005_8568_9569	307
81	3300047447	Ga0495685_001947	Ga0495685_001947_3833_4834	307
82	3300047469	Ga0495673_0002142	Ga0495673_0002142_11442_12443	307
83	3300048903	Ga0496100_0168269	Ga0496100_0168269_63_995	307
84	3300048907	Ga0496104_0005199	Ga0496104_0005199_7705_8637	307
85	3300048908	Ga0496105_0040063	Ga0496105_0040063_2834_3766	307
86	3300048918	Ga0496115_0200956	Ga0496115_0200956_621_1553	307
87	3300049460	Ga0495682_0017364	Ga0495682_0017364_726_1727	307
88	3300053087	Ga0500643_002749	Ga0500643_002749_1635_2639	307
89	2162886007	SwRhRL2b_contig_3393433	SwRhRL2b_0143.00000940	308
90	3300005289	Ga0065704_10004287	Ga0065704_100042872	308
91	3300005295	Ga0065707_10096139	Ga0065707_100961392	308
92	3300005458	Ga0070681_10161388	Ga0070681_101613883	308
93	3300005614	Ga0068856_100023294	Ga0068856_1000232941	308
94	3300006058	Ga0075432_10004723	Ga0075432_100047233	308
95	3300006847	Ga0075431_100102182	Ga0075431_1001021823	308
96	3300009036	Ga0105244_10093780	Ga0105244_100937801	308
97	3300009094	Ga0111539_10118824	Ga0111539_101188242	308
98	3300009147	Ga0114129_10076409	Ga0114129_100764093	308
99	3300009174	Ga0105241_10028977	Ga0105241_100289773	308
100	3300009545	Ga0105237_10134646	Ga0105237_101346462	308
101	3300013100	Ga0157373_10020266	Ga0157373_100202662	308
102	3300013308	Ga0157375_10072798	Ga0157375_100727983	308
103	3300025911	Ga0207654_10053643	Ga0207654_100536432	308
104	3300025914	Ga0207671_10166369	Ga0207671_101663692	308
105	3300027907	Ga0207428_10000225	Ga0207428_1000022533	308
106	3300044693	Ga0466961_0204571	Ga0466961_0204571_227_1162	308
107	3300046492	Ga0495585_0029878	Ga0495585_0029878_1105_2109	308
108	3300046648	Ga0495611_0000045	Ga0495611_0000045_82138_83142	308
109	3300046809	Ga0495600_0038808	Ga0495600_0038808_305_1306	308
110	3300049580	Ga0501046_0374554	Ga0501046_0374554_29_991	308
111	3300050507	nmdc:mga05p37_119532_c1	nmdc:mga05p37_119532_c1_1747_2703	308
112	3300050508	nmdc:mga09592_12781_c1	nmdc:mga09592_12781_c1_5512_6468	308
113	3300050509	nmdc:mga0qj67_241118_c1	nmdc:mga0qj67_241118_c1_215_1171	308
114	3300050510	nmdc:mga06r32_108455_c1	nmdc:mga06r32_108455_c1_1239_2195	308
115	3300050511	nmdc:mga08y16_1099_c1	nmdc:mga08y16_1099_c1_9955_10911	308
116	3300050512	nmdc:mga0n895_2258_c1	nmdc:mga0n895_2258_c1_10956_11912	308
117	3300050515	nmdc:mga0a205_37230_c1	nmdc:mga0a205_37230_c1_1664_2620	308
118	3300053139	Ga0500568_0013306	Ga0500568_0013306_459_1394	308
119	3300053154	Ga0500619_022793	Ga0500619_022793_305_1306	308
120	3300060353	Ga0501082_0313730	Ga0501082_0313730_50_1012	308
121	3300003322	rootL2_10139457	rootL2_101394573	309
122	3300005445	Ga0070708_100010333	Ga0070708_1000103334	309
123	3300005468	Ga0070707_100057997	Ga0070707_1000579972	309
124	3300005844	Ga0068862_100059224	Ga0068862_1000592242	309
125	3300013105	Ga0157369_10021100	Ga0157369_100211004	309
126	3300013296	Ga0157374_10296280	Ga0157374_102962802	309
127	3300046460	Ga0495638_0059813	Ga0495638_0059813_29_958	309
128	3300048091	Ga0495626_0013803	Ga0495626_0013803_1713_2642	309
129	3300048925	Ga0496122_0243195	Ga0496122_0243195_71_1000	309
130	3300002737	JGI25162J39368_1000005	JGI25162J39368_100000588	310
131	3300003781	Ga0055536_1000009	Ga0055536_100000959	310
132	3300013104	Ga0157370_10000187	Ga0157370_1000018717	310
133	3300013104	Ga0157370_10000929	Ga0157370_100009297	310
134	3300025295	Ga0209564_1034873	Ga0209564_10348732	310
135	3300028794	Ga0307515_10000174	Ga0307515_10000174108	310
136	3300046660	Ga0495625_0037690	Ga0495625_0037690_1691_2692	310
137	3300053122	Ga0500608_002213	Ga0500608_002213_5474_6415	310
138	3300003771	Ga0055526_1003546	Ga0055526_10035464	312
139	3300003790	Ga0055528_1000137	Ga0055528_100013715	312
140	3300025273	Ga0209673_1000023	Ga0209673_1000023340	312
141	3300025295	Ga0209564_1000100	Ga0209564_100010042	312
142	3300025299	Ga0209256_1000221	Ga0209256_100022173	312
143	3300047321	Ga0495676_0095574	Ga0495676_0095574_413_1417	312
144	3300048921	Ga0496118_0011575	Ga0496118_0011575_6461_7462	312
145	3300053156	Ga0500622_0000195	Ga0500622_0000195_29568_30569	312
146	iso_pu_bacteria	2870068957	2870071149	313
147	3300005518	Ga0070699_100109471	Ga0070699_1001094712	314
148	3300012502	Ga0157347_1002562	Ga0157347_10025622	314
149	3300013102	Ga0157371_10000012	Ga0157371_10000012166	314
150	3300046459	Ga0495629_0268094	Ga0495629_0268094_44_1045	314
151	3300046477	Ga0495664_0152191	Ga0495664_0152191_18_962	314
152	3300046506	Ga0495583_0040106	Ga0495583_0040106_486_1430	314
153	3300046512	Ga0495610_0000173	Ga0495610_0000173_68982_69926	314
154	3300046530	Ga0495654_0025182	Ga0495654_0025182_1338_2381	314
155	3300046557	Ga0495622_0001200	Ga0495622_0001200_9758_10759	314
156	3300046558	Ga0495633_0002852	Ga0495633_0002852_4286_5287	314
157	3300046616	Ga0495668_0199527	Ga0495668_0199527_68_1012	314
158	3300048929	Ga0496126_0415878	Ga0496126_0415878_127_1071	314
159	3300053119	Ga0500595_001262	Ga0500595_001262_1037_2038	314
160	3300046455	Ga0495603_0001797	Ga0495603_0001797_6355_7359	315
161	3300046459	Ga0495629_0001914	Ga0495629_0001914_9653_10657	315
162	3300046689	Ga0495613_0001014	Ga0495613_0001014_13139_14143	315
163	3300047321	Ga0495676_0112299	Ga0495676_0112299_851_1855	315
164	3300048089	Ga0495614_0001300	Ga0495614_0001300_1227_2231	315
165	3300005564	Ga0070664_100199460	Ga0070664_1001994602	316
166	3300011119	Ga0105246_10099201	Ga0105246_100992012	316
167	3300013100	Ga0157373_10186699	Ga0157373_101866992	316
168	3300042005	Ga0439448_0000193	Ga0439448_0000193_8110_9111	316
169	3300042012	Ga0439455_0021628	Ga0439455_0021628_393_1394	316
170	3300053139	Ga0500568_0000425	Ga0500568_0000425_24856_25857	316
171	3300001979	JGI24740J21852_10001985	JGI24740J21852_100019854	317
172	3300006880	Ga0075429_100133802	Ga0075429_1001338023	317
173	3300025258	Ga0209129_1005200	Ga0209129_10052004	317
174	3300025297	Ga0209758_1001740	Ga0209758_100174019	317
175	3300053161	Ga0500634_0001428	Ga0500634_0001428_5198_6199	317
176	3300009545	Ga0105237_10183592	Ga0105237_101835922	318
177	3300042005	Ga0439448_0003026	Ga0439448_0003026_115_1131	318
178	3300042012	Ga0439455_0003863	Ga0439455_0003863_450_1466	318
179	3300047318	Ga0495636_0079703	Ga0495636_0079703_17_973	318
180	3300048926	Ga0496123_0035017	Ga0496123_0035017_2010_3011	318
181	3300002774	JGI25150J39212_1006623	JGI25150J39212_10066232	319
182	3300005444	Ga0070694_100017455	Ga0070694_1000174553	319
183	3300025245	Ga0207425_1002384	Ga0207425_10023844	319
184	3300025258	Ga0209129_1005205	Ga0209129_10052054	319
185	3300025297	Ga0209758_1001767	Ga0209758_100176718	319
186	3300046665	Ga0495661_0065991	Ga0495661_0065991_1058_2059	319
187	2162886011	MRS1b_contig_9404902	MRS1b_0676.00002840	321
188	3300005290	Ga0065712_10067887	Ga0065712_1006788712	321
189	3300009545	Ga0105237_10053509	Ga0105237_100535093	321
190	3300025914	Ga0207671_10053532	Ga0207671_100535322	321
191	3300031456	Ga0307513_10018000	Ga0307513_100180008	321
192	3300048909	Ga0496106_0000493	Ga0496106_0000493_17374_18375	321
193	iso_pu_bacteria	2932794094	2932796957	322
194	iso_pu_bacteria	2932801729	2932807255	322
195	iso_pu_bacteria	2935648319	2935649186	322
196	iso_pu_bacteria	2935656913	2935658042	322
197	iso_pu_bacteria	2935883170	2935884621	322
198	iso_pu_bacteria	2936011229	2936012261	322
199	iso_pu_bacteria	2936019824	2936020658	322
200	iso_pu_bacteria	2936028420	2936029554	322
201	iso_pu_bacteria	2936046547	2936051981	322
202	iso_pu_bacteria	8016630954	8016635098	322
203	2124908027	MRS2a_Contig_7102	MRS2a_00004960	323
204	3300003771	Ga0055526_1000586	Ga0055526_100058611	324
205	3300003775	Ga0055524_1000742	Ga0055524_100074217	324
206	3300003790	Ga0055528_1000409	Ga0055528_100040915	324
207	3300006186	Ga0075369_10003691	Ga0075369_100036915	324
208	3300025273	Ga0209673_1000558	Ga0209673_100055840	324
209	3300025291	Ga0209675_1012045	Ga0209675_10120452	324
210	3300025295	Ga0209564_1000128	Ga0209564_1000128139	324
211	3300025299	Ga0209256_1000658	Ga0209256_100065830	324
212	3300031616	Ga0307508_10037533	Ga0307508_100375332	324
213	3300031731	Ga0307405_10073717	Ga0307405_100737172	324
214	3300046810	Ga0495660_0021757	Ga0495660_0021757_2385_3386	324
215	iso_pu_bacteria	2643221578	2643898738	324
216	iso_pu_bacteria	2643221673	2644402085	324
217	3300006178	Ga0075367_10075458	Ga0075367_100754583	325
218	iso_pu_bacteria	2919481497	2919484961	325
219	3300005434	Ga0070709_10101161	Ga0070709_101011612	326
220	3300005436	Ga0070713_100064989	Ga0070713_1000649893	326
221	3300005437	Ga0070710_10041369	Ga0070710_100413692	326
222	3300005439	Ga0070711_100224914	Ga0070711_1002249141	326
223	3300005467	Ga0070706_100128363	Ga0070706_1001283632	326
224	3300005548	Ga0070665_100069820	Ga0070665_1000698204	326
225	3300006173	Ga0070716_100142507	Ga0070716_1001425071	326
226	3300006175	Ga0070712_100187924	Ga0070712_1001879242	326
227	3300025903	Ga0207680_10044249	Ga0207680_100442492	326
228	3300025910	Ga0207684_10130041	Ga0207684_101300411	326
229	3300025915	Ga0207693_10009747	Ga0207693_100097476	326
230	3300025929	Ga0207664_10161179	Ga0207664_101611791	326
231	3300025939	Ga0207665_10190989	Ga0207665_101909892	326
232	3300028794	Ga0307515_10085550	Ga0307515_100855502	326
233	3300041404	Ga0439436_0010594	Ga0439436_0010594_1656_2660	326
234	3300041999	Ga0439433_0001888	Ga0439433_0001888_1873_2877	326
235	iso_pu_bacteria	2599185319	2600041507	326
236	iso_pu_bacteria	2599185323	2600063715	326
