F491352

General Info

Members Datasets Scaffolds Average Seq Length
1184 327 1184 142

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10000828|Ga0265330_100008289
Length 172
Sequence MVPRHPTLRQKKGEGWGNHLRSLERLNVAFSTFNGQTRSSLAEINITPLVDVVLVLLVIFMITEPVLQSGIEVNVPKTRTVKQITEQRMVVTIDREQNVFLNDQPVNVHDLPARLLQGSADPAHQAIYLRSDERVPFGAFASVMDAVKQSGITNVSIVTQPLDLKGSGGGSQ

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
97 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
177 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
186 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
298 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
299 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 3.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.31
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1007190 3300000546 Bacteria 1202
2 rootH2_10065200 3300003320 Bacteria 2748
3 Ga0058861_10190843 3300004800 Unclassified 1450
4 Ga0058861_11938866 3300004800 Bacteria 1793
5 Ga0058862_12837641 3300004803 Bacteria 2460
6 Ga0065712_10288886 3300005290 Unclassified 881
7 Ga0070658_10411978 3300005327 Bacteria 1161
8 Ga0070658_11053063 3300005327 Bacteria 707
9 Ga0070683_100084489 3300005329 Bacteria 2974
10 Ga0070683_100089019 3300005329 Bacteria 2897
11 Ga0070683_100133954 3300005329 Bacteria 2346
12 Ga0070683_100336452 3300005329 Bacteria 1437
13 Ga0070683_100484665 3300005329 Bacteria 1181
14 Ga0070683_100650618 3300005329 Bacteria 1009
15 Ga0070683_100765340 3300005329 Bacteria 925
16 Ga0070670_100006721 3300005331 Bacteria 9747
17 Ga0070670_100056892 3300005331 Bacteria 3357
18 Ga0070670_100470631 3300005331 Unclassified 1115
19 Ga0068869_100010983 3300005334 Bacteria 5929
20 Ga0068869_100018873 3300005334 Bacteria 4701
21 Ga0068869_100033268 3300005334 Bacteria 3639
22 Ga0070666_10318487 3300005335 Bacteria 1109
23 Ga0070680_100022347 3300005336 Bacteria 5038
24 Ga0070680_100111175 3300005336 Bacteria 2281
25 Ga0070680_100182554 3300005336 Bacteria 1767
26 Ga0070680_100231220 3300005336 Bacteria 1562
27 Ga0070680_100455728 3300005336 Bacteria 1093
28 Ga0070680_100973201 3300005336 Bacteria 732
29 Ga0070682_100017177 3300005337 Bacteria 4215
30 Ga0070682_100247376 3300005337 Bacteria 1283
31 Ga0070682_101471696 3300005337 Bacteria 585
32 Ga0068868_100008407 3300005338 Bacteria 7388
33 Ga0068868_100036900 3300005338 Bacteria 3786
34 Ga0068868_100202723 3300005338 Bacteria 1654
35 Ga0068868_100272672 3300005338 Bacteria 1430
36 Ga0070660_100039738 3300005339 Bacteria 3577
37 Ga0070660_100110273 3300005339 Bacteria 2188
38 Ga0070660_100273465 3300005339 Bacteria 1381
39 Ga0070691_10267994 3300005341 Bacteria 922
40 Ga0070687_100037398 3300005343 Bacteria 2426
41 Ga0070661_100016970 3300005344 Bacteria 5157
42 Ga0070661_100294897 3300005344 Bacteria 1261
43 Ga0070661_100475988 3300005344 Bacteria 997
44 Ga0070661_100615297 3300005344 Bacteria 879
45 Ga0070692_10248976 3300005345 Unclassified 1063
46 Ga0070669_100157681 3300005353 Bacteria 1761
47 Ga0070669_101667207 3300005353 Bacteria 555
48 Ga0070671_100028795 3300005355 Bacteria 4578
49 Ga0070671_100059908 3300005355 Unclassified 3169
50 Ga0070671_100088494 3300005355 Bacteria 2592
51 Ga0070671_101505546 3300005355 Bacteria 595
52 Ga0070688_101113930 3300005365 Bacteria 631
53 Ga0070659_100074859 3300005366 Bacteria 2698
54 Ga0070667_100136947 3300005367 Bacteria 2141
55 Ga0070703_10078451 3300005406 Unclassified 1119
56 Ga0070709_10003260 3300005434 Bacteria 8718
57 Ga0070709_10005394 3300005434 Bacteria 6924
58 Ga0070709_10027776 3300005434 Bacteria 3368
59 Ga0070709_10039309 3300005434 Bacteria 2902
60 Ga0070709_10077637 3300005434 Bacteria 2159
61 Ga0070709_10077651 3300005434 Unclassified 2159
62 Ga0070709_10097707 3300005434 Unclassified 1950
63 Ga0070709_10453962 3300005434 Bacteria 966
64 Ga0070714_100000168 3300005435 Bacteria 52928
65 Ga0070714_100007372 3300005435 Bacteria 8558
66 Ga0070714_100274812 3300005435 Bacteria 1563
67 Ga0070714_100465155 3300005435 Bacteria 1203
68 Ga0070714_100706336 3300005435 Bacteria 973
69 Ga0070714_100743803 3300005435 Bacteria 948
70 Ga0070714_101071088 3300005435 Bacteria 785
71 Ga0070714_101082640 3300005435 Bacteria 781
72 Ga0070714_101105310 3300005435 Bacteria 772
73 Ga0070714_101362819 3300005435 Bacteria 693
74 Ga0070713_100000037 3300005436 Bacteria 85487
75 Ga0070713_100000200 3300005436 Bacteria 40030
76 Ga0070713_100049628 3300005436 Unclassified 3463
77 Ga0070713_100051036 3300005436 Bacteria 3420
78 Ga0070713_100066658 3300005436 Unclassified 3028
79 Ga0070713_100069600 3300005436 Bacteria 2968
80 Ga0070713_100140121 3300005436 Bacteria 2141
81 Ga0070713_100190929 3300005436 Bacteria 1846
82 Ga0070713_100276254 3300005436 Bacteria 1540
83 Ga0070713_100282874 3300005436 Bacteria 1522
84 Ga0070713_100322086 3300005436 Bacteria 1428
85 Ga0070713_100436423 3300005436 Bacteria 1228
86 Ga0070713_100934609 3300005436 Bacteria 835
87 Ga0070713_100954261 3300005436 Bacteria 826
88 Ga0070713_101215468 3300005436 Bacteria 730
89 Ga0070713_101918693 3300005436 Bacteria 575
90 Ga0070710_10001589 3300005437 Bacteria 10728
91 Ga0070710_10025312 3300005437 Bacteria 3142
92 Ga0070710_10239736 3300005437 Bacteria 1161
93 Ga0070710_10391080 3300005437 Bacteria 930
94 Ga0070710_10551878 3300005437 Bacteria 796
95 Ga0070711_100000165 3300005439 Bacteria 35832
96 Ga0070711_100056241 3300005439 Bacteria 2720
97 Ga0070711_100085290 3300005439 Bacteria 2262
98 Ga0070711_100107326 3300005439 Bacteria 2043
99 Ga0070711_100253817 3300005439 Bacteria 1381
100 Ga0070700_100050694 3300005441 Bacteria 2581
101 Ga0070694_100461634 3300005444 Unclassified 1004
102 Ga0070708_100095788 3300005445 Bacteria 2710
103 Ga0070708_100106269 3300005445 Bacteria 2576
104 Ga0070708_100155885 3300005445 Unclassified 2126
105 Ga0070708_100306309 3300005445 Bacteria 1496
106 Ga0070708_100383756 3300005445 Bacteria 1325
107 Ga0070663_100023403 3300005455 Bacteria 4141
108 Ga0070663_100726203 3300005455 Unclassified 846
109 Ga0070663_101640549 3300005455 Bacteria 574
110 Ga0070678_100844041 3300005456 Bacteria 834
111 Ga0070681_10003422 3300005458 Bacteria 14863
112 Ga0070681_10007293 3300005458 Bacteria 10791
113 Ga0070681_10008702 3300005458 Bacteria 9955
114 Ga0070681_10072249 3300005458 Bacteria 3413
115 Ga0070681_10072357 3300005458 Bacteria 3410
116 Ga0070681_10082589 3300005458 Bacteria 3168
117 Ga0070681_10253597 3300005458 Bacteria 1672
118 Ga0070681_10285436 3300005458 Bacteria 1561
119 Ga0070681_10288069 3300005458 Bacteria 1553
120 Ga0070681_10954820 3300005458 Bacteria 776
121 Ga0070681_10985299 3300005458 Bacteria 763
122 Ga0068867_100077644 3300005459 Bacteria 2496
123 Ga0068867_100442779 3300005459 Bacteria 1105
124 Ga0070685_11010371 3300005466 Bacteria 624
125 Ga0070706_100003030 3300005467 Bacteria 16633
126 Ga0070706_100080381 3300005467 Bacteria 3019
127 Ga0070706_100152319 3300005467 Bacteria 2158
128 Ga0070706_100174186 3300005467 Bacteria 2009
129 Ga0070706_100324263 3300005467 Bacteria 1436
130 Ga0070706_101066383 3300005467 Bacteria 744
131 Ga0070707_100000016 3300005468 Bacteria 141729
132 Ga0070707_100002615 3300005468 Bacteria 17107
133 Ga0070707_100038533 3300005468 Bacteria 4565
134 Ga0070707_100220708 3300005468 Bacteria 1846
135 Ga0070707_100326989 3300005468 Bacteria 1490
136 Ga0070707_100601578 3300005468 Bacteria 1062
137 Ga0070707_101032189 3300005468 Bacteria 788
138 Ga0070707_101066876 3300005468 Bacteria 774
139 Ga0070698_100000956 3300005471 Bacteria 31611
