F491363

General Info

Members Datasets Scaffolds Average Seq Length
1185 271 1185 256

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10176816|Ga0207706_101768161
Length 299
Sequence MRGRGRLERYCEDSGNFASERCSVHEWARWGGDCELRLFRAPAAGSDIDPMHQFVIEPIFGSFQKGNPFVFTNSALWTLIVLATIWLFMFGGMKRELIPGRWQIMVEGLIGFVDDMVGASIGPQGRKYLPWVFTAFIFLLFANLMGNMPFGVIAAAHPFTVTSQFTFTGVMSLITFAIVLGVGFWKHGLHFFSLFVPPGVHWIGKAALFPIEFISFMVRPFSLGLRPFIAMFAGHILLDIFGNFVVQGLQAGGGGIVISILCFLFVTFISALELLVAAIQAYVFAILTSLYINDAVNLH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
165 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
166 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
248 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.36
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1016112 3300001904 Bacteria 1193
2 JGI24741J21665_1000842 3300001915 Bacteria 9243
3 JGI24741J21665_1002905 3300001915 Bacteria 4290
4 JGI24741J21665_1005065 3300001915 Bacteria 2818
5 JGI24741J21665_1022048 3300001915 Bacteria 990
6 JGI24740J21852_10002270 3300001979 Bacteria 8750
7 JGI24740J21852_10005854 3300001979 Bacteria 5156
8 JGI24740J21852_10006334 3300001979 Bacteria 4912
9 JGI24740J21852_10012776 3300001979 Bacteria 3156
10 JGI24740J21852_10022899 3300001979 Bacteria 2142
11 JGI24739J22299_10005253 3300001989 Bacteria 4934
12 JGI24739J22299_10042925 3300001989 Bacteria 1498
13 JGI24739J22299_10057670 3300001989 Bacteria 1235
14 JGI24737J22298_10007338 3300001990 Bacteria 3726
15 JGI24737J22298_10009427 3300001990 Bacteria 3248
16 JGI24737J22298_10013000 3300001990 Bacteria 2713
17 JGI24735J21928_10004414 3300002067 Bacteria 4734
18 JGI24735J21928_10005096 3300002067 Bacteria 4374
19 JGI24735J21928_10020678 3300002067 Bacteria 2014
20 JGI24745J21846_1003467 3300002073 Bacteria 1651
21 JGI24738J21930_10002750 3300002075 Bacteria 4523
22 Ga0065712_10048522 3300005290 Bacteria 859
23 Ga0065712_10109690 3300005290 Bacteria 1851
24 Ga0065707_10172306 3300005295 Bacteria 1475
25 Ga0070658_10000927 3300005327 Bacteria 25076
26 Ga0070658_10001367 3300005327 Bacteria 20870
27 Ga0070658_10005251 3300005327 Bacteria 10525
28 Ga0070658_10007130 3300005327 Bacteria 9023
29 Ga0070658_10031081 3300005327 Bacteria 4287
30 Ga0070658_10032422 3300005327 Bacteria 4199
31 Ga0070658_10046371 3300005327 Bacteria 3517
32 Ga0070658_10048462 3300005327 Bacteria 3441
33 Ga0070658_10079813 3300005327 Bacteria 2687
34 Ga0070658_10083024 3300005327 Bacteria 2633
35 Ga0070658_10099147 3300005327 Bacteria 2407
36 Ga0070658_10135505 3300005327 Bacteria 2054
37 Ga0070658_10152496 3300005327 Bacteria 1935
38 Ga0070658_10167245 3300005327 Bacteria 1846
39 Ga0070658_10172273 3300005327 Bacteria 1818
40 Ga0070658_10193861 3300005327 Bacteria 1713
41 Ga0070658_10223637 3300005327 Bacteria 1593
42 Ga0070658_10230337 3300005327 Bacteria 1568
43 Ga0070658_10248274 3300005327 Bacteria 1509
44 Ga0070658_10297738 3300005327 Bacteria 1375
45 Ga0070658_10341173 3300005327 Bacteria 1281
46 Ga0070658_10369477 3300005327 Bacteria 1229
47 Ga0070658_10427570 3300005327 Bacteria 1139
48 Ga0070676_10000509 3300005328 Bacteria 18636
49 Ga0070676_10254686 3300005328 Bacteria 1173
50 Ga0070683_100000593 3300005329 Bacteria 25938
51 Ga0070683_100010200 3300005329 Bacteria 8065
52 Ga0070683_100022957 3300005329 Bacteria 5578
53 Ga0070683_100029243 3300005329 Bacteria 4986
54 Ga0070683_100042403 3300005329 Bacteria 4190
55 Ga0070683_100068421 3300005329 Bacteria 3309
56 Ga0070683_100228388 3300005329 Bacteria 1769
57 Ga0070670_100017549 3300005331 Bacteria 6141
58 Ga0070670_100031218 3300005331 Bacteria 4587
59 Ga0070670_100074213 3300005331 Bacteria 2921
60 Ga0070670_100374550 3300005331 Bacteria 1254
61 Ga0070670_100381421 3300005331 Bacteria 1242
62 Ga0070666_10011907 3300005335 Bacteria 5472
63 Ga0070666_10102831 3300005335 Bacteria 1970
64 Ga0070680_100001538 3300005336 Bacteria 16820
65 Ga0070680_100005680 3300005336 Bacteria 9459
66 Ga0070680_100009825 3300005336 Bacteria 7365
67 Ga0070680_100030936 3300005336 Bacteria 4301
68 Ga0070680_100049800 3300005336 Bacteria 3416
69 Ga0070680_100079014 3300005336 Bacteria 2711
70 Ga0070680_100150090 3300005336 Bacteria 1956
71 Ga0070680_100171576 3300005336 Bacteria 1825
72 Ga0070680_100189985 3300005336 Bacteria 1730
73 Ga0070682_100044097 3300005337 Bacteria 2760
74 Ga0070682_100063573 3300005337 Bacteria 2340
75 Ga0070682_100072920 3300005337 Bacteria 2201
76 Ga0070682_100226748 3300005337 Bacteria 1333
77 Ga0068868_100222151 3300005338 Bacteria 1582
78 Ga0068868_100376290 3300005338 Bacteria 1221
79 Ga0068868_100511749 3300005338 Bacteria 1053
80 Ga0068868_100643366 3300005338 Bacteria 943
81 Ga0070660_100000012 3300005339 Bacteria 123961
82 Ga0070660_100000184 3300005339 Bacteria 41526
83 Ga0070660_100004077 3300005339 Bacteria 10082
84 Ga0070660_100004389 3300005339 Bacteria 9744
85 Ga0070660_100008354 3300005339 Bacteria 7239
86 Ga0070660_100011728 3300005339 Bacteria 6240
87 Ga0070660_100021621 3300005339 Bacteria 4747
88 Ga0070660_100029912 3300005339 Bacteria 4084
89 Ga0070660_100033408 3300005339 Bacteria 3878
90 Ga0070660_100065294 3300005339 Bacteria 2832
91 Ga0070660_100080127 3300005339 Bacteria 2562
92 Ga0070660_100125481 3300005339 Bacteria 2051
93 Ga0070660_100225954 3300005339 Bacteria 1522
94 Ga0070660_100361725 3300005339 Bacteria 1196
95 Ga0070689_100088660 3300005340 Bacteria 2436
96 Ga0070691_10004635 3300005341 Bacteria 6251
97 Ga0070687_100078232 3300005343 Bacteria 1797
98 Ga0070661_100000251 3300005344 Bacteria 44128
99 Ga0070661_100000735 3300005344 Bacteria 23855
100 Ga0070661_100009966 3300005344 Bacteria 6592
101 Ga0070661_100010100 3300005344 Bacteria 6557
102 Ga0070661_100026656 3300005344 Bacteria 4158
103 Ga0070661_100031148 3300005344 Bacteria 3856
104 Ga0070661_100035187 3300005344 Bacteria 3636
105 Ga0070661_100142201 3300005344 Bacteria 1809
106 Ga0070661_100226152 3300005344 Bacteria 1436
107 Ga0070661_100459683 3300005344 Bacteria 1014
108 Ga0070692_10005562 3300005345 Bacteria 5389
109 Ga0070692_10007799 3300005345 Bacteria 4742
110 Ga0070692_10043490 3300005345 Bacteria 2310
111 Ga0070692_10111486 3300005345 Bacteria 1513
112 Ga0070692_10133777 3300005345 Bacteria 1396
113 Ga0070668_100004342 3300005347 Bacteria 10512
114 Ga0070668_100023612 3300005347 Bacteria 4653
115 Ga0070668_100047206 3300005347 Bacteria 3310
116 Ga0070668_100055873 3300005347 Bacteria 3048
117 Ga0070668_100359606 3300005347 Bacteria 1234
118 Ga0070668_100407466 3300005347 Bacteria 1162
119 Ga0070669_100016249 3300005353 Bacteria 5308
120 Ga0070669_100180506 3300005353 Bacteria 1651
121 Ga0070669_100217807 3300005353 Bacteria 1509
122 Ga0070675_100070316 3300005354 Bacteria 2900
123 Ga0070675_100104900 3300005354 Bacteria 2385
124 Ga0070671_100069951 3300005355 Bacteria 2927
125 Ga0070671_100094078 3300005355 Bacteria 2511
126 Ga0070671_100125850 3300005355 Bacteria 2157
127 Ga0070674_100081176 3300005356 Bacteria 2317
128 Ga0070673_100033380 3300005364 Bacteria 3886
129 Ga0070673_100050242 3300005364 Bacteria 3260
130 Ga0070673_100431061 3300005364 Bacteria 1183
131 Ga0070659_100000438 3300005366 Bacteria 31272
132 Ga0070659_100001812 3300005366 Bacteria 15374
133 Ga0070659_100002707 3300005366 Bacteria 12596
134 Ga0070659_100006023 3300005366 Bacteria 8743
135 Ga0070659_100014558 3300005366 Bacteria 5879
136 Ga0070659_100017551 3300005366 Bacteria 5391
137 Ga0070659_100030147 3300005366 Bacteria 4196
138 Ga0070659_100030454 3300005366 Bacteria 4177
139 Ga0070659_100038337 3300005366 Bacteria 3738
140 Ga0070659_100052931 3300005366 Bacteria 3194
141 Ga0070659_100056234 3300005366 Bacteria 3102
142 Ga0070659_100060539 3300005366 Bacteria 2990
143 Ga0070659_100062295 3300005366 Bacteria 2948
144 Ga0070659_100166611 3300005366 Bacteria 1803
145 Ga0070659_100172868 3300005366 Bacteria 1770
146 Ga0070659_100220129 3300005366 Bacteria 1566
147 Ga0070659_100274087 3300005366 Bacteria 1402
148 Ga0070659_100288479 3300005366 Bacteria 1366
149 Ga0070667_100036411 3300005367 Bacteria 4126
150 Ga0070667_100096142 3300005367 Bacteria 2554
151 Ga0070667_100103391 3300005367 Bacteria 2463
152 Ga0070709_10028144 3300005434 Bacteria 3349
153 Ga0070714_100006333 3300005435 Bacteria 9125
154 Ga0070714_100032754 3300005435 Bacteria 4340
155 Ga0070714_100034254 3300005435 Bacteria 4252
156 Ga0070714_100038969 3300005435 Bacteria 3999
157 Ga0070714_100101406 3300005435 Bacteria 2536
158 Ga0070713_100057682 3300005436 Bacteria 3235
159 Ga0070713_100071296 3300005436 Bacteria 2935
160 Ga0070713_100366009 3300005436 Bacteria 1340
161 Ga0070705_100302304 3300005440 Bacteria 1147
162 Ga0070694_100003284 3300005444 Bacteria 9666
163 Ga0070694_100145269 3300005444 Bacteria 1727
164 Ga0070663_100000089 3300005455 Bacteria 41316
165 Ga0070663_100005406 3300005455 Bacteria 7588
166 Ga0070663_100018803 3300005455 Bacteria 4539
167 Ga0070663_100019266 3300005455 Bacteria 4494
168 Ga0070663_100030392 3300005455 Bacteria 3701
169 Ga0070663_100031207 3300005455 Bacteria 3660
170 Ga0070663_100038844 3300005455 Bacteria 3323
171 Ga0070663_100045345 3300005455 Bacteria 3105
172 Ga0070663_100049868 3300005455 Bacteria 2975
173 Ga0070663_100055042 3300005455 Unclassified 2846
174 Ga0070663_100071327 3300005455 Bacteria 2528
175 Ga0070663_100109180 3300005455 Bacteria 2077
176 Ga0070663_100271772 3300005455 Bacteria 1348
177 Ga0070663_100366778 3300005455 Bacteria 1169
178 Ga0070678_100067222 3300005456 Bacteria 2666
179 Ga0070662_100000023 3300005457 Bacteria 91833
180 Ga0070662_100000685 3300005457 Bacteria 20655
181 Ga0070662_100028950 3300005457 Bacteria 3860
182 Ga0070662_100049932 3300005457 Bacteria 3018
183 Ga0070662_100066786 3300005457 Bacteria 2639
184 Ga0070662_100099203 3300005457 Bacteria 2201
185 Ga0070662_100110723 3300005457 Bacteria 2091
186 Ga0070662_100212792 3300005457 Bacteria 1539
187 Ga0070662_100226007 3300005457 Bacteria 1495
188 Ga0070681_10005216 3300005458 Bacteria 12546
189 Ga0070681_10010663 3300005458 Bacteria 9083
190 Ga0070681_10012507 3300005458 Bacteria 8422
191 Ga0070681_10079843 3300005458 Bacteria 3228
192 Ga0070681_10189912 3300005458 Bacteria 1974
193 Ga0070681_10377778 3300005458 Bacteria 1328
194 Ga0070681_10433724 3300005458 Bacteria 1226
195 Ga0068867_100009758 3300005459 Bacteria 6765
196 Ga0068867_100228935 3300005459 Bacteria 1502
197 Ga0070679_100014033 3300005530 Bacteria 7681
198 Ga0070679_100023736 3300005530 Bacteria 6009
199 Ga0070679_100079774 3300005530 Bacteria 3263
200 Ga0070679_100081193 3300005530 Bacteria 3231
201 Ga0070679_100123420 3300005530 Bacteria 2573
202 Ga0070679_100160125 3300005530 Bacteria 2225
203 Ga0070679_100222892 3300005530 Bacteria 1846
204 Ga0070679_100560042 3300005530 Bacteria 1087
205 Ga0070684_100008026 3300005535 Bacteria 8239
206 Ga0070684_100028591 3300005535 Bacteria 4717
207 Ga0070684_100206128 3300005535 Bacteria 1792
208 Ga0070684_100263514 3300005535 Bacteria 1577
209 Ga0070684_100490141 3300005535 Bacteria 1138
210 Ga0070684_100508707 3300005535 Bacteria 1116
211 Ga0068853_100000358 3300005539 Bacteria 31415
212 Ga0068853_100000491 3300005539 Bacteria 26988
213 Ga0068853_100006806 3300005539 Bacteria 9115
214 Ga0068853_100012755 3300005539 Bacteria 6843
215 Ga0068853_100016145 3300005539 Bacteria 6141
216 Ga0068853_100032854 3300005539 Bacteria 4398
217 Ga0068853_100116404 3300005539 Bacteria 2380
218 Ga0068853_100153076 3300005539 Bacteria 2077
219 Ga0068853_100226261 3300005539 Unclassified 1710
220 Ga0068853_100349380 3300005539 Bacteria 1375
221 Ga0070672_100005294 3300005543 Bacteria 8539
222 Ga0070672_100052655 3300005543 Bacteria 3179
223 Ga0070672_100175530 3300005543 Bacteria 1784
224 Ga0070686_100335797 3300005544 Bacteria 1131
225 Ga0070695_100011170 3300005545 Bacteria 5370
226 Ga0070696_100020112 3300005546 Bacteria 4526
227 Ga0070693_100001684 3300005547 Bacteria 10023
228 Ga0070665_100007984 3300005548 Bacteria 10725
229 Ga0070665_100012483 3300005548 Bacteria 8562
230 Ga0070665_100079619 3300005548 Bacteria 3282
231 Ga0070704_100502079 3300005549 Bacteria 1053
232 Ga0068855_100000836 3300005563 Bacteria 38107
233 Ga0068855_100000907 3300005563 Bacteria 36754
234 Ga0068855_100002925 3300005563 Bacteria 20893
235 Ga0068855_100115261 3300005563 Bacteria 3080
236 Ga0068855_100141286 3300005563 Bacteria 2744
237 Ga0068855_100160441 3300005563 Bacteria 2553
238 Ga0068855_100185949 3300005563 Bacteria 2346
239 Ga0068855_100186358 3300005563 Bacteria 2343
240 Ga0068855_100261750 3300005563 Bacteria 1926
241 Ga0068855_100273827 3300005563 Unclassified 1876
242 Ga0068855_100330929 3300005563 Bacteria 1681
243 Ga0068855_100402569 3300005563 Bacteria 1500
244 Ga0068855_100550078 3300005563 Bacteria 1249
245 Ga0068855_100720263 3300005563 Bacteria 1066
246 Ga0070664_100000281 3300005564 Bacteria 36710
247 Ga0070664_100001029 3300005564 Bacteria 21907
248 Ga0070664_100007027 3300005564 Bacteria 9084
249 Ga0070664_100007055 3300005564 Bacteria 9067
250 Ga0070664_100016043 3300005564 Bacteria 6137
251 Ga0070664_100104651 3300005564 Bacteria 2464
252 Ga0070664_100105123 3300005564 Bacteria 2459
253 Ga0070664_100165106 3300005564 Bacteria 1961
254 Ga0070664_100167161 3300005564 Bacteria 1949
255 Ga0070664_100345433 3300005564 Bacteria 1352
256 Ga0070664_100386169 3300005564 Bacteria 1279
257 Ga0068857_100019286 3300005577 Bacteria 5987
258 Ga0068857_100023075 3300005577 Bacteria 5472
259 Ga0068857_100033123 3300005577 Bacteria 4569
260 Ga0068857_100036829 3300005577 Bacteria 4334
261 Ga0068857_100038996 3300005577 Bacteria 4206
262 Ga0068857_100057750 3300005577 Bacteria 3444
263 Ga0068857_100087204 3300005577 Bacteria 2791
264 Ga0068857_100097228 3300005577 Bacteria 2639
265 Ga0068857_100102883 3300005577 Bacteria 2564
266 Ga0068857_100608776 3300005577 Bacteria 1033
267 Ga0068854_100004248 3300005578 Bacteria 9021
268 Ga0068854_100004790 3300005578 Bacteria 8534
269 Ga0068854_100006833 3300005578 Bacteria 7277
270 Ga0068854_100012398 3300005578 Bacteria 5581
271 Ga0068854_100026732 3300005578 Bacteria 3969
272 Ga0068854_100037050 3300005578 Bacteria 3421
273 Ga0068854_100062367 3300005578 Bacteria 2702
274 Ga0068854_100116774 3300005578 Bacteria 2020
275 Ga0068854_100120152 3300005578 Bacteria 1994
276 Ga0068854_100184004 3300005578 Bacteria 1633
277 Ga0068854_100369675 3300005578 Bacteria 1179
278 Ga0068854_100479169 3300005578 Bacteria 1044
279 Ga0068856_100000128 3300005614 Bacteria 76603
280 Ga0068856_100005500 3300005614 Bacteria 12479
281 Ga0068856_100055537 3300005614 Bacteria 3908
282 Ga0068856_100081254 3300005614 Bacteria 3215
283 Ga0068856_100105163 3300005614 Bacteria 2817
284 Ga0068856_100122609 3300005614 Bacteria 2601
285 Ga0068856_100160456 3300005614 Bacteria 2259
286 Ga0068856_100164542 3300005614 Bacteria 2229
287 Ga0068856_100189693 3300005614 Bacteria 2069
288 Ga0068856_100270187 3300005614 Bacteria 1716
289 Ga0068856_100307607 3300005614 Bacteria 1603
290 Ga0068856_100588696 3300005614 Bacteria 1134
291 Ga0070702_100394540 3300005615 Bacteria 988
292 Ga0068852_100000378 3300005616 Bacteria 29963
293 Ga0068852_100000577 3300005616 Bacteria 24126
294 Ga0068852_100021755 3300005616 Bacteria 5130
295 Ga0068852_100023861 3300005616 Bacteria 4932
296 Ga0068852_100060921 3300005616 Bacteria 3278
297 Ga0068852_100173397 3300005616 Bacteria 2023
298 Ga0068852_100197420 3300005616 Bacteria 1902
299 Ga0068852_100315982 3300005616 Bacteria 1515
300 Ga0068852_100808624 3300005616 Bacteria 952
301 Ga0068859_100031616 3300005617 Bacteria 5315
302 Ga0068859_100111518 3300005617 Bacteria 2798
303 Ga0068864_100007635 3300005618 Bacteria 8908
304 Ga0068864_100015969 3300005618 Bacteria 6247
305 Ga0068864_100087213 3300005618 Bacteria 2747
306 Ga0068864_100673826 3300005618 Bacteria 1008
307 Ga0068866_10014334 3300005718 Bacteria 3498
308 Ga0068866_10059666 3300005718 Bacteria 1975
309 Ga0068851_10017873 3300005834 Bacteria 3413
310 Ga0068851_10092014 3300005834 Bacteria 1598
311 Ga0068851_10195655 3300005834 Bacteria 1126
312 Ga0068863_100087637 3300005841 Bacteria 2950
313 Ga0068863_100116566 3300005841 Bacteria 2545
314 Ga0068863_100131092 3300005841 Bacteria 2394
315 Ga0068858_100020526 3300005842 Bacteria 6174
316 Ga0068858_100025021 3300005842 Bacteria 5556
317 Ga0068858_100058227 3300005842 Bacteria 3572
318 Ga0068858_100075904 3300005842 Bacteria 3122
319 Ga0068858_100128909 3300005842 Bacteria 2371