237	iso_pu_bacteria	2738541295	2738818141	326
238	iso_pu_bacteria	2816332186	2816861513	326
239	iso_pu_bacteria	2842682962	2842687271	326
240	iso_pu_bacteria	2849139964	2849145495	326
241	iso_pu_bacteria	8022948649	8022950616	326
242	3300003773	Ga0055537_1008078	Ga0055537_10080782	327
243	3300005467	Ga0070706_100302195	Ga0070706_1003021952	327
244	3300005468	Ga0070707_100035949	Ga0070707_1000359492	327
245	3300025263	Ga0209565_1002381	Ga0209565_10023813	327
246	iso_pu_bacteria	2597489888	2597865222	327
247	iso_pu_bacteria	2599185189	2599508632	327
248	iso_pu_bacteria	2600255296	2601689523	327
249	iso_pu_bacteria	2643221713	2644622055	327
250	iso_pu_bacteria	2721755607	2723249976	327
251	iso_pu_bacteria	2747842501	2748018638	327
252	iso_pu_bacteria	2842826826	2842827552	327
253	iso_pu_bacteria	2842837860	2842841338	327
254	iso_pu_bacteria	2855195626	2855196011	327
255	iso_pu_bacteria	2857442823	2857443965	327
256	iso_pu_bacteria	2871272651	2871272715	327
257	iso_pu_bacteria	2939622612	2939623980	327
258	iso_pu_bacteria	8054347763	8054350655	327
259	3300046512	Ga0495610_0021415	Ga0495610_0021415_466_1452	328
260	iso_pu_bacteria	2511231004	2511257477	328
261	iso_pu_bacteria	2511231007	2511270469	328
262	iso_pu_bacteria	2511231010	2511290262	328
263	iso_pu_bacteria	2511231016	2511325521	328
264	iso_pu_bacteria	2511231018	2511341544	328
265	iso_pu_bacteria	2511231022	2511362497	328
266	iso_pu_bacteria	2511231156	2511824489	328
267	iso_pu_bacteria	2513020051	2513228965	328
268	iso_pu_bacteria	2515154134	2515742075	328
269	iso_pu_bacteria	2516653085	2517080629	328
270	iso_pu_bacteria	2554235341	2555669803	328
271	iso_pu_bacteria	2576861471	2578457960	328
272	iso_pu_bacteria	2597489887	2597859102	328
273	iso_pu_bacteria	2599185160	2599353186	328
274	iso_pu_bacteria	2599185164	2599378294	328
275	iso_pu_bacteria	2599185165	2599384329	328
276	iso_pu_bacteria	2599185181	2599460020	328
277	iso_pu_bacteria	2599185185	2599487467	328
278	iso_pu_bacteria	2599185186	2599489041	328
279	iso_pu_bacteria	2599185188	2599502093	328
280	iso_pu_bacteria	2599185212	2599614724	328
281	iso_pu_bacteria	2599185248	2599768800	328
282	iso_pu_bacteria	2599185257	2599806210	328
283	iso_pu_bacteria	2599185288	2599877978	328
284	iso_pu_bacteria	2599185289	2599884554	328
285	iso_pu_bacteria	2599185291	2599896267	328
286	iso_pu_bacteria	2599185300	2599932849	328
287	iso_pu_bacteria	2599185303	2599952214	328
288	iso_pu_bacteria	2599185305	2599958153	328
289	iso_pu_bacteria	2599185306	2599964012	328
290	iso_pu_bacteria	2599185308	2599976735	328
291	iso_pu_bacteria	2599185311	2599996674	328
292	iso_pu_bacteria	2599185313	2600003798	328
293	iso_pu_bacteria	2599185314	2600010904	328
294	iso_pu_bacteria	2599185315	2600015876	328
295	iso_pu_bacteria	2599185316	2600021880	328
296	iso_pu_bacteria	2599185317	2600031897	328
297	iso_pu_bacteria	2599185318	2600037345	328
298	iso_pu_bacteria	2599185321	2600051082	328
299	iso_pu_bacteria	2599185322	2600059464	328
300	iso_pu_bacteria	2599185324	2600069152	328
301	iso_pu_bacteria	2599185325	2600075154	328
302	iso_pu_bacteria	2599185356	2600212627	328
303	iso_pu_bacteria	2600254930	2600361687	328
304	iso_pu_bacteria	2600254931	2600367267	328
305	iso_pu_bacteria	2600254954	2600446865	328
306	iso_pu_bacteria	2600255313	2601772795	328
307	iso_pu_bacteria	2600255318	2601799496	328
308	iso_pu_bacteria	2603880185	2606078270	328
309	iso_pu_bacteria	2603880199	2606130378	328
310	iso_pu_bacteria	2619619299	2621302319	328
311	iso_pu_bacteria	2623620443	2624480464	328
312	iso_pu_bacteria	2643221571	2643869332	328
313	iso_pu_bacteria	2643221593	2643975941	328
314	iso_pu_bacteria	2643221633	2644189341	328
315	iso_pu_bacteria	2643221650	2644281076	328
316	iso_pu_bacteria	2643221683	2644465279	328
317	iso_pu_bacteria	2667528170	2671088960	328
318	iso_pu_bacteria	2667528176	2671126964	328
319	iso_pu_bacteria	2671180172	2671772726	328
320	iso_pu_bacteria	2675903515	2678263507	328
321	iso_pu_bacteria	2713897148	2715751584	328
322	iso_pu_bacteria	2713897149	2715759378	328
323	iso_pu_bacteria	2718217725	2718634509	328
324	iso_pu_bacteria	2738541265	2738674415	328
325	iso_pu_bacteria	2738541282	2738752808	328
326	iso_pu_bacteria	2738541294	2738810038	328
327	iso_pu_bacteria	2738541303	2738861849	328
328	iso_pu_bacteria	2738541309	2738897398	328
329	iso_pu_bacteria	2738541333	2739033963	328
330	iso_pu_bacteria	2738543015	2739258044	328
331	iso_pu_bacteria	2738543020	2739287516	328
332	iso_pu_bacteria	2738543021	2739292829	328
333	iso_pu_bacteria	2738543025	2739311670	328
334	iso_pu_bacteria	2744054620	2745009838	328
335	iso_pu_bacteria	2765235942	2766068510	328
336	iso_pu_bacteria	2773857670	2774123727	328
337	iso_pu_bacteria	2773857673	2774134204	328
338	iso_pu_bacteria	2784132063	2784264015	328
339	iso_pu_bacteria	2784132072	2784312243	328
340	iso_pu_bacteria	2791355520	2794597892	328
341	iso_pu_bacteria	2806310737	2807407048	328
342	iso_pu_bacteria	2806310745	2807455380	328
343	iso_pu_bacteria	2808606385	2808976993	328
344	iso_pu_bacteria	2808606388	2808992148	328
345	iso_pu_bacteria	2816332298	2817488256	328
346	iso_pu_bacteria	2818991446	2819601004	328
347	iso_pu_bacteria	2818991457	2819661052	328
348	iso_pu_bacteria	2818991463	2819697636	328
349	iso_pu_bacteria	2825651385	2825652301	328
350	iso_pu_bacteria	2826581358	2826584945	328
351	iso_pu_bacteria	2838686498	2838692956	328
352	iso_pu_bacteria	2838729681	2838734180	328
353	iso_pu_bacteria	2838742623	2838746632	328
354	iso_pu_bacteria	2841851746	2841853323	328
355	iso_pu_bacteria	2842156927	2842161592	328
356	iso_pu_bacteria	2842163707	2842167194	328
357	iso_pu_bacteria	2842180545	2842185607	328
358	iso_pu_bacteria	2842229732	2842234222	328
359	iso_pu_bacteria	2842243621	2842246523	328
360	iso_pu_bacteria	2842257432	2842260617	328
361	iso_pu_bacteria	2842271015	2842277424	328
362	iso_pu_bacteria	2842757796	2842757936	328
363	iso_pu_bacteria	2842780639	2842784253	328
364	iso_pu_bacteria	2842805378	2842805851	328
365	iso_pu_bacteria	2842815866	2842816240	328
366	iso_pu_bacteria	2842832357	2842834782	328
367	iso_pu_bacteria	2842843487	2842843490	328
368	iso_pu_bacteria	2842849001	2842850918	328
369	iso_pu_bacteria	2844454524	2844460955	328
370	iso_pu_bacteria	2844665904	2844670853	328
371	iso_pu_bacteria	2847085930	2847089186	328
372	iso_pu_bacteria	2852612431	2852613673	328
373	iso_pu_bacteria	2852667396	2852668591	328
374	iso_pu_bacteria	2852684882	2852686913	328
375	iso_pu_bacteria	2854896431	2854897294	328
376	iso_pu_bacteria	2857516855	2857519322	328
377	iso_pu_bacteria	2860339153	2860344657	328
378	iso_pu_bacteria	2860867994	2860868301	328
379	iso_pu_bacteria	2873151551	2873151778	328
380	iso_pu_bacteria	2874220319	2874221805	328
381	iso_pu_bacteria	2878029506	2878032398	328
382	iso_pu_bacteria	2880230671	2880233920	328
383	iso_pu_bacteria	2899924645	2899927959	328
384	iso_pu_bacteria	2903895155	2903897090	328
385	iso_pu_bacteria	2904479285	2904483639	328
386	iso_pu_bacteria	2904518522	2904523223	328
387	iso_pu_bacteria	2912963787	2912965823	328
388	iso_pu_bacteria	2913036834	2913039126	328
389	iso_pu_bacteria	2917070673	2917073621	328
390	iso_pu_bacteria	2919089067	2919089552	328
391	iso_pu_bacteria	2919385768	2919387108	328
392	iso_pu_bacteria	2919487758	2919489054	328
393	iso_pu_bacteria	2919697872	2919703939	328
394	iso_pu_bacteria	2923586266	2923588140	328
395	iso_pu_bacteria	2928037797	2928044518	328
396	iso_pu_bacteria	2928044640	2928051278	328
397	iso_pu_bacteria	2928051484	2928056377	328
398	iso_pu_bacteria	2928084124	2928090062	328
399	iso_pu_bacteria	2928496128	2928497278	328
400	iso_pu_bacteria	2929144301	2929147747	328
401	iso_pu_bacteria	2929189879	2929190163	328
402	iso_pu_bacteria	2931369376	2931374860	328
403	iso_pu_bacteria	2931380184	2931380589	328
404	iso_pu_bacteria	2931396565	2931402178	328
405	iso_pu_bacteria	2932082852	2932083852	328
406	iso_pu_bacteria	2935353572	2935357367	328
407	iso_pu_bacteria	2935901341	2935905904	328
408	iso_pu_bacteria	2937610967	2937612625	328
409	iso_pu_bacteria	2939589442	2939591588	328
410	iso_pu_bacteria	2939626828	2939627170	328
411	iso_pu_bacteria	2939631187	2939631731	328
412	iso_pu_bacteria	2941479691	2941480071	328
413	iso_pu_bacteria	2941489479	2941490958	328
414	iso_pu_bacteria	2945928738	2945932220	328
415	iso_pu_bacteria	2947233263	2947239057	328
416	iso_pu_bacteria	2961047084	2961048572	328
417	iso_pu_bacteria	2974289157	2974290819	328
418	iso_pu_bacteria	2977247770	2977249587	328
419	iso_pu_bacteria	2977254563	2977257604	328
420	iso_pu_bacteria	2998139840	2998142995	328
421	iso_pu_bacteria	3007855910	3007856999	328
422	iso_pu_bacteria	3007861166	3007862029	328
423	iso_pu_bacteria	637000220	637320142	328
424	iso_pu_bacteria	8005307578	8005309974	328
425	iso_pu_bacteria	8019775933	8019781975	328
426	iso_pu_bacteria	8029995093	8029997792	328
427	iso_pu_bacteria	8054285046	8054287928	328
428	iso_pu_bacteria	8054285046	8054288658	328
429	iso_pu_bacteria	8054285046	8054291339	328
430	iso_pu_bacteria	8055770955	8055773603	328
431	iso_pu_bacteria	8056125926	8056128342	328
432	iso_pu_bacteria	8056131705	8056134196	328
433	iso_pu_bacteria	8056161164	8056162204	328
434	iso_pu_bacteria	8056166840	8056168197	328
435	iso_pu_bacteria	8056569372	8056574109	328
436	3300048928	Ga0496125_0000465	Ga0496125_0000465_7995_8996	329
437	3300003771	Ga0055526_1000046	Ga0055526_100004662	330