140 Ga0070698_100250450 3300005471 Bacteria 1704
141 Ga0070698_100323633 3300005471 Bacteria 1473
142 Ga0070699_100001599 3300005518 Bacteria 20683
143 Ga0070699_100008452 3300005518 Bacteria 8919
144 Ga0070699_100206477 3300005518 Bacteria 1748
145 Ga0070699_100408058 3300005518 Bacteria 1229
146 Ga0070679_100000926 3300005530 Bacteria 25527
147 Ga0070679_100001090 3300005530 Bacteria 23752
148 Ga0070679_100005449 3300005530 Bacteria 11794
149 Ga0070679_100018151 3300005530 Bacteria 6822
150 Ga0070679_100072145 3300005530 Bacteria 3444
151 Ga0070679_100396355 3300005530 Bacteria 1326
152 Ga0070679_100432256 3300005530 Unclassified 1261
153 Ga0070679_100571212 3300005530 Bacteria 1074
154 Ga0070684_100063302 3300005535 Bacteria 3242
155 Ga0070684_100105716 3300005535 Bacteria 2519
156 Ga0070684_100111171 3300005535 Bacteria 2457
157 Ga0070684_100181169 3300005535 Bacteria 1916
158 Ga0070684_100302902 3300005535 Bacteria 1467
159 Ga0070684_100306853 3300005535 Bacteria 1457
160 Ga0070684_100470307 3300005535 Bacteria 1163
161 Ga0070684_101212338 3300005535 Bacteria 710
162 Ga0070697_100000573 3300005536 Bacteria 27727
163 Ga0070697_100111175 3300005536 Bacteria 2283
164 Ga0070697_100818293 3300005536 Bacteria 824
165 Ga0070697_101161898 3300005536 Bacteria 688
166 Ga0068853_100001553 3300005539 Bacteria 16715
167 Ga0068853_100027048 3300005539 Bacteria 4820
168 Ga0068853_100027679 3300005539 Bacteria 4764
169 Ga0068853_100036136 3300005539 Bacteria 4199
170 Ga0068853_100103927 3300005539 Bacteria 2514
171 Ga0068853_100254257 3300005539 Bacteria 1613
172 Ga0068853_100406710 3300005539 Bacteria 1275
173 Ga0068853_101317100 3300005539 Bacteria 698
174 Ga0070672_101102984 3300005543 Unclassified 705
175 Ga0070686_100261478 3300005544 Bacteria 1269
176 Ga0070696_100394531 3300005546 Bacteria 1081
177 Ga0070693_100162240 3300005547 Unclassified 1424
178 Ga0070693_100644100 3300005547 Bacteria 770
179 Ga0070665_100112272 3300005548 Bacteria 2728
180 Ga0070665_100353179 3300005548 Bacteria 1476
181 Ga0070704_101158574 3300005549 Unclassified 704
182 Ga0068855_100001917 3300005563 Bacteria 25809
183 Ga0068855_100004015 3300005563 Bacteria 17973
184 Ga0068855_100016465 3300005563 Bacteria 8890
185 Ga0068855_100067912 3300005563 Bacteria 4151
186 Ga0068855_100154219 3300005563 Bacteria 2610
187 Ga0068855_100263428 3300005563 Bacteria 1919
188 Ga0068855_100611337 3300005563 Bacteria 1174
189 Ga0068855_100643796 3300005563 Bacteria 1139
190 Ga0068855_100973488 3300005563 Unclassified 893
191 Ga0068855_101421166 3300005563 Bacteria 714
192 Ga0070664_100002302 3300005564 Bacteria 15342
193 Ga0070664_100132986 3300005564 Bacteria 2186
194 Ga0070664_100157054 3300005564 Bacteria 2010
195 Ga0070664_101128672 3300005564 Bacteria 739
196 Ga0068857_100000704 3300005577 Bacteria 24884
197 Ga0068857_100002569 3300005577 Bacteria 14864
198 Ga0068857_100843541 3300005577 Bacteria 877
199 Ga0068857_100931717 3300005577 Bacteria 834
200 Ga0068854_100019800 3300005578 Bacteria 4542
201 Ga0068854_100056908 3300005578 Unclassified 2819
202 Ga0068854_100139004 3300005578 Bacteria 1862
203 Ga0068854_100141279 3300005578 Bacteria 1848
204 Ga0068854_100700606 3300005578 Bacteria 874
205 Ga0068856_100004417 3300005614 Bacteria 14018
206 Ga0068856_100004783 3300005614 Bacteria 13420
207 Ga0068856_100005368 3300005614 Bacteria 12638
208 Ga0068856_100030129 3300005614 Bacteria 5304
209 Ga0068856_100055262 3300005614 Bacteria 3918
210 Ga0068856_100059239 3300005614 Bacteria 3782
211 Ga0068856_100064707 3300005614 Bacteria 3613
212 Ga0068856_100572190 3300005614 Bacteria 1151
213 Ga0068856_100864946 3300005614 Bacteria 923
214 Ga0068856_101145443 3300005614 Bacteria 795
215 Ga0068856_102497944 3300005614 Unclassified 523
216 Ga0068852_100000034 3300005616 Bacteria 101076
217 Ga0068852_100000210 3300005616 Bacteria 39774
218 Ga0068852_100017573 3300005616 Bacteria 5615
219 Ga0068852_100023711 3300005616 Bacteria 4945
220 Ga0068852_100151271 3300005616 Bacteria 2158
221 Ga0068852_100164032 3300005616 Unclassified 2077
222 Ga0068852_100341090 3300005616 Bacteria 1460
223 Ga0068852_100546729 3300005616 Bacteria 1158
224 Ga0068852_101519792 3300005616 Bacteria 692
225 Ga0068859_100000183 3300005617 Bacteria 61406
226 Ga0068859_100063383 3300005617 Bacteria 3727
227 Ga0068859_100075701 3300005617 Bacteria 3406
228 Ga0068864_100000838 3300005618 Bacteria 25945
229 Ga0068864_100007241 3300005618 Bacteria 9120
230 Ga0068864_100466039 3300005618 Unclassified 1210
231 Ga0068866_10029740 3300005718 Bacteria 2615
232 Ga0068851_10006214 3300005834 Bacteria 5452
233 Ga0068851_10024116 3300005834 Bacteria 2978
234 Ga0068851_10097923 3300005834 Bacteria 1552
235 Ga0068851_10554727 3300005834 Unclassified 695
236 Ga0068863_100015920 3300005841 Bacteria 7214
237 Ga0068863_100041585 3300005841 Bacteria 4371
238 Ga0068863_100107626 3300005841 Bacteria 2653
239 Ga0068863_100298242 3300005841 Bacteria 1563
240 Ga0068863_101566388 3300005841 Bacteria 668
241 Ga0068858_100003853 3300005842 Bacteria 14829
242 Ga0068858_100009794 3300005842 Bacteria 9122
243 Ga0068858_100014663 3300005842 Bacteria 7378
244 Ga0068858_100110119 3300005842 Bacteria 2571
245 Ga0068858_100215651 3300005842 Bacteria 1817
246 Ga0068858_100280344 3300005842 Bacteria 1587
247 Ga0068858_101307173 3300005842 Unclassified 714
248 Ga0068858_101344858 3300005842 Unclassified 703
249 Ga0068858_101439038 3300005842 Bacteria 679
250 Ga0068860_100002858 3300005843 Bacteria 17929
251 Ga0068860_100018135 3300005843 Bacteria 6851
252 Ga0068860_100333548 3300005843 Bacteria 1490
253 Ga0068860_100997561 3300005843 Bacteria 855
254 Ga0068862_100078136 3300005844 Bacteria 2867
255 Ga0068862_100118881 3300005844 Bacteria 2327
256 Ga0068862_100130615 3300005844 Bacteria 2221
257 Ga0081540_1010434 3300005983 Bacteria 6291
258 Ga0081540_1084639 3300005983 Bacteria 1415
259 Ga0070717_10002732 3300006028 Bacteria 12463
260 Ga0070717_10023487 3300006028 Bacteria 4886
261 Ga0070717_10043221 3300006028 Bacteria 3677
262 Ga0070717_10092511 3300006028 Bacteria 2555
263 Ga0070717_10173286 3300006028 Bacteria 1877
264 Ga0070717_10212528 3300006028 Bacteria 1698
265 Ga0070717_10270138 3300006028 Bacteria 1506
266 Ga0070717_10395263 3300006028 Bacteria 1241
267 Ga0070717_10510279 3300006028 Bacteria 1087
268 Ga0070717_10580695 3300006028 Bacteria 1016
269 Ga0070717_10789849 3300006028 Bacteria 863
270 Ga0070715_10051175 3300006163 Bacteria 1776
271 Ga0070716_100146128 3300006173 Bacteria 1515
272 Ga0070716_100376928 3300006173 Bacteria 1013
273 Ga0070716_100432247 3300006173 Bacteria 955
274 Ga0070712_100000010 3300006175 Bacteria 143560
275 Ga0070712_100001120 3300006175 Bacteria 16137
276 Ga0070712_100005291 3300006175 Bacteria 7989
277 Ga0070712_100202561 3300006175 Bacteria 1560
278 Ga0097621_100006016 3300006237 Bacteria 8577
279 Ga0097621_100023882 3300006237 Bacteria 4766
280 Ga0097621_100025548 3300006237 Bacteria 4622
281 Ga0097621_100448085 3300006237 Bacteria 1162
282 Ga0097621_100648911 3300006237 Bacteria 968
283 Ga0068871_100006586 3300006358 Bacteria 8235
284 Ga0068871_100014144 3300006358 Bacteria 5937
285 Ga0068871_100016777 3300006358 Bacteria 5527
286 Ga0068871_100048401 3300006358 Unclassified 3432
287 Ga0068871_100259331 3300006358 Bacteria 1516
288 Ga0068871_100346190 3300006358 Bacteria 1313
289 Ga0075428_100262328 3300006844 Unclassified 1860
290 Ga0075428_100340525 3300006844 Bacteria 1610
291 Ga0075431_100034985 3300006847 Bacteria 5174
292 Ga0075433_10088550 3300006852 Unclassified 2735