320 Ga0068860_100027502 3300005843 Bacteria 5478
321 Ga0068860_100030028 3300005843 Bacteria 5227
322 Ga0068860_100036062 3300005843 Bacteria 4740
323 Ga0068860_100059291 3300005843 Bacteria 3639
324 Ga0068860_100168857 3300005843 Bacteria 2113
325 Ga0068860_100410529 3300005843 Bacteria 1341
326 Ga0068860_100652842 3300005843 Bacteria 1060
327 Ga0068862_100025302 3300005844 Bacteria 4983
328 Ga0068862_100144492 3300005844 Bacteria 2113
329 Ga0068862_100149115 3300005844 Bacteria 2081
330 Ga0068862_100200306 3300005844 Bacteria 1800
331 Ga0068862_100211283 3300005844 Bacteria 1753
332 Ga0068862_100256559 3300005844 Bacteria 1595
333 Ga0068862_100268178 3300005844 Bacteria 1560
334 Ga0068862_100286082 3300005844 Bacteria 1512
335 Ga0068862_100311141 3300005844 Bacteria 1452
336 Ga0070716_100007713 3300006173 Bacteria 5311
337 Ga0097621_100012388 3300006237 Bacteria 6319
338 Ga0097621_100017678 3300006237 Bacteria 5422
339 Ga0097621_100044825 3300006237 Bacteria 3570
340 Ga0097621_100206546 3300006237 Bacteria 1707
341 Ga0068871_100018700 3300006358 Bacteria 5276
342 Ga0068871_100048620 3300006358 Bacteria 3425
343 Ga0075431_100344225 3300006847 Bacteria 1500
344 Ga0075434_100287522 3300006871 Bacteria 1664
345 Ga0075434_100357298 3300006871 Bacteria 1482
346 Ga0068865_100638816 3300006881 Bacteria 903
347 Ga0075436_100272544 3300006914 Bacteria 1209
348 Ga0097620_100031616 3300006931 Bacteria 5315
349 Ga0097620_100111513 3300006931 Bacteria 2798
350 Ga0105251_10038441 3300009011 Bacteria 2344
351 Ga0105240_10024166 3300009093 Bacteria 8019
352 Ga0105240_10218747 3300009093 Bacteria 2220
353 Ga0105240_10222074 3300009093 Bacteria 2200
354 Ga0105240_10223002 3300009093 Bacteria 2195
355 Ga0111539_10058536 3300009094 Bacteria 4571
356 Ga0111539_10191515 3300009094 Bacteria 2386
357 Ga0105245_10037207 3300009098 Bacteria 4326
358 Ga0105245_10061467 3300009098 Bacteria 3386
359 Ga0105241_10031105 3300009174 Bacteria 3994
360 Ga0105241_10125210 3300009174 Bacteria 2074
361 Ga0105241_10242046 3300009174 Bacteria 1526
362 Ga0105241_10333310 3300009174 Bacteria 1312
363 Ga0105242_10098610 3300009176 Bacteria 2471
364 Ga0105248_10006468 3300009177 Bacteria 12854
365 Ga0105248_10012350 3300009177 Bacteria 9425
366 Ga0105248_10022027 3300009177 Bacteria 7061
367 Ga0105248_10055018 3300009177 Bacteria 4463
368 Ga0105248_10431300 3300009177 Bacteria 1484
369 Ga0105248_10501873 3300009177 Bacteria 1368
370 Ga0105248_10834807 3300009177 Bacteria 1040
371 Ga0105237_10027499 3300009545 Bacteria 5805
372 Ga0105237_10111045 3300009545 Bacteria 2733
373 Ga0105237_10145883 3300009545 Bacteria 2361
374 Ga0105237_10715352 3300009545 Bacteria 1008
375 Ga0105238_10017865 3300009551 Bacteria 7211
376 Ga0105238_10021856 3300009551 Bacteria 6517
377 Ga0105238_10034743 3300009551 Bacteria 5128
378 Ga0105238_10045756 3300009551 Bacteria 4420
379 Ga0105238_10074218 3300009551 Bacteria 3394
380 Ga0105238_10142061 3300009551 Bacteria 2377
381 Ga0105249_10012623 3300009553 Bacteria 7449
382 Ga0105249_10121432 3300009553 Bacteria 2483
383 Ga0105249_10158478 3300009553 Bacteria 2185
384 Ga0105239_10212835 3300010375 Bacteria 2167
385 Ga0105239_10958780 3300010375 Bacteria 983
386 Ga0105246_10020097 3300011119 Bacteria 4281
387 Ga0105246_10413664 3300011119 Bacteria 1123
388 Ga0157373_10001222 3300013100 Bacteria 19667
389 Ga0157373_10006351 3300013100 Bacteria 8827
390 Ga0157373_10024962 3300013100 Bacteria 4327
391 Ga0157373_10039293 3300013100 Bacteria 3388
392 Ga0157373_10073226 3300013100 Bacteria 2418
393 Ga0157373_10091812 3300013100 Bacteria 2138
394 Ga0157373_10211483 3300013100 Bacteria 1368
395 Ga0157373_10229036 3300013100 Bacteria 1312
396 Ga0157373_10255559 3300013100 Bacteria 1239
397 Ga0157371_10000705 3300013102 Bacteria 39219
398 Ga0157371_10000765 3300013102 Bacteria 37140
399 Ga0157371_10004503 3300013102 Bacteria 12142
400 Ga0157371_10019607 3300013102 Bacteria 4983
401 Ga0157371_10112660 3300013102 Bacteria 1931
402 Ga0157371_10147867 3300013102 Bacteria 1675
403 Ga0157371_10219847 3300013102 Bacteria 1364
404 Ga0157371_10479391 3300013102 Bacteria 917
405 Ga0157370_10000534 3300013104 Bacteria 47653
406 Ga0157370_10024298 3300013104 Bacteria 6002
407 Ga0157370_10042233 3300013104 Bacteria 4395
408 Ga0157370_10084669 3300013104 Bacteria 2980
409 Ga0157370_10118719 3300013104 Bacteria 2470
410 Ga0157370_10267670 3300013104 Bacteria 1579
411 Ga0157370_10334383 3300013104 Unclassified 1396
412 Ga0157370_10360568 3300013104 Bacteria 1339
413 Ga0157370_10371460 3300013104 Bacteria 1318
414 Ga0157370_10396485 3300013104 Bacteria 1271
415 Ga0157370_10432012 3300013104 Bacteria 1211
416 Ga0157370_10557760 3300013104 Bacteria 1050
417 Ga0157369_10000553 3300013105 Bacteria 49107
418 Ga0157369_10004144 3300013105 Bacteria 17177
419 Ga0157369_10008548 3300013105 Bacteria 11739
420 Ga0157369_10057491 3300013105 Bacteria 4196
421 Ga0157369_10057812 3300013105 Bacteria 4183
422 Ga0157369_10104342 3300013105 Bacteria 3019
423 Ga0157369_10171497 3300013105 Bacteria 2286
424 Ga0157369_10229385 3300013105 Bacteria 1942
425 Ga0157369_10295878 3300013105 Bacteria 1684
426 Ga0157369_10344610 3300013105 Bacteria 1548
427 Ga0157369_10832200 3300013105 Bacteria 948
428 Ga0157374_10009784 3300013296 Bacteria 8236
429 Ga0157374_10053321 3300013296 Unclassified 3770
430 Ga0157374_10148809 3300013296 Bacteria 2276
431 Ga0157374_10229571 3300013296 Bacteria 1823
432 Ga0157374_10268049 3300013296 Bacteria 1683
433 Ga0157374_10406631 3300013296 Bacteria 1358
434 Ga0157378_10032806 3300013297 Bacteria 4590
435 Ga0163162_10069109 3300013306 Bacteria 3584
436 Ga0163162_10139307 3300013306 Bacteria 2538
437 Ga0163162_10464778 3300013306 Bacteria 1397
438 Ga0157372_10014257 3300013307 Bacteria 8497
439 Ga0157372_10041031 3300013307 Bacteria 5116
440 Ga0157372_10301922 3300013307 Bacteria 1862
441 Ga0157372_10359964 3300013307 Bacteria 1695
442 Ga0157372_10386280 3300013307 Bacteria 1631
443 Ga0157372_10390415 3300013307 Bacteria 1622
444 Ga0157372_10478167 3300013307 Bacteria 1452
445 Ga0157375_10060270 3300013308 Bacteria 3763
446 Ga0157375_10246061 3300013308 Bacteria 1948
447 Ga0157375_11184902 3300013308 Bacteria 896
448 Ga0163163_10000151 3300014325 Bacteria 72496
449 Ga0157380_10007784 3300014326 Bacteria 7625
450 Ga0157380_10116449 3300014326 Bacteria 2256
451 Ga0157380_10364791 3300014326 Bacteria 1357
452 Ga0157380_10519485 3300014326 Bacteria 1161
453 Ga0182008_10045746 3300014497 Bacteria 2176
454 Ga0182008_10143572 3300014497 Bacteria 1195
455 Ga0182008_10248647 3300014497 Bacteria 917
456 Ga0157377_10015317 3300014745 Bacteria 3919
457 Ga0157379_10006649 3300014968 Bacteria 9978
458 Ga0157379_10034150 3300014968 Bacteria 4533
459 Ga0206356_10032050 3300020070 Bacteria 913
460 Ga0207697_10011949 3300025315 Bacteria 3656
461 Ga0207697_10012055 3300025315 Bacteria 3638
462 Ga0207656_10024588 3300025321 Bacteria 2437
463 Ga0207656_10077776 3300025321 Bacteria 1486
464 Ga0207713_1059775 3300025735 Bacteria 1461
465 Ga0207682_10019468 3300025893 Bacteria 2657
466 Ga0207682_10079538 3300025893 Bacteria 1402
467 Ga0207642_10014221 3300025899 Bacteria 2930
468 Ga0207688_10022736 3300025901 Bacteria 3433
469 Ga0207688_10049037 3300025901 Bacteria 2359
470 Ga0207688_10139241 3300025901 Bacteria 1427
471 Ga0207680_10033075 3300025903 Bacteria 2946
472 Ga0207680_10122057 3300025903 Bacteria 1705
473 Ga0207647_10000450 3300025904 Bacteria 33415
474 Ga0207647_10008523 3300025904 Bacteria 7343
475 Ga0207647_10008732 3300025904 Bacteria 7234
476 Ga0207647_10016675 3300025904 Bacteria 5007
477 Ga0207647_10028515 3300025904 Bacteria 3623
478 Ga0207647_10081506 3300025904 Bacteria 1939
479 Ga0207645_10000896 3300025907 Bacteria 24720
480 Ga0207645_10193546 3300025907 Bacteria 1337
481 Ga0207705_10000050 3300025909 Bacteria 170078
482 Ga0207705_10000411 3300025909 Bacteria 37615
483 Ga0207705_10000694 3300025909 Bacteria 27899
484 Ga0207705_10001324 3300025909 Bacteria 19811
485 Ga0207705_10001951 3300025909 Bacteria 16098
486 Ga0207705_10001965 3300025909 Bacteria 16037
487 Ga0207705_10007574 3300025909 Bacteria 7979
488 Ga0207705_10009725 3300025909 Bacteria 6994
489 Ga0207705_10018413 3300025909 Bacteria 4995
490 Ga0207705_10023014 3300025909 Bacteria 4443
491 Ga0207705_10024198 3300025909 Bacteria 4334
492 Ga0207705_10031145 3300025909 Bacteria 3806
493 Ga0207705_10037815 3300025909 Bacteria 3453
494 Ga0207705_10038042 3300025909 Bacteria 3443
495 Ga0207705_10062142 3300025909 Bacteria 2698
496 Ga0207705_10087789 3300025909 Bacteria 2274
497 Ga0207705_10104053 3300025909 Bacteria 2091
498 Ga0207705_10136327 3300025909 Bacteria 1830
499 Ga0207705_10159814 3300025909 Bacteria 1692
500 Ga0207705_10337840 3300025909 Bacteria 1159
501 Ga0207705_10359167 3300025909 Bacteria 1123
502 Ga0207705_10383837 3300025909 Bacteria 1085
503 Ga0207705_10435159 3300025909 Bacteria 1016
504 Ga0207654_10055910 3300025911 Bacteria 2287
505 Ga0207707_10006787 3300025912 Bacteria 9990
506 Ga0207707_10021788 3300025912 Bacteria 5601
507 Ga0207707_10026570 3300025912 Bacteria 5060
508 Ga0207707_10147117 3300025912 Bacteria 2060
509 Ga0207707_10237642 3300025912 Bacteria 1585
510 Ga0207707_10250870 3300025912 Bacteria 1537
511 Ga0207707_10414847 3300025912 Bacteria 1155
512 Ga0207707_10534051 3300025912 Bacteria 998
513 Ga0207695_10036869 3300025913 Bacteria 5280
514 Ga0207695_10045251 3300025913 Bacteria 4673
515 Ga0207695_10194826 3300025913 Bacteria 1943
516 Ga0207695_10486157 3300025913 Bacteria 1117
517 Ga0207671_10267925 3300025914 Bacteria 1345
518 Ga0207671_10380143 3300025914 Bacteria 1122
519 Ga0207671_10383381 3300025914 Bacteria 1117
520 Ga0207671_10500243 3300025914 Bacteria 969
521 Ga0207693_10058392 3300025915 Bacteria 3022
522 Ga0207660_10000036 3300025917 Bacteria 65280
523 Ga0207660_10005638 3300025917 Bacteria 8128
524 Ga0207660_10010780 3300025917 Bacteria 5939
525 Ga0207660_10014749 3300025917 Bacteria 5149
526 Ga0207660_10026000 3300025917 Bacteria 3981
527 Ga0207660_10030712 3300025917 Bacteria 3694
528 Ga0207660_10110471 3300025917 Bacteria 2068
529 Ga0207660_10113763 3300025917 Bacteria 2040
530 Ga0207660_10134672 3300025917 Bacteria 1884
531 Ga0207662_10033903 3300025918 Bacteria 2979
532 Ga0207662_10070150 3300025918 Bacteria 2119
533 Ga0207657_10000038 3300025919 Bacteria 123940
534 Ga0207657_10000077 3300025919 Bacteria 92227
535 Ga0207657_10000210 3300025919 Bacteria 60425
536 Ga0207657_10000301 3300025919 Bacteria 52361
537 Ga0207657_10001185 3300025919 Bacteria 27703
538 Ga0207657_10002057 3300025919 Bacteria 21773
539 Ga0207657_10002433 3300025919 Bacteria 20101
540 Ga0207657_10002467 3300025919 Bacteria 20011
541 Ga0207657_10007540 3300025919 Bacteria 11152
542 Ga0207657_10009969 3300025919 Bacteria 9509
543 Ga0207657_10014882 3300025919 Bacteria 7569
544 Ga0207657_10015664 3300025919 Bacteria 7333
545 Ga0207657_10032164 3300025919 Bacteria 4743
546 Ga0207657_10040363 3300025919 Bacteria 4135
547 Ga0207657_10041138 3300025919 Bacteria 4088
548 Ga0207657_10070145 3300025919 Bacteria 2971
549 Ga0207657_10074459 3300025919 Bacteria 2867
550 Ga0207657_10094058 3300025919 Bacteria 2496
551 Ga0207657_10098731 3300025919 Bacteria 2426
552 Ga0207657_10111021 3300025919 Bacteria 2265
553 Ga0207657_10289701 3300025919 Bacteria 1298
554 Ga0207657_10303580 3300025919 Bacteria 1264
555 Ga0207657_10317496 3300025919 Bacteria 1232
556 Ga0207657_10379831 3300025919 Bacteria 1113
557 Ga0207649_10000330 3300025920 Bacteria 35879
558 Ga0207649_10003557 3300025920 Bacteria 8514
559 Ga0207649_10007872 3300025920 Bacteria 5799
560 Ga0207649_10008212 3300025920 Bacteria 5685
561 Ga0207649_10009034 3300025920 Bacteria 5444
562 Ga0207649_10012189 3300025920 Bacteria 4762
563 Ga0207649_10023772 3300025920 Bacteria 3553
564 Ga0207649_10024272 3300025920 Bacteria 3522
565 Ga0207649_10024328 3300025920 Bacteria 3519
566 Ga0207649_10067223 3300025920 Bacteria 2274
567 Ga0207649_10075368 3300025920 Bacteria 2168
568 Ga0207649_10081102 3300025920 Bacteria 2100
569 Ga0207649_10082789 3300025920 Bacteria 2081
570 Ga0207649_10225715 3300025920 Bacteria 1337
571 Ga0207652_10011268 3300025921 Bacteria 7203
572 Ga0207652_10018222 3300025921 Bacteria 5757
573 Ga0207652_10019345 3300025921 Bacteria 5599
574 Ga0207652_10045902 3300025921 Bacteria 3726
575 Ga0207652_10046054 3300025921 Bacteria 3720
576 Ga0207652_10075220 3300025921 Bacteria 2943
577 Ga0207652_10079763 3300025921 Bacteria 2860
578 Ga0207652_10233905 3300025921 Bacteria 1656
579 Ga0207652_10421378 3300025921 Bacteria 1204
580 Ga0207681_10005902 3300025923 Bacteria 7509
581 Ga0207681_10040198 3300025923 Bacteria 3110
582 Ga0207681_10067717 3300025923 Bacteria 2477
583 Ga0207681_10121231 3300025923 Bacteria 1918
584 Ga0207681_10121349 3300025923 Bacteria 1917
585 Ga0207681_10270230 3300025923 Bacteria 1334
586 Ga0207681_10608836 3300025923 Bacteria 903
587 Ga0207694_10007689 3300025924 Bacteria 8166
588 Ga0207694_10008070 3300025924 Bacteria 7961
589 Ga0207694_10025045 3300025924 Bacteria 4534
590 Ga0207694_10230999 3300025924 Bacteria 1511
591 Ga0207694_10286672 3300025924 Bacteria 1353
592 Ga0207650_10039191 3300025925 Bacteria 3463
593 Ga0207650_10072948 3300025925 Bacteria 2584
594 Ga0207650_10108317 3300025925 Bacteria 2147
595 Ga0207650_10138216 3300025925 Bacteria 1913
596 Ga0207650_10180396 3300025925 Bacteria 1682
597 Ga0207650_10355919 3300025925 Bacteria 1205
598 Ga0207659_10201878 3300025926 Bacteria 1589
599 Ga0207659_10354830 3300025926 Bacteria 1217
600 Ga0207687_10117610 3300025927 Bacteria 1983
601 Ga0207687_10151900 3300025927 Bacteria 1768
602 Ga0207700_10051185 3300025928 Bacteria 3081
603 Ga0207664_10018528 3300025929 Bacteria 5127
604 Ga0207664_10024781 3300025929 Bacteria 4512
605 Ga0207664_10028956 3300025929 Bacteria 4215
606 Ga0207664_10041017 3300025929 Bacteria 3604
607 Ga0207664_10129563 3300025929 Bacteria 2122
608 Ga0207664_10187352 3300025929 Bacteria 1780
609 Ga0207644_10039546 3300025931 Bacteria 3329
610 Ga0207644_10078292 3300025931 Bacteria 2436
611 Ga0207644_10103917 3300025931 Bacteria 2138
612 Ga0207690_10000149 3300025932 Bacteria 55374
613 Ga0207690_10001427 3300025932 Bacteria 14960
614 Ga0207690_10002639 3300025932 Bacteria 10796
615 Ga0207690_10021822 3300025932 Bacteria 3976
616 Ga0207690_10025995 3300025932 Bacteria 3684
617 Ga0207690_10030826 3300025932 Bacteria 3425
618 Ga0207690_10034598 3300025932 Bacteria 3256
619 Ga0207690_10036760 3300025932 Bacteria 3173
620 Ga0207690_10039518 3300025932 Bacteria 3079
621 Ga0207690_10043136 3300025932 Bacteria 2967
622 Ga0207690_10059226 3300025932 Bacteria 2594
623 Ga0207690_10065215 3300025932 Bacteria 2489
624 Ga0207690_10069444 3300025932 Bacteria 2424
625 Ga0207690_10079276 3300025932 Bacteria 2288
626 Ga0207690_10133924 3300025932 Bacteria 1817
627 Ga0207690_10144435 3300025932 Bacteria 1757
628 Ga0207690_10214018 3300025932 Bacteria 1471
629 Ga0207690_10247390 3300025932 Bacteria 1376
630 Ga0207690_10262770 3300025932 Bacteria 1338
631 Ga0207706_10000061 3300025933 Bacteria 109447
632 Ga0207706_10000204 3300025933 Bacteria 65744
633 Ga0207706_10001971 3300025933 Bacteria 20129
634 Ga0207706_10015533 3300025933 Bacteria 6879
635 Ga0207706_10015844 3300025933 Bacteria 6816
636 Ga0207706_10024853 3300025933 Bacteria 5369
637 Ga0207706_10034925 3300025933 Bacteria 4472
638 Ga0207706_10075810 3300025933 Bacteria 2958
639 Ga0207706_10089694 3300025933 Bacteria 2703
640 Ga0207706_10137295 3300025933 Bacteria 2151
641 Ga0207706_10168831 3300025933 Bacteria 1923
642 Ga0207706_10176816 3300025933 Bacteria 1875
643 Ga0207706_10290143 3300025933 Bacteria 1426
644 Ga0207709_10084838 3300025935 Bacteria 2052
645 Ga0207669_10115974 3300025937 Bacteria 1806
646 Ga0207665_10014260 3300025939 Bacteria 5232
647 Ga0207691_10014594 3300025940 Bacteria 7488
648 Ga0207691_10016405 3300025940 Bacteria 7033
649 Ga0207691_10061771 3300025940 Bacteria 3403
650 Ga0207691_10204755 3300025940 Bacteria 1716
651 Ga0207691_10213441 3300025940 Bacteria 1676
652 Ga0207711_10001606 3300025941 Bacteria 20889
653 Ga0207711_10003282 3300025941 Bacteria 14060
654 Ga0207711_10032298 3300025941 Bacteria 4426
655 Ga0207711_10037413 3300025941 Bacteria 4122
656 Ga0207711_10201557 3300025941 Bacteria 1816
657 Ga0207689_10009583 3300025942 Bacteria 8352
658 Ga0207689_10073436 3300025942 Bacteria 2810
659 Ga0207689_10172606 3300025942 Bacteria 1783