438	3300005842	Ga0068858_100028701	Ga0068858_1000287015	330
439	3300014325	Ga0163163_10063356	Ga0163163_100633562	330
440	3300025295	Ga0209564_1000277	Ga0209564_100027746	330
441	3300050492	nmdc:mga0yw44_30502_c1	nmdc:mga0yw44_30502_c1_16_1008	330
442	3300003751	Ga0055538_1000027	Ga0055538_1000027158	331
443	3300003752	Ga0055539_1000036	Ga0055539_1000036158	331
444	3300003756	Ga0055533_1000046	Ga0055533_1000046158	331
445	3300003758	Ga0055532_1000032	Ga0055532_1000032158	331
446	3300003759	Ga0055525_1000217	Ga0055525_100021725	331
447	3300003841	Ga0055541_1000024	Ga0055541_1000024158	331
448	3300005288	Ga0065714_10004350	Ga0065714_1000435010	331
449	3300005329	Ga0070683_100078659	Ga0070683_1000786593	331
450	3300005331	Ga0070670_100079470	Ga0070670_1000794702	331
451	3300005334	Ga0068869_100141663	Ga0068869_1001416632	331
452	3300005441	Ga0070700_100218754	Ga0070700_1002187541	331
453	3300005535	Ga0070684_100049889	Ga0070684_1000498893	331
454	3300005548	Ga0070665_100109473	Ga0070665_1001094734	331
455	3300005614	Ga0068856_100038127	Ga0068856_1000381274	331
456	3300005618	Ga0068864_100057694	Ga0068864_1000576943	331
457	3300006175	Ga0070712_100231028	Ga0070712_1002310281	331
458	3300009098	Ga0105245_10106599	Ga0105245_101065993	331
459	3300011119	Ga0105246_10123287	Ga0105246_101232872	331
460	3300013297	Ga0157378_10022123	Ga0157378_100221234	331
461	3300025224	Ga0209784_100017	Ga0209784_100017291	331
462	3300025225	Ga0209566_100014	Ga0209566_100014291	331
463	3300025226	Ga0209674_100028	Ga0209674_100028291	331
464	3300025229	Ga0209147_100038	Ga0209147_100038146	331
465	3300025230	Ga0209563_100032	Ga0209563_100032291	331
466	3300025233	Ga0209437_111655	Ga0209437_1116552	331
467	3300025242	Ga0209258_100197	Ga0209258_10019771	331
468	3300025246	Ga0209646_1000171	Ga0209646_100017182	331
469	3300025253	Ga0209677_100018	Ga0209677_100018291	331
470	3300025901	Ga0207688_10088066	Ga0207688_100880662	331
471	3300025942	Ga0207689_10106270	Ga0207689_101062702	331
472	3300025944	Ga0207661_10083475	Ga0207661_100834753	331
473	3300025945	Ga0207679_10066811	Ga0207679_100668111	331
474	3300026023	Ga0207677_10165123	Ga0207677_101651232	331
475	3300026095	Ga0207676_10019984	Ga0207676_100199844	331
476	3300031731	Ga0307405_10140430	Ga0307405_101404302	331
477	3300031911	Ga0307412_10001043	Ga0307412_1000104314	331
478	3300035171	Ga0373946_0100059	Ga0373946_0100059_116_1114	331
479	3300035725	Ga0373947_0041936	Ga0373947_0041936_1693_2706	331
480	3300041407	Ga0439447_007833	Ga0439447_007833_716_1729	331
481	3300046453	Ga0495627_012947	Ga0495627_012947_1139_2137	331
482	3300046458	Ga0495591_035649	Ga0495591_035649_287_1285	331
483	3300046512	Ga0495610_0001317	Ga0495610_0001317_9524_10525	331
484	3300046530	Ga0495654_0005434	Ga0495654_0005434_1990_2991	331
485	3300048911	Ga0496108_0167918	Ga0496108_0167918_487_1485	331
486	3300048913	Ga0496110_0037891	Ga0496110_0037891_280_1278	331
487	3300048919	Ga0496116_0032863	Ga0496116_0032863_649_1647	331
488	3300048920	Ga0496117_0043042	Ga0496117_0043042_742_1740	331
489	3300048921	Ga0496118_0004397	Ga0496118_0004397_1445_2443	331
490	3300048921	Ga0496118_0056586	Ga0496118_0056586_573_1571	331
491	3300048922	Ga0496119_0000053	Ga0496119_0000053_34770_35768	331
492	3300048923	Ga0496120_0003005	Ga0496120_0003005_2040_3038	331
493	3300048924	Ga0496121_0112145	Ga0496121_0112145_440_1438	331
494	3300048925	Ga0496122_0000806	Ga0496122_0000806_47204_48202	331
495	3300048925	Ga0496122_0062402	Ga0496122_0062402_1053_2051	331
496	3300048926	Ga0496123_0001020	Ga0496123_0001020_28980_29978	331
497	3300048926	Ga0496123_0042503	Ga0496123_0042503_276_1274	331
498	3300048927	Ga0496124_0024312	Ga0496124_0024312_3900_4898	331
499	3300048927	Ga0496124_0338042	Ga0496124_0338042_13_1011	331
500	3300048928	Ga0496125_0197316	Ga0496125_0197316_15_1013	331
501	3300048929	Ga0496126_0212736	Ga0496126_0212736_69_1067	331
502	2124908027	MRS2a_Contig_53	MRS2a_00409530	332
503	2162886007	SwRhRL2b_contig_1366508	SwRhRL2b_0892.00003490	332
504	2162886007	SwRhRL2b_contig_41922	SwRhRL2b_0780.00010990	332
505	2162886007	SwRhRL2b_contig_51000	SwRhRL2b_0269.00001030	332
506	2162886007	SwRhRL2b_contig_623336	SwRhRL2b_0786.00004670	332
507	3300002067	JGI24735J21928_10013344	JGI24735J21928_100133443	332
508	3300002737	JGI25162J39368_1000004	JGI25162J39368_1000004339	332
509	3300002737	JGI25162J39368_1000045	JGI25162J39368_1000045113	332
510	3300002739	JGI25158J39367_1001527	JGI25158J39367_10015275	332
511	3300002771	JGI25163J39215_1001144	JGI25163J39215_10011443	332
512	3300002771	JGI25163J39215_1001518	JGI25163J39215_10015183	332
513	3300002772	JGI25164J39214_1000026	JGI25164J39214_100002644	332
514	3300002772	JGI25164J39214_1000068	JGI25164J39214_100006847	332
515	3300002773	JGI25152J39213_1000073	JGI25152J39213_10000738	332
516	3300002774	JGI25150J39212_1000062	JGI25150J39212_10000628	332
517	3300002774	JGI25150J39212_1006965	JGI25150J39212_10069653	332
518	3300002987	JGI25159J45721_1000212	JGI25159J45721_100021232	332
519	3300002987	JGI25159J45721_1009535	JGI25159J45721_10095352	332
520	3300003187	JGI25151J46595_10000255	JGI25151J46595_1000025562	332
521	3300003214	JGI25165J46597_1000011	JGI25165J46597_1000011339	332
522	3300003214	JGI25165J46597_1000086	JGI25165J46597_1000086113	332
523	3300003215	JGI25153J46596_10000165	JGI25153J46596_100001658	332
524	3300003320	rootH2_10067062	rootH2_100670622	332
525	3300003323	rootH1_10081472	rootH1_100814728	332
526	3300003354	JGI25160J50197_1000410	JGI25160J50197_100041032	332
527	3300003374	JGI25161J50226_1000688	JGI25161J50226_10006888	332
528	3300003771	Ga0055526_1000146	Ga0055526_100014662	332
529	3300003771	Ga0055526_1001245	Ga0055526_10012456	332
530	3300003773	Ga0055537_1000090	Ga0055537_10000908	332
531	3300003773	Ga0055537_1000185	Ga0055537_100018512	332
532	3300003775	Ga0055524_1000195	Ga0055524_10001958	332
533	3300003781	Ga0055536_1000013	Ga0055536_1000013197	332
534	3300003781	Ga0055536_1000032	Ga0055536_100003285	332
535	3300003781	Ga0055536_1000398	Ga0055536_100039817	332
536	3300003781	Ga0055536_1013921	Ga0055536_10139212	332
537	3300003784	Ga0055534_1000101	Ga0055534_10001018	332
538	3300003784	Ga0055534_1000172	Ga0055534_100017217	332
539	3300003790	Ga0055528_1000111	Ga0055528_10001118	332
540	3300003790	Ga0055528_1001427	Ga0055528_100142712	332
541	3300003791	Ga0055530_10000004	Ga0055530_1000000434	332
542	3300003791	Ga0055530_10000029	Ga0055530_1000002985	332
543	3300003791	Ga0055530_10000062	Ga0055530_1000006275	332
544	3300003791	Ga0055530_10000648	Ga0055530_1000064821	332
545	3300003792	Ga0055540_1000008	Ga0055540_1000008244	332
546	3300003792	Ga0055540_1000017	Ga0055540_1000017169	332
547	3300003792	Ga0055540_1000166	Ga0055540_100016627	332
548	3300003792	Ga0055540_1003475	Ga0055540_10034756	332
549	3300003794	Ga0055531_10000242	Ga0055531_1000024226	332
550	3300003841	Ga0055541_1000279	Ga0055541_10002793	332
551	3300004625	Ga0055543_1000585	Ga0055543_100058528	332
552	3300005262	Ga0065165_1001334	Ga0065165_100133432	332
553	3300005288	Ga0065714_10000918	Ga0065714_100009182	332
554	3300005288	Ga0065714_10002302	Ga0065714_1000230223	332
555	3300005288	Ga0065714_10010287	Ga0065714_100102873	332
556	3300005289	Ga0065704_10021112	Ga0065704_100211122	332
557	3300005289	Ga0065704_10070262	Ga0065704_100702628	332
558	3300005289	Ga0065704_10071259	Ga0065704_1007125914	332
559	3300005289	Ga0065704_10073317	Ga0065704_100733174	332
560	3300005289	Ga0065704_10077761	Ga0065704_100777613	332
561	3300005289	Ga0065704_10095544	Ga0065704_100955442	332
562	3300005290	Ga0065712_10071558	Ga0065712_100715581	332
563	3300005290	Ga0065712_10129706	Ga0065712_101297061	332
564	3300005293	Ga0065715_10156801	Ga0065715_101568011	332
565	3300005331	Ga0070670_100000034	Ga0070670_10000003493	332
566	3300005331	Ga0070670_100000381	Ga0070670_10000038134	332
567	3300005334	Ga0068869_100178240	Ga0068869_1001782402	332
568	3300005344	Ga0070661_100000140	Ga0070661_10000014052	332
569	3300005353	Ga0070669_100000259	Ga0070669_10000025930	332
570	3300005456	Ga0070678_100025883	Ga0070678_1000258834	332
571	3300005457	Ga0070662_100002140	Ga0070662_10000214010	332
572	3300005563	Ga0068855_100063492	Ga0068855_1000634925	332
573	3300005564	Ga0070664_100000201	Ga0070664_10000020123	332
574	3300005564	Ga0070664_100032383	Ga0070664_1000323833	332
575	3300006038	Ga0075365_10003444	Ga0075365_100034448	332
576	3300006038	Ga0075365_10116853	Ga0075365_101168532	332
577	3300006051	Ga0075364_10128252	Ga0075364_101282521	332
578	3300006058	Ga0075432_10000821	Ga0075432_1000082115	332
579	3300006058	Ga0075432_10005619	Ga0075432_100056192	332
580	3300006178	Ga0075367_10082318	Ga0075367_100823182	332
581	3300006948	Ga0099826_10022319	Ga0099826_100223192	332
582	3300009011	Ga0105251_10000207	Ga0105251_1000020727	332
583	3300009011	Ga0105251_10008072	Ga0105251_100080723	332
584	3300009011	Ga0105251_10011506	Ga0105251_100115064	332
585	3300009011	Ga0105251_10028303	Ga0105251_100283031	332
586	3300009036	Ga0105244_10001462	Ga0105244_1000146219	332
587	3300009036	Ga0105244_10003328	Ga0105244_100033286	332
588	3300009036	Ga0105244_10008660	Ga0105244_100086602	332
589	3300009036	Ga0105244_10013572	Ga0105244_100135727	332
590	3300009036	Ga0105244_10018340	Ga0105244_100183404	332
591	3300009036	Ga0105244_10023151	Ga0105244_100231512	332
592	3300009036	Ga0105244_10024647	Ga0105244_100246472	332