293 Ga0075433_10150687 3300006852 Bacteria 2069
294 Ga0075433_10324881 3300006852 Bacteria 1361
295 Ga0075434_100001985 3300006871 Bacteria 17750
296 Ga0075434_100015065 3300006871 Bacteria 7403
297 Ga0075434_100436848 3300006871 Unclassified 1330
298 Ga0075434_101667861 3300006871 Unclassified 645
299 Ga0075429_100206588 3300006880 Bacteria 1721
300 Ga0068865_100046586 3300006881 Bacteria 2976
301 Ga0075436_100103408 3300006914 Bacteria 1985
302 Ga0075436_100158031 3300006914 Bacteria 1597
303 Ga0075436_100615185 3300006914 Unclassified 801
304 Ga0075436_101319593 3300006914 Bacteria 546
305 Ga0097620_100000183 3300006931 Bacteria 61406
306 Ga0097620_100063382 3300006931 Bacteria 3727
307 Ga0097620_100075698 3300006931 Bacteria 3406
308 Ga0075435_100032082 3300007076 Bacteria 4146
309 Ga0075435_100040020 3300007076 Bacteria 3742
310 Ga0075435_100312949 3300007076 Bacteria 1344
311 Ga0075435_100423967 3300007076 Unclassified 1146
312 Ga0099794_10655051 3300007265 Bacteria 558
313 Ga0099795_10162176 3300007788 Bacteria 923
314 Ga0105251_10381597 3300009011 Bacteria 646
315 Ga0105240_10000060 3300009093 Bacteria 219839
316 Ga0105240_10000077 3300009093 Bacteria 197213
317 Ga0105240_10000612 3300009093 Bacteria 66202
318 Ga0105240_10002617 3300009093 Bacteria 28747
319 Ga0105240_10008055 3300009093 Bacteria 15161
320 Ga0105240_10026848 3300009093 Bacteria 7552
321 Ga0105240_10026860 3300009093 Bacteria 7549
322 Ga0105240_10028975 3300009093 Bacteria 7221
323 Ga0105240_10032717 3300009093 Bacteria 6730
324 Ga0105240_10081263 3300009093 Bacteria 3983
325 Ga0105240_10098003 3300009093 Bacteria 3571
326 Ga0105240_10104641 3300009093 Bacteria 3437
327 Ga0105240_10151581 3300009093 Bacteria 2760
328 Ga0105240_10192655 3300009093 Bacteria 2396
329 Ga0105240_10258022 3300009093 Bacteria 2012
330 Ga0105240_10260847 3300009093 Bacteria 1999
331 Ga0105240_10542342 3300009093 Bacteria 1288
332 Ga0105240_11662236 3300009093 Unclassified 667
333 Ga0105240_12095943 3300009093 Bacteria 587
334 Ga0105245_10009603 3300009098 Bacteria 8438
335 Ga0105245_10032408 3300009098 Bacteria 4626
336 Ga0105245_10036700 3300009098 Bacteria 4355
337 Ga0105245_10038322 3300009098 Unclassified 4264
338 Ga0105245_10049064 3300009098 Bacteria 3778
339 Ga0105245_10140224 3300009098 Bacteria 2276
340 Ga0105245_10384626 3300009098 Bacteria 1398
341 Ga0105245_10564180 3300009098 Bacteria 1161
342 Ga0105245_11811613 3300009098 Unclassified 663
343 Ga0105247_10030064 3300009101 Bacteria 3293
344 Ga0105247_10165847 3300009101 Bacteria 1466
345 Ga0105247_11224158 3300009101 Bacteria 599
346 Ga0114129_10026137 3300009147 Bacteria 8267
347 Ga0114129_10113916 3300009147 Bacteria 3729
348 Ga0105243_10104427 3300009148 Bacteria 2359
349 Ga0105243_10388467 3300009148 Bacteria 1293
350 Ga0105243_10511651 3300009148 Bacteria 1140
351 Ga0105241_10000034 3300009174 Bacteria 115663
352 Ga0105241_10007113 3300009174 Bacteria 8238
353 Ga0105241_10015796 3300009174 Bacteria 5531
354 Ga0105241_10089155 3300009174 Bacteria 2430
355 Ga0105241_10106883 3300009174 Bacteria 2234
356 Ga0105241_10149486 3300009174 Bacteria 1909
357 Ga0105241_10411807 3300009174 Bacteria 1188
358 Ga0105241_10690066 3300009174 Bacteria 931
359 Ga0105241_10888947 3300009174 Bacteria 826
360 Ga0105242_10123848 3300009176 Bacteria 2222
361 Ga0105248_10000004 3300009177 Bacteria 695244
362 Ga0105248_10007097 3300009177 Bacteria 12270
363 Ga0105248_10016900 3300009177 Bacteria 8033
364 Ga0105248_10024598 3300009177 Bacteria 6696
365 Ga0105248_10038208 3300009177 Bacteria 5372
366 Ga0105248_10159546 3300009177 Bacteria 2544
367 Ga0105248_10178140 3300009177 Bacteria 2396
368 Ga0105248_10332108 3300009177 Bacteria 1712
369 Ga0105248_10395243 3300009177 Bacteria 1557
370 Ga0105237_10009255 3300009545 Bacteria 10560
371 Ga0105237_10047147 3300009545 Unclassified 4332
372 Ga0105237_10051387 3300009545 Bacteria 4140
373 Ga0105237_10053017 3300009545 Bacteria 4069
374 Ga0105237_10110924 3300009545 Bacteria 2735
375 Ga0105237_10157165 3300009545 Unclassified 2271
376 Ga0105237_10229279 3300009545 Bacteria 1858
377 Ga0105237_10384657 3300009545 Bacteria 1408
378 Ga0105237_10546549 3300009545 Bacteria 1165
379 Ga0105237_10628857 3300009545 Bacteria 1080
380 Ga0105237_10666233 3300009545 Bacteria 1047
381 Ga0105237_10684300 3300009545 Bacteria 1032
382 Ga0105237_10719320 3300009545 Bacteria 1005
383 Ga0105237_10853432 3300009545 Bacteria 917
384 Ga0105237_11969385 3300009545 Bacteria 593
385 Ga0105238_10000559 3300009551 Bacteria 38954
386 Ga0105238_10001285 3300009551 Bacteria 25205
387 Ga0105238_10001495 3300009551 Bacteria 23446
388 Ga0105238_10013086 3300009551 Bacteria 8370
389 Ga0105238_10014313 3300009551 Bacteria 8019
390 Ga0105238_10031256 3300009551 Bacteria 5420
391 Ga0105238_10116298 3300009551 Bacteria 2654
392 Ga0105238_10175168 3300009551 Bacteria 2122
393 Ga0105238_10280787 3300009551 Bacteria 1647
394 Ga0105238_11214486 3300009551 Bacteria 779
395 Ga0105249_10158736 3300009553 Bacteria 2184
396 Ga0105249_10417154 3300009553 Bacteria 1375
397 Ga0130087_1098374 3300009828 Bacteria 526
398 Ga0130086_1025278 3300009829 Bacteria 526
399 Ga0099796_10344618 3300010159 Bacteria 641
400 Ga0099796_10387295 3300010159 Bacteria 610
401 Ga0105239_10000325 3300010375 Bacteria 70490
402 Ga0105239_10019346 3300010375 Bacteria 7520
403 Ga0105239_10065257 3300010375 Bacteria 3997
404 Ga0105239_10165171 3300010375 Bacteria 2475
405 Ga0105239_10188672 3300010375 Bacteria 2307
406 Ga0105239_10207643 3300010375 Bacteria 2195
407 Ga0105239_10339952 3300010375 Bacteria 1694
408 Ga0105239_10465627 3300010375 Bacteria 1435
409 Ga0105239_10596896 3300010375 Bacteria 1259
410 Ga0105246_10023366 3300011119 Bacteria 4000
411 Ga0157373_10044556 3300013100 Bacteria 3167
412 Ga0157373_10089065 3300013100 Bacteria 2174
413 Ga0157373_10175255 3300013100 Bacteria 1509
414 Ga0157373_10475374 3300013100 Bacteria 901
415 Ga0157373_10831837 3300013100 Bacteria 682
416 Ga0157371_10048060 3300013102 Bacteria 3033
417 Ga0157371_10158935 3300013102 Bacteria 1614
418 Ga0157371_10420494 3300013102 Bacteria 980
419 Ga0157370_10000094 3300013104 Bacteria 100869
420 Ga0157370_10001457 3300013104 Bacteria 29273
421 Ga0157370_10065467 3300013104 Bacteria 3439
422 Ga0157370_10200487 3300013104 Bacteria 1851
423 Ga0157370_10262579 3300013104 Bacteria 1596
424 Ga0157370_10323875 3300013104 Bacteria 1421
425 Ga0157369_10000144 3300013105 Bacteria 101137
426 Ga0157369_10022158 3300013105 Bacteria 7097
427 Ga0157369_10027478 3300013105 Bacteria 6307
428 Ga0157369_10040273 3300013105 Bacteria 5101
429 Ga0157369_10042594 3300013105 Bacteria 4952
430 Ga0157369_10064108 3300013105 Bacteria 3957
431 Ga0157369_10068718 3300013105 Bacteria 3806
432 Ga0157369_10112753 3300013105 Bacteria 2889
433 Ga0157369_10136444 3300013105 Bacteria 2597
434 Ga0157369_10190881 3300013105 Bacteria 2153
435 Ga0157369_10241773 3300013105 Bacteria 1885
436 Ga0157369_10575335 3300013105 Bacteria 1163
437 Ga0157369_10865545 3300013105 Bacteria 927
438 Ga0157369_11091553 3300013105 Bacteria 816
439 Ga0157369_11345998 3300013105 Bacteria 727
440 Ga0157369_11857136 3300013105 Bacteria 612
441 Ga0157374_10000556 3300013296 Bacteria 33304
442 Ga0157374_10007237 3300013296 Bacteria 9455
443 Ga0157374_10010685 3300013296 Bacteria 7909
444 Ga0157374_10011657 3300013296 Bacteria 7622
445 Ga0157374_10017333 3300013296 Bacteria 6339
446 Ga0157374_10020227 3300013296 Bacteria 5904
447 Ga0157374_10020811 3300013296 Bacteria 5826