660 Ga0207661_10000937 3300025944 Bacteria 19198
661 Ga0207661_10003474 3300025944 Bacteria 10940
662 Ga0207661_10034772 3300025944 Bacteria 3922
663 Ga0207661_10069848 3300025944 Bacteria 2865
664 Ga0207661_10085490 3300025944 Bacteria 2615
665 Ga0207661_10089140 3300025944 Bacteria 2565
666 Ga0207661_10090819 3300025944 Bacteria 2544
667 Ga0207661_10121811 3300025944 Bacteria 2221
668 Ga0207661_10174425 3300025944 Bacteria 1873
669 Ga0207661_10374629 3300025944 Bacteria 1288
670 Ga0207661_10462729 3300025944 Bacteria 1156
671 Ga0207679_10000149 3300025945 Bacteria 57484
672 Ga0207679_10003346 3300025945 Bacteria 9903
673 Ga0207679_10003580 3300025945 Bacteria 9627
674 Ga0207679_10012302 3300025945 Bacteria 5576
675 Ga0207679_10018236 3300025945 Bacteria 4699
676 Ga0207679_10072979 3300025945 Bacteria 2595
677 Ga0207679_10081752 3300025945 Bacteria 2471
678 Ga0207679_10094150 3300025945 Bacteria 2325
679 Ga0207679_10104205 3300025945 Bacteria 2225
680 Ga0207679_10154590 3300025945 Bacteria 1872
681 Ga0207679_10157015 3300025945 Bacteria 1859
682 Ga0207679_10389172 3300025945 Bacteria 1224
683 Ga0207667_10000327 3300025949 Bacteria 66205
684 Ga0207667_10003170 3300025949 Bacteria 20344
685 Ga0207667_10005685 3300025949 Bacteria 15203
686 Ga0207667_10017438 3300025949 Bacteria 8080
687 Ga0207667_10040222 3300025949 Bacteria 4979
688 Ga0207667_10048771 3300025949 Bacteria 4476
689 Ga0207667_10052956 3300025949 Bacteria 4272
690 Ga0207667_10060365 3300025949 Bacteria 3969
691 Ga0207667_10088835 3300025949 Bacteria 3195
692 Ga0207667_10119630 3300025949 Bacteria 2714
693 Ga0207667_10159183 3300025949 Bacteria 2323
694 Ga0207667_10182739 3300025949 Bacteria 2153
695 Ga0207667_10186843 3300025949 Bacteria 2127
696 Ga0207667_10340833 3300025949 Bacteria 1530
697 Ga0207667_10350155 3300025949 Bacteria 1506
698 Ga0207667_10364753 3300025949 Bacteria 1473
699 Ga0207667_10538235 3300025949 Bacteria 1182
700 Ga0207667_10787806 3300025949 Bacteria 948
701 Ga0207651_10031969 3300025960 Bacteria 3372
702 Ga0207651_10055402 3300025960 Bacteria 2723
703 Ga0207651_10185628 3300025960 Bacteria 1654
704 Ga0207712_10000146 3300025961 Bacteria 73378
705 Ga0207712_10024626 3300025961 Bacteria 3989
706 Ga0207712_10192049 3300025961 Bacteria 1612
707 Ga0207712_10261141 3300025961 Bacteria 1405
708 Ga0207668_10000070 3300025972 Bacteria 78666
709 Ga0207668_10015855 3300025972 Bacteria 4692
710 Ga0207668_10313894 3300025972 Bacteria 1298
711 Ga0207640_10007531 3300025981 Bacteria 6013
712 Ga0207640_10007538 3300025981 Bacteria 6009
713 Ga0207640_10015002 3300025981 Bacteria 4474
714 Ga0207640_10016771 3300025981 Bacteria 4269
715 Ga0207640_10019095 3300025981 Bacteria 4043
716 Ga0207640_10042755 3300025981 Bacteria 2891
717 Ga0207640_10074059 3300025981 Bacteria 2303
718 Ga0207640_10133706 3300025981 Bacteria 1797
719 Ga0207640_10201323 3300025981 Bacteria 1509
720 Ga0207640_10248815 3300025981 Bacteria 1378
721 Ga0207658_10040256 3300025986 Bacteria 3377
722 Ga0207658_10216039 3300025986 Bacteria 1610
723 Ga0207658_10223441 3300025986 Bacteria 1585
724 Ga0207658_10310718 3300025986 Bacteria 1361
725 Ga0207677_10194989 3300026023 Bacteria 1605
726 Ga0207677_10435613 3300026023 Bacteria 1120
727 Ga0207677_10646115 3300026023 Bacteria 933
728 Ga0207703_10007173 3300026035 Bacteria 8866
729 Ga0207703_10024636 3300026035 Bacteria 4734
730 Ga0207703_10069215 3300026035 Bacteria 2910
731 Ga0207639_10000306 3300026041 Bacteria 34858
732 Ga0207639_10000754 3300026041 Bacteria 22067
733 Ga0207639_10000847 3300026041 Bacteria 20809
734 Ga0207639_10002714 3300026041 Bacteria 11874
735 Ga0207639_10032745 3300026041 Bacteria 3829
736 Ga0207639_10038297 3300026041 Bacteria 3566
737 Ga0207639_10104605 3300026041 Bacteria 2295
738 Ga0207639_10117738 3300026041 Bacteria 2177
739 Ga0207639_10127004 3300026041 Bacteria 2105
740 Ga0207639_10166683 3300026041 Bacteria 1862
741 Ga0207639_10444428 3300026041 Bacteria 1176
742 Ga0207639_10707423 3300026041 Bacteria 935
743 Ga0207678_10002367 3300026067 Bacteria 17102
744 Ga0207678_10006909 3300026067 Bacteria 10069
745 Ga0207678_10019221 3300026067 Bacteria 5999
746 Ga0207678_10023897 3300026067 Bacteria 5344
747 Ga0207678_10024047 3300026067 Bacteria 5323
748 Ga0207678_10026074 3300026067 Bacteria 5099
749 Ga0207678_10026852 3300026067 Bacteria 5022
750 Ga0207678_10043646 3300026067 Bacteria 3879
751 Ga0207678_10044371 3300026067 Bacteria 3846
752 Ga0207678_10046436 3300026067 Bacteria 3755
753 Ga0207678_10051358 3300026067 Bacteria 3559
754 Ga0207678_10148222 3300026067 Bacteria 2003
755 Ga0207702_10001192 3300026078 Bacteria 26389
756 Ga0207702_10005600 3300026078 Bacteria 10963
757 Ga0207702_10007990 3300026078 Bacteria 8965
758 Ga0207702_10015456 3300026078 Bacteria 6321
759 Ga0207702_10037633 3300026078 Bacteria 4050
760 Ga0207702_10078374 3300026078 Bacteria 2860
761 Ga0207702_10093557 3300026078 Bacteria 2636
762 Ga0207702_10094662 3300026078 Bacteria 2622
763 Ga0207702_10115370 3300026078 Bacteria 2395
764 Ga0207702_10222774 3300026078 Bacteria 1758
765 Ga0207702_10272080 3300026078 Bacteria 1598
766 Ga0207702_10353487 3300026078 Bacteria 1407
767 Ga0207702_10442568 3300026078 Bacteria 1260
768 Ga0207641_10061126 3300026088 Bacteria 3212
769 Ga0207641_10067884 3300026088 Bacteria 3056
770 Ga0207641_10155647 3300026088 Bacteria 2073
771 Ga0207641_10200252 3300026088 Bacteria 1840
772 Ga0207648_10001147 3300026089 Bacteria 29705
773 Ga0207648_10020937 3300026089 Bacteria 5888
774 Ga0207648_10028790 3300026089 Bacteria 4924
775 Ga0207676_10005875 3300026095 Bacteria 8668
776 Ga0207676_10081824 3300026095 Bacteria 2624
777 Ga0207676_10123626 3300026095 Bacteria 2186
778 Ga0207676_10692581 3300026095 Bacteria 986
779 Ga0207674_10002878 3300026116 Bacteria 21384
780 Ga0207674_10005415 3300026116 Bacteria 15173
781 Ga0207674_10009470 3300026116 Bacteria 11125
782 Ga0207674_10012787 3300026116 Bacteria 9373
783 Ga0207674_10015233 3300026116 Bacteria 8459
784 Ga0207674_10021020 3300026116 Bacteria 7038
785 Ga0207674_10036665 3300026116 Bacteria 5106
786 Ga0207674_10043520 3300026116 Bacteria 4630
787 Ga0207674_10066032 3300026116 Bacteria 3645
788 Ga0207674_10103298 3300026116 Bacteria 2829
789 Ga0207674_10122923 3300026116 Bacteria 2561
790 Ga0207674_10161846 3300026116 Bacteria 2192
791 Ga0207674_10183890 3300026116 Bacteria 2040
792 Ga0207674_10583438 3300026116 Bacteria 1080
793 Ga0207675_100143382 3300026118 Bacteria 2270
794 Ga0207683_10058836 3300026121 Bacteria 3375
795 Ga0207683_10093132 3300026121 Bacteria 2685
796 Ga0207698_10000562 3300026142 Bacteria 21599
797 Ga0207698_10000924 3300026142 Bacteria 17092
798 Ga0207698_10003675 3300026142 Bacteria 9268
799 Ga0207698_10004660 3300026142 Bacteria 8379
800 Ga0207698_10004791 3300026142 Bacteria 8285
801 Ga0207698_10032721 3300026142 Bacteria 3770
802 Ga0207698_10032766 3300026142 Bacteria 3768
803 Ga0207698_10087713 3300026142 Bacteria 2535
804 Ga0207698_10109576 3300026142 Bacteria 2311
805 Ga0207698_10252308 3300026142 Bacteria 1615
806 Ga0207698_10344896 3300026142 Bacteria 1404
807 Ga0207698_10743066 3300026142 Bacteria 979
808 Ga0209974_10013126 3300027876 Bacteria 2762
809 Ga0209974_10147890 3300027876 Bacteria 846
810 Ga0207428_10111418 3300027907 Bacteria 2106
811 Ga0268266_10002339 3300028379 Bacteria 20508
812 Ga0268266_10014941 3300028379 Bacteria 6667
813 Ga0268266_10015168 3300028379 Bacteria 6615
814 Ga0268265_10028171 3300028380 Bacteria 4019
815 Ga0268265_10053112 3300028380 Bacteria 3068
816 Ga0268265_10058445 3300028380 Bacteria 2944
817 Ga0268265_10079746 3300028380 Bacteria 2579
818 Ga0268265_10176810 3300028380 Bacteria 1830
819 Ga0268265_10210555 3300028380 Bacteria 1693
820 Ga0268265_10369625 3300028380 Bacteria 1316
821 Ga0268264_10000594 3300028381 Bacteria 43886
822 Ga0268264_10050338 3300028381 Bacteria 3469
823 Ga0268264_10068579 3300028381 Bacteria 2997
824 Ga0268264_10222302 3300028381 Bacteria 1739
825 Ga0268264_10631781 3300028381 Bacteria 1058
826 Ga0314311_1210440 3300030733 Bacteria 2354
827 Ga0316178_1060611 3300030735 Bacteria 1601
828 Ga0316180_1155850 3300030736 Bacteria 2863
829 Ga0307408_100011889 3300031548 Bacteria 5759
830 Ga0307408_100029310 3300031548 Bacteria 3812
831 Ga0307408_100049976 3300031548 Bacteria 3005
832 Ga0307408_100056110 3300031548 Bacteria 2855
833 Ga0307408_100338840 3300031548 Bacteria 1272
834 Ga0307405_10024745 3300031731 Bacteria 3435
835 Ga0307405_10276507 3300031731 Bacteria 1262
836 Ga0307405_10438773 3300031731 Bacteria 1032
837 Ga0307413_10007434 3300031824 Bacteria 5090
838 Ga0307413_10018307 3300031824 Bacteria 3672
839 Ga0307413_10020109 3300031824 Bacteria 3543
840 Ga0307413_10031641 3300031824 Bacteria 2988
841 Ga0307413_10142605 3300031824 Bacteria 1657
842 Ga0307413_10275981 3300031824 Bacteria 1261
843 Ga0307410_10035962 3300031852 Bacteria 3221
844 Ga0307410_10055529 3300031852 Bacteria 2689
845 Ga0307410_10060343 3300031852 Bacteria 2591
846 Ga0307410_10064244 3300031852 Bacteria 2521
847 Ga0307410_10179979 3300031852 Bacteria 1600
848 Ga0307410_10364287 3300031852 Bacteria 1158
849 Ga0307406_10054765 3300031901 Bacteria 2547
850 Ga0307406_10065286 3300031901 Bacteria 2365
851 Ga0307406_10137853 3300031901 Bacteria 1722
852 Ga0307406_10216233 3300031901 Bacteria 1421
853 Ga0307407_10006983 3300031903 Bacteria 5075
854 Ga0307407_10048019 3300031903 Bacteria 2427
855 Ga0307407_10052020 3300031903 Bacteria 2350
856 Ga0307407_10188318 3300031903 Bacteria 1373
857 Ga0307412_10011595 3300031911 Bacteria 5110
858 Ga0307412_10018791 3300031911 Bacteria 4168
859 Ga0307412_10065035 3300031911 Bacteria 2466
860 Ga0307412_10103898 3300031911 Bacteria 2015
861 Ga0307412_10365127 3300031911 Bacteria 1164
862 Ga0307409_100125019 3300031995 Bacteria 2186
863 Ga0307409_100156943 3300031995 Bacteria 1984
864 Ga0307409_100444700 3300031995 Bacteria 1249
865 Ga0307409_100700413 3300031995 Bacteria 1012
866 Ga0307409_101072063 3300031995 Bacteria 826
867 Ga0307416_100010392 3300032002 Bacteria 6144
868 Ga0307416_100012629 3300032002 Bacteria 5700
869 Ga0307416_100019598 3300032002 Bacteria 4802
870 Ga0307416_100066910 3300032002 Bacteria 2960
871 Ga0307416_100388747 3300032002 Bacteria 1428
872 Ga0307416_100668287 3300032002 Bacteria 1125
873 Ga0307416_100750514 3300032002 Bacteria 1068
874 Ga0307414_10006609 3300032004 Bacteria 6477
875 Ga0307414_10027762 3300032004 Bacteria 3662
876 Ga0307414_10065709 3300032004 Bacteria 2589
877 Ga0307414_10120203 3300032004 Bacteria 2018
878 Ga0307414_10340598 3300032004 Bacteria 1283
879 Ga0307414_10644764 3300032004 Bacteria 954
880 Ga0307411_10006078 3300032005 Bacteria 6003
881 Ga0307411_10037558 3300032005 Bacteria 3046
882 Ga0307411_10113353 3300032005 Bacteria 1945
883 Ga0307411_10136238 3300032005 Bacteria 1803
884 Ga0307411_10137157 3300032005 Bacteria 1798
885 Ga0307411_10388799 3300032005 Bacteria 1149
886 Ga0307411_10596613 3300032005 Bacteria 949
887 Ga0307415_100033686 3300032126 Bacteria 3326
888 Ga0307415_100090615 3300032126 Bacteria 2212
889 Ga0307415_100148044 3300032126 Bacteria 1803
890 Ga0307415_100373630 3300032126 Bacteria 1208
891 Ga0307415_100513444 3300032126 Bacteria 1050
892 Ga0373930_0003943 3300034816 Bacteria 2385
893 Ga0373940_0025767 3300035088 Bacteria 1534
894 Ga0373954_0035162 3300035118 Bacteria 2323
895 Ga0373943_0138120 3300035170 Bacteria 1311
896 Ga0373931_0017772 3300035691 Bacteria 3523
897 Ga0373935_0027457 3300035692 Bacteria 3517
898 Ga0373937_0064013 3300036401 Bacteria 3382
899 Ga0395899_0000103 3300037312 Bacteria 147274
900 Ga0395899_0000258 3300037312 Bacteria 69644
901 Ga0395899_0001198 3300037312 Bacteria 22796
902 Ga0395899_0005982 3300037312 Bacteria 9447
903 Ga0395899_0012190 3300037312 Bacteria 6581
904 Ga0395899_0016719 3300037312 Bacteria 5592
905 Ga0395899_0017318 3300037312 Bacteria 5491
906 Ga0395899_0025770 3300037312 Bacteria 4438
907 Ga0395899_0041445 3300037312 Bacteria 3440
908 Ga0395899_0045361 3300037312 Bacteria 3275
909 Ga0395899_0051693 3300037312 Bacteria 3048
910 Ga0395899_0053952 3300037312 Bacteria 2975
911 Ga0395899_0053982 3300037312 Bacteria 2974
912 Ga0395899_0089844 3300037312 Bacteria 2228
913 Ga0395899_0094461 3300037312 Bacteria 2164
914 Ga0395899_0162361 3300037312 Bacteria 1577
915 Ga0395899_0170226 3300037312 Bacteria 1534
916 Ga0395899_0171802 3300037312 Bacteria 1526
917 Ga0395899_0366325 3300037312 Unclassified 960
918 Ga0395900_0000093 3300037418 Bacteria 166505
919 Ga0395900_0000254 3300037418 Bacteria 83296
920 Ga0395900_0000325 3300037418 Bacteria 70579
921 Ga0395900_0003281 3300037418 Bacteria 17510
922 Ga0395900_0007015 3300037418 Bacteria 11666
923 Ga0395900_0007369 3300037418 Bacteria 11372
924 Ga0395900_0010382 3300037418 Bacteria 9521
925 Ga0395900_0012543 3300037418 Bacteria 8670
926 Ga0395900_0013998 3300037418 Bacteria 8188
927 Ga0395900_0026676 3300037418 Bacteria 5914
928 Ga0395900_0051565 3300037418 Bacteria 4237
929 Ga0395900_0053214 3300037418 Bacteria 4166
930 Ga0395900_0056809 3300037418 Bacteria 4029
931 Ga0395900_0057619 3300037418 Bacteria 4000
932 Ga0395900_0084658 3300037418 Bacteria 3258
933 Ga0395900_0092489 3300037418 Bacteria 3107
934 Ga0395900_0095271 3300037418 Bacteria 3058
935 Ga0395900_0102789 3300037418 Bacteria 2935
936 Ga0395900_0112669 3300037418 Bacteria 2793
937 Ga0395900_0129979 3300037418 Bacteria 2581
938 Ga0395900_0154585 3300037418 Bacteria 2343
939 Ga0395900_0177114 3300037418 Bacteria 2168
940 Ga0395900_0196028 3300037418 Bacteria 2046
941 Ga0395900_0219404 3300037418 Bacteria 1917
942 Ga0395900_0230126 3300037418 Bacteria 1864
943 Ga0395900_0243214 3300037418 Bacteria 1804
944 Ga0395900_0687457 3300037418 Bacteria 957
945 Ga0395898_0000053 3300037466 Bacteria 279600
946 Ga0395898_0001084 3300037466 Bacteria 42107
947 Ga0395898_0004617 3300037466 Bacteria 15031
948 Ga0395898_0029408 3300037466 Bacteria 5503
949 Ga0395898_0039524 3300037466 Bacteria 4670
950 Ga0395898_0039580 3300037466 Bacteria 4666
951 Ga0395898_0049561 3300037466 Bacteria 4114
952 Ga0395898_0078565 3300037466 Bacteria 3183
953 Ga0395898_0083567 3300037466 Bacteria 3077
954 Ga0395898_0116580 3300037466 Bacteria 2559
955 Ga0395898_0179041 3300037466 Bacteria 2026
956 Ga0395898_0205429 3300037466 Bacteria 1879
957 Ga0395898_0209103 3300037466 Bacteria 1861
958 Ga0395898_0272223 3300037466 Bacteria 1615
959 Ga0395898_0280602 3300037466 Bacteria 1589
960 Ga0395898_0447808 3300037466 Bacteria 1230
961 Ga0395898_0502123 3300037466 Bacteria 1153
962 Ga0395898_0549820 3300037466 Bacteria 1096
963 Ga0395898_0818544 3300037466 Bacteria 871
964 Ga0395905_0000031 3300037471 Bacteria 286757
965 Ga0395905_0000218 3300037471 Bacteria 87745
966 Ga0395905_0001373 3300037471 Bacteria 29537
967 Ga0395905_0001843 3300037471 Bacteria 24471
968 Ga0395905_0006008 3300037471 Bacteria 12291
969 Ga0395905_0009843 3300037471 Bacteria 9318
970 Ga0395905_0010575 3300037471 Bacteria 8962
971 Ga0395905_0010587 3300037471 Bacteria 8958
972 Ga0395905_0016261 3300037471 Bacteria 7068
973 Ga0395905_0016724 3300037471 Bacteria 6971
974 Ga0395905_0024115 3300037471 Bacteria 5741
975 Ga0395905_0027692 3300037471 Bacteria 5344
976 Ga0395905_0043845 3300037471 Bacteria 4197
977 Ga0395905_0045805 3300037471 Bacteria 4102
978 Ga0395905_0045908 3300037471 Bacteria 4097
979 Ga0395905_0069845 3300037471 Bacteria 3290
980 Ga0395905_0077926 3300037471 Bacteria 3105
981 Ga0395905_0085306 3300037471 Bacteria 2959
982 Ga0395905_0094175 3300037471 Bacteria 2809
983 Ga0395905_0102774 3300037471 Bacteria 2683
984 Ga0395905_0115598 3300037471 Bacteria 2521
985 Ga0395905_0121000 3300037471 Bacteria 2460
986 Ga0395905_0121015 3300037471 Bacteria 2460
987 Ga0395905_0142392 3300037471 Bacteria 2255
988 Ga0395905_0161530 3300037471 Bacteria 2105
989 Ga0395905_0176198 3300037471 Bacteria 2008
990 Ga0395905_0178583 3300037471 Bacteria 1993
991 Ga0395905_0192613 3300037471 Bacteria 1912
992 Ga0395905_0198150 3300037471 Bacteria 1883
993 Ga0395905_0222246 3300037471 Bacteria 1767
994 Ga0395905_0233319 3300037471 Bacteria 1720
995 Ga0395905_0234240 3300037471 Bacteria 1716
996 Ga0395905_0291130 3300037471 Bacteria 1519
997 Ga0395901_0000030 3300038443 Bacteria 241916
998 Ga0395901_0000603 3300038443 Bacteria 41824
999 Ga0395901_0000962 3300038443 Bacteria 31358
1000 Ga0395901_0001133 3300038443 Bacteria 28265