593	3300009036	Ga0105244_10030690	Ga0105244_100306904	332
594	3300009036	Ga0105244_10031259	Ga0105244_100312592	332
595	3300009036	Ga0105244_10033000	Ga0105244_100330002	332
596	3300009036	Ga0105244_10141714	Ga0105244_101417141	332
597	3300009092	Ga0105250_10000353	Ga0105250_1000035310	332
598	3300009092	Ga0105250_10017372	Ga0105250_100173721	332
599	3300009092	Ga0105250_10045731	Ga0105250_100457312	332
600	3300009093	Ga0105240_10341144	Ga0105240_103411441	332
601	3300009148	Ga0105243_10000170	Ga0105243_1000017030	332
602	3300009148	Ga0105243_10000604	Ga0105243_1000060410	332
603	3300009148	Ga0105243_10002467	Ga0105243_1000246718	332
604	3300009148	Ga0105243_10044749	Ga0105243_100447493	332
605	3300009148	Ga0105243_10089683	Ga0105243_100896832	332
606	3300009176	Ga0105242_10002140	Ga0105242_100021407	332
607	3300009545	Ga0105237_10000413	Ga0105237_1000041342	332
608	3300009545	Ga0105237_10083475	Ga0105237_100834753	332
609	3300010375	Ga0105239_10062976	Ga0105239_100629764	332
610	3300010375	Ga0105239_10121819	Ga0105239_101218192	332
611	3300011119	Ga0105246_10000151	Ga0105246_1000015127	332
612	3300013100	Ga0157373_10002818	Ga0157373_100028183	332
613	3300013100	Ga0157373_10004724	Ga0157373_100047242	332
614	3300013100	Ga0157373_10014652	Ga0157373_100146526	332
615	3300013100	Ga0157373_10015520	Ga0157373_100155206	332
616	3300013100	Ga0157373_10061134	Ga0157373_100611342	332
617	3300013100	Ga0157373_10088366	Ga0157373_100883661	332
618	3300013100	Ga0157373_10106220	Ga0157373_101062203	332
619	3300013102	Ga0157371_10001339	Ga0157371_1000133910	332
620	3300013102	Ga0157371_10002985	Ga0157371_1000298510	332
621	3300013102	Ga0157371_10011312	Ga0157371_100113124	332
622	3300013102	Ga0157371_10017488	Ga0157371_100174883	332
623	3300013104	Ga0157370_10000070	Ga0157370_1000007043	332
624	3300013104	Ga0157370_10004641	Ga0157370_1000464113	332
625	3300013104	Ga0157370_10019782	Ga0157370_100197828	332
626	3300013104	Ga0157370_10068703	Ga0157370_100687032	332
627	3300013104	Ga0157370_10081653	Ga0157370_100816533	332
628	3300013104	Ga0157370_10153518	Ga0157370_101535182	332
629	3300013104	Ga0157370_10202775	Ga0157370_102027751	332
630	3300013104	Ga0157370_10215721	Ga0157370_102157212	332
631	3300013104	Ga0157370_10235891	Ga0157370_102358911	332
632	3300013105	Ga0157369_10004478	Ga0157369_100044783	332
633	3300013105	Ga0157369_10035026	Ga0157369_100350265	332
634	3300013105	Ga0157369_10056204	Ga0157369_100562043	332
635	3300013306	Ga0163162_10112114	Ga0163162_101121142	332
636	3300013306	Ga0163162_10132585	Ga0163162_101325852	332
637	3300013307	Ga0157372_10000821	Ga0157372_1000082110	332
638	3300013308	Ga0157375_10000466	Ga0157375_1000046621	332
639	3300013308	Ga0157375_10000987	Ga0157375_1000098714	332
640	3300014325	Ga0163163_10000163	Ga0163163_1000016351	332
641	3300014497	Ga0182008_10000429	Ga0182008_100004294	332
642	3300014497	Ga0182008_10007005	Ga0182008_100070057	332
643	3300014497	Ga0182008_10019916	Ga0182008_100199163	332
644	3300014497	Ga0182008_10069257	Ga0182008_100692572	332
645	3300015261	Ga0182006_1001013	Ga0182006_100101327	332
646	3300015261	Ga0182006_1005590	Ga0182006_10055902	332
647	3300015261	Ga0182006_1006763	Ga0182006_10067633	332
648	3300015261	Ga0182006_1006842	Ga0182006_10068426	332
649	3300015261	Ga0182006_1007269	Ga0182006_10072692	332
650	3300015261	Ga0182006_1012336	Ga0182006_10123362	332
651	3300015262	Ga0182007_10000766	Ga0182007_1000076627	332
652	3300015262	Ga0182007_10026034	Ga0182007_100260342	332
653	3300015265	Ga0182005_1000355	Ga0182005_10003552	332
654	3300015265	Ga0182005_1000891	Ga0182005_10008912	332
655	3300015265	Ga0182005_1002698	Ga0182005_10026987	332
656	3300015265	Ga0182005_1010563	Ga0182005_10105632	332
657	3300015265	Ga0182005_1025501	Ga0182005_10255012	332
658	3300017792	Ga0163161_10006451	Ga0163161_100064513	332
659	3300017792	Ga0163161_10007535	Ga0163161_100075358	332
660	3300017792	Ga0163161_10011334	Ga0163161_100113344	332
661	3300017792	Ga0163161_10022604	Ga0163161_100226044	332
662	3300017792	Ga0163161_10024161	Ga0163161_100241615	332
663	3300017792	Ga0163161_10028069	Ga0163161_100280694	332
664	3300017792	Ga0163161_10030055	Ga0163161_100300554	332
665	3300017792	Ga0163161_10058097	Ga0163161_100580972	332
666	3300025207	Ga0209760_100019	Ga0209760_10001956	332
667	3300025207	Ga0209760_100105	Ga0209760_10010559	332
668	3300025208	Ga0209436_100619	Ga0209436_10061916	332
669	3300025231	Ga0207427_100003	Ga0207427_100003337	332
670	3300025231	Ga0207427_100011	Ga0207427_10001156	332
671	3300025233	Ga0209437_100002	Ga0209437_100002676	332
672	3300025233	Ga0209437_100044	Ga0209437_10004456	332
673	3300025245	Ga0207425_1000042	Ga0207425_100004285	332
674	3300025245	Ga0207425_1004551	Ga0207425_10045513	332
675	3300025250	Ga0209026_1002815	Ga0209026_10028151	332
676	3300025258	Ga0209129_1000058	Ga0209129_100005891	332
677	3300025261	Ga0209233_1000004	Ga0209233_1000004749	332
678	3300025261	Ga0209233_1000057	Ga0209233_100005756	332
679	3300025263	Ga0209565_1000024	Ga0209565_100002476	332
680	3300025263	Ga0209565_1000027	Ga0209565_1000027106	332
681	3300025273	Ga0209673_1000031	Ga0209673_100003196	332
682	3300025273	Ga0209673_1000237	Ga0209673_100023770	332
683	3300025284	Ga0209130_1000025	Ga0209130_1000025148	332
684	3300025291	Ga0209675_1000011	Ga0209675_100001134	332
685	3300025291	Ga0209675_1000064	Ga0209675_100006480	332
686	3300025291	Ga0209675_1002987	Ga0209675_10029872	332
687	3300025292	Ga0209676_1000002	Ga0209676_10000021328	332
688	3300025292	Ga0209676_1000003	Ga0209676_10000031038	332
689	3300025292	Ga0209676_1000120	Ga0209676_100012012	332
690	3300025292	Ga0209676_1000190	Ga0209676_100019040	332
691	3300025292	Ga0209676_1001065	Ga0209676_10010654	332
692	3300025292	Ga0209676_1001876	Ga0209676_10018766	332
693	3300025292	Ga0209676_1003558	Ga0209676_10035581	332
694	3300025294	Ga0209025_1000075	Ga0209025_1000075201	332
695	3300025295	Ga0209564_1000040	Ga0209564_1000040189	332
696	3300025295	Ga0209564_1000490	Ga0209564_100049030	332
697	3300025297	Ga0209758_1000050	Ga0209758_1000050249	332
698	3300025298	Ga0209050_1000004	Ga0209050_10000041020	332
699	3300025298	Ga0209050_1000006	Ga0209050_1000006242	332
700	3300025298	Ga0209050_1000037	Ga0209050_100003733	332
701	3300025298	Ga0209050_1000536	Ga0209050_100053633	332
702	3300025298	Ga0209050_1025227	Ga0209050_10252272	332
703	3300025298	Ga0209050_1028072	Ga0209050_10280722	332
704	3300025299	Ga0209256_1000023	Ga0209256_1000023249	332
705	3300025299	Ga0209256_1004393	Ga0209256_10043935	332
706	3300025302	Ga0207426_1000118	Ga0207426_1000118137	332
707	3300025303	Ga0209051_1000001	Ga0209051_10000011328	332
708	3300025303	Ga0209051_1000040	Ga0209051_100004034	332
709	3300025303	Ga0209051_1000052	Ga0209051_1000052235	332
710	3300025303	Ga0209051_1001497	Ga0209051_100149717	332
711	3300025304	Ga0209257_1000029	Ga0209257_1000029242	332
712	3300025304	Ga0209257_1000188	Ga0209257_100018894	332
713	3300025304	Ga0209257_1002953	Ga0209257_100295311	332
714	3300025321	Ga0207656_10000034	Ga0207656_100000341	332
715	3300025711	Ga0207696_1000002	Ga0207696_1000002339	332
716	3300025711	Ga0207696_1000108	Ga0207696_1000108103	332
717	3300025711	Ga0207696_1002028	Ga0207696_10020283	332
718	3300025711	Ga0207696_1011178	Ga0207696_10111781	332
719	3300025728	Ga0207655_1000140	Ga0207655_100014057	332
720	3300025728	Ga0207655_1000141	Ga0207655_1000141155	332
721	3300025728	Ga0207655_1000520	Ga0207655_100052041	332
722	3300025728	Ga0207655_1002113	Ga0207655_100211312	332
723	3300025728	Ga0207655_1006557	Ga0207655_10065574	332
724	3300025728	Ga0207655_1007497	Ga0207655_10074976	332
725	3300025728	Ga0207655_1011607	Ga0207655_10116074	332
726	3300025728	Ga0207655_1021576	Ga0207655_10215764	332
727	3300025728	Ga0207655_1022375	Ga0207655_10223752	332
728	3300025735	Ga0207713_1000122	Ga0207713_100012284	332
729	3300025735	Ga0207713_1001144	Ga0207713_10011443	332
730	3300025735	Ga0207713_1001298	Ga0207713_100129815	332
731	3300025735	Ga0207713_1006129	Ga0207713_10061292	332
732	3300025735	Ga0207713_1007532	Ga0207713_10075322	332
733	3300025735	Ga0207713_1007837	Ga0207713_10078376	332
734	3300025735	Ga0207713_1007845	Ga0207713_10078456	332
735	3300025913	Ga0207695_10241289	Ga0207695_102412892	332
736	3300025914	Ga0207671_10001061	Ga0207671_1000106140	332
737	3300025914	Ga0207671_10058842	Ga0207671_100588421	332
738	3300025915	Ga0207693_10005229	Ga0207693_1000522911	332
739	3300025920	Ga0207649_10000183	Ga0207649_1000018311	332
740	3300025923	Ga0207681_10000215	Ga0207681_1000021527	332
741	3300025925	Ga0207650_10000066	Ga0207650_1000006693	332
742	3300025925	Ga0207650_10000272	Ga0207650_1000027211	332
743	3300025933	Ga0207706_10007035	Ga0207706_100070355	332
744	3300025933	Ga0207706_10021587	Ga0207706_100215871	332
745	3300025934	Ga0207686_10023090	Ga0207686_100230903	332
746	3300025935	Ga0207709_10000004	Ga0207709_10000004614	332
747	3300025935	Ga0207709_10000411	Ga0207709_1000041110	332
748	3300025935	Ga0207709_10004673	Ga0207709_100046732	332
749	3300025935	Ga0207709_10025258	Ga0207709_100252583	332
750	3300025935	Ga0207709_10037848	Ga0207709_100378482	332
751	3300025935	Ga0207709_10039430	Ga0207709_100394303	332
752	3300025935	Ga0207709_10133198	Ga0207709_101331982	332
753	3300025945	Ga0207679_10000016	Ga0207679_10000016108	332
754	3300025945	Ga0207679_10010647	Ga0207679_100106475	332