448 Ga0157374_10057003 3300013296 Bacteria 3648
449 Ga0157374_10082182 3300013296 Bacteria 3058
450 Ga0157374_10689386 3300013296 Bacteria 1034
451 Ga0157374_10765015 3300013296 Bacteria 981
452 Ga0157378_10000046 3300013297 Bacteria 105298
453 Ga0157378_10004033 3300013297 Bacteria 12965
454 Ga0157378_10010671 3300013297 Bacteria 8027
455 Ga0157378_10014390 3300013297 Bacteria 6926
456 Ga0157378_10019310 3300013297 Bacteria 5992
457 Ga0157378_10031312 3300013297 Bacteria 4700
458 Ga0157378_10045885 3300013297 Bacteria 3884
459 Ga0157378_10205685 3300013297 Bacteria 1864
460 Ga0157378_12518725 3300013297 Bacteria 567
461 Ga0163162_10002202 3300013306 Bacteria 18303
462 Ga0163162_10177649 3300013306 Bacteria 2255
463 Ga0163162_11156679 3300013306 Bacteria 877
464 Ga0163162_11189939 3300013306 Unclassified 865
465 Ga0157372_10000076 3300013307 Bacteria 102440
466 Ga0157372_10000275 3300013307 Bacteria 57081
467 Ga0157372_10000701 3300013307 Bacteria 36835
468 Ga0157372_10000958 3300013307 Bacteria 31445
469 Ga0157372_10014129 3300013307 Bacteria 8530
470 Ga0157372_10086108 3300013307 Bacteria 3565
471 Ga0157372_10127989 3300013307 Bacteria 2920
472 Ga0157372_10143937 3300013307 Bacteria 2749
473 Ga0157372_10149334 3300013307 Bacteria 2696
474 Ga0157372_10176843 3300013307 Bacteria 2470
475 Ga0157372_10201886 3300013307 Bacteria 2303
476 Ga0157372_10204676 3300013307 Bacteria 2287
477 Ga0157372_10255399 3300013307 Bacteria 2035
478 Ga0157372_10305808 3300013307 Bacteria 1850
479 Ga0157372_10326009 3300013307 Bacteria 1788
480 Ga0157372_10353233 3300013307 Bacteria 1713
481 Ga0157372_10354148 3300013307 Bacteria 1710
482 Ga0157372_11133243 3300013307 Bacteria 905
483 Ga0157372_11266817 3300013307 Bacteria 851
484 Ga0157372_11723367 3300013307 Bacteria 721
485 Ga0157372_12022904 3300013307 Bacteria 662
486 Ga0157375_10136060 3300013308 Bacteria 2581
487 Ga0157375_10300296 3300013308 Bacteria 1769
488 Ga0157375_10919688 3300013308 Bacteria 1018
489 Ga0157375_11770967 3300013308 Bacteria 732
490 Ga0163163_10038347 3300014325 Bacteria 4669
491 Ga0163163_10041061 3300014325 Bacteria 4522
492 Ga0163163_10080044 3300014325 Bacteria 3266
493 Ga0163163_10182534 3300014325 Bacteria 2146
494 Ga0157380_10317757 3300014326 Bacteria 1442
495 Ga0182008_10006174 3300014497 Bacteria 6732
496 Ga0157379_10001316 3300014968 Bacteria 20266
497 Ga0157379_10044416 3300014968 Bacteria 3967
498 Ga0157379_10082946 3300014968 Bacteria 2873
499 Ga0157379_10084926 3300014968 Bacteria 2837
500 Ga0157379_10098779 3300014968 Bacteria 2621
501 Ga0157379_10245060 3300014968 Bacteria 1626
502 Ga0157379_10360292 3300014968 Bacteria 1333
503 Ga0157379_10405716 3300014968 Bacteria 1253
504 Ga0157376_10009032 3300014969 Bacteria 7219
505 Ga0157376_10017619 3300014969 Bacteria 5454
506 Ga0157376_10024059 3300014969 Bacteria 4777
507 Ga0157376_10148573 3300014969 Bacteria 2111
508 Ga0157376_10161960 3300014969 Bacteria 2029
509 Ga0157376_10349611 3300014969 Bacteria 1414
510 Ga0157376_10423277 3300014969 Bacteria 1293
511 Ga0182006_1006060 3300015261 Bacteria 5660
512 Ga0182007_10029489 3300015262 Bacteria 1878
513 Ga0182005_1011183 3300015265 Bacteria 2565
514 Ga0206356_10466912 3300020070 Bacteria 1820
515 Ga0206354_11514623 3300020081 Unclassified 1565
516 Ga0206353_10611514 3300020082 Bacteria 781
517 Ga0206353_11871440 3300020082 Bacteria 1923
518 Ga0213872_10031946 3300021361 Unclassified 2413
519 Ga0213872_10260083 3300021361 Bacteria 729
520 Ga0224712_10001945 3300022467 Bacteria 4986
521 Ga0224572_1007280 3300024225 Bacteria 2026
522 Ga0224572_1007429 3300024225 Bacteria 2007
523 Ga0228598_1000453 3300024227 Bacteria 8375
524 Ga0228598_1001426 3300024227 Bacteria 5260
525 Ga0228598_1001628 3300024227 Bacteria 4905
526 Ga0228598_1020588 3300024227 Bacteria 1299
527 Ga0228598_1048423 3300024227 Bacteria 842
528 Ga0207656_10084167 3300025321 Bacteria 1434
529 Ga0207656_10146403 3300025321 Unclassified 1116
530 Ga0207656_10295402 3300025321 Bacteria 801
531 Ga0207656_10301099 3300025321 Unclassified 794
532 Ga0207692_10008566 3300025898 Bacteria 4238
533 Ga0207692_10241052 3300025898 Bacteria 1080
534 Ga0207692_10284921 3300025898 Bacteria 1001
535 Ga0207692_10920578 3300025898 Bacteria 575
536 Ga0207692_10948925 3300025898 Bacteria 567
537 Ga0207642_10006280 3300025899 Bacteria 3943
538 Ga0207710_10004110 3300025900 Bacteria 6393
539 Ga0207710_10609165 3300025900 Bacteria 571
540 Ga0207680_10232840 3300025903 Bacteria 1267
541 Ga0207680_10453990 3300025903 Bacteria 910
542 Ga0207647_10011620 3300025904 Bacteria 6165
543 Ga0207647_10016929 3300025904 Bacteria 4963
544 Ga0207685_10038013 3300025905 Bacteria 1776
545 Ga0207699_10000400 3300025906 Bacteria 22428
546 Ga0207699_10020437 3300025906 Bacteria 3550
547 Ga0207699_10024423 3300025906 Bacteria 3305
548 Ga0207699_10087768 3300025906 Unclassified 1945
549 Ga0207699_10096251 3300025906 Bacteria 1869
550 Ga0207699_10108949 3300025906 Bacteria 1771
551 Ga0207699_10284390 3300025906 Bacteria 1150
552 Ga0207705_10150175 3300025909 Bacteria 1746
553 Ga0207705_10172215 3300025909 Bacteria 1630
554 Ga0207705_10833987 3300025909 Bacteria 715
555 Ga0207684_10000426 3300025910 Bacteria 56031
556 Ga0207684_10030237 3300025910 Bacteria 4612
557 Ga0207684_10182801 3300025910 Bacteria 1808
558 Ga0207684_10187610 3300025910 Bacteria 1783
559 Ga0207684_10285282 3300025910 Bacteria 1424
560 Ga0207684_10894643 3300025910 Bacteria 746
561 Ga0207654_10000029 3300025911 Bacteria 123429
562 Ga0207654_10000085 3300025911 Bacteria 61970
563 Ga0207654_10007149 3300025911 Bacteria 5621
564 Ga0207654_10013595 3300025911 Bacteria 4189
565 Ga0207654_10046565 3300025911 Bacteria 2473
566 Ga0207654_10141886 3300025911 Bacteria 1533
567 Ga0207707_10004349 3300025912 Bacteria 12531
568 Ga0207707_10006821 3300025912 Bacteria 9964
569 Ga0207707_10008260 3300025912 Bacteria 9038
570 Ga0207707_10008380 3300025912 Bacteria 8972
571 Ga0207707_10091121 3300025912 Bacteria 2664
572 Ga0207707_10168907 3300025912 Bacteria 1911
573 Ga0207707_10291955 3300025912 Bacteria 1411
574 Ga0207707_10309675 3300025912 Bacteria 1365
575 Ga0207707_10327554 3300025912 Bacteria 1322
576 Ga0207707_10598899 3300025912 Bacteria 933
577 Ga0207707_10766937 3300025912 Bacteria 805
578 Ga0207695_10000063 3300025913 Bacteria 349527
579 Ga0207695_10000192 3300025913 Bacteria 173760
580 Ga0207695_10000707 3300025913 Bacteria 64975
581 Ga0207695_10001427 3300025913 Bacteria 40218
582 Ga0207695_10009869 3300025913 Bacteria 11731
583 Ga0207695_10020786 3300025913 Bacteria 7508
584 Ga0207695_10071518 3300025913 Bacteria 3543
585 Ga0207695_10094515 3300025913 Unclassified 2996
586 Ga0207695_10108434 3300025913 Bacteria 2761
587 Ga0207695_10121858 3300025913 Bacteria 2575
588 Ga0207695_10233630 3300025913 Bacteria 1742
589 Ga0207695_10345697 3300025913 Bacteria 1375
590 Ga0207695_10451670 3300025913 Bacteria 1168
591 Ga0207671_10000395 3300025914 Bacteria 60888
592 Ga0207671_10002488 3300025914 Bacteria 19682
593 Ga0207671_10047033 3300025914 Bacteria 3193
594 Ga0207671_10146525 3300025914 Bacteria 1822
595 Ga0207671_10155202 3300025914 Bacteria 1770
596 Ga0207671_10549358 3300025914 Bacteria 921
597 Ga0207671_10560701 3300025914 Bacteria 911
598 Ga0207693_10000004 3300025915 Bacteria 193261
599 Ga0207693_10000051 3300025915 Bacteria 99220
600 Ga0207693_10008481 3300025915 Bacteria 8412
601 Ga0207693_10029941 3300025915 Bacteria 4296
602 Ga0207693_11390159 3300025915 Bacteria 522
603 Ga0207663_10009977 3300025916 Bacteria 5029