1001 Ga0395901_0002677 3300038443 Bacteria 17972
1002 Ga0395901_0026729 3300038443 Bacteria 5925
1003 Ga0395901_0030345 3300038443 Bacteria 5569
1004 Ga0395901_0045421 3300038443 Bacteria 4558
1005 Ga0395901_0055540 3300038443 Bacteria 4118
1006 Ga0395901_0071471 3300038443 Bacteria 3616
1007 Ga0395901_0089256 3300038443 Bacteria 3225
1008 Ga0395901_0099227 3300038443 Bacteria 3053
1009 Ga0395901_0107449 3300038443 Bacteria 2929
1010 Ga0395901_0108113 3300038443 Bacteria 2920
1011 Ga0395901_0191992 3300038443 Bacteria 2141
1012 Ga0395901_0207644 3300038443 Bacteria 2051
1013 Ga0395901_0220149 3300038443 Bacteria 1984
1014 Ga0395901_0220892 3300038443 Bacteria 1980
1015 Ga0395901_0224323 3300038443 Bacteria 1963
1016 Ga0395901_0319726 3300038443 Bacteria 1606
1017 Ga0395901_0375600 3300038443 Bacteria 1464
1018 Ga0395901_0613643 3300038443 Bacteria 1095
1019 Ga0395901_0621145 3300038443 Bacteria 1087
1020 Ga0395901_0878864 3300038443 Bacteria 879
1021 Ga0436365_0813844 3300039437 Bacteria 6011
1022 Ga0436365_1200409 3300039437 Bacteria 2522
1023 Ga0439448_0058437 3300042005 Bacteria 1272
1024 Ga0439432_019048 3300042006 Bacteria 2290
1025 Ga0439462_0003175 3300042015 Bacteria 3920
1026 Ga0450889_001073 3300042144 Bacteria 2870
1027 Ga0439434_0033268 3300042435 Bacteria 1571
1028 Ga0439464_0001273 3300042439 Bacteria 5861
1029 Ga0466969_0041053 3300044656 Bacteria 2316
1030 Ga0466965_0024422 3300044683 Bacteria 2924
1031 Ga0466966_0000040 3300044684 Bacteria 97159
1032 Ga0466966_0003997 3300044684 Bacteria 9739
1033 Ga0466966_0009110 3300044684 Bacteria 6574
1034 Ga0466966_0013352 3300044684 Bacteria 5436
1035 Ga0466966_0030967 3300044684 Bacteria 3470
1036 Ga0466966_0088973 3300044684 Bacteria 1918
1037 Ga0466966_0099973 3300044684 Bacteria 1794
1038 Ga0466966_0109882 3300044684 Bacteria 1700
1039 Ga0466966_0128561 3300044684 Bacteria 1552
1040 Ga0466961_0005676 3300044693 Bacteria 7889
1041 Ga0466961_0014064 3300044693 Bacteria 5132
1042 Ga0466961_0059538 3300044693 Bacteria 2429
1043 Ga0466961_0187351 3300044693 Bacteria 1283
1044 Ga0466963_0005840 3300044694 Bacteria 7246
1045 Ga0466963_0009039 3300044694 Bacteria 5986
1046 Ga0466963_0010230 3300044694 Bacteria 5674
1047 Ga0466963_0010809 3300044694 Bacteria 5540
1048 Ga0466963_0012991 3300044694 Bacteria 5104
1049 Ga0466963_0104377 3300044694 Bacteria 1942
1050 Ga0466963_0119278 3300044694 Bacteria 1814
1051 Ga0466963_0132539 3300044694 Bacteria 1722
1052 Ga0466964_0015616 3300044706 Bacteria 2891
1053 Ga0466971_0004851 3300044719 Bacteria 5818
1054 Ga0466971_0021489 3300044719 Bacteria 2872
1055 Ga0466971_0024646 3300044719 Bacteria 2684
1056 Ga0466971_0208707 3300044719 Bacteria 923
1057 Ga0466968_0071788 3300044735 Bacteria 1508
1058 Ga0466970_0020790 3300044765 Bacteria 3414
1059 Ga0466970_0025510 3300044765 Bacteria 3095
1060 Ga0466970_0027849 3300044765 Bacteria 2967
1061 Ga0466970_0032630 3300044765 Bacteria 2751
1062 Ga0466957_0004308 3300044842 Bacteria 7899
1063 Ga0466957_0007856 3300044842 Bacteria 6047
1064 Ga0466957_0009860 3300044842 Bacteria 5461
1065 Ga0466957_0027323 3300044842 Bacteria 3391
1066 Ga0466957_0054483 3300044842 Bacteria 2441
1067 Ga0466957_0055976 3300044842 Bacteria 2411
1068 Ga0466957_0124291 3300044842 Bacteria 1647
1069 Ga0466959_0011278 3300045049 Bacteria 6414
1070 Ga0466959_0050974 3300045049 Bacteria 3038
1071 Ga0466959_0108434 3300045049 Bacteria 1983
1072 Ga0466959_0109205 3300045049 Bacteria 1975
1073 Ga0466959_0121256 3300045049 Bacteria 1858
1074 Ga0466959_0233223 3300045049 Bacteria 1273
1075 Ga0466959_0403872 3300045049 Bacteria 928
1076 Ga0466958_0003093 3300045836 Bacteria 8542
1077 Ga0466958_0010790 3300045836 Bacteria 5127
1078 Ga0466958_0024570 3300045836 Bacteria 3546
1079 Ga0466958_0075556 3300045836 Bacteria 2067
1080 Ga0466958_0077273 3300045836 Bacteria 2044
1081 Ga0466958_0270170 3300045836 Bacteria 1089
1082 Ga0466967_0000651 3300045976 Bacteria 17431
1083 Ga0466967_0001599 3300045976 Bacteria 13345
1084 Ga0466967_0004220 3300045976 Bacteria 9640
1085 Ga0466967_0016058 3300045976 Bacteria 5891
1086 Ga0466967_0019582 3300045976 Bacteria 5446
1087 Ga0466967_0058141 3300045976 Bacteria 3417
1088 Ga0466967_0068688 3300045976 Bacteria 3165
1089 Ga0466967_0120715 3300045976 Bacteria 2421
1090 Ga0466967_0178284 3300045976 Bacteria 2003
1091 Ga0466967_0182448 3300045976 Bacteria 1980
1092 Ga0466967_0306359 3300045976 Bacteria 1529
1093 Ga0466967_0311096 3300045976 Bacteria 1517
1094 Ga0466967_0357487 3300045976 Bacteria 1414
1095 Ga0466967_0380379 3300045976 Bacteria 1370
1096 Ga0466967_0441020 3300045976 Bacteria 1271
1097 Ga0495584_0058572 3300046491 Bacteria 1938
1098 Ga0495596_0055479 3300046500 Bacteria 1548
1099 Ga0495663_0009725 3300046525 Bacteria 2668
1100 Ga0495663_0018057 3300046525 Bacteria 2006
1101 Ga0495598_0021035 3300046537 Bacteria 1730
1102 Ga0495598_0056973 3300046537 Bacteria 1194
1103 Ga0495621_0008001 3300046539 Bacteria 3151
1104 Ga0495597_0079249 3300046542 Bacteria 1407
1105 Ga0495668_0012970 3300046616 Bacteria 4933
1106 Ga0495668_0087717 3300046616 Bacteria 1706
1107 Ga0495659_0005509 3300046664 Bacteria 3983
1108 Ga0495623_0046451 3300046679 Bacteria 2756
1109 Ga0495669_0021522 3300046684 Bacteria 2799
1110 Ga0495670_0099502 3300046691 Bacteria 1496
1111 Ga0495636_0088809 3300047318 Bacteria 1340
1112 Ga0495677_0056911 3300047445 Bacteria 1445
1113 Ga0496102_0020707 3300048905 Bacteria 5812
1114 Ga0496103_0007362 3300048906 Bacteria 6560
1115 Ga0496106_0016894 3300048909 Bacteria 5401
1116 Ga0496107_0036931 3300048910 Bacteria 3505
1117 Ga0496107_0105049 3300048910 Bacteria 2073
1118 Ga0496107_0183064 3300048910 Bacteria 1556
1119 Ga0496107_0241198 3300048910 Bacteria 1345
1120 Ga0496108_0010565 3300048911 Bacteria 7495
1121 Ga0496108_0039973 3300048911 Bacteria 3908
1122 Ga0496109_0008469 3300048912 Bacteria 8743
1123 Ga0496109_0202215 3300048912 Bacteria 1868
1124 Ga0496110_0002515 3300048913 Bacteria 13774
1125 Ga0496110_0023537 3300048913 Bacteria 5240
1126 Ga0496110_0336135 3300048913 Bacteria 1376
1127 Ga0496111_0003916 3300048914 Bacteria 9331
1128 Ga0496111_0038041 3300048914 Bacteria 3446
1129 Ga0496111_0063305 3300048914 Bacteria 2682
1130 Ga0496111_0264471 3300048914 Bacteria 1276
1131 Ga0496112_0003787 3300048915 Bacteria 12636
1132 Ga0496112_0024520 3300048915 Bacteria 5777
1133 Ga0496112_0066201 3300048915 Bacteria 3565
1134 Ga0496112_0067079 3300048915 Bacteria 3541
1135 Ga0496112_0067093 3300048915 Bacteria 3540
1136 Ga0496112_0135604 3300048915 Bacteria 2432
1137 Ga0496113_0002425 3300048916 Bacteria 10840
1138 Ga0496113_0322501 3300048916 Bacteria 1238
1139 Ga0496113_0330000 3300048916 Bacteria 1223
1140 Ga0496114_0000019 3300048917 Bacteria 244365
1141 Ga0501310_005781 3300049130 Bacteria 1277
1142 Ga0501315_008395 3300049531 Bacteria 1201
1143 Ga0501034_0038567 3300049571 Bacteria 4837
1144 Ga0501036_0191857 3300049572 Bacteria 1719
1145 Ga0501047_0209826 3300049581 Bacteria 1806
1146 Ga0501069_0091314 3300049585 Bacteria 1722
1147 Ga0501207_012210 3300049654 Bacteria 1289
1148 Ga0501217_011813 3300049661 Bacteria 1937
1149 Ga0501217_052464 3300049661 Bacteria 1070
1150 Ga0501223_008280 3300049663 Bacteria 2120
1151 Ga0501233_005000 3300049668 Bacteria 2453
1152 Ga0501235_049723 3300049669 Unclassified 970
1153 Ga0501080_0093792 3300049742 Bacteria 2787
1154 Ga0501267_006396 3300049764 Bacteria 1132
1155 Ga0501268_001492 3300049765 Bacteria 2934
1156 Ga0501268_013999 3300049765 Bacteria 1302
1157 Ga0501273_006056 3300049770 Bacteria 1387
1158 Ga0501044_0145012 3300049823 Bacteria 2361
1159 Ga0501044_0228910 3300049823 Bacteria 1807
1160 nmdc:mga05p37_203026_c1 3300050507 Bacteria 2399
1161 nmdc:mga09592_278229_c1 3300050508 Bacteria 1451
1162 nmdc:mga06r32_244961_c1 3300050510 Bacteria 1780
1163 nmdc:mga08y16_133627_c1 3300050511 Bacteria 2579
1164 nmdc:mga08x19_303978_c1 3300050514 Bacteria 1108
1165 nmdc:mga0a205_1450_c1 3300050515 Bacteria 20207
1166 Ga0500643_000001 3300053087 Bacteria 1440111
1167 Ga0500658_0000041 3300053134 Bacteria 77435
1168 Ga0500604_0018603 3300053151 Bacteria 1937
1169 Ga0500616_0003651 3300053153 Bacteria 11556
1170 Ga0500645_041608 3300053730 Bacteria 1357
1171 Ga0587066_007332 3300059490 Bacteria 1491
1172 Ga0587090_004776 3300059510 Bacteria 1664
1173 Ga0587090_018476 3300059510 Bacteria 1066
1174 Ga0587092_023171 3300059512 Bacteria 976
1175 Ga0587106_009386 3300059605 Bacteria 1243
1176 Ga0587101_002602 3300059623 Bacteria 1745
1177 Ga0587075_011312 3300059644 Bacteria 1195
1178 Ga0587078_006952 3300059646 Bacteria 1240
1179 Ga0587079_013900 3300059647 Bacteria 1341
1180 Ga0587079_017477 3300059647 Bacteria 1245
1181 Ga0587079_027440 3300059647 Bacteria 1071
1182 Ga0587071_004639 3300060344 Bacteria 2061
1183 Ga0587071_056784 3300060344 Bacteria 823
1184 Ga0466962_0004600 3300061719 Bacteria 6619
1185 Ga0466962_0088504 3300061719 Unclassified 1483

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049130 Ga0501310_005781 Ga0501310_005781_21_761 226
2 3300031824 Ga0307413_10031641 Ga0307413_100316413 229
3 3300031852 Ga0307410_10060343 Ga0307410_100603435 229
4 3300031911 Ga0307412_10011595 Ga0307412_100115954 229
5 3300032002 Ga0307416_100010392 Ga0307416_1000103926 229
6 3300032004 Ga0307414_10006609 Ga0307414_100066093 229
7 3300032005 Ga0307411_10006078 Ga0307411_100060786 229
8 3300049531 Ga0501315_008395 Ga0501315_008395_411_1181 229
9 3300049654 Ga0501207_012210 Ga0501207_012210_497_1267 229
10 3300049661 Ga0501217_011813 Ga0501217_011813_665_1435 229
11 3300049668 Ga0501233_005000 Ga0501233_005000_1482_2252 229
12 3300049764 Ga0501267_006396 Ga0501267_006396_122_892 229
13 3300049765 Ga0501268_001492 Ga0501268_001492_1488_2258 229
14 3300049770 Ga0501273_006056 Ga0501273_006056_597_1367 229
15 3300027876 Ga0209974_10013126 Ga0209974_100131263 232
16 3300031824 Ga0307413_10018307 Ga0307413_100183076 232
17 3300031995 Ga0307409_100444700 Ga0307409_1004447002 232
18 3300049765 Ga0501268_013999 Ga0501268_013999_473_1213 232
19 3300037418 Ga0395900_0000325 Ga0395900_0000325_55117_55887 233
20 3300037466 Ga0395898_0272223 Ga0395898_0272223_730_1500 233
21 3300037471 Ga0395905_0000218 Ga0395905_0000218_54743_55513 233
22 3300038443 Ga0395901_0000962 Ga0395901_0000962_20330_21100 233
23 3300031731 Ga0307405_10438773 Ga0307405_104387732 236
24 3300046491 Ga0495584_0058572 Ga0495584_0058572_693_1472 236
25 3300053730 Ga0500645_041608 Ga0500645_041608_171_950 238
26 3300005327 Ga0070658_10005251 Ga0070658_100052518 239
27 3300005329 Ga0070683_100022957 Ga0070683_1000229575 239
28 3300005336 Ga0070680_100030936 Ga0070680_1000309365 239
29 3300005339 Ga0070660_100004077 Ga0070660_1000040776 239
30 3300005344 Ga0070661_100000735 Ga0070661_10000073519 239
31 3300005366 Ga0070659_100002707 Ga0070659_10000270715 239
32 3300005457 Ga0070662_100000685 Ga0070662_10000068518 239
33 3300005458 Ga0070681_10005216 Ga0070681_100052165 239
34 3300005530 Ga0070679_100023736 Ga0070679_1000237365 239
35 3300005539 Ga0068853_100000358 Ga0068853_10000035813 239
36 3300005563 Ga0068855_100002925 Ga0068855_1000029256 239
37 3300005564 Ga0070664_100007055 Ga0070664_1000070557 239
38 3300005577 Ga0068857_100019286 Ga0068857_1000192862 239
39 3300005578 Ga0068854_100012398 Ga0068854_1000123986 239
40 3300005614 Ga0068856_100005500 Ga0068856_1000055005 239
41 3300010375 Ga0105239_10958780 Ga0105239_109587802 239
42 3300013100 Ga0157373_10001222 Ga0157373_1000122218 239
43 3300013102 Ga0157371_10004503 Ga0157371_100045038 239
44 3300013104 Ga0157370_10024298 Ga0157370_100242985 239
45 3300013105 Ga0157369_10008548 Ga0157369_100085488 239
46 3300013307 Ga0157372_10041031 Ga0157372_100410315 239
47 3300025909 Ga0207705_10031145 Ga0207705_100311455 239
48 3300025912 Ga0207707_10021788 Ga0207707_100217887 239
49 3300025917 Ga0207660_10010780 Ga0207660_100107806 239
50 3300025919 Ga0207657_10000077 Ga0207657_1000007735 239
51 3300025920 Ga0207649_10009034 Ga0207649_100090344 239
52 3300025921 Ga0207652_10019345 Ga0207652_100193456 239
53 3300025932 Ga0207690_10001427 Ga0207690_100014276 239
54 3300025933 Ga0207706_10000204 Ga0207706_100002048 239
55 3300025944 Ga0207661_10003474 Ga0207661_100034746 239
56 3300025945 Ga0207679_10018236 Ga0207679_100182363 239
57 3300025949 Ga0207667_10005685 Ga0207667_1000568512 239
58 3300025981 Ga0207640_10007531 Ga0207640_100075315 239
59 3300026041 Ga0207639_10000847 Ga0207639_100008478 239
60 3300026078 Ga0207702_10015456 Ga0207702_100154565 239
61 3300026116 Ga0207674_10161846 Ga0207674_101618462 239
62 3300032002 Ga0307416_100066910 Ga0307416_1000669103 239
63 3300032005 Ga0307411_10113353 Ga0307411_101133532 239
64 3300046537 Ga0495598_0021035 Ga0495598_0021035_262_1038 239
65 3300046539 Ga0495621_0008001 Ga0495621_0008001_1094_1870 239
66 3300049663 Ga0501223_008280 Ga0501223_008280_906_1676 239
67 3300005327 Ga0070658_10046371 Ga0070658_100463712 240
68 3300049669 Ga0501235_049723 Ga0501235_049723_61_831 240
69 3300031548 Ga0307408_100011889 Ga0307408_1000118896 241
70 3300031911 Ga0307412_10018791 Ga0307412_100187915 241
71 3300032002 Ga0307416_100012629 Ga0307416_1000126296 241
72 3300032004 Ga0307414_10027762 Ga0307414_100277626 241
73 3300032005 Ga0307411_10037558 Ga0307411_100375581 241
74 3300032126 Ga0307415_100033686 Ga0307415_1000336865 241
75 3300005347 Ga0070668_100047206 Ga0070668_1000472066 242
76 3300005353 Ga0070669_100217807 Ga0070669_1002178072 242
77 3300005844 Ga0068862_100149115 Ga0068862_1001491151 242
78 3300014326 Ga0157380_10364791 Ga0157380_103647911 242
79 3300025923 Ga0207681_10270230 Ga0207681_102702302 242
80 3300046542 Ga0495597_0079249 Ga0495597_0079249_226_996 242
81 3300049742 Ga0501080_0093792 Ga0501080_0093792_1746_2525 242
82 3300026041 Ga0207639_10707423 Ga0207639_107074231 243
83 3300049661 Ga0501217_052464 Ga0501217_052464_62_832 243
84 3300044684 Ga0466966_0128561 Ga0466966_0128561_427_1206 244
85 3300045049 Ga0466959_0109205 Ga0466959_0109205_1060_1839 244
86 3300005347 Ga0070668_100055873 Ga0070668_1000558736 245
87 3300005347 Ga0070668_100359606 Ga0070668_1003596062 245
88 3300005539 Ga0068853_100016145 Ga0068853_1000161455 245
89 3300009094 Ga0111539_10191515 Ga0111539_101915153 245
90 3300009553 Ga0105249_10158478 Ga0105249_101584784 245
91 3300025923 Ga0207681_10005902 Ga0207681_100059025 245
92 3300025961 Ga0207712_10192049 Ga0207712_101920493 245
93 3300025972 Ga0207668_10313894 Ga0207668_103138942 245
94 3300031731 Ga0307405_10276507 Ga0307405_102765073 245
95 3300032005 Ga0307411_10596613 Ga0307411_105966131 245
96 3300046500 Ga0495596_0055479 Ga0495596_0055479_264_1043 245
97 3300046525 Ga0495663_0009725 Ga0495663_0009725_792_1571 245
98 3300046537 Ga0495598_0056973 Ga0495598_0056973_387_1166 245
99 3300046664 Ga0495659_0005509 Ga0495659_0005509_2140_2919 245
100 3300046691 Ga0495670_0099502 Ga0495670_0099502_57_836 245
101 3300050510 nmdc:mga06r32_244961_c1 nmdc:mga06r32_244961_c1_771_1544 245
102 3300005844 Ga0068862_100200306 Ga0068862_1002003063 246
103 3300037471 Ga0395905_0178583 Ga0395905_0178583_535_1308 246
104 3300046525 Ga0495663_0018057 Ga0495663_0018057_1120_1899 246
105 3300046684 Ga0495669_0021522 Ga0495669_0021522_1254_2033 246
106 3300047318 Ga0495636_0088809 Ga0495636_0088809_200_979 246
107 3300047445 Ga0495677_0056911 Ga0495677_0056911_263_1042 246
108 3300005336 Ga0070680_100009825 Ga0070680_1000098255 247
109 3300005458 Ga0070681_10079843 Ga0070681_100798433 247
110 3300005539 Ga0068853_100153076 Ga0068853_1001530763 247
111 3300005578 Ga0068854_100004790 Ga0068854_1000047905 247
112 3300005616 Ga0068852_100023861 Ga0068852_1000238615 247
113 3300013100 Ga0157373_10229036 Ga0157373_102290361 247
114 3300013104 Ga0157370_10557760 Ga0157370_105577602 247
115 3300013307 Ga0157372_10301922 Ga0157372_103019223 247
116 3300013307 Ga0157372_10359964 Ga0157372_103599643 247
117 3300025917 Ga0207660_10005638 Ga0207660_100056382 247
118 3300025917 Ga0207660_10026000 Ga0207660_100260003 247
119 3300025949 Ga0207667_10040222 Ga0207667_100402225 247
120 3300025981 Ga0207640_10016771 Ga0207640_100167712 247
121 3300026041 Ga0207639_10127004 Ga0207639_101270042 247
122 3300026078 Ga0207702_10037633 Ga0207702_100376333 247
123 3300026142 Ga0207698_10032766 Ga0207698_100327664 247
124 3300031548 Ga0307408_100049976 Ga0307408_1000499763 247
125 3300031911 Ga0307412_10103898 Ga0307412_101038983 247