755	3300025945	Ga0207679_10150036	Ga0207679_101500362	332
756	3300025986	Ga0207658_10136774	Ga0207658_101367742	332
757	3300026041	Ga0207639_10066713	Ga0207639_100667131	332
758	3300026116	Ga0207674_10055336	Ga0207674_100553362	332
759	3300026121	Ga0207683_10046840	Ga0207683_100468403	332
760	3300027111	Ga0209281_1006092	Ga0209281_10060923	332
761	3300027907	Ga0207428_10023325	Ga0207428_100233254	332
762	3300028794	Ga0307515_10137656	Ga0307515_101376562	332
763	3300030735	Ga0316178_1157838	Ga0316178_11578386	332
764	3300030744	Ga0316181_1238654	Ga0316181_12386543	332
765	3300031548	Ga0307408_100001576	Ga0307408_1000015765	332
766	3300031548	Ga0307408_100003629	Ga0307408_1000036298	332
767	3300031548	Ga0307408_100008360	Ga0307408_1000083604	332
768	3300031548	Ga0307408_100031974	Ga0307408_1000319743	332
769	3300031731	Ga0307405_10000137	Ga0307405_1000013721	332
770	3300031731	Ga0307405_10040077	Ga0307405_100400772	332
771	3300031731	Ga0307405_10044327	Ga0307405_100443272	332
772	3300031731	Ga0307405_10114110	Ga0307405_101141102	332
773	3300031731	Ga0307405_10119124	Ga0307405_101191242	332
774	3300031852	Ga0307410_10121573	Ga0307410_101215732	332
775	3300031901	Ga0307406_10008975	Ga0307406_100089754	332
776	3300031911	Ga0307412_10000124	Ga0307412_1000012443	332
777	3300031911	Ga0307412_10144534	Ga0307412_101445342	332
778	3300032004	Ga0307414_10199159	Ga0307414_101991592	332
779	3300032005	Ga0307411_10020132	Ga0307411_100201325	332
780	3300037471	Ga0395905_0006135	Ga0395905_0006135_11100_12119	332
781	3300038705	Ga0237819_01805	Ga0237819_01805_1918_2916	332
782	3300041405	Ga0439438_000390	Ga0439438_000390_5773_6771	332
783	3300041405	Ga0439438_000979	Ga0439438_000979_6312_7328	332
784	3300041405	Ga0439438_001292	Ga0439438_001292_9557_10657	332
785	3300041405	Ga0439438_002520	Ga0439438_002520_2087_3085	332
786	3300041405	Ga0439438_021516	Ga0439438_021516_687_1688	332
787	3300041407	Ga0439447_015203	Ga0439447_015203_662_1660	332
788	3300041411	Ga0439466_0000184	Ga0439466_0000184_13727_14725	332
789	3300041411	Ga0439466_0000514	Ga0439466_0000514_9097_10098	332
790	3300041411	Ga0439466_0001065	Ga0439466_0001065_4180_5280	332
791	3300041411	Ga0439466_0003466	Ga0439466_0003466_4580_5596	332
792	3300041411	Ga0439466_0005163	Ga0439466_0005163_3722_4720	332
793	3300041413	Ga0439465_0002423	Ga0439465_0002423_465_1463	332
794	3300041997	Ga0439431_0000048	Ga0439431_0000048_6062_7060	332
795	3300042004	Ga0439445_0002382	Ga0439445_0002382_1832_2830	332
796	3300042006	Ga0439432_000667	Ga0439432_000667_11738_12736	332
797	3300042006	Ga0439432_001831	Ga0439432_001831_3437_4444	332
798	3300042006	Ga0439432_004610	Ga0439432_004610_898_1899	332
799	3300042009	Ga0439451_000431	Ga0439451_000431_3419_4426	332
800	3300042009	Ga0439451_007241	Ga0439451_007241_383_1384	332
801	3300042010	Ga0439452_000024	Ga0439452_000024_82287_83303	332
802	3300042010	Ga0439452_001785	Ga0439452_001785_3940_4947	332
803	3300042010	Ga0439452_003858	Ga0439452_003858_454_1452	332
804	3300042010	Ga0439452_004120	Ga0439452_004120_1740_2738	332
805	3300042010	Ga0439452_008576	Ga0439452_008576_1186_2184	332
806	3300042013	Ga0439456_003890	Ga0439456_003890_1627_2643	332
807	3300042013	Ga0439456_004728	Ga0439456_004728_434_1435	332
808	3300042013	Ga0439456_010726	Ga0439456_010726_261_1277	332
809	3300042016	Ga0439463_013919	Ga0439463_013919_109_1125	332
810	3300042016	Ga0439463_026516	Ga0439463_026516_95_1093	332
811	3300042115	Ga0450911_000030	Ga0450911_000030_26222_27238	332
812	3300042115	Ga0450911_000070	Ga0450911_000070_5963_6985	332
813	3300042115	Ga0450911_000297	Ga0450911_000297_15756_16754	332
814	3300042115	Ga0450911_001667	Ga0450911_001667_2305_3303	332
815	3300042121	Ga0450919_000226	Ga0450919_000226_5108_6106	332
816	3300042122	Ga0450920_003671	Ga0450920_003671_116_1114	332
817	3300042124	Ga0450922_000576	Ga0450922_000576_1108_2106	332
818	3300042134	Ga0450898_001443	Ga0450898_001443_646_1644	332
819	3300042138	Ga0450903_003413	Ga0450903_003413_980_1978	332
820	3300042139	Ga0450904_001386	Ga0450904_001386_440_1456	332
821	3300042145	Ga0450906_000016	Ga0450906_000016_2090_3106	332
822	3300042145	Ga0450906_002462	Ga0450906_002462_2819_3817	332
823	3300042146	Ga0450907_000039	Ga0450907_000039_17305_18303	332
824	3300042146	Ga0450907_001750	Ga0450907_001750_2500_3501	332
825	3300042146	Ga0450907_005465	Ga0450907_005465_503_1501	332
826	3300042147	Ga0450910_000003	Ga0450910_000003_41463_42461	332
827	3300042147	Ga0450910_003972	Ga0450910_003972_895_1893	332
828	3300042156	Ga0439446_0000458	Ga0439446_0000458_2299_3297	332
829	3300042156	Ga0439446_0011200	Ga0439446_0011200_1140_2141	332
830	3300042184	Ga0450908_000492	Ga0450908_000492_2236_3234	332
831	3300042184	Ga0450908_004043	Ga0450908_004043_949_1947	332
832	3300042185	Ga0450909_001586	Ga0450909_001586_1116_2117	332
833	3300042185	Ga0450909_006888	Ga0450909_006888_41_1039	332
834	3300042435	Ga0439434_0000441	Ga0439434_0000441_2479_3480	332
835	3300042435	Ga0439434_0071416	Ga0439434_0071416_10_1008	332
836	3300042439	Ga0439464_0016003	Ga0439464_0016003_487_1485	332
837	3300042533	Ga0450901_000416	Ga0450901_000416_1394_2392	332
838	3300042993	Ga0439440_0000389	Ga0439440_0000389_2407_3408	332
839	3300042993	Ga0439440_0006241	Ga0439440_0006241_994_1995	332
840	3300045051	Ga0451576_0009888	Ga0451576_0009888_3547_4548	332
841	3300046452	Ga0495617_001900	Ga0495617_001900_433_1431	332
842	3300046452	Ga0495617_004806	Ga0495617_004806_3534_4532	332
843	3300046452	Ga0495617_013438	Ga0495617_013438_516_1589	332
844	3300046452	Ga0495617_019900	Ga0495617_019900_66_1064	332
845	3300046453	Ga0495627_000271	Ga0495627_000271_38211_39209	332
846	3300046453	Ga0495627_000538	Ga0495627_000538_28109_29161	332
847	3300046454	Ga0495592_0027191	Ga0495592_0027191_1174_2226	332
848	3300046457	Ga0495590_0000153	Ga0495590_0000153_17065_18132	332
849	3300046457	Ga0495590_0006220	Ga0495590_0006220_3126_4124	332
850	3300046457	Ga0495590_0006342	Ga0495590_0006342_2389_3390	332
851	3300046458	Ga0495591_000139	Ga0495591_000139_5721_6773	332
852	3300046458	Ga0495591_000144	Ga0495591_000144_13907_14905	332
853	3300046458	Ga0495591_000277	Ga0495591_000277_40126_41124	332
854	3300046458	Ga0495591_000834	Ga0495591_000834_19331_20329	332
855	3300046458	Ga0495591_009352	Ga0495591_009352_2239_3237	332
856	3300046458	Ga0495591_011664	Ga0495591_011664_885_1883	332
857	3300046459	Ga0495629_0006452	Ga0495629_0006452_306_1304	332
858	3300046460	Ga0495638_0000124	Ga0495638_0000124_89630_90631	332
859	3300046460	Ga0495638_0002792	Ga0495638_0002792_7143_8210	332
860	3300046460	Ga0495638_0022269	Ga0495638_0022269_3096_4094	332
861	3300046460	Ga0495638_0133487	Ga0495638_0133487_418_1416	332
862	3300046462	Ga0495651_0000663	Ga0495651_0000663_15919_16923	332
863	3300046463	Ga0495653_0003966	Ga0495653_0003966_6818_7819	332
864	3300046463	Ga0495653_0024563	Ga0495653_0024563_2441_3493	332
865	3300046463	Ga0495653_0070855	Ga0495653_0070855_1253_2326	332
866	3300046463	Ga0495653_0173785	Ga0495653_0173785_451_1449	332
867	3300046471	Ga0495650_0001218	Ga0495650_0001218_9603_10601	332
868	3300046471	Ga0495650_0001374	Ga0495650_0001374_5876_6949	332
869	3300046472	Ga0495580_0019261	Ga0495580_0019261_1332_2333	332
870	3300046473	Ga0495582_0008582	Ga0495582_0008582_2829_3827	332
871	3300046474	Ga0495605_0001055	Ga0495605_0001055_8866_9864	332
872	3300046474	Ga0495605_0002751	Ga0495605_0002751_8331_9347	332
873	3300046474	Ga0495605_0007746	Ga0495605_0007746_3224_4276	332
874	3300046475	Ga0495639_0000066	Ga0495639_0000066_2261_3259	332
875	3300046491	Ga0495584_0000352	Ga0495584_0000352_16951_17949	332
876	3300046491	Ga0495584_0000362	Ga0495584_0000362_8812_9816	332
877	3300046491	Ga0495584_0073339	Ga0495584_0073339_544_1545	332
878	3300046492	Ga0495585_0000054	Ga0495585_0000054_6543_7541	332
879	3300046492	Ga0495585_0012751	Ga0495585_0012751_3749_4747	332
880	3300046492	Ga0495585_0018499	Ga0495585_0018499_2380_3432	332
881	3300046492	Ga0495585_0020167	Ga0495585_0020167_1265_2338	332
882	3300046492	Ga0495585_0035717	Ga0495585_0035717_1047_2045	332
883	3300046499	Ga0495594_0005760	Ga0495594_0005760_828_1826	332
884	3300046499	Ga0495594_0015269	Ga0495594_0015269_2644_3642	332
885	3300046501	Ga0495607_0000259	Ga0495607_0000259_38392_39459	332
886	3300046501	Ga0495607_0000768	Ga0495607_0000768_6436_7452	332
887	3300046501	Ga0495607_0003561	Ga0495607_0003561_7043_8116	332
888	3300046501	Ga0495607_0015873	Ga0495607_0015873_1096_2100	332
889	3300046501	Ga0495607_0018449	Ga0495607_0018449_2324_3325	332
890	3300046501	Ga0495607_0021884	Ga0495607_0021884_2785_3783	332
891	3300046501	Ga0495607_0037588	Ga0495607_0037588_1508_2506	332
892	3300046507	Ga0495606_0002688	Ga0495606_0002688_5283_6284	332
893	3300046507	Ga0495606_0003459	Ga0495606_0003459_1824_2822	332
894	3300046507	Ga0495606_0024048	Ga0495606_0024048_1723_2721	332
895	3300046511	Ga0495608_0051896	Ga0495608_0051896_1429_2433	332
896	3300046512	Ga0495610_0000564	Ga0495610_0000564_22218_23216	332
897	3300046512	Ga0495610_0037474	Ga0495610_0037474_1119_2120	332
898	3300046513	Ga0495616_0000101	Ga0495616_0000101_66714_67766	332
899	3300046513	Ga0495616_0000142	Ga0495616_0000142_35438_36454	332
900	3300046513	Ga0495616_0000203	Ga0495616_0000203_31206_32273	332
901	3300046513	Ga0495616_0000938	Ga0495616_0000938_14812_15816	332
902	3300046513	Ga0495616_0013082	Ga0495616_0013082_393_1391	332