604 Ga0207663_10012865 3300025916 Bacteria 4535
605 Ga0207663_10057872 3300025916 Bacteria 2444
606 Ga0207663_10116619 3300025916 Bacteria 1821
607 Ga0207663_10123167 3300025916 Bacteria 1779
608 Ga0207663_10678711 3300025916 Bacteria 814
609 Ga0207660_10002880 3300025917 Bacteria 11246
610 Ga0207660_10015331 3300025917 Bacteria 5056
611 Ga0207660_10044750 3300025917 Bacteria 3115
612 Ga0207660_10333449 3300025917 Bacteria 1213
613 Ga0207660_10339170 3300025917 Bacteria 1203
614 Ga0207660_11028511 3300025917 Bacteria 672
615 Ga0207657_10000830 3300025919 Bacteria 32651
616 Ga0207657_10051050 3300025919 Bacteria 3596
617 Ga0207657_10441804 3300025919 Bacteria 1021
618 Ga0207657_10750781 3300025919 Bacteria 756
619 Ga0207649_10021802 3300025920 Bacteria 3695
620 Ga0207649_10060496 3300025920 Bacteria 2380
621 Ga0207649_10103973 3300025920 Bacteria 1885
622 Ga0207649_10488536 3300025920 Bacteria 935
623 Ga0207649_10803792 3300025920 Bacteria 734
624 Ga0207652_10000885 3300025921 Bacteria 28349
625 Ga0207652_10001154 3300025921 Bacteria 23752
626 Ga0207652_10008135 3300025921 Bacteria 8421
627 Ga0207652_10046345 3300025921 Bacteria 3709
628 Ga0207652_10094323 3300025921 Bacteria 2635
629 Ga0207652_10180386 3300025921 Bacteria 1897
630 Ga0207652_10260500 3300025921 Bacteria 1564
631 Ga0207652_10334070 3300025921 Bacteria 1368
632 Ga0207652_10577441 3300025921 Bacteria 1009
633 Ga0207652_10638643 3300025921 Bacteria 952
634 Ga0207652_10786128 3300025921 Bacteria 846
635 Ga0207652_11117658 3300025921 Bacteria 689
636 Ga0207646_10000057 3300025922 Bacteria 158121
637 Ga0207646_10000614 3300025922 Bacteria 46404
638 Ga0207646_10038225 3300025922 Bacteria 4325
639 Ga0207646_10124272 3300025922 Bacteria 2319
640 Ga0207646_10155508 3300025922 Bacteria 2062
641 Ga0207646_10281600 3300025922 Bacteria 1502
642 Ga0207646_10411483 3300025922 Bacteria 1221
643 Ga0207694_10000370 3300025924 Bacteria 41884
644 Ga0207694_10003761 3300025924 Bacteria 12024
645 Ga0207694_10078342 3300025924 Bacteria 2590
646 Ga0207694_10126806 3300025924 Bacteria 2043
647 Ga0207694_10178101 3300025924 Unclassified 1723
648 Ga0207694_11192573 3300025924 Bacteria 644
649 Ga0207650_10082389 3300025925 Bacteria 2442
650 Ga0207650_11062960 3300025925 Unclassified 689
651 Ga0207687_10069322 3300025927 Bacteria 2515
652 Ga0207687_10141581 3300025927 Bacteria 1825
653 Ga0207687_10413277 3300025927 Bacteria 1112
654 Ga0207687_10428409 3300025927 Bacteria 1093
655 Ga0207687_10463983 3300025927 Bacteria 1052
656 Ga0207687_10854945 3300025927 Bacteria 777
657 Ga0207700_10000100 3300025928 Bacteria 52891
658 Ga0207700_10001993 3300025928 Bacteria 11644
659 Ga0207700_10016139 3300025928 Bacteria 4951
660 Ga0207700_10039508 3300025928 Bacteria 3436
661 Ga0207700_10164350 3300025928 Bacteria 1846
662 Ga0207700_10341379 3300025928 Bacteria 1302
663 Ga0207700_10411712 3300025928 Bacteria 1186
664 Ga0207700_10426971 3300025928 Bacteria 1165
665 Ga0207700_10527358 3300025928 Bacteria 1047
666 Ga0207700_10684008 3300025928 Bacteria 915
667 Ga0207664_10000133 3300025929 Bacteria 63672
668 Ga0207664_10005816 3300025929 Bacteria 8434
669 Ga0207664_10336689 3300025929 Bacteria 1334
670 Ga0207664_10354871 3300025929 Bacteria 1298
671 Ga0207664_10671194 3300025929 Bacteria 932
672 Ga0207664_10698581 3300025929 Bacteria 912
673 Ga0207664_10706156 3300025929 Bacteria 907
674 Ga0207664_10749260 3300025929 Bacteria 878
675 Ga0207664_10947585 3300025929 Bacteria 772
676 Ga0207644_10044962 3300025931 Unclassified 3140
677 Ga0207644_10066079 3300025931 Bacteria 2632
678 Ga0207644_10075817 3300025931 Bacteria 2472
679 Ga0207690_10082547 3300025932 Bacteria 2248
680 Ga0207690_10171722 3300025932 Bacteria 1625
681 Ga0207706_10336595 3300025933 Bacteria 1313
682 Ga0207706_10727194 3300025933 Unclassified 847
683 Ga0207704_10303940 3300025938 Bacteria 1223
684 Ga0207665_10009619 3300025939 Bacteria 6349
685 Ga0207665_10272338 3300025939 Bacteria 1258
686 Ga0207665_10399241 3300025939 Bacteria 1047
687 Ga0207665_10429015 3300025939 Bacteria 1011
688 Ga0207665_10627286 3300025939 Bacteria 841
689 Ga0207665_11131185 3300025939 Bacteria 624
690 Ga0207711_10000032 3300025941 Bacteria 199046
691 Ga0207711_10052956 3300025941 Bacteria 3480
692 Ga0207711_10062004 3300025941 Bacteria 3225
693 Ga0207711_10194575 3300025941 Bacteria 1849
694 Ga0207711_10200542 3300025941 Bacteria 1820
695 Ga0207711_10237154 3300025941 Bacteria 1672
696 Ga0207711_11311601 3300025941 Bacteria 666
697 Ga0207689_10000185 3300025942 Bacteria 54094
698 Ga0207689_10006589 3300025942 Bacteria 10238
699 Ga0207661_10126119 3300025944 Bacteria 2186
700 Ga0207661_10135912 3300025944 Bacteria 2111
701 Ga0207661_10331596 3300025944 Bacteria 1370
702 Ga0207661_10603878 3300025944 Bacteria 1007
703 Ga0207679_10018593 3300025945 Bacteria 4658
704 Ga0207679_10143520 3300025945 Bacteria 1933
705 Ga0207679_10179629 3300025945 Bacteria 1750
706 Ga0207679_10703302 3300025945 Bacteria 917
707 Ga0207667_10001339 3300025949 Bacteria 30901
708 Ga0207667_10005355 3300025949 Bacteria 15640
709 Ga0207667_10013091 3300025949 Bacteria 9520
710 Ga0207667_10014310 3300025949 Bacteria 9048
711 Ga0207667_10064551 3300025949 Bacteria 3822
712 Ga0207667_10150173 3300025949 Bacteria 2398
713 Ga0207667_10380854 3300025949 Bacteria 1437
714 Ga0207667_10507078 3300025949 Bacteria 1223
715 Ga0207667_10616455 3300025949 Bacteria 1093
716 Ga0207667_10648859 3300025949 Bacteria 1061
717 Ga0207651_10717618 3300025960 Bacteria 882
718 Ga0207640_10642353 3300025981 Unclassified 903
719 Ga0207658_10419625 3300025986 Bacteria 1179
720 Ga0207677_10008122 3300026023 Bacteria 5844
721 Ga0207677_10012943 3300026023 Bacteria 4819
722 Ga0207677_10173309 3300026023 Unclassified 1689
723 Ga0207677_10228291 3300026023 Bacteria 1498
724 Ga0207677_10828073 3300026023 Bacteria 830
725 Ga0207703_10008164 3300026035 Bacteria 8273
726 Ga0207703_10022015 3300026035 Bacteria 4992
727 Ga0207703_10054572 3300026035 Bacteria 3250
728 Ga0207703_10187654 3300026035 Bacteria 1829
729 Ga0207703_10459315 3300026035 Unclassified 1191
730 Ga0207703_10968599 3300026035 Bacteria 816
731 Ga0207639_10000119 3300026041 Bacteria 60307
732 Ga0207639_10033168 3300026041 Bacteria 3807
733 Ga0207639_10232529 3300026041 Bacteria 1598
734 Ga0207639_10777087 3300026041 Bacteria 892
735 Ga0207639_10798603 3300026041 Bacteria 879
736 Ga0207639_12236179 3300026041 Unclassified 508
737 Ga0207678_10040651 3300026067 Bacteria 4032
738 Ga0207678_10572682 3300026067 Unclassified 989
739 Ga0207708_10067352 3300026075 Bacteria 2738
740 Ga0207702_10002128 3300026078 Bacteria 19052
741 Ga0207702_10002334 3300026078 Bacteria 18128
742 Ga0207702_10005686 3300026078 Bacteria 10875
743 Ga0207702_10030516 3300026078 Bacteria 4492
744 Ga0207702_10062172 3300026078 Bacteria 3187
745 Ga0207702_10066393 3300026078 Bacteria 3092
746 Ga0207702_10173272 3300026078 Bacteria 1981
747 Ga0207702_10314391 3300026078 Bacteria 1490
748 Ga0207702_10342495 3300026078 Bacteria 1428
749 Ga0207702_10895145 3300026078 Bacteria 879
750 Ga0207702_12310832 3300026078 Bacteria 525
751 Ga0207641_10043523 3300026088 Bacteria 3771
752 Ga0207641_10227447 3300026088 Bacteria 1732
753 Ga0207641_10238468 3300026088 Bacteria 1693
754 Ga0207641_10776973 3300026088 Bacteria 946
755 Ga0207648_10028945 3300026089 Bacteria 4911
756 Ga0207648_10445166 3300026089 Bacteria 1179
757 Ga0207648_10567290 3300026089 Bacteria 1044
758 Ga0207676_10031738 3300026095 Bacteria 3974
759 Ga0207676_10228538 3300026095 Bacteria 1662