126 3300049823 Ga0501044_0145012 Ga0501044_0145012_1282_2061 247
127 3300050507 nmdc:mga05p37_203026_c1 nmdc:mga05p37_203026_c1_1176_1949 247
128 3300050508 nmdc:mga09592_278229_c1 nmdc:mga09592_278229_c1_277_1050 247
129 3300001915 JGI24741J21665_1022048 JGI24741J21665_10220482 249
130 3300001979 JGI24740J21852_10005854 JGI24740J21852_100058544 249
131 3300005327 Ga0070658_10083024 Ga0070658_100830241 249
132 3300005339 Ga0070660_100004389 Ga0070660_1000043895 249
133 3300005344 Ga0070661_100010100 Ga0070661_1000101002 249
134 3300005366 Ga0070659_100056234 Ga0070659_1000562344 249
135 3300005435 Ga0070714_100034254 Ga0070714_1000342545 249
136 3300005435 Ga0070714_100038969 Ga0070714_1000389695 249
137 3300005436 Ga0070713_100071296 Ga0070713_1000712964 249
138 3300005455 Ga0070663_100049868 Ga0070663_1000498683 249
139 3300005535 Ga0070684_100263514 Ga0070684_1002635142 249
140 3300005535 Ga0070684_100490141 Ga0070684_1004901412 249
141 3300005539 Ga0068853_100032854 Ga0068853_1000328546 249
142 3300005563 Ga0068855_100550078 Ga0068855_1005500783 249
143 3300005577 Ga0068857_100036829 Ga0068857_1000368293 249
144 3300009174 Ga0105241_10242046 Ga0105241_102420462 249
145 3300009545 Ga0105237_10111045 Ga0105237_101110454 249
146 3300009551 Ga0105238_10021856 Ga0105238_100218566 249
147 3300010375 Ga0105239_10212835 Ga0105239_102128353 249
148 3300013100 Ga0157373_10024962 Ga0157373_100249626 249
149 3300013102 Ga0157371_10479391 Ga0157371_104793911 249
150 3300013104 Ga0157370_10396485 Ga0157370_103964852 249
151 3300013307 Ga0157372_10390415 Ga0157372_103904152 249
152 3300025904 Ga0207647_10016675 Ga0207647_100166756 249
153 3300025909 Ga0207705_10001951 Ga0207705_1000195112 249
154 3300025913 Ga0207695_10486157 Ga0207695_104861572 249
155 3300025914 Ga0207671_10380143 Ga0207671_103801432 249
156 3300025919 Ga0207657_10002467 Ga0207657_1000246719 249
157 3300025920 Ga0207649_10003557 Ga0207649_100035576 249
158 3300025924 Ga0207694_10025045 Ga0207694_100250456 249
159 3300025928 Ga0207700_10051185 Ga0207700_100511853 249
160 3300025929 Ga0207664_10024781 Ga0207664_100247814 249
161 3300025932 Ga0207690_10039518 Ga0207690_100395183 249
162 3300025944 Ga0207661_10090819 Ga0207661_100908194 249
163 3300025981 Ga0207640_10015002 Ga0207640_100150022 249
164 3300026041 Ga0207639_10166683 Ga0207639_101666834 249
165 3300026067 Ga0207678_10026852 Ga0207678_100268522 249
166 3300026116 Ga0207674_10036665 Ga0207674_100366654 249
167 3300026142 Ga0207698_10004660 Ga0207698_100046606 249
168 3300037312 Ga0395899_0041445 Ga0395899_0041445_446_1216 249
169 3300037418 Ga0395900_0230126 Ga0395900_0230126_770_1540 249
170 3300037466 Ga0395898_0209103 Ga0395898_0209103_1003_1773 249
171 3300042015 Ga0439462_0003175 Ga0439462_0003175_2302_3060 249
172 3300044683 Ga0466965_0024422 Ga0466965_0024422_2035_2793 249
173 3300044693 Ga0466961_0005676 Ga0466961_0005676_2380_3138 249
174 3300045049 Ga0466959_0011278 Ga0466959_0011278_4921_5679 249
175 3300053087 Ga0500643_000001 Ga0500643_000001_1119507_1120265 249
176 3300005327 Ga0070658_10172273 Ga0070658_101722734 250
177 3300005327 Ga0070658_10230337 Ga0070658_102303373 250
178 3300005336 Ga0070680_100001538 Ga0070680_10000153811 250
179 3300005344 Ga0070661_100026656 Ga0070661_1000266565 250
180 3300005347 Ga0070668_100407466 Ga0070668_1004074662 250
181 3300005353 Ga0070669_100180506 Ga0070669_1001805062 250
182 3300005366 Ga0070659_100014558 Ga0070659_1000145585 250
183 3300005455 Ga0070663_100038844 Ga0070663_1000388443 250
184 3300005458 Ga0070681_10012507 Ga0070681_100125074 250
185 3300005563 Ga0068855_100141286 Ga0068855_1001412865 250
186 3300005563 Ga0068855_100273827 Ga0068855_1002738273 250
187 3300005577 Ga0068857_100102883 Ga0068857_1001028832 250
188 3300005616 Ga0068852_100173397 Ga0068852_1001733974 250
189 3300005616 Ga0068852_100808624 Ga0068852_1008086242 250
190 3300013104 Ga0157370_10432012 Ga0157370_104320122 250
191 3300013105 Ga0157369_10000553 Ga0157369_1000055325 250
192 3300013105 Ga0157369_10057491 Ga0157369_100574915 250
193 3300025909 Ga0207705_10337840 Ga0207705_103378402 250
194 3300025912 Ga0207707_10237642 Ga0207707_102376421 250
195 3300025914 Ga0207671_10500243 Ga0207671_105002431 250
196 3300025917 Ga0207660_10110471 Ga0207660_101104714 250
197 3300025919 Ga0207657_10111021 Ga0207657_101110214 250
198 3300025920 Ga0207649_10225715 Ga0207649_102257151 250
199 3300025931 Ga0207644_10103917 Ga0207644_101039172 250
200 3300025932 Ga0207690_10133924 Ga0207690_101339243 250
201 3300025933 Ga0207706_10137295 Ga0207706_101372952 250
202 3300025949 Ga0207667_10060365 Ga0207667_100603652 250
203 3300025949 Ga0207667_10186843 Ga0207667_101868433 250
204 3300026023 Ga0207677_10646115 Ga0207677_106461151 250
205 3300026041 Ga0207639_10104605 Ga0207639_101046053 250
206 3300026067 Ga0207678_10024047 Ga0207678_100240476 250
207 3300026078 Ga0207702_10442568 Ga0207702_104425682 250
208 3300026116 Ga0207674_10103298 Ga0207674_101032983 250
209 3300026142 Ga0207698_10252308 Ga0207698_102523082 250
210 3300026142 Ga0207698_10743066 Ga0207698_107430662 250
211 3300038443 Ga0395901_0878864 Ga0395901_0878864_110_862 250
212 3300044656 Ga0466969_0041053 Ga0466969_0041053_74_844 250
213 3300044684 Ga0466966_0088973 Ga0466966_0088973_38_808 250
214 3300044694 Ga0466963_0009039 Ga0466963_0009039_3974_4744 250
215 3300044719 Ga0466971_0004851 Ga0466971_0004851_4543_5313 250
216 3300044765 Ga0466970_0025510 Ga0466970_0025510_621_1391 250
217 3300044842 Ga0466957_0027323 Ga0466957_0027323_160_930 250
218 3300045049 Ga0466959_0108434 Ga0466959_0108434_744_1514 250
219 3300048914 Ga0496111_0264471 Ga0496111_0264471_18_770 250
220 3300061719 Ga0466962_0004600 Ga0466962_0004600_2845_3615 250
221 3300005327 Ga0070658_10341173 Ga0070658_103411732 251
222 3300009177 Ga0105248_10834807 Ga0105248_108348071 251
223 3300031903 Ga0307407_10188318 Ga0307407_101883182 251
224 3300042435 Ga0439434_0033268 Ga0439434_0033268_67_825 251
225 3300005327 Ga0070658_10000927 Ga0070658_100009275 252
226 3300005327 Ga0070658_10007130 Ga0070658_1000713012 252
227 3300005339 Ga0070660_100000184 Ga0070660_10000018431 252
228 3300005345 Ga0070692_10007799 Ga0070692_100077996 252
229 3300005455 Ga0070663_100005406 Ga0070663_1000054066 252
230 3300005458 Ga0070681_10189912 Ga0070681_101899123 252
231 3300005530 Ga0070679_100560042 Ga0070679_1005600422 252
232 3300005563 Ga0068855_100000907 Ga0068855_10000090719 252
233 3300005563 Ga0068855_100330929 Ga0068855_1003309293 252
234 3300013102 Ga0157371_10000705 Ga0157371_1000070541 252
235 3300013104 Ga0157370_10267670 Ga0157370_102676702 252
236 3300025909 Ga0207705_10000050 Ga0207705_1000005028 252
237 3300025909 Ga0207705_10001324 Ga0207705_100013245 252
238 3300025909 Ga0207705_10087789 Ga0207705_100877892 252
239 3300025909 Ga0207705_10359167 Ga0207705_103591671 252
240 3300025909 Ga0207705_10435159 Ga0207705_104351592 252
241 3300025912 Ga0207707_10147117 Ga0207707_101471172 252
242 3300025919 Ga0207657_10000210 Ga0207657_1000021029 252
243 3300025919 Ga0207657_10000301 Ga0207657_1000030112 252
244 3300025921 Ga0207652_10045902 Ga0207652_100459025 252
245 3300025921 Ga0207652_10421378 Ga0207652_104213782 252
246 3300025932 Ga0207690_10262770 Ga0207690_102627702 252
247 3300025949 Ga0207667_10000327 Ga0207667_1000032726 252
248 3300025981 Ga0207640_10007538 Ga0207640_100075385 252
249 3300026067 Ga0207678_10002367 Ga0207678_100023676 252
250 3300031548 Ga0307408_100056110 Ga0307408_1000561102 252
251 3300031852 Ga0307410_10064244 Ga0307410_100642445 252
252 3300031901 Ga0307406_10065286 Ga0307406_100652862 252
253 3300031903 Ga0307407_10006983 Ga0307407_100069835 252
254 3300031995 Ga0307409_100125019 Ga0307409_1001250192 252
255 3300032002 Ga0307416_100019598 Ga0307416_1000195986 252
256 3300032002 Ga0307416_100388747 Ga0307416_1003887473 252
257 3300037312 Ga0395899_0000258 Ga0395899_0000258_44671_45444 252
258 3300037312 Ga0395899_0005982 Ga0395899_0005982_6862_7650 252
259 3300037312 Ga0395899_0171802 Ga0395899_0171802_34_807 252
260 3300037418 Ga0395900_0000254 Ga0395900_0000254_21839_22612 252
261 3300037466 Ga0395898_0116580 Ga0395898_0116580_1461_2234 252
262 3300037471 Ga0395905_0009843 Ga0395905_0009843_7054_7842 252
263 3300037471 Ga0395905_0142392 Ga0395905_0142392_193_966 252
264 3300038443 Ga0395901_0000030 Ga0395901_0000030_60685_61458 252
265 3300038443 Ga0395901_0191992 Ga0395901_0191992_163_936 252
266 3300027876 Ga0209974_10147890 Ga0209974_101478901 254
267 3300031731 Ga0307405_10024745 Ga0307405_100247453 254
268 3300031824 Ga0307413_10007434 Ga0307413_100074342 254
269 3300031852 Ga0307410_10035962 Ga0307410_100359626 254
270 3300031852 Ga0307410_10055529 Ga0307410_100555295 254
271 3300031852 Ga0307410_10179979 Ga0307410_101799792 254
272 3300031901 Ga0307406_10137853 Ga0307406_101378532 254
273 3300031901 Ga0307406_10216233 Ga0307406_102162331 254
274 3300031903 Ga0307407_10052020 Ga0307407_100520203 254
275 3300031995 Ga0307409_100700413 Ga0307409_1007004131 254
276 3300031995 Ga0307409_101072063 Ga0307409_1010720631 254
277 3300032002 Ga0307416_100668287 Ga0307416_1006682872 254
278 3300032004 Ga0307414_10065709 Ga0307414_100657094 254
279 3300032004 Ga0307414_10120203 Ga0307414_101202033 254
280 3300032004 Ga0307414_10340598 Ga0307414_103405982 254
281 3300032005 Ga0307411_10137157 Ga0307411_101371571 254
282 3300032005 Ga0307411_10388799 Ga0307411_103887992 254
283 3300032126 Ga0307415_100090615 Ga0307415_1000906153 254
284 3300032126 Ga0307415_100373630 Ga0307415_1003736302 254
285 3300046616 Ga0495668_0087717 Ga0495668_0087717_503_1273 254
286 3300001990 JGI24737J22298_10013000 JGI24737J22298_100130003 255
287 3300002073 JGI24745J21846_1003467 JGI24745J21846_10034672 255
288 3300005295 Ga0065707_10172306 Ga0065707_101723061 255
289 3300005327 Ga0070658_10135505 Ga0070658_101355054 255
290 3300005327 Ga0070658_10152496 Ga0070658_101524962 255
291 3300005331 Ga0070670_100074213 Ga0070670_1000742135 255
292 3300005338 Ga0068868_100643366 Ga0068868_1006433661 255
293 3300005354 Ga0070675_100070316 Ga0070675_1000703164 255
294 3300005366 Ga0070659_100062295 Ga0070659_1000622951 255
295 3300005366 Ga0070659_100274087 Ga0070659_1002740872 255
296 3300005434 Ga0070709_10028144 Ga0070709_100281444 255
297 3300005435 Ga0070714_100032754 Ga0070714_1000327545 255
298 3300005436 Ga0070713_100057682 Ga0070713_1000576825 255
299 3300005436 Ga0070713_100366009 Ga0070713_1003660092 255
300 3300005457 Ga0070662_100212792 Ga0070662_1002127923 255
301 3300005564 Ga0070664_100105123 Ga0070664_1001051235 255
302 3300005615 Ga0070702_100394540 Ga0070702_1003945401 255
303 3300005718 Ga0068866_10014334 Ga0068866_100143342 255
304 3300005834 Ga0068851_10195655 Ga0068851_101956552 255
305 3300006173 Ga0070716_100007713 Ga0070716_1000077132 255
306 3300006871 Ga0075434_100287522 Ga0075434_1002875223 255
307 3300009098 Ga0105245_10061467 Ga0105245_100614675 255
308 3300009176 Ga0105242_10098610 Ga0105242_100986103 255
309 3300009177 Ga0105248_10501873 Ga0105248_105018732 255
310 3300011119 Ga0105246_10413664 Ga0105246_104136642 255
311 3300013296 Ga0157374_10406631 Ga0157374_104066313 255
312 3300013297 Ga0157378_10032806 Ga0157378_100328062 255
313 3300014326 Ga0157380_10007784 Ga0157380_100077846 255
314 3300014326 Ga0157380_10116449 Ga0157380_101164492 255
315 3300025315 Ga0207697_10011949 Ga0207697_100119496 255
316 3300025321 Ga0207656_10077776 Ga0207656_100777763 255
317 3300025899 Ga0207642_10014221 Ga0207642_100142215 255
318 3300025901 Ga0207688_10022736 Ga0207688_100227364 255
319 3300025904 Ga0207647_10008523 Ga0207647_100085234 255
320 3300025909 Ga0207705_10007574 Ga0207705_100075742 255
321 3300025915 Ga0207693_10058392 Ga0207693_100583925 255
322 3300025918 Ga0207662_10070150 Ga0207662_100701503 255
323 3300025919 Ga0207657_10070145 Ga0207657_100701454 255
324 3300025925 Ga0207650_10039191 Ga0207650_100391913 255
325 3300025926 Ga0207659_10354830 Ga0207659_103548302 255
326 3300025927 Ga0207687_10151900 Ga0207687_101519003 255
327 3300025929 Ga0207664_10129563 Ga0207664_101295632 255
328 3300025932 Ga0207690_10021822 Ga0207690_100218221 255
329 3300025932 Ga0207690_10247390 Ga0207690_102473902 255
330 3300025933 Ga0207706_10015844 Ga0207706_100158445 255
331 3300025933 Ga0207706_10290143 Ga0207706_102901432 255
332 3300025939 Ga0207665_10014260 Ga0207665_100142602 255
333 3300025940 Ga0207691_10016405 Ga0207691_100164057 255
334 3300025945 Ga0207679_10072979 Ga0207679_100729792 255
335 3300025960 Ga0207651_10031969 Ga0207651_100319693 255
336 3300025986 Ga0207658_10216039 Ga0207658_102160393 255
337 3300026023 Ga0207677_10194989 Ga0207677_101949893 255
338 3300026041 Ga0207639_10444428 Ga0207639_104444282 255
339 3300026067 Ga0207678_10051358 Ga0207678_100513585 255
340 3300026089 Ga0207648_10020937 Ga0207648_100209376 255
341 3300026121 Ga0207683_10058836 Ga0207683_100588363 255
342 3300030733 Ga0314311_1210440 Ga0314311_12104402 255
343 3300030735 Ga0316178_1060611 Ga0316178_10606111 255
344 3300030736 Ga0316180_1155850 Ga0316180_11558505 255
345 3300031824 Ga0307413_10142605 Ga0307413_101426052 255
346 3300031852 Ga0307410_10364287 Ga0307410_103642872 255
347 3300031911 Ga0307412_10065035 Ga0307412_100650355 255
348 3300032002 Ga0307416_100750514 Ga0307416_1007505142 255
349 3300035692 Ga0373935_0027457 Ga0373935_0027457_2266_3042 255
350 3300037312 Ga0395899_0001198 Ga0395899_0001198_20725_21498 255
351 3300037312 Ga0395899_0170226 Ga0395899_0170226_740_1513 255
352 3300037418 Ga0395900_0007015 Ga0395900_0007015_6952_7725 255
353 3300037418 Ga0395900_0007369 Ga0395900_0007369_7331_8107 255
354 3300037418 Ga0395900_0012543 Ga0395900_0012543_6424_7197 255
355 3300037418 Ga0395900_0057619 Ga0395900_0057619_2830_3603 255
356 3300037418 Ga0395900_0095271 Ga0395900_0095271_298_1074 255
357 3300037466 Ga0395898_0001084 Ga0395898_0001084_14037_14810 255
358 3300037466 Ga0395898_0039524 Ga0395898_0039524_1603_2379 255
359 3300037466 Ga0395898_0039580 Ga0395898_0039580_3152_3925 255
360 3300037471 Ga0395905_0001843 Ga0395905_0001843_11610_12386 255
361 3300037471 Ga0395905_0006008 Ga0395905_0006008_3635_4408 255
362 3300037471 Ga0395905_0010575 Ga0395905_0010575_4040_4813 255
363 3300037471 Ga0395905_0027692 Ga0395905_0027692_2385_3161 255
364 3300037471 Ga0395905_0094175 Ga0395905_0094175_475_1251 255
365 3300038443 Ga0395901_0045421 Ga0395901_0045421_2589_3365 255
366 3300038443 Ga0395901_0071471 Ga0395901_0071471_1817_2590 255
367 3300038443 Ga0395901_0108113 Ga0395901_0108113_1662_2435 255
368 3300038443 Ga0395901_0220149 Ga0395901_0220149_952_1728 255
369 3300039437 Ga0436365_0813844 Ga0436365_0813844_3493_4269 255
370 3300044765 Ga0466970_0027849 Ga0466970_0027849_800_1588 255
371 3300045976 Ga0466967_0068688 Ga0466967_0068688_887_1663 255
372 3300048910 Ga0496107_0241198 Ga0496107_0241198_32_808 255
373 3300048915 Ga0496112_0024520 Ga0496112_0024520_4468_5241 255
374 3300048915 Ga0496112_0135604 Ga0496112_0135604_1180_1956 255
375 3300048916 Ga0496113_0330000 Ga0496113_0330000_114_890 255
376 3300048917 Ga0496114_0000019 Ga0496114_0000019_9844_10620 255
377 3300005327 Ga0070658_10032422 Ga0070658_100324224 256
378 3300005327 Ga0070658_10048462 Ga0070658_100484625 256
379 3300005328 Ga0070676_10254686 Ga0070676_102546862 256
380 3300005331 Ga0070670_100031218 Ga0070670_1000312184 256
381 3300005336 Ga0070680_100150090 Ga0070680_1001500902 256
382 3300005339 Ga0070660_100361725 Ga0070660_1003617252 256
383 3300005344 Ga0070661_100142201 Ga0070661_1001422012 256
384 3300005354 Ga0070675_100104900 Ga0070675_1001049002 256
385 3300005364 Ga0070673_100033380 Ga0070673_1000333806 256
386 3300005366 Ga0070659_100030454 Ga0070659_1000304545 256
387 3300005366 Ga0070659_100038337 Ga0070659_1000383375 256
388 3300005366 Ga0070659_100052931 Ga0070659_1000529316 256
389 3300005366 Ga0070659_100172868 Ga0070659_1001728681 256
390 3300005440 Ga0070705_100302304 Ga0070705_1003023042 256
391 3300005444 Ga0070694_100145269 Ga0070694_1001452693 256
392 3300005455 Ga0070663_100019266 Ga0070663_1000192666 256
393 3300005455 Ga0070663_100071327 Ga0070663_1000713272 256
394 3300005457 Ga0070662_100049932 Ga0070662_1000499323 256
395 3300005457 Ga0070662_100226007 Ga0070662_1002260071 256
396 3300005458 Ga0070681_10433724 Ga0070681_104337242 256
397 3300005530 Ga0070679_100160125 Ga0070679_1001601254 256