903	3300046515	Ga0495620_0021167	Ga0495620_0021167_1346_2398	332
904	3300046516	Ga0495628_0013219	Ga0495628_0013219_46_1050	332
905	3300046516	Ga0495628_0034474	Ga0495628_0034474_1070_2068	332
906	3300046517	Ga0495630_0011955	Ga0495630_0011955_3899_4897	332
907	3300046517	Ga0495630_0018426	Ga0495630_0018426_812_1810	332
908	3300046517	Ga0495630_0024105	Ga0495630_0024105_1449_2447	332
909	3300046518	Ga0495631_0000793	Ga0495631_0000793_2724_3725	332
910	3300046518	Ga0495631_0010567	Ga0495631_0010567_2021_3019	332
911	3300046518	Ga0495631_0019664	Ga0495631_0019664_28_1026	332
912	3300046519	Ga0495632_0001558	Ga0495632_0001558_14137_15135	332
913	3300046519	Ga0495632_0002308	Ga0495632_0002308_4748_5746	332
914	3300046519	Ga0495632_0011725	Ga0495632_0011725_127_1128	332
915	3300046519	Ga0495632_0015974	Ga0495632_0015974_1977_3029	332
916	3300046520	Ga0495637_0005411	Ga0495637_0005411_175_1173	332
917	3300046520	Ga0495637_0068647	Ga0495637_0068647_181_1179	332
918	3300046520	Ga0495637_0068650	Ga0495637_0068650_257_1255	332
919	3300046522	Ga0495643_0026570	Ga0495643_0026570_726_1724	332
920	3300046522	Ga0495643_0053632	Ga0495643_0053632_113_1165	332
921	3300046523	Ga0495644_0000030	Ga0495644_0000030_29695_30699	332
922	3300046524	Ga0495648_0000042	Ga0495648_0000042_45855_46937	332
923	3300046524	Ga0495648_0000495	Ga0495648_0000495_30238_31236	332
924	3300046524	Ga0495648_0001223	Ga0495648_0001223_10554_11552	332
925	3300046524	Ga0495648_0013854	Ga0495648_0013854_2805_3803	332
926	3300046524	Ga0495648_0018323	Ga0495648_0018323_937_1989	332
927	3300046524	Ga0495648_0023915	Ga0495648_0023915_2783_3781	332
928	3300046524	Ga0495648_0045858	Ga0495648_0045858_884_1882	332
929	3300046524	Ga0495648_0062020	Ga0495648_0062020_272_1270	332
930	3300046525	Ga0495663_0000553	Ga0495663_0000553_9831_10832	332
931	3300046526	Ga0495666_0004144	Ga0495666_0004144_4672_5670	332
932	3300046526	Ga0495666_0013970	Ga0495666_0013970_744_1796	332
933	3300046526	Ga0495666_0051174	Ga0495666_0051174_252_1250	332
934	3300046526	Ga0495666_0087408	Ga0495666_0087408_48_1121	332
935	3300046528	Ga0495642_0000082	Ga0495642_0000082_30730_31728	332
936	3300046529	Ga0495652_0006428	Ga0495652_0006428_479_1483	332
937	3300046530	Ga0495654_0000145	Ga0495654_0000145_5966_7018	332
938	3300046530	Ga0495654_0038118	Ga0495654_0038118_854_1852	332
939	3300046530	Ga0495654_0089785	Ga0495654_0089785_272_1270	332
940	3300046535	Ga0495586_0048065	Ga0495586_0048065_457_1455	332
941	3300046536	Ga0495587_0000089	Ga0495587_0000089_64926_65999	332
942	3300046536	Ga0495587_0040621	Ga0495587_0040621_1279_2331	332
943	3300046538	Ga0495609_0000198	Ga0495609_0000198_35438_36454	332
944	3300046538	Ga0495609_0000316	Ga0495609_0000316_21805_22803	332
945	3300046538	Ga0495609_0008107	Ga0495609_0008107_2949_4001	332
946	3300046539	Ga0495621_0020479	Ga0495621_0020479_876_1877	332
947	3300046542	Ga0495597_0000792	Ga0495597_0000792_1629_2627	332
948	3300046543	Ga0495645_0049680	Ga0495645_0049680_840_1892	332
949	3300046543	Ga0495645_0057111	Ga0495645_0057111_1476_2474	332
950	3300046543	Ga0495645_0086614	Ga0495645_0086614_496_1590	332
951	3300046557	Ga0495622_0000922	Ga0495622_0000922_13435_14433	332
952	3300046557	Ga0495622_0005762	Ga0495622_0005762_487_1485	332
953	3300046558	Ga0495633_0000181	Ga0495633_0000181_30150_31154	332
954	3300046558	Ga0495633_0001936	Ga0495633_0001936_1150_2151	332
955	3300046558	Ga0495633_0002253	Ga0495633_0002253_12160_13164	332
956	3300046615	Ga0495656_0009096	Ga0495656_0009096_401_1399	332
957	3300046615	Ga0495656_0012951	Ga0495656_0012951_553_1551	332
958	3300046615	Ga0495656_0042127	Ga0495656_0042127_578_1582	332
959	3300046615	Ga0495656_0087099	Ga0495656_0087099_121_1122	332
960	3300046616	Ga0495668_0004783	Ga0495668_0004783_6793_7791	332
961	3300046642	Ga0495634_0001522	Ga0495634_0001522_17194_18267	332
962	3300046642	Ga0495634_0027195	Ga0495634_0027195_709_1761	332
963	3300046648	Ga0495611_0003059	Ga0495611_0003059_5601_6602	332
964	3300046648	Ga0495611_0014576	Ga0495611_0014576_1218_2216	332
965	3300046660	Ga0495625_0005136	Ga0495625_0005136_6152_7150	332
966	3300046660	Ga0495625_0006501	Ga0495625_0006501_3968_4966	332
967	3300046660	Ga0495625_0007517	Ga0495625_0007517_5388_6389	332
968	3300046660	Ga0495625_0018045	Ga0495625_0018045_2016_3017	332
969	3300046660	Ga0495625_0107075	Ga0495625_0107075_456_1454	332
970	3300046663	Ga0495635_0004174	Ga0495635_0004174_8504_9502	332
971	3300046665	Ga0495661_0000037	Ga0495661_0000037_4392_5390	332
972	3300046665	Ga0495661_0000047	Ga0495661_0000047_65592_66590	332
973	3300046665	Ga0495661_0000660	Ga0495661_0000660_26273_27289	332
974	3300046665	Ga0495661_0002600	Ga0495661_0002600_7497_8495	332
975	3300046665	Ga0495661_0036432	Ga0495661_0036432_546_1550	332
976	3300046665	Ga0495661_0071839	Ga0495661_0071839_310_1314	332
977	3300046665	Ga0495661_0110781	Ga0495661_0110781_396_1394	332
978	3300046674	Ga0495588_0030158	Ga0495588_0030158_528_1526	332
979	3300046679	Ga0495623_0000644	Ga0495623_0000644_20767_21798	332
980	3300046679	Ga0495623_0019679	Ga0495623_0019679_2759_3763	332
981	3300046680	Ga0495646_0001803	Ga0495646_0001803_7631_8704	332
982	3300046680	Ga0495646_0001903	Ga0495646_0001903_10272_11366	332
983	3300046680	Ga0495646_0006219	Ga0495646_0006219_3952_4950	332
984	3300046680	Ga0495646_0026663	Ga0495646_0026663_367_1419	332
985	3300046684	Ga0495669_0000895	Ga0495669_0000895_2678_3676	332
986	3300046689	Ga0495613_0004820	Ga0495613_0004820_27_1025	332
987	3300046689	Ga0495613_0023754	Ga0495613_0023754_1314_2366	332
988	3300046690	Ga0495624_0001651	Ga0495624_0001651_13302_14303	332
989	3300046690	Ga0495624_0005155	Ga0495624_0005155_2461_3513	332
990	3300046691	Ga0495670_0000053	Ga0495670_0000053_47477_48481	332
991	3300046691	Ga0495670_0000722	Ga0495670_0000722_4347_5345	332
992	3300046691	Ga0495670_0027684	Ga0495670_0027684_1184_2182	332
993	3300046691	Ga0495670_0038522	Ga0495670_0038522_798_1796	332
994	3300046692	Ga0495671_0000160	Ga0495671_0000160_16542_17540	332
995	3300046692	Ga0495671_0003635	Ga0495671_0003635_1844_2842	332
996	3300046692	Ga0495671_0006086	Ga0495671_0006086_208_1275	332
997	3300046692	Ga0495671_0007838	Ga0495671_0007838_3189_4229	332
998	3300046692	Ga0495671_0008889	Ga0495671_0008889_1750_2748	332
999	3300046692	Ga0495671_0013022	Ga0495671_0013022_3029_4027	332
1000	3300046694	Ga0495649_0004478	Ga0495649_0004478_4883_5935	332
1001	3300046694	Ga0495649_0007192	Ga0495649_0007192_1305_2303	332
1002	3300046794	Ga0495589_0000168	Ga0495589_0000168_35300_36316	332
1003	3300046794	Ga0495589_0003672	Ga0495589_0003672_3457_4455	332
1004	3300046809	Ga0495600_0040139	Ga0495600_0040139_2016_3014	332
1005	3300046809	Ga0495600_0088543	Ga0495600_0088543_367_1419	332
1006	3300046810	Ga0495660_0001910	Ga0495660_0001910_721_1719	332
1007	3300046810	Ga0495660_0008826	Ga0495660_0008826_3298_4371	332
1008	3300046810	Ga0495660_0039539	Ga0495660_0039539_643_1641	332
1009	3300047315	Ga0495581_0084142	Ga0495581_0084142_582_1580	332
1010	3300047317	Ga0495604_0002079	Ga0495604_0002079_6218_7222	332
1011	3300047317	Ga0495604_0082637	Ga0495604_0082637_1191_2243	332
1012	3300047319	Ga0495674_0002864	Ga0495674_0002864_2337_3338	332
1013	3300047320	Ga0495672_0006019	Ga0495672_0006019_2531_3583	332
1014	3300047320	Ga0495672_0013454	Ga0495672_0013454_3936_4934	332
1015	3300047321	Ga0495676_0002798	Ga0495676_0002798_4570_5568	332
1016	3300047321	Ga0495676_0031920	Ga0495676_0031920_1229_2281	332
1017	3300047322	Ga0495680_0002988	Ga0495680_0002988_14175_15173	332
1018	3300047322	Ga0495680_0045953	Ga0495680_0045953_518_1570	332
1019	3300047323	Ga0495683_0000022	Ga0495683_0000022_80433_81431	332
1020	3300047323	Ga0495683_0000268	Ga0495683_0000268_3967_4965	332
1021	3300047323	Ga0495683_0012180	Ga0495683_0012180_983_1981	332
1022	3300047323	Ga0495683_0013807	Ga0495683_0013807_2118_3116	332
1023	3300047323	Ga0495683_0019719	Ga0495683_0019719_1126_2178	332
1024	3300047323	Ga0495683_0033186	Ga0495683_0033186_1210_2283	332
1025	3300047443	Ga0495687_000313	Ga0495687_000313_26133_27149	332
1026	3300047443	Ga0495687_000784	Ga0495687_000784_4305_5303	332
1027	3300047443	Ga0495687_000983	Ga0495687_000983_1297_2370	332
1028	3300047444	Ga0495675_0027384	Ga0495675_0027384_2337_3341	332
1029	3300047445	Ga0495677_0000062	Ga0495677_0000062_23912_24928	332
1030	3300047445	Ga0495677_0001731	Ga0495677_0001731_1708_2706	332
1031	3300047445	Ga0495677_0014185	Ga0495677_0014185_1568_2572	332
1032	3300047446	Ga0495679_002750	Ga0495679_002750_1455_2453	332
1033	3300047446	Ga0495679_003259	Ga0495679_003259_4690_5688	332
1034	3300047446	Ga0495679_005202	Ga0495679_005202_2952_4004	332
1035	3300047469	Ga0495673_0001186	Ga0495673_0001186_2175_3173	332
1036	3300047469	Ga0495673_0003466	Ga0495673_0003466_1824_2822	332
1037	3300047469	Ga0495673_0004351	Ga0495673_0004351_1546_2544	332
1038	3300047469	Ga0495673_0005975	Ga0495673_0005975_1454_2452	332
1039	3300047469	Ga0495673_0023924	Ga0495673_0023924_1790_2788	332
1040	3300047469	Ga0495673_0036997	Ga0495673_0036997_553_1551	332
1041	3300047470	Ga0495681_0000109	Ga0495681_0000109_17047_18114	332
1042	3300047470	Ga0495681_0020517	Ga0495681_0020517_2090_3088	332
1043	3300047470	Ga0495681_0029657	Ga0495681_0029657_1743_2741	332
1044	3300047470	Ga0495681_0062262	Ga0495681_0062262_380_1378	332
1045	3300047471	Ga0495684_0036953	Ga0495684_0036953_2138_3190	332