760 Ga0207674_10000444 3300026116 Bacteria 53769
761 Ga0207674_10000601 3300026116 Bacteria 47324
762 Ga0207674_10211528 3300026116 Bacteria 1888
763 Ga0207674_10273074 3300026116 Bacteria 1638
764 Ga0207674_10432127 3300026116 Bacteria 1272
765 Ga0207674_10633914 3300026116 Bacteria 1032
766 Ga0207698_10000069 3300026142 Bacteria 68642
767 Ga0207698_10000230 3300026142 Bacteria 34951
768 Ga0207698_10010674 3300026142 Bacteria 5922
769 Ga0207698_10542880 3300026142 Bacteria 1138
770 Ga0207698_10611863 3300026142 Bacteria 1075
771 Ga0207698_11442379 3300026142 Bacteria 703
772 Ga0207698_12311462 3300026142 Unclassified 549
773 Ga0207428_10168643 3300027907 Bacteria 1659
774 Ga0265356_1000349 3300028017 Bacteria 8439
775 Ga0265356_1012164 3300028017 Bacteria 947
776 Ga0265356_1037211 3300028017 Bacteria 533
777 Ga0265355_1017435 3300028036 Bacteria 613
778 Ga0268266_10054113 3300028379 Bacteria 3449
779 Ga0268266_10289255 3300028379 Bacteria 1526
780 Ga0268265_10216596 3300028380 Bacteria 1672
781 Ga0268265_10600952 3300028380 Bacteria 1051
782 Ga0268265_10898922 3300028380 Bacteria 869
783 Ga0268265_11201872 3300028380 Bacteria 756
784 Ga0268264_10004880 3300028381 Bacteria 11364
785 Ga0268264_10014897 3300028381 Bacteria 6387
786 Ga0268264_10225676 3300028381 Bacteria 1727
787 Ga0268264_10924880 3300028381 Bacteria 876
788 Ga0268264_11233909 3300028381 Bacteria 757
789 Ga0265326_10047833 3300028558 Bacteria 1213
790 Ga0265323_10095612 3300028653 Bacteria 988
791 Ga0265336_10001878 3300028666 Bacteria 9085
792 Ga0265336_10021494 3300028666 Bacteria 2062
793 Ga0265338_10002959 3300028800 Bacteria 24653
794 Ga0265338_10003184 3300028800 Bacteria 23419
795 Ga0265338_10005440 3300028800 Bacteria 16622
796 Ga0265338_10016693 3300028800 Bacteria 7958
797 Ga0265338_10033453 3300028800 Bacteria 4988
798 Ga0265338_10052707 3300028800 Bacteria 3647
799 Ga0265338_10077754 3300028800 Bacteria 2803
800 Ga0265338_10107048 3300028800 Bacteria 2262
801 Ga0265338_10157759 3300028800 Bacteria 1756
802 Ga0265338_10159635 3300028800 Bacteria 1742
803 Ga0265338_10421551 3300028800 Bacteria 948
804 Ga0265338_10542874 3300028800 Bacteria 814
805 Ga0265338_10607077 3300028800 Bacteria 762
806 Ga0265338_10779783 3300028800 Bacteria 656
807 Ga0265324_10176510 3300029957 Bacteria 725
808 Ga0265762_1000898 3300030760 Bacteria 5299
809 Ga0265762_1002331 3300030760 Bacteria 3435
810 Ga0265762_1011840 3300030760 Bacteria 1560
811 Ga0265762_1046806 3300030760 Bacteria 859
812 Ga0265765_1013026 3300030879 Bacteria 948
813 Ga0265760_10000507 3300031090 Bacteria 10900
814 Ga0265760_10000556 3300031090 Bacteria 10568
815 Ga0265760_10019053 3300031090 Bacteria 1977
816 Ga0265760_10022397 3300031090 Bacteria 1831
817 Ga0265760_10066032 3300031090 Bacteria 1105
818 Ga0265760_10099672 3300031090 Bacteria 917
819 Ga0265760_10144149 3300031090 Unclassified 777
820 Ga0265330_10000079 3300031235 Bacteria 82255
821 Ga0265330_10000828 3300031235 Bacteria 19434
822 Ga0265330_10018444 3300031235 Bacteria 3205
823 Ga0265330_10028694 3300031235 Bacteria 2506
824 Ga0265330_10076759 3300031235 Bacteria 1442
825 Ga0265330_10092325 3300031235 Bacteria 1299
826 Ga0265330_10107453 3300031235 Bacteria 1193
827 Ga0265330_10172446 3300031235 Bacteria 917
828 Ga0265332_10030604 3300031238 Bacteria 2351
829 Ga0265332_10037397 3300031238 Bacteria 2105
830 Ga0265328_10006930 3300031239 Bacteria 4757
831 Ga0265320_10101866 3300031240 Bacteria 1322
832 Ga0265325_10000269 3300031241 Bacteria 37019
833 Ga0265325_10000664 3300031241 Bacteria 25082
834 Ga0265325_10004556 3300031241 Bacteria 8728
835 Ga0265325_10009565 3300031241 Bacteria 5657
836 Ga0265325_10029196 3300031241 Bacteria 2965
837 Ga0265325_10048764 3300031241 Unclassified 2188
838 Ga0265325_10050267 3300031241 Bacteria 2148
839 Ga0265325_10052532 3300031241 Bacteria 2091
840 Ga0265325_10163211 3300031241 Bacteria 1047
841 Ga0265329_10012908 3300031242 Bacteria 2991
842 Ga0265329_10131947 3300031242 Bacteria 804
843 Ga0265340_10003189 3300031247 Bacteria 9298
844 Ga0265340_10013452 3300031247 Bacteria 4296
845 Ga0265340_10014250 3300031247 Bacteria 4159
846 Ga0265340_10026330 3300031247 Bacteria 2941
847 Ga0265340_10043205 3300031247 Bacteria 2210
848 Ga0265340_10090959 3300031247 Bacteria 1426
849 Ga0265340_10227405 3300031247 Bacteria 835
850 Ga0265339_10002137 3300031249 Bacteria 14389
851 Ga0265339_10007786 3300031249 Bacteria 6887
852 Ga0265339_10010524 3300031249 Bacteria 5742
853 Ga0265339_10014373 3300031249 Bacteria 4771
854 Ga0265339_10028226 3300031249 Bacteria 3193
855 Ga0265339_10038843 3300031249 Bacteria 2653
856 Ga0265339_10064493 3300031249 Bacteria 1965
857 Ga0265339_10156554 3300031249 Bacteria 1149
858 Ga0265339_10172218 3300031249 Bacteria 1083
859 Ga0265331_10010830 3300031250 Bacteria 5016
860 Ga0265331_10013219 3300031250 Bacteria 4446
861 Ga0265331_10154354 3300031250 Bacteria 1042
862 Ga0265331_10174303 3300031250 Bacteria 972
863 Ga0265331_10196951 3300031250 Bacteria 908
864 Ga0265327_10007910 3300031251 Bacteria 8060
865 Ga0265316_10000687 3300031344 Bacteria 37565
866 Ga0265316_10001007 3300031344 Bacteria 30605
867 Ga0265316_10004970 3300031344 Bacteria 13057
868 Ga0265316_10005155 3300031344 Bacteria 12792
869 Ga0265316_10014095 3300031344 Bacteria 7055
870 Ga0265316_10015829 3300031344 Bacteria 6570
871 Ga0265316_10028528 3300031344 Bacteria 4604
872 Ga0265316_10039972 3300031344 Bacteria 3763
873 Ga0265316_10040159 3300031344 Bacteria 3753
874 Ga0265316_10077681 3300031344 Bacteria 2549
875 Ga0265316_10080823 3300031344 Unclassified 2493
876 Ga0265316_10191129 3300031344 Bacteria 1521
877 Ga0265316_10293950 3300031344 Unclassified 1185
878 Ga0265316_10334310 3300031344 Bacteria 1099
879 Ga0265316_10691444 3300031344 Bacteria 719
880 Ga0307408_100093043 3300031548 Bacteria 2280
881 Ga0265313_10004047 3300031595 Bacteria 11424
882 Ga0265313_10004402 3300031595 Bacteria 10860
883 Ga0265313_10005676 3300031595 Bacteria 9107
884 Ga0265313_10038923 3300031595 Bacteria 2364
885 Ga0265313_10070179 3300031595 Bacteria 1615
886 Ga0265313_10112988 3300031595 Unclassified 1192
887 Ga0265313_10237341 3300031595 Bacteria 747
888 Ga0265314_10000064 3300031711 Bacteria 158787
889 Ga0265314_10003032 3300031711 Bacteria 16593
890 Ga0265314_10011561 3300031711 Bacteria 7272
891 Ga0265314_10012941 3300031711 Bacteria 6776
892 Ga0265314_10090780 3300031711 Bacteria 1989
893 Ga0265314_10107760 3300031711 Bacteria 1777
894 Ga0265314_10108330 3300031711 Bacteria 1770
895 Ga0265314_10120586 3300031711 Bacteria 1651
896 Ga0265314_10192228 3300031711 Bacteria 1213
897 Ga0265342_10001845 3300031712 Bacteria 19168
898 Ga0265342_10003868 3300031712 Bacteria 12046
899 Ga0265342_10006161 3300031712 Bacteria 8976
900 Ga0265342_10113000 3300031712 Bacteria 1535
901 Ga0265342_10127761 3300031712 Bacteria 1426
902 Ga0265342_10198302 3300031712 Bacteria 1092
903 Ga0265342_10210266 3300031712 Bacteria 1052
904 Ga0265342_10315431 3300031712 Unclassified 820
905 Ga0307416_100854016 3300032002 Bacteria 1008
906 Ga0373926_0162658 3300035083 Unclassified 852
907 Ga0373934_0240717 3300035086 Bacteria 747
908 Ga0373923_0143464 3300035111 Bacteria 1080
909 Ga0373936_0000533 3300035113 Bacteria 13047
910 Ga0373936_0122954 3300035113 Bacteria 1110
911 Ga0373945_0003319 3300035116 Bacteria 5050
912 Ga0373953_0395864 3300035117 Bacteria 608
913 Ga0373954_0038348 3300035118 Bacteria 2228
914 Ga0373954_0061913 3300035118 Bacteria 1767
915 Ga0373954_0244409 3300035118 Bacteria 883