398 3300005530 Ga0070679_100222892 Ga0070679_1002228921 256
399 3300005539 Ga0068853_100226261 Ga0068853_1002262613 256
400 3300005543 Ga0070672_100175530 Ga0070672_1001755302 256
401 3300005545 Ga0070695_100011170 Ga0070695_1000111705 256
402 3300005546 Ga0070696_100020112 Ga0070696_1000201126 256
403 3300005548 Ga0070665_100079619 Ga0070665_1000796194 256
404 3300005549 Ga0070704_100502079 Ga0070704_1005020791 256
405 3300005563 Ga0068855_100720263 Ga0068855_1007202632 256
406 3300005564 Ga0070664_100001029 Ga0070664_10000102922 256
407 3300005564 Ga0070664_100007027 Ga0070664_1000070279 256
408 3300005564 Ga0070664_100104651 Ga0070664_1001046515 256
409 3300005577 Ga0068857_100608776 Ga0068857_1006087761 256
410 3300005578 Ga0068854_100116774 Ga0068854_1001167743 256
411 3300005614 Ga0068856_100105163 Ga0068856_1001051635 256
412 3300005616 Ga0068852_100060921 Ga0068852_1000609213 256
413 3300005617 Ga0068859_100111518 Ga0068859_1001115182 256
414 3300005618 Ga0068864_100087213 Ga0068864_1000872134 256
415 3300005718 Ga0068866_10059666 Ga0068866_100596662 256
416 3300005834 Ga0068851_10017873 Ga0068851_100178732 256
417 3300005841 Ga0068863_100131092 Ga0068863_1001310921 256
418 3300005842 Ga0068858_100058227 Ga0068858_1000582275 256
419 3300005842 Ga0068858_100128909 Ga0068858_1001289092 256
420 3300005843 Ga0068860_100059291 Ga0068860_1000592916 256
421 3300005843 Ga0068860_100410529 Ga0068860_1004105292 256
422 3300005844 Ga0068862_100286082 Ga0068862_1002860822 256
423 3300006237 Ga0097621_100206546 Ga0097621_1002065462 256
424 3300006847 Ga0075431_100344225 Ga0075431_1003442252 256
425 3300006931 Ga0097620_100111513 Ga0097620_1001115132 256
426 3300009094 Ga0111539_10058536 Ga0111539_100585365 256
427 3300009098 Ga0105245_10037207 Ga0105245_100372074 256
428 3300009177 Ga0105248_10012350 Ga0105248_100123507 256
429 3300009177 Ga0105248_10055018 Ga0105248_100550186 256
430 3300011119 Ga0105246_10020097 Ga0105246_100200974 256
431 3300013100 Ga0157373_10073226 Ga0157373_100732262 256
432 3300013100 Ga0157373_10255559 Ga0157373_102555592 256
433 3300013102 Ga0157371_10147867 Ga0157371_101478673 256
434 3300013102 Ga0157371_10219847 Ga0157371_102198472 256
435 3300013296 Ga0157374_10148809 Ga0157374_101488092 256
436 3300013306 Ga0163162_10139307 Ga0163162_101393074 256
437 3300013306 Ga0163162_10464778 Ga0163162_104647782 256
438 3300014745 Ga0157377_10015317 Ga0157377_100153175 256
439 3300025321 Ga0207656_10024588 Ga0207656_100245883 256
440 3300025907 Ga0207645_10193546 Ga0207645_101935461 256
441 3300025909 Ga0207705_10001965 Ga0207705_100019656 256
442 3300025909 Ga0207705_10024198 Ga0207705_100241985 256
443 3300025912 Ga0207707_10414847 Ga0207707_104148471 256
444 3300025919 Ga0207657_10032164 Ga0207657_100321642 256
445 3300025919 Ga0207657_10074459 Ga0207657_100744596 256
446 3300025919 Ga0207657_10094058 Ga0207657_100940584 256
447 3300025919 Ga0207657_10289701 Ga0207657_102897012 256
448 3300025919 Ga0207657_10317496 Ga0207657_103174962 256
449 3300025920 Ga0207649_10067223 Ga0207649_100672235 256
450 3300025920 Ga0207649_10081102 Ga0207649_100811024 256
451 3300025921 Ga0207652_10018222 Ga0207652_100182224 256
452 3300025923 Ga0207681_10040198 Ga0207681_100401982 256
453 3300025925 Ga0207650_10180396 Ga0207650_101803963 256
454 3300025926 Ga0207659_10201878 Ga0207659_102018783 256
455 3300025927 Ga0207687_10117610 Ga0207687_101176103 256
456 3300025931 Ga0207644_10039546 Ga0207644_100395463 256
457 3300025932 Ga0207690_10036760 Ga0207690_100367604 256
458 3300025932 Ga0207690_10065215 Ga0207690_100652153 256
459 3300025932 Ga0207690_10144435 Ga0207690_101444353 256
460 3300025933 Ga0207706_10034925 Ga0207706_100349252 256
461 3300025933 Ga0207706_10089694 Ga0207706_100896943 256
462 3300025933 Ga0207706_10168831 Ga0207706_101688313 256
463 3300025933 Ga0207706_10176816 Ga0207706_101768161 256
464 3300025935 Ga0207709_10084838 Ga0207709_100848382 256
465 3300025940 Ga0207691_10204755 Ga0207691_102047553 256
466 3300025940 Ga0207691_10213441 Ga0207691_102134412 256
467 3300025941 Ga0207711_10003282 Ga0207711_1000328213 256
468 3300025941 Ga0207711_10032298 Ga0207711_100322982 256
469 3300025942 Ga0207689_10009583 Ga0207689_100095836 256
470 3300025944 Ga0207661_10374629 Ga0207661_103746291 256
471 3300025944 Ga0207661_10462729 Ga0207661_104627292 256
472 3300025945 Ga0207679_10003346 Ga0207679_100033463 256
473 3300025945 Ga0207679_10003580 Ga0207679_100035805 256
474 3300025945 Ga0207679_10389172 Ga0207679_103891723 256
475 3300025949 Ga0207667_10538235 Ga0207667_105382352 256
476 3300025960 Ga0207651_10055402 Ga0207651_100554025 256
477 3300025960 Ga0207651_10185628 Ga0207651_101856283 256
478 3300025961 Ga0207712_10024626 Ga0207712_100246266 256
479 3300025981 Ga0207640_10133706 Ga0207640_101337062 256
480 3300026035 Ga0207703_10007173 Ga0207703_100071738 256
481 3300026035 Ga0207703_10024636 Ga0207703_100246362 256
482 3300026041 Ga0207639_10032745 Ga0207639_100327456 256
483 3300026067 Ga0207678_10019221 Ga0207678_100192215 256
484 3300026078 Ga0207702_10093557 Ga0207702_100935572 256
485 3300026088 Ga0207641_10155647 Ga0207641_101556472 256
486 3300026095 Ga0207676_10081824 Ga0207676_100818244 256
487 3300026116 Ga0207674_10183890 Ga0207674_101838903 256
488 3300026116 Ga0207674_10583438 Ga0207674_105834382 256
489 3300026142 Ga0207698_10003675 Ga0207698_100036753 256
490 3300027907 Ga0207428_10111418 Ga0207428_101114184 256
491 3300028379 Ga0268266_10015168 Ga0268266_100151687 256
492 3300028380 Ga0268265_10053112 Ga0268265_100531122 256
493 3300028380 Ga0268265_10369625 Ga0268265_103696253 256
494 3300028381 Ga0268264_10050338 Ga0268264_100503386 256
495 3300031548 Ga0307408_100029310 Ga0307408_1000293105 256
496 3300031548 Ga0307408_100338840 Ga0307408_1003388402 256
497 3300031824 Ga0307413_10020109 Ga0307413_100201095 256
498 3300031901 Ga0307406_10054765 Ga0307406_100547653 256
499 3300031903 Ga0307407_10048019 Ga0307407_100480193 256
500 3300031911 Ga0307412_10365127 Ga0307412_103651272 256
501 3300031995 Ga0307409_100156943 Ga0307409_1001569433 256
502 3300032004 Ga0307414_10644764 Ga0307414_106447642 256
503 3300032005 Ga0307411_10136238 Ga0307411_101362383 256
504 3300032126 Ga0307415_100148044 Ga0307415_1001480442 256
505 3300032126 Ga0307415_100513444 Ga0307415_1005134441 256
506 3300035170 Ga0373943_0138120 Ga0373943_0138120_163_939 256
507 3300037312 Ga0395899_0017318 Ga0395899_0017318_106_882 256
508 3300037418 Ga0395900_0177114 Ga0395900_0177114_903_1679 256
509 3300037418 Ga0395900_0687457 Ga0395900_0687457_144_929 256
510 3300037466 Ga0395898_0818544 Ga0395898_0818544_24_800 256
511 3300037471 Ga0395905_0001373 Ga0395905_0001373_4515_5285 256
512 3300037471 Ga0395905_0024115 Ga0395905_0024115_4163_4939 256
513 3300037471 Ga0395905_0043845 Ga0395905_0043845_1280_2077 256
514 3300037471 Ga0395905_0233319 Ga0395905_0233319_218_994 256
515 3300038443 Ga0395901_0000603 Ga0395901_0000603_15573_16349 256
516 3300038443 Ga0395901_0319726 Ga0395901_0319726_435_1211 256
517 3300039437 Ga0436365_1200409 Ga0436365_1200409_217_993 256
518 3300042006 Ga0439432_019048 Ga0439432_019048_150_926 256
519 3300042144 Ga0450889_001073 Ga0450889_001073_845_1618 256
520 3300044684 Ga0466966_0013352 Ga0466966_0013352_2970_3746 256
521 3300044693 Ga0466961_0187351 Ga0466961_0187351_355_1131 256
522 3300044735 Ga0466968_0071788 Ga0466968_0071788_676_1473 256
523 3300044765 Ga0466970_0032630 Ga0466970_0032630_678_1475 256
524 3300048910 Ga0496107_0183064 Ga0496107_0183064_222_992 256
525 3300048911 Ga0496108_0039973 Ga0496108_0039973_2200_2976 256
526 3300048913 Ga0496110_0002515 Ga0496110_0002515_8395_9171 256
527 3300048913 Ga0496110_0336135 Ga0496110_0336135_572_1342 256
528 3300048914 Ga0496111_0003916 Ga0496111_0003916_6406_7182 256
529 3300048915 Ga0496112_0066201 Ga0496112_0066201_326_1105 256
530 3300048915 Ga0496112_0067093 Ga0496112_0067093_1832_2608 256
531 3300049572 Ga0501036_0191857 Ga0501036_0191857_693_1472 256
532 3300049581 Ga0501047_0209826 Ga0501047_0209826_1015_1794 256
533 3300049823 Ga0501044_0228910 Ga0501044_0228910_712_1491 256
534 3300050511 nmdc:mga08y16_133627_c1 nmdc:mga08y16_133627_c1_1325_2098 256
535 3300050515 nmdc:mga0a205_1450_c1 nmdc:mga0a205_1450_c1_168_944 256
536 3300053151 Ga0500604_0018603 Ga0500604_0018603_301_1086 256
537 3300053153 Ga0500616_0003651 Ga0500616_0003651_4216_5001 256
538 3300001904 JGI24736J21556_1016112 JGI24736J21556_10161122 257
539 3300001915 JGI24741J21665_1000842 JGI24741J21665_10008427 257
540 3300001915 JGI24741J21665_1002905 JGI24741J21665_10029056 257
541 3300001915 JGI24741J21665_1005065 JGI24741J21665_10050655 257
542 3300001979 JGI24740J21852_10002270 JGI24740J21852_100022708 257
543 3300001979 JGI24740J21852_10006334 JGI24740J21852_100063345 257
544 3300001979 JGI24740J21852_10012776 JGI24740J21852_100127763 257
545 3300001979 JGI24740J21852_10022899 JGI24740J21852_100228993 257
546 3300001989 JGI24739J22299_10005253 JGI24739J22299_100052533 257
547 3300001989 JGI24739J22299_10042925 JGI24739J22299_100429252 257
548 3300001989 JGI24739J22299_10057670 JGI24739J22299_100576702 257
549 3300001990 JGI24737J22298_10007338 JGI24737J22298_100073384 257
550 3300001990 JGI24737J22298_10009427 JGI24737J22298_100094276 257
551 3300002067 JGI24735J21928_10004414 JGI24735J21928_100044141 257
552 3300002067 JGI24735J21928_10005096 JGI24735J21928_100050966 257
553 3300002067 JGI24735J21928_10020678 JGI24735J21928_100206782 257
554 3300002075 JGI24738J21930_10002750 JGI24738J21930_100027503 257
555 3300005290 Ga0065712_10048522 Ga0065712_100485221 257
556 3300005290 Ga0065712_10109690 Ga0065712_101096902 257
557 3300005327 Ga0070658_10001367 Ga0070658_1000136715 257
558 3300005327 Ga0070658_10031081 Ga0070658_100310815 257
559 3300005327 Ga0070658_10079813 Ga0070658_100798134 257
560 3300005327 Ga0070658_10099147 Ga0070658_100991474 257
561 3300005327 Ga0070658_10167245 Ga0070658_101672452 257
562 3300005327 Ga0070658_10193861 Ga0070658_101938612 257
563 3300005327 Ga0070658_10223637 Ga0070658_102236373 257
564 3300005327 Ga0070658_10248274 Ga0070658_102482742 257
565 3300005327 Ga0070658_10297738 Ga0070658_102977381 257
566 3300005327 Ga0070658_10369477 Ga0070658_103694772 257
567 3300005327 Ga0070658_10427570 Ga0070658_104275701 257
568 3300005328 Ga0070676_10000509 Ga0070676_100005098 257
569 3300005329 Ga0070683_100000593 Ga0070683_1000005939 257
570 3300005329 Ga0070683_100010200 Ga0070683_1000102006 257
571 3300005329 Ga0070683_100029243 Ga0070683_1000292434 257
572 3300005329 Ga0070683_100042403 Ga0070683_1000424036 257
573 3300005329 Ga0070683_100068421 Ga0070683_1000684215 257
574 3300005329 Ga0070683_100228388 Ga0070683_1002283881 257
575 3300005331 Ga0070670_100017549 Ga0070670_1000175492 257
576 3300005331 Ga0070670_100374550 Ga0070670_1003745501 257
577 3300005331 Ga0070670_100381421 Ga0070670_1003814212 257
578 3300005335 Ga0070666_10011907 Ga0070666_100119076 257
579 3300005335 Ga0070666_10102831 Ga0070666_101028311 257
580 3300005336 Ga0070680_100005680 Ga0070680_1000056805 257
581 3300005336 Ga0070680_100049800 Ga0070680_1000498005 257
582 3300005336 Ga0070680_100079014 Ga0070680_1000790142 257
583 3300005336 Ga0070680_100171576 Ga0070680_1001715762 257
584 3300005336 Ga0070680_100189985 Ga0070680_1001899853 257
585 3300005337 Ga0070682_100044097 Ga0070682_1000440973 257
586 3300005337 Ga0070682_100063573 Ga0070682_1000635733 257
587 3300005337 Ga0070682_100072920 Ga0070682_1000729202 257
588 3300005337 Ga0070682_100226748 Ga0070682_1002267482 257
589 3300005338 Ga0068868_100222151 Ga0068868_1002221512 257
590 3300005338 Ga0068868_100376290 Ga0068868_1003762902 257
591 3300005338 Ga0068868_100511749 Ga0068868_1005117491 257
592 3300005339 Ga0070660_100000012 Ga0070660_10000001253 257
593 3300005339 Ga0070660_100008354 Ga0070660_1000083548 257
594 3300005339 Ga0070660_100011728 Ga0070660_1000117286 257
595 3300005339 Ga0070660_100021621 Ga0070660_1000216214 257
596 3300005339 Ga0070660_100029912 Ga0070660_1000299125 257
597 3300005339 Ga0070660_100033408 Ga0070660_1000334086 257
598 3300005339 Ga0070660_100065294 Ga0070660_1000652946 257
599 3300005339 Ga0070660_100080127 Ga0070660_1000801272 257
600 3300005339 Ga0070660_100125481 Ga0070660_1001254811 257
601 3300005339 Ga0070660_100225954 Ga0070660_1002259542 257
602 3300005340 Ga0070689_100088660 Ga0070689_1000886603 257
603 3300005341 Ga0070691_10004635 Ga0070691_100046352 257
604 3300005343 Ga0070687_100078232 Ga0070687_1000782323 257
605 3300005344 Ga0070661_100000251 Ga0070661_10000025128 257
606 3300005344 Ga0070661_100009966 Ga0070661_1000099665 257
607 3300005344 Ga0070661_100031148 Ga0070661_1000311484 257
608 3300005344 Ga0070661_100035187 Ga0070661_1000351872 257
609 3300005344 Ga0070661_100226152 Ga0070661_1002261522 257
610 3300005344 Ga0070661_100459683 Ga0070661_1004596831 257
611 3300005345 Ga0070692_10005562 Ga0070692_100055624 257
612 3300005345 Ga0070692_10043490 Ga0070692_100434903 257
613 3300005345 Ga0070692_10111486 Ga0070692_101114862 257
614 3300005345 Ga0070692_10133777 Ga0070692_101337772 257
615 3300005347 Ga0070668_100004342 Ga0070668_1000043426 257
616 3300005347 Ga0070668_100023612 Ga0070668_1000236125 257
617 3300005353 Ga0070669_100016249 Ga0070669_1000162493 257
618 3300005355 Ga0070671_100069951 Ga0070671_1000699513 257
619 3300005355 Ga0070671_100094078 Ga0070671_1000940784 257
620 3300005355 Ga0070671_100125850 Ga0070671_1001258503 257
621 3300005356 Ga0070674_100081176 Ga0070674_1000811764 257
622 3300005364 Ga0070673_100050242 Ga0070673_1000502425 257
623 3300005364 Ga0070673_100431061 Ga0070673_1004310612 257
624 3300005366 Ga0070659_100000438 Ga0070659_1000004389 257
625 3300005366 Ga0070659_100001812 Ga0070659_1000018126 257
626 3300005366 Ga0070659_100006023 Ga0070659_1000060239 257
627 3300005366 Ga0070659_100017551 Ga0070659_1000175515 257
628 3300005366 Ga0070659_100030147 Ga0070659_1000301476 257
629 3300005366 Ga0070659_100060539 Ga0070659_1000605395 257
630 3300005366 Ga0070659_100166611 Ga0070659_1001666113 257
631 3300005366 Ga0070659_100220129 Ga0070659_1002201292 257
632 3300005366 Ga0070659_100288479 Ga0070659_1002884791 257
633 3300005367 Ga0070667_100036411 Ga0070667_1000364115 257
634 3300005367 Ga0070667_100096142 Ga0070667_1000961424 257
635 3300005367 Ga0070667_100103391 Ga0070667_1001033913 257
636 3300005435 Ga0070714_100006333 Ga0070714_1000063337 257
637 3300005435 Ga0070714_100101406 Ga0070714_1001014064 257
638 3300005444 Ga0070694_100003284 Ga0070694_1000032845 257
639 3300005455 Ga0070663_100000089 Ga0070663_10000008941 257
640 3300005455 Ga0070663_100018803 Ga0070663_1000188036 257
641 3300005455 Ga0070663_100030392 Ga0070663_1000303925 257
642 3300005455 Ga0070663_100031207 Ga0070663_1000312076 257
643 3300005455 Ga0070663_100045345 Ga0070663_1000453453 257
644 3300005455 Ga0070663_100055042 Ga0070663_1000550424 257
645 3300005455 Ga0070663_100109180 Ga0070663_1001091803 257
646 3300005455 Ga0070663_100271772 Ga0070663_1002717722 257
647 3300005455 Ga0070663_100366778 Ga0070663_1003667782 257
648 3300005456 Ga0070678_100067222 Ga0070678_1000672222 257
649 3300005457 Ga0070662_100000023 Ga0070662_10000002363 257
650 3300005457 Ga0070662_100028950 Ga0070662_1000289506 257
651 3300005457 Ga0070662_100066786 Ga0070662_1000667865 257
652 3300005457 Ga0070662_100099203 Ga0070662_1000992033 257
653 3300005457 Ga0070662_100110723 Ga0070662_1001107232 257
654 3300005458 Ga0070681_10010663 Ga0070681_100106635 257
655 3300005458 Ga0070681_10377778 Ga0070681_103777782 257
656 3300005459 Ga0068867_100009758 Ga0068867_1000097587 257
657 3300005459 Ga0068867_100228935 Ga0068867_1002289352 257
658 3300005530 Ga0070679_100014033 Ga0070679_1000140337 257
659 3300005530 Ga0070679_100079774 Ga0070679_1000797742 257
660 3300005530 Ga0070679_100081193 Ga0070679_1000811931 257
661 3300005530 Ga0070679_100123420 Ga0070679_1001234204 257
662 3300005535 Ga0070684_100008026 Ga0070684_1000080265 257
663 3300005535 Ga0070684_100028591 Ga0070684_1000285915 257
664 3300005535 Ga0070684_100206128 Ga0070684_1002061283 257
665 3300005535 Ga0070684_100508707 Ga0070684_1005087071 257
666 3300005539 Ga0068853_100000491 Ga0068853_10000049128 257
667 3300005539 Ga0068853_100006806 Ga0068853_1000068066 257
668 3300005539 Ga0068853_100012755 Ga0068853_1000127556 257