1046	3300047472	Ga0495686_0000378	Ga0495686_0000378_66560_67633	332
1047	3300047472	Ga0495686_0009549	Ga0495686_0009549_2756_3757	332
1048	3300047472	Ga0495686_0144381	Ga0495686_0144381_134_1132	332
1049	3300047673	Ga0495593_0001352	Ga0495593_0001352_10872_11873	332
1050	3300047673	Ga0495593_0027915	Ga0495593_0027915_705_1703	332
1051	3300047673	Ga0495593_0028976	Ga0495593_0028976_442_1494	332
1052	3300047673	Ga0495593_0152009	Ga0495593_0152009_124_1122	332
1053	3300048088	Ga0495602_0036190	Ga0495602_0036190_1329_2381	332
1054	3300048088	Ga0495602_0167434	Ga0495602_0167434_185_1189	332
1055	3300048089	Ga0495614_0089077	Ga0495614_0089077_325_1323	332
1056	3300048091	Ga0495626_0000224	Ga0495626_0000224_1318_2391	332
1057	3300048091	Ga0495626_0000253	Ga0495626_0000253_36152_37168	332
1058	3300048091	Ga0495626_0000671	Ga0495626_0000671_28904_29956	332
1059	3300048091	Ga0495626_0001614	Ga0495626_0001614_4956_5954	332
1060	3300048091	Ga0495626_0083670	Ga0495626_0083670_85_1158	332
1061	3300048904	Ga0496101_0193780	Ga0496101_0193780_180_1181	332
1062	3300048905	Ga0496102_0000038	Ga0496102_0000038_73270_74343	332
1063	3300048905	Ga0496102_0109912	Ga0496102_0109912_1011_2012	332
1064	3300048907	Ga0496104_0096303	Ga0496104_0096303_1487_2491	332
1065	3300048913	Ga0496110_0166587	Ga0496110_0166587_944_1942	332
1066	3300048914	Ga0496111_0145917	Ga0496111_0145917_355_1353	332
1067	3300048916	Ga0496113_0021009	Ga0496113_0021009_2394_3416	332
1068	3300048917	Ga0496114_0315074	Ga0496114_0315074_200_1201	332
1069	3300048918	Ga0496115_0000044	Ga0496115_0000044_72848_73849	332
1070	3300048919	Ga0496116_0000038	Ga0496116_0000038_87976_88974	332
1071	3300048919	Ga0496116_0000081	Ga0496116_0000081_111803_112825	332
1072	3300048919	Ga0496116_0000312	Ga0496116_0000312_5789_6862	332
1073	3300048919	Ga0496116_0000593	Ga0496116_0000593_16256_17257	332
1074	3300048919	Ga0496116_0000630	Ga0496116_0000630_41008_42009	332
1075	3300048919	Ga0496116_0000646	Ga0496116_0000646_13126_14124	332
1076	3300048919	Ga0496116_0001263	Ga0496116_0001263_1987_3126	332
1077	3300048919	Ga0496116_0009525	Ga0496116_0009525_2014_3015	332
1078	3300048919	Ga0496116_0044158	Ga0496116_0044158_227_1228	332
1079	3300048919	Ga0496116_0047937	Ga0496116_0047937_337_1344	332
1080	3300048920	Ga0496117_0000597	Ga0496117_0000597_19247_20245	332
1081	3300048920	Ga0496117_0000807	Ga0496117_0000807_13062_14135	332
1082	3300048920	Ga0496117_0001329	Ga0496117_0001329_33486_34487	332
1083	3300048920	Ga0496117_0004196	Ga0496117_0004196_11925_12923	332
1084	3300048920	Ga0496117_0004650	Ga0496117_0004650_8174_9172	332
1085	3300048920	Ga0496117_0009361	Ga0496117_0009361_2294_3292	332
1086	3300048920	Ga0496117_0024859	Ga0496117_0024859_2091_3089	332
1087	3300048920	Ga0496117_0039081	Ga0496117_0039081_1075_2073	332
1088	3300048920	Ga0496117_0043258	Ga0496117_0043258_2201_3202	332
1089	3300048920	Ga0496117_0080799	Ga0496117_0080799_892_1893	332
1090	3300048921	Ga0496118_0000074	Ga0496118_0000074_110772_111773	332
1091	3300048921	Ga0496118_0000663	Ga0496118_0000663_3307_4308	332
1092	3300048921	Ga0496118_0001066	Ga0496118_0001066_24711_25784	332
1093	3300048921	Ga0496118_0004887	Ga0496118_0004887_4136_5137	332
1094	3300048921	Ga0496118_0018588	Ga0496118_0018588_898_1896	332
1095	3300048921	Ga0496118_0020919	Ga0496118_0020919_3888_4886	332
1096	3300048921	Ga0496118_0087744	Ga0496118_0087744_70_1071	332
1097	3300048921	Ga0496118_0097673	Ga0496118_0097673_211_1233	332
1098	3300048921	Ga0496118_0099856	Ga0496118_0099856_664_1662	332
1099	3300048922	Ga0496119_0003729	Ga0496119_0003729_7383_8381	332
1100	3300048922	Ga0496119_0033505	Ga0496119_0033505_408_1415	332
1101	3300048922	Ga0496119_0057832	Ga0496119_0057832_894_1892	332
1102	3300048922	Ga0496119_0104939	Ga0496119_0104939_282_1283	332
1103	3300048923	Ga0496120_0002470	Ga0496120_0002470_4445_5443	332
1104	3300048923	Ga0496120_0014947	Ga0496120_0014947_170_1177	332
1105	3300048924	Ga0496121_0000373	Ga0496121_0000373_41337_42338	332
1106	3300048924	Ga0496121_0000377	Ga0496121_0000377_88028_89026	332
1107	3300048924	Ga0496121_0000614	Ga0496121_0000614_14411_15418	332
1108	3300048924	Ga0496121_0001424	Ga0496121_0001424_39467_40465	332
1109	3300048924	Ga0496121_0019621	Ga0496121_0019621_3018_4019	332
1110	3300048924	Ga0496121_0038397	Ga0496121_0038397_2733_3734	332
1111	3300048924	Ga0496121_0126332	Ga0496121_0126332_825_1823	332
1112	3300048925	Ga0496122_0001605	Ga0496122_0001605_28167_29168	332
1113	3300048925	Ga0496122_0002359	Ga0496122_0002359_13160_14161	332
1114	3300048925	Ga0496122_0017184	Ga0496122_0017184_3325_4332	332
1115	3300048925	Ga0496122_0021067	Ga0496122_0021067_3485_4483	332
1116	3300048925	Ga0496122_0026984	Ga0496122_0026984_2490_3575	332
1117	3300048925	Ga0496122_0052527	Ga0496122_0052527_1869_2891	332
1118	3300048925	Ga0496122_0074444	Ga0496122_0074444_1002_2000	332
1119	3300048926	Ga0496123_0000108	Ga0496123_0000108_45590_46591	332
1120	3300048926	Ga0496123_0000881	Ga0496123_0000881_25788_26786	332
1121	3300048926	Ga0496123_0001515	Ga0496123_0001515_19357_20442	332
1122	3300048926	Ga0496123_0003847	Ga0496123_0003847_14219_15220	332
1123	3300048926	Ga0496123_0013256	Ga0496123_0013256_5842_6840	332
1124	3300048926	Ga0496123_0026615	Ga0496123_0026615_1714_2721	332
1125	3300048926	Ga0496123_0028038	Ga0496123_0028038_373_1371	332
1126	3300048926	Ga0496123_0029152	Ga0496123_0029152_1860_2858	332
1127	3300048926	Ga0496123_0087794	Ga0496123_0087794_118_1119	332
1128	3300048927	Ga0496124_0000312	Ga0496124_0000312_14135_15136	332
1129	3300048927	Ga0496124_0000460	Ga0496124_0000460_52081_53088	332
1130	3300048927	Ga0496124_0000747	Ga0496124_0000747_6217_7215	332
1131	3300048927	Ga0496124_0001209	Ga0496124_0001209_33536_34537	332
1132	3300048927	Ga0496124_0002788	Ga0496124_0002788_137_1138	332
1133	3300048927	Ga0496124_0007420	Ga0496124_0007420_9676_10677	332
1134	3300048927	Ga0496124_0036107	Ga0496124_0036107_562_1560	332
1135	3300048927	Ga0496124_0050551	Ga0496124_0050551_1944_2945	332
1136	3300048927	Ga0496124_0088913	Ga0496124_0088913_287_1288	332
1137	3300048928	Ga0496125_0000095	Ga0496125_0000095_41038_42045	332
1138	3300048928	Ga0496125_0001332	Ga0496125_0001332_7173_8171	332
1139	3300048928	Ga0496125_0005891	Ga0496125_0005891_11227_12225	332
1140	3300048928	Ga0496125_0006657	Ga0496125_0006657_11112_12134	332
1141	3300048928	Ga0496125_0013150	Ga0496125_0013150_3009_4013	332
1142	3300048928	Ga0496125_0030170	Ga0496125_0030170_2160_3158	332
1143	3300048928	Ga0496125_0044185	Ga0496125_0044185_1896_2897	332
1144	3300048928	Ga0496125_0046946	Ga0496125_0046946_898_1896	332
1145	3300048928	Ga0496125_0048096	Ga0496125_0048096_1306_2304	332
1146	3300048928	Ga0496125_0052393	Ga0496125_0052393_1786_2787	332
1147	3300048928	Ga0496125_0125334	Ga0496125_0125334_395_1396	332
1148	3300048928	Ga0496125_0182086	Ga0496125_0182086_165_1163	332
1149	3300048929	Ga0496126_0001120	Ga0496126_0001120_35985_36983	332
1150	3300048929	Ga0496126_0004738	Ga0496126_0004738_12965_13963	332
1151	3300048929	Ga0496126_0058654	Ga0496126_0058654_1053_2054	332
1152	3300049459	Ga0495678_002732	Ga0495678_002732_3606_4679	332
1153	3300049459	Ga0495678_004290	Ga0495678_004290_4796_5794	332
1154	3300049459	Ga0495678_008151	Ga0495678_008151_3017_4069	332
1155	3300049460	Ga0495682_0000430	Ga0495682_0000430_27561_28562	332
1156	3300049460	Ga0495682_0000629	Ga0495682_0000629_5850_6917	332
1157	3300049460	Ga0495682_0031004	Ga0495682_0031004_271_1344	332
1158	3300049460	Ga0495682_0033593	Ga0495682_0033593_684_1682	332
1159	3300049460	Ga0495682_0039975	Ga0495682_0039975_396_1463	332
1160	3300049671	Ga0501238_002693	Ga0501238_002693_218_1219	332
1161	3300049744	Ga0501083_0055419	Ga0501083_0055419_1234_2235	332
1162	3300049758	Ga0501241_000070	Ga0501241_000070_7353_8351	332
1163	3300050489	nmdc:mga03683_81973_c1	nmdc:mga03683_81973_c1_296_1303	332
1164	3300050492	nmdc:mga0yw44_266145_c1	nmdc:mga0yw44_266145_c1_39_1040	332
1165	3300050494	nmdc:mga06z11_99558_c1	nmdc:mga06z11_99558_c1_372_1373	332
1166	3300050496	nmdc:mga07m45_14745_c1	nmdc:mga07m45_14745_c1_2882_3883	332
1167	3300053079	Ga0500610_0000239	Ga0500610_0000239_4553_5554	332
1168	3300053079	Ga0500610_0000575	Ga0500610_0000575_6430_7467	332
1169	3300053117	Ga0500593_000078	Ga0500593_000078_5580_6620	332
1170	3300053118	Ga0500594_0000365	Ga0500594_0000365_7814_8815	332
1171	3300053121	Ga0500607_000025	Ga0500607_000025_91244_92245	332
1172	3300053134	Ga0500658_0000166	Ga0500658_0000166_14919_15920	332
1173	3300053136	Ga0500559_0008519	Ga0500559_0008519_2218_3219	332
1174	3300053136	Ga0500559_0037630	Ga0500559_0037630_161_1162	332
1175	3300053139	Ga0500568_0001031	Ga0500568_0001031_11200_12201	332
1176	3300053141	Ga0500574_012850	Ga0500574_012850_738_1739	332
1177	3300053153	Ga0500616_0000278	Ga0500616_0000278_49755_50756	332
1178	3300053153	Ga0500616_0083772	Ga0500616_0083772_485_1486	332
1179	3300053158	Ga0500627_0007737	Ga0500627_0007737_1667_2707	332
1180	3300053161	Ga0500634_0000172	Ga0500634_0000172_3319_4320	332
1181	3300053161	Ga0500634_0001595	Ga0500634_0001595_2802_3800	332
1182	3300053730	Ga0500645_000048	Ga0500645_000048_55070_56071	332
1183	iso_pu_bacteria	2623620446	2624491570	332
1184	iso_pu_bacteria	2675903420	2677896611	332
1185	iso_pu_bacteria	2852657418	2852657905	332
1186	iso_pu_bacteria	2946006987	2946010530	332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