916 Ga0373956_0028844 3300035119 Bacteria 2416
917 Ga0373956_0147722 3300035119 Bacteria 1105
918 Ga0373956_0284857 3300035119 Bacteria 787
919 Ga0373957_0033697 3300035120 Bacteria 1892
920 Ga0373943_0009149 3300035170 Bacteria 4439
921 Ga0373943_0088580 3300035170 Bacteria 1599
922 Ga0373946_0023484 3300035171 Bacteria 2409
923 Ga0373946_0241068 3300035171 Unclassified 879
924 Ga0373955_0011959 3300035172 Bacteria 4158
925 Ga0373955_0073014 3300035172 Bacteria 1923
926 Ga0373924_0013341 3300035410 Bacteria 3086
927 Ga0373924_0052741 3300035410 Bacteria 1688
928 Ga0373924_0396683 3300035410 Bacteria 616
929 Ga0373931_0253271 3300035691 Bacteria 1071
930 Ga0373931_0363943 3300035691 Unclassified 908
931 Ga0373935_0001852 3300035692 Bacteria 11864
932 Ga0373935_0004543 3300035692 Bacteria 8161
933 Ga0373935_0226224 3300035692 Bacteria 1301
934 Ga0373935_0226735 3300035692 Bacteria 1300
935 Ga0373935_0475808 3300035692 Bacteria 905
936 Ga0373935_0572185 3300035692 Bacteria 825
937 Ga0373935_1066678 3300035692 Bacteria 601
938 Ga0373927_0003241 3300035695 Bacteria 11709
939 Ga0373927_0106783 3300035695 Bacteria 1823
940 Ga0373927_0674731 3300035695 Bacteria 683
941 Ga0373927_0697103 3300035695 Bacteria 671
942 Ga0373927_1177502 3300035695 Bacteria 505
943 Ga0373933_0032235 3300035724 Bacteria 3044
944 Ga0373933_0168056 3300035724 Bacteria 1395
945 Ga0373933_0180598 3300035724 Bacteria 1346
946 Ga0373933_0788982 3300035724 Bacteria 625
947 Ga0373947_0000052 3300035725 Bacteria 59070
948 Ga0373947_0073444 3300035725 Bacteria 2102
949 Ga0373947_0155592 3300035725 Unclassified 1475
950 Ga0373947_0417524 3300035725 Bacteria 906
951 Ga0373937_0009850 3300036401 Bacteria 8331
952 Ga0373937_0026166 3300036401 Bacteria 5272
953 Ga0373937_0033230 3300036401 Bacteria 4684
954 Ga0373937_0096889 3300036401 Bacteria 2736
955 Ga0373937_0183688 3300036401 Bacteria 1964
956 Ga0373937_0217625 3300036401 Bacteria 1797
957 Ga0373937_0332171 3300036401 Bacteria 1439
958 Ga0373937_0387476 3300036401 Bacteria 1326
959 Ga0373937_0588223 3300036401 Bacteria 1057
960 Ga0373937_0813997 3300036401 Bacteria 882
961 Ga0373937_0871953 3300036401 Bacteria 849
962 Ga0373937_1600305 3300036401 Bacteria 599
963 Ga0373925_0010808 3300037068 Bacteria 6619
964 Ga0373925_0015262 3300037068 Bacteria 5553
965 Ga0373925_0072626 3300037068 Bacteria 2603
966 Ga0373925_0201268 3300037068 Bacteria 1584
967 Ga0373925_0467119 3300037068 Unclassified 1034
968 Ga0373925_0642626 3300037068 Bacteria 874
969 Ga0373925_1132268 3300037068 Bacteria 644
970 Ga0395900_0112474 3300037418 Unclassified 2796
971 Ga0395898_0043466 3300037466 Unclassified 4427
972 Ga0395898_0414804 3300037466 Bacteria 1283
973 Ga0395898_1365404 3300037466 Bacteria 637
974 Ga0395901_0178836 3300038443 Unclassified 2225
975 Ga0395901_0373666 3300038443 Bacteria 1468
976 Ga0395901_0576011 3300038443 Bacteria 1138
977 Ga0436360_0199375 3300039438 Bacteria 5151
978 Ga0436361_0274684 3300039447 Bacteria 26616
979 Ga0436361_0396041 3300039447 Bacteria 3434
980 Ga0436361_0430533 3300039447 Bacteria 1517
981 Ga0436361_0464047 3300039447 Bacteria 78853
982 Ga0436361_1050554 3300039447 Bacteria 1694
983 Ga0436363_0137489 3300039450 Bacteria 1314
984 Ga0436363_0160947 3300039450 Bacteria 546
985 Ga0436363_0353117 3300039450 Bacteria 597
986 Ga0436362_1012151 3300039453 Bacteria 3184
987 Ga0451577_0000157 3300042876 Bacteria 151953
988 Ga0451577_0140764 3300042876 Bacteria 2168
989 Ga0451577_0213873 3300042876 Bacteria 1742
990 Ga0451577_1237573 3300042876 Bacteria 665
991 Ga0453683_0034110 3300044673 Bacteria 3209
992 Ga0466966_0042838 3300044684 Bacteria 2904
993 Ga0466966_0751555 3300044684 Unclassified 588
994 Ga0466963_0003309 3300044694 Bacteria 9192
995 Ga0466963_0230481 3300044694 Bacteria 1298
996 Ga0466963_0464938 3300044694 Bacteria 893
997 Ga0453684_0001152 3300044712 Bacteria 82543
998 Ga0466957_0117077 3300044842 Unclassified 1696
999 Ga0466957_0192132 3300044842 Bacteria 1338
1000 Ga0466959_0119174 3300045049 Bacteria 1878
1001 Ga0451576_0013453 3300045051 Bacteria 9154
1002 Ga0451576_0027054 3300045051 Bacteria 6164
1003 Ga0451576_0118137 3300045051 Bacteria 2761
1004 Ga0451576_0246022 3300045051 Bacteria 1869
1005 Ga0451576_2051296 3300045051 Bacteria 589
1006 Ga0466958_0698682 3300045836 Bacteria 661
1007 Ga0466967_0003997 3300045976 Bacteria 9825
1008 Ga0466967_0024446 3300045976 Unclassified 4967
1009 Ga0466967_0071278 3300045976 Bacteria 3111
1010 Ga0466967_0133478 3300045976 Bacteria 2307
1011 Ga0466967_0271155 3300045976 Bacteria 1626
1012 Ga0466967_1798381 3300045976 Bacteria 610
1013 Ga0495592_0737946 3300046454 Bacteria 590
1014 Ga0495603_0628094 3300046455 Unclassified 615
1015 Ga0495590_0169828 3300046457 Unclassified 795
1016 Ga0495629_0039205 3300046459 Bacteria 3334
1017 Ga0495629_0071067 3300046459 Bacteria 2429
1018 Ga0495629_0403671 3300046459 Bacteria 929
1019 Ga0495651_0000035 3300046462 Bacteria 98834
1020 Ga0495651_0263820 3300046462 Bacteria 1171
1021 Ga0495653_0359635 3300046463 Bacteria 934
1022 Ga0495653_0459359 3300046463 Bacteria 800
1023 Ga0495580_0000055 3300046472 Bacteria 65061
1024 Ga0495580_0001081 3300046472 Bacteria 23915
1025 Ga0495580_0003815 3300046472 Bacteria 12761
1026 Ga0495580_0067263 3300046472 Bacteria 2507
1027 Ga0495580_0107798 3300046472 Bacteria 1934
1028 Ga0495580_0750430 3300046472 Bacteria 636
1029 Ga0495582_0006528 3300046473 Bacteria 6473
1030 Ga0495664_0102600 3300046477 Bacteria 1724
1031 Ga0495664_0689180 3300046477 Bacteria 604
1032 Ga0495608_0073411 3300046511 Bacteria 2231
1033 Ga0495608_0224796 3300046511 Bacteria 1177
1034 Ga0495628_0270629 3300046516 Bacteria 1264
1035 Ga0495630_0127681 3300046517 Bacteria 1930
1036 Ga0495630_0377752 3300046517 Bacteria 1085
1037 Ga0495630_0936963 3300046517 Bacteria 659
1038 Ga0495666_0124177 3300046526 Bacteria 1208
1039 Ga0495652_0276359 3300046529 Bacteria 1232
1040 Ga0495665_0053201 3300046531 Bacteria 2142
1041 Ga0495665_0054442 3300046531 Bacteria 2114
1042 Ga0495665_0340174 3300046531 Bacteria 765
1043 Ga0495665_0454230 3300046531 Bacteria 647
1044 Ga0495640_0339916 3300046533 Bacteria 928
1045 Ga0495586_0043304 3300046535 Bacteria 2425
1046 Ga0495645_0153618 3300046543 Bacteria 1597
1047 Ga0495622_0140958 3300046557 Bacteria 1095
1048 Ga0495667_0674849 3300046559 Bacteria 641
1049 Ga0495634_0016760 3300046642 Bacteria 5235
1050 Ga0495635_0139894 3300046663 Bacteria 1649
1051 Ga0495588_0770309 3300046674 Bacteria 503
1052 Ga0495657_0786777 3300046675 Bacteria 544
1053 Ga0495599_0191185 3300046678 Bacteria 1259
1054 Ga0495623_0135832 3300046679 Bacteria 1468
1055 Ga0495647_0037481 3300046681 Bacteria 1830
1056 Ga0495658_0034973 3300046683 Bacteria 2760
1057 Ga0495613_0029936 3300046689 Bacteria 4045
1058 Ga0495613_0108597 3300046689 Bacteria 2001
1059 Ga0495613_0497149 3300046689 Bacteria 821
1060 Ga0495600_0611916 3300046809 Bacteria 661
1061 Ga0495604_0595008 3300047317 Bacteria 710
1062 Ga0495674_0030511 3300047319 Bacteria 4901
1063 Ga0495674_0037940 3300047319 Bacteria 4329
1064 Ga0495674_0079862 3300047319 Bacteria 2808
1065 Ga0495674_0250616 3300047319 Unclassified 1457
1066 Ga0495674_0384055 3300047319 Bacteria 1136
1067 Ga0495680_0003341 3300047322 Bacteria 15863
1068 Ga0495680_0202856 3300047322 Bacteria 1422
1069 Ga0495675_0126456 3300047444 Unclassified 1590
1070 Ga0495684_0220202 3300047471 Bacteria 1392
1071 Ga0495684_0245912 3300047471 Bacteria 1303
1072 Ga0495684_0693283 3300047471 Bacteria 676