669 3300005539 Ga0068853_100116404 Ga0068853_1001164044 257
670 3300005539 Ga0068853_100349380 Ga0068853_1003493801 257
671 3300005543 Ga0070672_100005294 Ga0070672_1000052944 257
672 3300005543 Ga0070672_100052655 Ga0070672_1000526555 257
673 3300005544 Ga0070686_100335797 Ga0070686_1003357972 257
674 3300005547 Ga0070693_100001684 Ga0070693_1000016849 257
675 3300005548 Ga0070665_100007984 Ga0070665_1000079844 257
676 3300005548 Ga0070665_100012483 Ga0070665_1000124835 257
677 3300005563 Ga0068855_100000836 Ga0068855_1000008369 257
678 3300005563 Ga0068855_100115261 Ga0068855_1001152616 257
679 3300005563 Ga0068855_100160441 Ga0068855_1001604412 257
680 3300005563 Ga0068855_100185949 Ga0068855_1001859493 257
681 3300005563 Ga0068855_100186358 Ga0068855_1001863583 257
682 3300005563 Ga0068855_100261750 Ga0068855_1002617503 257
683 3300005563 Ga0068855_100402569 Ga0068855_1004025692 257
684 3300005564 Ga0070664_100000281 Ga0070664_10000028138 257
685 3300005564 Ga0070664_100016043 Ga0070664_1000160435 257
686 3300005564 Ga0070664_100165106 Ga0070664_1001651061 257
687 3300005564 Ga0070664_100167161 Ga0070664_1001671612 257
688 3300005564 Ga0070664_100345433 Ga0070664_1003454332 257
689 3300005564 Ga0070664_100386169 Ga0070664_1003861692 257
690 3300005577 Ga0068857_100023075 Ga0068857_1000230756 257
691 3300005577 Ga0068857_100033123 Ga0068857_1000331235 257
692 3300005577 Ga0068857_100038996 Ga0068857_1000389962 257
693 3300005577 Ga0068857_100057750 Ga0068857_1000577504 257
694 3300005577 Ga0068857_100087204 Ga0068857_1000872043 257
695 3300005577 Ga0068857_100097228 Ga0068857_1000972284 257
696 3300005578 Ga0068854_100004248 Ga0068854_1000042488 257
697 3300005578 Ga0068854_100006833 Ga0068854_1000068338 257
698 3300005578 Ga0068854_100026732 Ga0068854_1000267326 257
699 3300005578 Ga0068854_100037050 Ga0068854_1000370504 257
700 3300005578 Ga0068854_100062367 Ga0068854_1000623675 257
701 3300005578 Ga0068854_100120152 Ga0068854_1001201523 257
702 3300005578 Ga0068854_100184004 Ga0068854_1001840042 257
703 3300005578 Ga0068854_100369675 Ga0068854_1003696752 257
704 3300005578 Ga0068854_100479169 Ga0068854_1004791692 257
705 3300005614 Ga0068856_100000128 Ga0068856_10000012831 257
706 3300005614 Ga0068856_100055537 Ga0068856_1000555376 257
707 3300005614 Ga0068856_100081254 Ga0068856_1000812543 257
708 3300005614 Ga0068856_100122609 Ga0068856_1001226093 257
709 3300005614 Ga0068856_100160456 Ga0068856_1001604564 257
710 3300005614 Ga0068856_100164542 Ga0068856_1001645423 257
711 3300005614 Ga0068856_100189693 Ga0068856_1001896932 257
712 3300005614 Ga0068856_100270187 Ga0068856_1002701872 257
713 3300005614 Ga0068856_100307607 Ga0068856_1003076073 257
714 3300005614 Ga0068856_100588696 Ga0068856_1005886962 257
715 3300005616 Ga0068852_100000378 Ga0068852_10000037823 257
716 3300005616 Ga0068852_100000577 Ga0068852_10000057721 257
717 3300005616 Ga0068852_100021755 Ga0068852_1000217557 257
718 3300005616 Ga0068852_100197420 Ga0068852_1001974204 257
719 3300005616 Ga0068852_100315982 Ga0068852_1003159821 257
720 3300005617 Ga0068859_100031616 Ga0068859_1000316166 257
721 3300005618 Ga0068864_100007635 Ga0068864_1000076358 257
722 3300005618 Ga0068864_100015969 Ga0068864_1000159696 257
723 3300005618 Ga0068864_100673826 Ga0068864_1006738262 257
724 3300005834 Ga0068851_10092014 Ga0068851_100920142 257
725 3300005841 Ga0068863_100087637 Ga0068863_1000876372 257
726 3300005841 Ga0068863_100116566 Ga0068863_1001165663 257
727 3300005842 Ga0068858_100020526 Ga0068858_1000205266 257
728 3300005842 Ga0068858_100025021 Ga0068858_1000250216 257
729 3300005842 Ga0068858_100075904 Ga0068858_1000759043 257
730 3300005843 Ga0068860_100027502 Ga0068860_1000275023 257
731 3300005843 Ga0068860_100030028 Ga0068860_1000300286 257
732 3300005843 Ga0068860_100036062 Ga0068860_1000360626 257
733 3300005843 Ga0068860_100168857 Ga0068860_1001688573 257
734 3300005843 Ga0068860_100652842 Ga0068860_1006528421 257
735 3300005844 Ga0068862_100025302 Ga0068862_1000253025 257
736 3300005844 Ga0068862_100144492 Ga0068862_1001444923 257
737 3300005844 Ga0068862_100211283 Ga0068862_1002112834 257
738 3300005844 Ga0068862_100256559 Ga0068862_1002565592 257
739 3300005844 Ga0068862_100268178 Ga0068862_1002681781 257
740 3300005844 Ga0068862_100311141 Ga0068862_1003111412 257
741 3300006237 Ga0097621_100012388 Ga0097621_1000123886 257
742 3300006237 Ga0097621_100017678 Ga0097621_1000176786 257
743 3300006237 Ga0097621_100044825 Ga0097621_1000448256 257
744 3300006358 Ga0068871_100018700 Ga0068871_1000187003 257
745 3300006358 Ga0068871_100048620 Ga0068871_1000486202 257
746 3300006871 Ga0075434_100357298 Ga0075434_1003572983 257
747 3300006881 Ga0068865_100638816 Ga0068865_1006388161 257
748 3300006914 Ga0075436_100272544 Ga0075436_1002725442 257
749 3300006931 Ga0097620_100031616 Ga0097620_1000316166 257
750 3300009011 Ga0105251_10038441 Ga0105251_100384412 257
751 3300009093 Ga0105240_10024166 Ga0105240_100241666 257
752 3300009093 Ga0105240_10218747 Ga0105240_102187474 257
753 3300009093 Ga0105240_10222074 Ga0105240_102220742 257
754 3300009093 Ga0105240_10223002 Ga0105240_102230023 257
755 3300009174 Ga0105241_10031105 Ga0105241_100311051 257
756 3300009174 Ga0105241_10125210 Ga0105241_101252104 257
757 3300009174 Ga0105241_10333310 Ga0105241_103333102 257
758 3300009177 Ga0105248_10006468 Ga0105248_1000646815 257
759 3300009177 Ga0105248_10022027 Ga0105248_100220275 257
760 3300009177 Ga0105248_10431300 Ga0105248_104313001 257
761 3300009545 Ga0105237_10027499 Ga0105237_100274995 257
762 3300009545 Ga0105237_10145883 Ga0105237_101458833 257
763 3300009545 Ga0105237_10715352 Ga0105237_107153522 257
764 3300009551 Ga0105238_10017865 Ga0105238_100178655 257
765 3300009551 Ga0105238_10034743 Ga0105238_100347437 257
766 3300009551 Ga0105238_10045756 Ga0105238_100457562 257
767 3300009551 Ga0105238_10074218 Ga0105238_100742185 257
768 3300009551 Ga0105238_10142061 Ga0105238_101420611 257
769 3300009553 Ga0105249_10012623 Ga0105249_100126232 257
770 3300009553 Ga0105249_10121432 Ga0105249_101214321 257
771 3300013100 Ga0157373_10006351 Ga0157373_100063516 257
772 3300013100 Ga0157373_10039293 Ga0157373_100392934 257
773 3300013100 Ga0157373_10091812 Ga0157373_100918122 257
774 3300013100 Ga0157373_10211483 Ga0157373_102114832 257
775 3300013102 Ga0157371_10000765 Ga0157371_1000076515 257
776 3300013102 Ga0157371_10019607 Ga0157371_100196072 257
777 3300013102 Ga0157371_10112660 Ga0157371_101126604 257
778 3300013104 Ga0157370_10000534 Ga0157370_1000053440 257
779 3300013104 Ga0157370_10042233 Ga0157370_100422335 257
780 3300013104 Ga0157370_10084669 Ga0157370_100846694 257
781 3300013104 Ga0157370_10118719 Ga0157370_101187192 257
782 3300013104 Ga0157370_10334383 Ga0157370_103343832 257
783 3300013104 Ga0157370_10360568 Ga0157370_103605681 257
784 3300013104 Ga0157370_10371460 Ga0157370_103714602 257
785 3300013105 Ga0157369_10004144 Ga0157369_100041442 257
786 3300013105 Ga0157369_10057812 Ga0157369_100578122 257
787 3300013105 Ga0157369_10104342 Ga0157369_101043426 257
788 3300013105 Ga0157369_10171497 Ga0157369_101714972 257
789 3300013105 Ga0157369_10229385 Ga0157369_102293851 257
790 3300013105 Ga0157369_10295878 Ga0157369_102958781 257
791 3300013105 Ga0157369_10344610 Ga0157369_103446102 257
792 3300013105 Ga0157369_10832200 Ga0157369_108322001 257
793 3300013296 Ga0157374_10009784 Ga0157374_100097841 257
794 3300013296 Ga0157374_10053321 Ga0157374_100533211 257
795 3300013296 Ga0157374_10229571 Ga0157374_102295713 257
796 3300013296 Ga0157374_10268049 Ga0157374_102680491 257
797 3300013306 Ga0163162_10069109 Ga0163162_100691092 257
798 3300013307 Ga0157372_10014257 Ga0157372_100142576 257
799 3300013307 Ga0157372_10386280 Ga0157372_103862802 257
800 3300013307 Ga0157372_10478167 Ga0157372_104781672 257
801 3300013308 Ga0157375_10060270 Ga0157375_100602704 257
802 3300013308 Ga0157375_10246061 Ga0157375_102460614 257
803 3300013308 Ga0157375_11184902 Ga0157375_111849021 257
804 3300014325 Ga0163163_10000151 Ga0163163_1000015115 257
805 3300014326 Ga0157380_10519485 Ga0157380_105194852 257
806 3300014497 Ga0182008_10045746 Ga0182008_100457465 257
807 3300014497 Ga0182008_10143572 Ga0182008_101435722 257
808 3300014497 Ga0182008_10248647 Ga0182008_102486472 257
809 3300014968 Ga0157379_10006649 Ga0157379_100066499 257
810 3300014968 Ga0157379_10034150 Ga0157379_100341506 257
811 3300020070 Ga0206356_10032050 Ga0206356_100320501 257
812 3300025315 Ga0207697_10012055 Ga0207697_100120556 257
813 3300025735 Ga0207713_1059775 Ga0207713_10597751 257
814 3300025893 Ga0207682_10019468 Ga0207682_100194681 257
815 3300025893 Ga0207682_10079538 Ga0207682_100795382 257
816 3300025901 Ga0207688_10049037 Ga0207688_100490374 257
817 3300025901 Ga0207688_10139241 Ga0207688_101392412 257
818 3300025903 Ga0207680_10033075 Ga0207680_100330752 257
819 3300025903 Ga0207680_10122057 Ga0207680_101220572 257
820 3300025904 Ga0207647_10000450 Ga0207647_1000045035 257
821 3300025904 Ga0207647_10008732 Ga0207647_100087326 257
822 3300025904 Ga0207647_10028515 Ga0207647_100285156 257
823 3300025904 Ga0207647_10081506 Ga0207647_100815063 257
824 3300025907 Ga0207645_10000896 Ga0207645_1000089616 257
825 3300025909 Ga0207705_10000411 Ga0207705_100004114 257
826 3300025909 Ga0207705_10000694 Ga0207705_1000069416 257
827 3300025909 Ga0207705_10009725 Ga0207705_100097256 257
828 3300025909 Ga0207705_10018413 Ga0207705_100184135 257
829 3300025909 Ga0207705_10023014 Ga0207705_100230145 257
830 3300025909 Ga0207705_10037815 Ga0207705_100378155 257
831 3300025909 Ga0207705_10038042 Ga0207705_100380424 257
832 3300025909 Ga0207705_10062142 Ga0207705_100621423 257
833 3300025909 Ga0207705_10104053 Ga0207705_101040534 257
834 3300025909 Ga0207705_10136327 Ga0207705_101363272 257
835 3300025909 Ga0207705_10159814 Ga0207705_101598141 257
836 3300025909 Ga0207705_10383837 Ga0207705_103838372 257
837 3300025911 Ga0207654_10055910 Ga0207654_100559102 257
838 3300025912 Ga0207707_10006787 Ga0207707_100067873 257
839 3300025912 Ga0207707_10026570 Ga0207707_100265706 257
840 3300025912 Ga0207707_10250870 Ga0207707_102508702 257
841 3300025912 Ga0207707_10534051 Ga0207707_105340512 257
842 3300025913 Ga0207695_10036869 Ga0207695_100368696 257
843 3300025913 Ga0207695_10045251 Ga0207695_100452516 257
844 3300025913 Ga0207695_10194826 Ga0207695_101948262 257
845 3300025914 Ga0207671_10267925 Ga0207671_102679253 257
846 3300025914 Ga0207671_10383381 Ga0207671_103833812 257
847 3300025917 Ga0207660_10000036 Ga0207660_1000003643 257
848 3300025917 Ga0207660_10014749 Ga0207660_100147494 257
849 3300025917 Ga0207660_10030712 Ga0207660_100307125 257
850 3300025917 Ga0207660_10113763 Ga0207660_101137634 257
851 3300025917 Ga0207660_10134672 Ga0207660_101346723 257
852 3300025918 Ga0207662_10033903 Ga0207662_100339034 257
853 3300025919 Ga0207657_10000038 Ga0207657_1000003883 257
854 3300025919 Ga0207657_10001185 Ga0207657_1000118523 257
855 3300025919 Ga0207657_10002057 Ga0207657_1000205719 257
856 3300025919 Ga0207657_10002433 Ga0207657_100024338 257
857 3300025919 Ga0207657_10007540 Ga0207657_100075406 257
858 3300025919 Ga0207657_10009969 Ga0207657_100099696 257
859 3300025919 Ga0207657_10014882 Ga0207657_100148828 257
860 3300025919 Ga0207657_10015664 Ga0207657_100156645 257
861 3300025919 Ga0207657_10040363 Ga0207657_100403631 257
862 3300025919 Ga0207657_10041138 Ga0207657_100411382 257
863 3300025919 Ga0207657_10098731 Ga0207657_100987315 257
864 3300025919 Ga0207657_10303580 Ga0207657_103035802 257
865 3300025919 Ga0207657_10379831 Ga0207657_103798312 257
866 3300025920 Ga0207649_10000330 Ga0207649_1000033035 257
867 3300025920 Ga0207649_10007872 Ga0207649_100078725 257
868 3300025920 Ga0207649_10008212 Ga0207649_100082123 257
869 3300025920 Ga0207649_10012189 Ga0207649_100121896 257
870 3300025920 Ga0207649_10023772 Ga0207649_100237722 257
871 3300025920 Ga0207649_10024272 Ga0207649_100242724 257
872 3300025920 Ga0207649_10024328 Ga0207649_100243284 257
873 3300025920 Ga0207649_10075368 Ga0207649_100753683 257
874 3300025920 Ga0207649_10082789 Ga0207649_100827892 257
875 3300025921 Ga0207652_10011268 Ga0207652_100112686 257
876 3300025921 Ga0207652_10046054 Ga0207652_100460542 257
877 3300025921 Ga0207652_10075220 Ga0207652_100752206 257
878 3300025921 Ga0207652_10079763 Ga0207652_100797634 257
879 3300025921 Ga0207652_10233905 Ga0207652_102339052 257
880 3300025923 Ga0207681_10067717 Ga0207681_100677173 257
881 3300025923 Ga0207681_10121231 Ga0207681_101212314 257
882 3300025923 Ga0207681_10121349 Ga0207681_101213492 257
883 3300025923 Ga0207681_10608836 Ga0207681_106088362 257
884 3300025924 Ga0207694_10007689 Ga0207694_100076893 257
885 3300025924 Ga0207694_10008070 Ga0207694_100080706 257
886 3300025924 Ga0207694_10230999 Ga0207694_102309992 257
887 3300025924 Ga0207694_10286672 Ga0207694_102866722 257
888 3300025925 Ga0207650_10072948 Ga0207650_100729483 257
889 3300025925 Ga0207650_10108317 Ga0207650_101083174 257
890 3300025925 Ga0207650_10138216 Ga0207650_101382163 257
891 3300025925 Ga0207650_10355919 Ga0207650_103559192 257
892 3300025929 Ga0207664_10018528 Ga0207664_100185286 257
893 3300025929 Ga0207664_10028956 Ga0207664_100289566 257
894 3300025929 Ga0207664_10041017 Ga0207664_100410175 257
895 3300025929 Ga0207664_10187352 Ga0207664_101873522 257
896 3300025931 Ga0207644_10078292 Ga0207644_100782922 257
897 3300025932 Ga0207690_10000149 Ga0207690_100001493 257
898 3300025932 Ga0207690_10002639 Ga0207690_1000263910 257
899 3300025932 Ga0207690_10025995 Ga0207690_100259953 257
900 3300025932 Ga0207690_10030826 Ga0207690_100308263 257
901 3300025932 Ga0207690_10034598 Ga0207690_100345983 257
902 3300025932 Ga0207690_10043136 Ga0207690_100431365 257
903 3300025932 Ga0207690_10059226 Ga0207690_100592262 257
904 3300025932 Ga0207690_10069444 Ga0207690_100694445 257
905 3300025932 Ga0207690_10079276 Ga0207690_100792762 257
906 3300025932 Ga0207690_10214018 Ga0207690_102140183 257
907 3300025933 Ga0207706_10000061 Ga0207706_1000006139 257
908 3300025933 Ga0207706_10001971 Ga0207706_100019716 257
909 3300025933 Ga0207706_10015533 Ga0207706_100155335 257
910 3300025933 Ga0207706_10024853 Ga0207706_100248534 257
911 3300025933 Ga0207706_10075810 Ga0207706_100758105 257
912 3300025937 Ga0207669_10115974 Ga0207669_101159743 257
913 3300025940 Ga0207691_10014594 Ga0207691_100145947 257
914 3300025940 Ga0207691_10061771 Ga0207691_100617715 257
915 3300025941 Ga0207711_10001606 Ga0207711_100016062 257
916 3300025941 Ga0207711_10037413 Ga0207711_100374135 257
917 3300025941 Ga0207711_10201557 Ga0207711_102015572 257
918 3300025942 Ga0207689_10073436 Ga0207689_100734365 257
919 3300025942 Ga0207689_10172606 Ga0207689_101726064 257
920 3300025944 Ga0207661_10000937 Ga0207661_100009376 257
921 3300025944 Ga0207661_10034772 Ga0207661_100347726 257
922 3300025944 Ga0207661_10069848 Ga0207661_100698485 257
923 3300025944 Ga0207661_10085490 Ga0207661_100854902 257
924 3300025944 Ga0207661_10089140 Ga0207661_100891403 257
925 3300025944 Ga0207661_10121811 Ga0207661_101218112 257
926 3300025944 Ga0207661_10174425 Ga0207661_101744253 257
927 3300025945 Ga0207679_10000149 Ga0207679_1000014933 257
928 3300025945 Ga0207679_10012302 Ga0207679_100123025 257
929 3300025945 Ga0207679_10081752 Ga0207679_100817521 257
930 3300025945 Ga0207679_10094150 Ga0207679_100941504 257
931 3300025945 Ga0207679_10104205 Ga0207679_101042051 257
932 3300025945 Ga0207679_10154590 Ga0207679_101545902 257
933 3300025945 Ga0207679_10157015 Ga0207679_101570151 257
934 3300025949 Ga0207667_10003170 Ga0207667_100031706 257
935 3300025949 Ga0207667_10017438 Ga0207667_100174388 257
936 3300025949 Ga0207667_10048771 Ga0207667_100487716 257
937 3300025949 Ga0207667_10052956 Ga0207667_100529563 257
938 3300025949 Ga0207667_10088835 Ga0207667_100888353 257
939 3300025949 Ga0207667_10119630 Ga0207667_101196304 257
940 3300025949 Ga0207667_10159183 Ga0207667_101591832 257
941 3300025949 Ga0207667_10182739 Ga0207667_101827392 257
942 3300025949 Ga0207667_10340833 Ga0207667_103408332 257
943 3300025949 Ga0207667_10350155 Ga0207667_103501553 257
944 3300025949 Ga0207667_10364753 Ga0207667_103647532 257
945 3300025949 Ga0207667_10787806 Ga0207667_107878062 257
946 3300025961 Ga0207712_10000146 Ga0207712_1000014661 257
947 3300025961 Ga0207712_10261141 Ga0207712_102611412 257