233

376

0.94 PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

202

312

0.89 PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

72

161

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ide-assembly1.cif.gz_A	structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf	0.9107	2	329
3tqh-assembly1.cif.gz_A	structure of the quinone oxidoreductase from coxiella burnetii	0.8987	1	331
3tqh-assembly1.cif.gz_A	structure of the quinone oxidoreductase from coxiella burnetii	0.8905	1	331
5a3j-assembly8.cif.gz_H	crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid.	0.8854	1	330
2vn8-assembly2.cif.gz_B	crystal structure of human reticulon 4 interacting protein 1 in complex with nadph	0.8846	2	331

ID	Description	Score	Start	End	Superfamily
af_A0A0P0W924_2_174_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9438	14	134	3.90.180.10
af_Q0J0N7_12_137_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.942	1	124	3.90.180.10
af_Q54II4_2_127_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9396	2	117	3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9343	2	117	3.90.180.10
af_Q9LK96_31_155_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9328	2	117	3.90.180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2V7NA27-F1-model_v4	Enoyl reductase (ER) domain-containing protein	0.9982	1	331	GO:0008270 GO:0016491
AF-A0A2V7NA27-F1-model_v4	Enoyl reductase (ER) domain-containing protein	0.9952	1	331	GO:0008270 GO:0016491
AF-A0A656JHV2-F1-model_v4	Oxidoreductase zinc-binding protein	0.9928	95	331	GO:0016491
AF-G4L722-F1-model_v4	deleted	0.9914	1	331
AF-A0A0W0HQ86-F1-model_v4	NADPH:quinone oxidoreductase	0.9914	1	331	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
97.06	0.94	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F491388

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

233

376

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

202

312

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

72

161

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map