948 3300025972 Ga0207668_10000070 Ga0207668_1000007063 257
949 3300025972 Ga0207668_10015855 Ga0207668_100158555 257
950 3300025981 Ga0207640_10019095 Ga0207640_100190953 257
951 3300025981 Ga0207640_10042755 Ga0207640_100427553 257
952 3300025981 Ga0207640_10074059 Ga0207640_100740592 257
953 3300025981 Ga0207640_10201323 Ga0207640_102013232 257
954 3300025981 Ga0207640_10248815 Ga0207640_102488151 257
955 3300025986 Ga0207658_10040256 Ga0207658_100402562 257
956 3300025986 Ga0207658_10223441 Ga0207658_102234412 257
957 3300025986 Ga0207658_10310718 Ga0207658_103107182 257
958 3300026023 Ga0207677_10435613 Ga0207677_104356132 257
959 3300026035 Ga0207703_10069215 Ga0207703_100692153 257
960 3300026041 Ga0207639_10000306 Ga0207639_1000030615 257
961 3300026041 Ga0207639_10000754 Ga0207639_100007549 257
962 3300026041 Ga0207639_10002714 Ga0207639_1000271414 257
963 3300026041 Ga0207639_10038297 Ga0207639_100382975 257
964 3300026041 Ga0207639_10117738 Ga0207639_101177382 257
965 3300026067 Ga0207678_10006909 Ga0207678_100069098 257
966 3300026067 Ga0207678_10023897 Ga0207678_100238976 257
967 3300026067 Ga0207678_10026074 Ga0207678_100260746 257
968 3300026067 Ga0207678_10043646 Ga0207678_100436462 257
969 3300026067 Ga0207678_10044371 Ga0207678_100443716 257
970 3300026067 Ga0207678_10046436 Ga0207678_100464365 257
971 3300026067 Ga0207678_10148222 Ga0207678_101482225 257
972 3300026078 Ga0207702_10001192 Ga0207702_1000119211 257
973 3300026078 Ga0207702_10005600 Ga0207702_100056006 257
974 3300026078 Ga0207702_10007990 Ga0207702_1000799010 257
975 3300026078 Ga0207702_10078374 Ga0207702_100783744 257
976 3300026078 Ga0207702_10094662 Ga0207702_100946622 257
977 3300026078 Ga0207702_10115370 Ga0207702_101153703 257
978 3300026078 Ga0207702_10222774 Ga0207702_102227743 257
979 3300026078 Ga0207702_10272080 Ga0207702_102720803 257
980 3300026078 Ga0207702_10353487 Ga0207702_103534872 257
981 3300026088 Ga0207641_10061126 Ga0207641_100611265 257
982 3300026088 Ga0207641_10067884 Ga0207641_100678843 257
983 3300026088 Ga0207641_10200252 Ga0207641_102002523 257
984 3300026089 Ga0207648_10001147 Ga0207648_1000114722 257
985 3300026089 Ga0207648_10028790 Ga0207648_100287905 257
986 3300026095 Ga0207676_10005875 Ga0207676_100058758 257
987 3300026095 Ga0207676_10123626 Ga0207676_101236262 257
988 3300026095 Ga0207676_10692581 Ga0207676_106925811 257
989 3300026116 Ga0207674_10002878 Ga0207674_1000287818 257
990 3300026116 Ga0207674_10005415 Ga0207674_100054154 257
991 3300026116 Ga0207674_10009470 Ga0207674_100094709 257
992 3300026116 Ga0207674_10012787 Ga0207674_100127872 257
993 3300026116 Ga0207674_10015233 Ga0207674_100152336 257
994 3300026116 Ga0207674_10021020 Ga0207674_100210203 257
995 3300026116 Ga0207674_10043520 Ga0207674_100435203 257
996 3300026116 Ga0207674_10066032 Ga0207674_100660326 257
997 3300026116 Ga0207674_10122923 Ga0207674_101229235 257
998 3300026118 Ga0207675_100143382 Ga0207675_1001433822 257
999 3300026121 Ga0207683_10093132 Ga0207683_100931322 257
1000 3300026142 Ga0207698_10000562 Ga0207698_1000056220 257
1001 3300026142 Ga0207698_10000924 Ga0207698_1000092417 257
1002 3300026142 Ga0207698_10004791 Ga0207698_100047912 257
1003 3300026142 Ga0207698_10032721 Ga0207698_100327214 257
1004 3300026142 Ga0207698_10087713 Ga0207698_100877133 257
1005 3300026142 Ga0207698_10109576 Ga0207698_101095762 257
1006 3300026142 Ga0207698_10344896 Ga0207698_103448962 257
1007 3300028379 Ga0268266_10002339 Ga0268266_100023399 257
1008 3300028379 Ga0268266_10014941 Ga0268266_100149414 257
1009 3300028380 Ga0268265_10028171 Ga0268265_100281714 257
1010 3300028380 Ga0268265_10058445 Ga0268265_100584454 257
1011 3300028380 Ga0268265_10079746 Ga0268265_100797464 257
1012 3300028380 Ga0268265_10176810 Ga0268265_101768103 257
1013 3300028380 Ga0268265_10210555 Ga0268265_102105553 257
1014 3300028381 Ga0268264_10000594 Ga0268264_1000059422 257
1015 3300028381 Ga0268264_10068579 Ga0268264_100685793 257
1016 3300028381 Ga0268264_10222302 Ga0268264_102223022 257
1017 3300028381 Ga0268264_10631781 Ga0268264_106317812 257
1018 3300031824 Ga0307413_10275981 Ga0307413_102759812 257
1019 3300034816 Ga0373930_0003943 Ga0373930_0003943_1369_2148 257
1020 3300035088 Ga0373940_0025767 Ga0373940_0025767_448_1221 257
1021 3300035118 Ga0373954_0035162 Ga0373954_0035162_653_1432 257
1022 3300035691 Ga0373931_0017772 Ga0373931_0017772_1030_1809 257
1023 3300036401 Ga0373937_0064013 Ga0373937_0064013_781_1560 257
1024 3300037312 Ga0395899_0000103 Ga0395899_0000103_46523_47299 257
1025 3300037312 Ga0395899_0012190 Ga0395899_0012190_4337_5116 257
1026 3300037312 Ga0395899_0016719 Ga0395899_0016719_1677_2456 257
1027 3300037312 Ga0395899_0025770 Ga0395899_0025770_299_1078 257
1028 3300037312 Ga0395899_0045361 Ga0395899_0045361_431_1210 257
1029 3300037312 Ga0395899_0051693 Ga0395899_0051693_1807_2586 257
1030 3300037312 Ga0395899_0053952 Ga0395899_0053952_1497_2276 257
1031 3300037312 Ga0395899_0053982 Ga0395899_0053982_1867_2646 257
1032 3300037312 Ga0395899_0089844 Ga0395899_0089844_936_1709 257
1033 3300037312 Ga0395899_0094461 Ga0395899_0094461_377_1156 257
1034 3300037312 Ga0395899_0162361 Ga0395899_0162361_192_971 257
1035 3300037312 Ga0395899_0366325 Ga0395899_0366325_155_934 257
1036 3300037418 Ga0395900_0000093 Ga0395900_0000093_101124_101900 257
1037 3300037418 Ga0395900_0003281 Ga0395900_0003281_5438_6217 257
1038 3300037418 Ga0395900_0010382 Ga0395900_0010382_2352_3131 257
1039 3300037418 Ga0395900_0013998 Ga0395900_0013998_313_1092 257
1040 3300037418 Ga0395900_0026676 Ga0395900_0026676_2883_3662 257
1041 3300037418 Ga0395900_0051565 Ga0395900_0051565_1326_2105 257
1042 3300037418 Ga0395900_0053214 Ga0395900_0053214_828_1607 257
1043 3300037418 Ga0395900_0056809 Ga0395900_0056809_828_1601 257
1044 3300037418 Ga0395900_0084658 Ga0395900_0084658_213_992 257
1045 3300037418 Ga0395900_0092489 Ga0395900_0092489_1947_2726 257
1046 3300037418 Ga0395900_0102789 Ga0395900_0102789_212_991 257
1047 3300037418 Ga0395900_0112669 Ga0395900_0112669_1334_2116 257
1048 3300037418 Ga0395900_0129979 Ga0395900_0129979_1600_2379 257
1049 3300037418 Ga0395900_0154585 Ga0395900_0154585_551_1324 257
1050 3300037418 Ga0395900_0196028 Ga0395900_0196028_926_1705 257
1051 3300037418 Ga0395900_0219404 Ga0395900_0219404_967_1746 257
1052 3300037418 Ga0395900_0243214 Ga0395900_0243214_96_875 257
1053 3300037466 Ga0395898_0000053 Ga0395898_0000053_101124_101900 257
1054 3300037466 Ga0395898_0004617 Ga0395898_0004617_7862_8641 257
1055 3300037466 Ga0395898_0029408 Ga0395898_0029408_2600_3379 257
1056 3300037466 Ga0395898_0049561 Ga0395898_0049561_1815_2594 257
1057 3300037466 Ga0395898_0078565 Ga0395898_0078565_2081_2860 257
1058 3300037466 Ga0395898_0083567 Ga0395898_0083567_2193_2972 257
1059 3300037466 Ga0395898_0179041 Ga0395898_0179041_1023_1805 257
1060 3300037466 Ga0395898_0205429 Ga0395898_0205429_387_1166 257
1061 3300037466 Ga0395898_0280602 Ga0395898_0280602_333_1112 257
1062 3300037466 Ga0395898_0447808 Ga0395898_0447808_394_1173 257
1063 3300037466 Ga0395898_0502123 Ga0395898_0502123_220_999 257
1064 3300037466 Ga0395898_0549820 Ga0395898_0549820_252_1031 257
1065 3300037471 Ga0395905_0000031 Ga0395905_0000031_184858_185634 257
1066 3300037471 Ga0395905_0010587 Ga0395905_0010587_2081_2860 257
1067 3300037471 Ga0395905_0016261 Ga0395905_0016261_5914_6693 257
1068 3300037471 Ga0395905_0016724 Ga0395905_0016724_2113_2892 257
1069 3300037471 Ga0395905_0045805 Ga0395905_0045805_3214_3993 257
1070 3300037471 Ga0395905_0045908 Ga0395905_0045908_463_1242 257
1071 3300037471 Ga0395905_0069845 Ga0395905_0069845_2099_2875 257
1072 3300037471 Ga0395905_0077926 Ga0395905_0077926_360_1139 257
1073 3300037471 Ga0395905_0085306 Ga0395905_0085306_152_931 257
1074 3300037471 Ga0395905_0102774 Ga0395905_0102774_849_1622 257
1075 3300037471 Ga0395905_0115598 Ga0395905_0115598_1675_2454 257
1076 3300037471 Ga0395905_0121000 Ga0395905_0121000_790_1569 257
1077 3300037471 Ga0395905_0121015 Ga0395905_0121015_198_977 257
1078 3300037471 Ga0395905_0161530 Ga0395905_0161530_1013_1792 257
1079 3300037471 Ga0395905_0176198 Ga0395905_0176198_429_1211 257
1080 3300037471 Ga0395905_0192613 Ga0395905_0192613_1064_1843 257
1081 3300037471 Ga0395905_0198150 Ga0395905_0198150_345_1124 257
1082 3300037471 Ga0395905_0222246 Ga0395905_0222246_403_1182 257
1083 3300037471 Ga0395905_0234240 Ga0395905_0234240_450_1229 257
1084 3300037471 Ga0395905_0291130 Ga0395905_0291130_415_1194 257
1085 3300038443 Ga0395901_0001133 Ga0395901_0001133_2286_3062 257
1086 3300038443 Ga0395901_0002677 Ga0395901_0002677_4079_4858 257
1087 3300038443 Ga0395901_0026729 Ga0395901_0026729_2798_3577 257
1088 3300038443 Ga0395901_0030345 Ga0395901_0030345_2082_2861 257
1089 3300038443 Ga0395901_0055540 Ga0395901_0055540_3137_3916 257
1090 3300038443 Ga0395901_0089256 Ga0395901_0089256_1555_2334 257
1091 3300038443 Ga0395901_0099227 Ga0395901_0099227_954_1733 257
1092 3300038443 Ga0395901_0107449 Ga0395901_0107449_1185_1964 257
1093 3300038443 Ga0395901_0207644 Ga0395901_0207644_1227_2009 257
1094 3300038443 Ga0395901_0220892 Ga0395901_0220892_463_1242 257
1095 3300038443 Ga0395901_0224323 Ga0395901_0224323_415_1194 257
1096 3300038443 Ga0395901_0375600 Ga0395901_0375600_337_1110 257
1097 3300038443 Ga0395901_0613643 Ga0395901_0613643_292_1071 257
1098 3300038443 Ga0395901_0621145 Ga0395901_0621145_234_1013 257
1099 3300042005 Ga0439448_0058437 Ga0439448_0058437_415_1194 257
1100 3300042439 Ga0439464_0001273 Ga0439464_0001273_2394_3167 257
1101 3300044684 Ga0466966_0000040 Ga0466966_0000040_22785_23564 257
1102 3300044684 Ga0466966_0003997 Ga0466966_0003997_5801_6580 257
1103 3300044684 Ga0466966_0009110 Ga0466966_0009110_3561_4340 257
1104 3300044684 Ga0466966_0030967 Ga0466966_0030967_1614_2393 257
1105 3300044684 Ga0466966_0099973 Ga0466966_0099973_548_1327 257
1106 3300044684 Ga0466966_0109882 Ga0466966_0109882_574_1353 257
1107 3300044693 Ga0466961_0014064 Ga0466961_0014064_1158_1937 257
1108 3300044693 Ga0466961_0059538 Ga0466961_0059538_864_1643 257
1109 3300044694 Ga0466963_0005840 Ga0466963_0005840_5821_6600 257
1110 3300044694 Ga0466963_0010230 Ga0466963_0010230_2880_3659 257
1111 3300044694 Ga0466963_0010809 Ga0466963_0010809_3762_4541 257
1112 3300044694 Ga0466963_0012991 Ga0466963_0012991_3143_3922 257
1113 3300044694 Ga0466963_0104377 Ga0466963_0104377_845_1624 257
1114 3300044694 Ga0466963_0119278 Ga0466963_0119278_414_1193 257
1115 3300044694 Ga0466963_0132539 Ga0466963_0132539_563_1342 257
1116 3300044706 Ga0466964_0015616 Ga0466964_0015616_809_1588 257
1117 3300044719 Ga0466971_0021489 Ga0466971_0021489_1421_2200 257
1118 3300044719 Ga0466971_0024646 Ga0466971_0024646_767_1546 257
1119 3300044719 Ga0466971_0208707 Ga0466971_0208707_10_789 257
1120 3300044765 Ga0466970_0020790 Ga0466970_0020790_2497_3276 257
1121 3300044842 Ga0466957_0004308 Ga0466957_0004308_4012_4791 257
1122 3300044842 Ga0466957_0007856 Ga0466957_0007856_934_1713 257
1123 3300044842 Ga0466957_0009860 Ga0466957_0009860_2412_3191 257
1124 3300044842 Ga0466957_0054483 Ga0466957_0054483_691_1470 257
1125 3300044842 Ga0466957_0055976 Ga0466957_0055976_1508_2287 257
1126 3300044842 Ga0466957_0124291 Ga0466957_0124291_636_1415 257
1127 3300045049 Ga0466959_0050974 Ga0466959_0050974_851_1630 257
1128 3300045049 Ga0466959_0121256 Ga0466959_0121256_914_1693 257
1129 3300045049 Ga0466959_0233223 Ga0466959_0233223_388_1167 257
1130 3300045049 Ga0466959_0403872 Ga0466959_0403872_65_844 257
1131 3300045836 Ga0466958_0003093 Ga0466958_0003093_5317_6096 257
1132 3300045836 Ga0466958_0010790 Ga0466958_0010790_2239_3018 257
1133 3300045836 Ga0466958_0024570 Ga0466958_0024570_1184_1963 257
1134 3300045836 Ga0466958_0075556 Ga0466958_0075556_663_1442 257
1135 3300045836 Ga0466958_0077273 Ga0466958_0077273_686_1465 257
1136 3300045836 Ga0466958_0270170 Ga0466958_0270170_141_920 257
1137 3300045976 Ga0466967_0000651 Ga0466967_0000651_9106_9885 257
1138 3300045976 Ga0466967_0001599 Ga0466967_0001599_11584_12363 257
1139 3300045976 Ga0466967_0004220 Ga0466967_0004220_7086_7865 257
1140 3300045976 Ga0466967_0016058 Ga0466967_0016058_3844_4623 257
1141 3300045976 Ga0466967_0019582 Ga0466967_0019582_1385_2164 257
1142 3300045976 Ga0466967_0058141 Ga0466967_0058141_1117_1896 257
1143 3300045976 Ga0466967_0120715 Ga0466967_0120715_400_1179 257
1144 3300045976 Ga0466967_0178284 Ga0466967_0178284_626_1405 257
1145 3300045976 Ga0466967_0182448 Ga0466967_0182448_25_804 257
1146 3300045976 Ga0466967_0306359 Ga0466967_0306359_405_1184 257
1147 3300045976 Ga0466967_0311096 Ga0466967_0311096_464_1243 257
1148 3300045976 Ga0466967_0357487 Ga0466967_0357487_551_1333 257
1149 3300045976 Ga0466967_0380379 Ga0466967_0380379_10_789 257
1150 3300045976 Ga0466967_0441020 Ga0466967_0441020_269_1048 257
1151 3300046616 Ga0495668_0012970 Ga0495668_0012970_3300_4073 257
1152 3300046679 Ga0495623_0046451 Ga0495623_0046451_1224_2003 257
1153 3300048905 Ga0496102_0020707 Ga0496102_0020707_1000_1779 257
1154 3300048906 Ga0496103_0007362 Ga0496103_0007362_3169_3948 257
1155 3300048909 Ga0496106_0016894 Ga0496106_0016894_685_1464 257
1156 3300048910 Ga0496107_0036931 Ga0496107_0036931_895_1674 257
1157 3300048910 Ga0496107_0105049 Ga0496107_0105049_767_1546 257
1158 3300048911 Ga0496108_0010565 Ga0496108_0010565_6421_7200 257
1159 3300048912 Ga0496109_0008469 Ga0496109_0008469_7444_8223 257
1160 3300048912 Ga0496109_0202215 Ga0496109_0202215_668_1447 257
1161 3300048913 Ga0496110_0023537 Ga0496110_0023537_3369_4148 257
1162 3300048914 Ga0496111_0038041 Ga0496111_0038041_1832_2608 257
1163 3300048914 Ga0496111_0063305 Ga0496111_0063305_1121_1900 257
1164 3300048915 Ga0496112_0003787 Ga0496112_0003787_3434_4213 257
1165 3300048915 Ga0496112_0067079 Ga0496112_0067079_511_1290 257
1166 3300048916 Ga0496113_0002425 Ga0496113_0002425_9383_10162 257
1167 3300048916 Ga0496113_0322501 Ga0496113_0322501_429_1208 257
1168 3300049571 Ga0501034_0038567 Ga0501034_0038567_2505_3287 257
1169 3300049585 Ga0501069_0091314 Ga0501069_0091314_77_859 257
1170 3300050514 nmdc:mga08x19_303978_c1 nmdc:mga08x19_303978_c1_313_1092 257
1171 3300053134 Ga0500658_0000041 Ga0500658_0000041_20221_20994 257
1172 3300059490 Ga0587066_007332 Ga0587066_007332_392_1171 257
1173 3300059510 Ga0587090_004776 Ga0587090_004776_463_1242 257
1174 3300059510 Ga0587090_018476 Ga0587090_018476_59_838 257
1175 3300059512 Ga0587092_023171 Ga0587092_023171_184_963 257
1176 3300059605 Ga0587106_009386 Ga0587106_009386_425_1204 257
1177 3300059623 Ga0587101_002602 Ga0587101_002602_463_1242 257
1178 3300059644 Ga0587075_011312 Ga0587075_011312_14_793 257
1179 3300059646 Ga0587078_006952 Ga0587078_006952_421_1200 257
1180 3300059647 Ga0587079_013900 Ga0587079_013900_141_920 257
1181 3300059647 Ga0587079_017477 Ga0587079_017477_50_829 257
1182 3300059647 Ga0587079_027440 Ga0587079_027440_66_845 257
1183 3300060344 Ga0587071_004639 Ga0587071_004639_848_1627 257
1184 3300060344 Ga0587071_056784 Ga0587071_056784_31_810 257
1185 3300061719 Ga0466962_0088504 Ga0466962_0088504_336_1115 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

74

293

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8156 29 257
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8091 29 257
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.7961 29 257
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.7899 29 257
6b2z-assembly1.cif.gz_a cryo-em structure of the dimeric fo region of yeast mitochondrial atp synthase 0.7886 7 257
ID Description Score Start End Superfamily
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8754 84 257 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8743 83 257 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8657 84 257 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8558 83 257 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8302 83 257 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A4Q3E736-F1-model_v4 deleted 0.9017 87 257
AF-A0A4Q3E1I6-F1-model_v4 deleted 0.9006 97 257
AF-A0A4Q3E1I6-F1-model_v4 deleted 0.8897 97 257
AF-A0A4Q3E736-F1-model_v4 deleted 0.8817 87 257
AF-A0A2P6PM79-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) (F-ATPase protein 6) 0.88 89 257 GO:0000166
GO:0003677
GO:0003887
GO:0005739
GO:0006260
GO:0045263
GO:0046933

Feature Viewer

pLDDT pTM Quality
65.55 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map