1073 Ga0495684_0814588 3300047471 Bacteria 609
1074 Ga0495593_0219083 3300047673 Unclassified 955
1075 Ga0495593_0375772 3300047673 Bacteria 710
1076 Ga0495602_0177900 3300048088 Bacteria 1644
1077 Ga0495602_0198642 3300048088 Bacteria 1532
1078 Ga0495602_0303439 3300048088 Bacteria 1168
1079 Ga0495602_0381002 3300048088 Bacteria 1010
1080 Ga0495602_0524835 3300048088 Bacteria 824
1081 Ga0495602_0541428 3300048088 Bacteria 808
1082 Ga0496100_0003993 3300048903 Bacteria 7756
1083 Ga0496100_0094577 3300048903 Bacteria 2047
1084 Ga0496100_0177546 3300048903 Bacteria 1538
1085 Ga0496100_0605589 3300048903 Bacteria 851
1086 Ga0496101_0029509 3300048904 Bacteria 3836
1087 Ga0496101_0153595 3300048904 Unclassified 1762
1088 Ga0496101_0277963 3300048904 Bacteria 1308
1089 Ga0496102_0026165 3300048905 Bacteria 5201
1090 Ga0496102_0028121 3300048905 Bacteria 5024
1091 Ga0496102_0048015 3300048905 Bacteria 3881
1092 Ga0496103_0085280 3300048906 Bacteria 1990
1093 Ga0496104_0043090 3300048907 Bacteria 4238
1094 Ga0496104_0063488 3300048907 Bacteria 3503
1095 Ga0496104_0113152 3300048907 Bacteria 2603
1096 Ga0496104_0115870 3300048907 Bacteria 2571
1097 Ga0496104_0420567 3300048907 Bacteria 1248
1098 Ga0496104_0773624 3300048907 Bacteria 866
1099 Ga0496104_1403989 3300048907 Bacteria 601
1100 Ga0496105_0103952 3300048908 Bacteria 2346
1101 Ga0496105_0105691 3300048908 Bacteria 2324
1102 Ga0496105_0113235 3300048908 Bacteria 2239
1103 Ga0496105_0133416 3300048908 Bacteria 2046
1104 Ga0496105_0977694 3300048908 Bacteria 634
1105 Ga0496106_0119205 3300048909 Unclassified 2061
1106 Ga0496107_0322343 3300048910 Unclassified 1150
1107 Ga0496107_0381638 3300048910 Bacteria 1048
1108 Ga0496108_0088137 3300048911 Bacteria 2636
1109 Ga0496108_0335517 3300048911 Bacteria 1319
1110 Ga0496109_0021961 3300048912 Bacteria 5650
1111 Ga0496109_0500239 3300048912 Bacteria 1147
1112 Ga0496110_0011347 3300048913 Bacteria 7289
1113 Ga0496110_0080440 3300048913 Bacteria 2904
1114 Ga0496110_0520200 3300048913 Bacteria 1082
1115 Ga0496110_1304265 3300048913 Bacteria 635
1116 Ga0496111_0056434 3300048914 Bacteria 2841
1117 Ga0496112_0018802 3300048915 Bacteria 6512
1118 Ga0496112_0027057 3300048915 Bacteria 5529
1119 Ga0496112_0037860 3300048915 Bacteria 4710
1120 Ga0496112_0065583 3300048915 Bacteria 3583
1121 Ga0496112_0338993 3300048915 Bacteria 1447
1122 Ga0496112_0817967 3300048915 Bacteria 856
1123 Ga0496112_1352692 3300048915 Unclassified 627
1124 Ga0496113_0014960 3300048916 Bacteria 5312
1125 Ga0496114_0004511 3300048917 Bacteria 10807
1126 Ga0496114_0178138 3300048917 Bacteria 1855
1127 Ga0496114_0345027 3300048917 Bacteria 1317
1128 Ga0496115_0001265 3300048918 Bacteria 18112
1129 Ga0496115_0004512 3300048918 Bacteria 10070
1130 Ga0496115_0035376 3300048918 Bacteria 3950
1131 Ga0496115_0037201 3300048918 Bacteria 3857
1132 Ga0496115_0088211 3300048918 Bacteria 2532
1133 Ga0496118_0250036 3300048921 Bacteria 1008
1134 Ga0496126_0001061 3300048929 Bacteria 46386
1135 Ga0501295_130937 3300049518 Bacteria 609
1136 Ga0501259_160682 3300049688 Unclassified 561
1137 Ga0501283_024569 3300049779 Bacteria 982
1138 nmdc:mga05p37_1235354_c1 3300050507 Unclassified 768
1139 nmdc:mga05p37_19207_c1 3300050507 Bacteria 8267
1140 nmdc:mga09592_71144_c1 3300050508 Bacteria 2952
1141 nmdc:mga08y16_84944_c1 3300050511 Bacteria 3299
1142 nmdc:mga0n895_13968_c1 3300050512 Bacteria 7273
1143 nmdc:mga0n895_1440242_c1 3300050512 Unclassified 656
1144 nmdc:mga0n895_1826_c1 3300050512 Bacteria 13550
1145 nmdc:mga0n895_208203_c1 3300050512 Bacteria 1986
1146 nmdc:mga0rr50_125979_c1 3300050513 Bacteria 2045
1147 nmdc:mga0rr50_2275_c1 3300050513 Bacteria 10770
1148 nmdc:mga0rr50_25863_c1 3300050513 Bacteria 4087
1149 nmdc:mga08x19_41460_c1 3300050514 Bacteria 2932
1150 nmdc:mga08x19_543525_c1 3300050514 Unclassified 822
1151 nmdc:mga08x19_878219_c1 3300050514 Bacteria 637
1152 nmdc:mga08x19_97756_c1 3300050514 Bacteria 1944
1153 nmdc:mga0a205_14096_c1 3300050515 Bacteria 7459
1154 nmdc:mga0a205_219721_c1 3300050515 Bacteria 1786
1155 Ga0495601_0023552 3300053077 Bacteria 3784
1156 Ga0495595_0307258 3300053084 Bacteria 798
1157 Ga0495619_0036897 3300053085 Bacteria 3184
1158 Ga0495619_0433415 3300053085 Bacteria 907
1159 Ga0587066_013801 3300059490 Unclassified 1230
1160 Ga0587066_053853 3300059490 Bacteria 801
1161 Ga0587070_041643 3300059491 Bacteria 881
1162 Ga0587073_0047469 3300059492 Bacteria 961
1163 Ga0587073_0071726 3300059492 Bacteria 838
1164 Ga0587073_0255653 3300059492 Bacteria 551
1165 Ga0587077_025197 3300059493 Bacteria 1089
1166 Ga0587077_025511 3300059493 Bacteria 1085
1167 Ga0587082_036179 3300059504 Bacteria 884
1168 Ga0587083_0197556 3300059505 Bacteria 573
1169 Ga0587088_034982 3300059508 Bacteria 919
1170 Ga0587089_046486 3300059509 Bacteria 686
1171 Ga0587092_066326 3300059512 Bacteria 686
1172 Ga0587092_073852 3300059512 Bacteria 661
1173 Ga0587067_027596 3300059640 Bacteria 1025
1174 Ga0587067_234555 3300059640 Bacteria 503
1175 Ga0587069_072903 3300059642 Bacteria 656
1176 Ga0587076_037858 3300059645 Bacteria 888
1177 Ga0587079_026803 3300059647 Bacteria 1080
1178 Ga0587079_044062 3300059647 Bacteria 913
1179 Ga0587100_010620 3300059648 Bacteria 779
1180 Ga0587060_024539 3300060243 Unclassified 590
1181 Ga0587071_046155 3300060344 Bacteria 888
1182 Ga0587071_048794 3300060344 Unclassified 870
1183 Ga0587111_0222759 3300060346 Unclassified 545
1184 Ga0466962_0541354 3300061719 Bacteria 591

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10049064 Ga0105245_100490643 136
2 3300013296 Ga0157374_10010685 Ga0157374_100106852 136
3 3300013297 Ga0157378_10004033 Ga0157378_100040339 136
4 3300025927 Ga0207687_10463983 Ga0207687_104639832 136
5 3300031241 Ga0265325_10163211 Ga0265325_101632112 136
6 3300031249 Ga0265339_10172218 Ga0265339_101722182 136
7 3300031250 Ga0265331_10010830 Ga0265331_100108305 136
8 3300031344 Ga0265316_10039972 Ga0265316_100399722 136
9 3300031595 Ga0265313_10237341 Ga0265313_102373411 136
10 3300037068 Ga0373925_1132268 Ga0373925_1132268_34_492 136
11 3300046462 Ga0495651_0000035 Ga0495651_0000035_97512_97928 136
12 3300046511 Ga0495608_0224796 Ga0495608_0224796_712_1128 136
13 3300046531 Ga0495665_0053201 Ga0495665_0053201_1196_1654 136
14 3300046535 Ga0495586_0043304 Ga0495586_0043304_1264_1680 136
15 3300046557 Ga0495622_0140958 Ga0495622_0140958_363_779 136
16 3300046642 Ga0495634_0016760 Ga0495634_0016760_4768_5184 136
17 3300046675 Ga0495657_0786777 Ga0495657_0786777_73_489 136
18 3300046689 Ga0495613_0029936 Ga0495613_0029936_165_581 136
19 3300047319 Ga0495674_0384055 Ga0495674_0384055_350_766 136
20 3300047322 Ga0495680_0003341 Ga0495680_0003341_11481_11897 136
21 3300047444 Ga0495675_0126456 Ga0495675_0126456_401_817 136
22 3300048907 Ga0496104_1403989 Ga0496104_1403989_149_565 136
23 3300049518 Ga0501295_130937 Ga0501295_130937_18_440 136
24 3300009093 Ga0105240_10000060 Ga0105240_10000060105 137
25 3300013104 Ga0157370_10200487 Ga0157370_102004871 137
26 3300013105 Ga0157369_10022158 Ga0157369_100221583 137
27 3300013296 Ga0157374_10689386 Ga0157374_106893862 137
28 3300013307 Ga0157372_10143937 Ga0157372_101439372 137
29 3300005468 Ga0070707_100000016 Ga0070707_10000001647 138
30 3300005530 Ga0070679_100001090 Ga0070679_1000010909 138
31 3300024227 Ga0228598_1000453 Ga0228598_10004539 138
32 3300024227 Ga0228598_1020588 Ga0228598_10205882 138
33 3300025921 Ga0207652_10001154 Ga0207652_100011548 138
34 3300025922 Ga0207646_10000057 Ga0207646_10000057116 138
35 3300031090 Ga0265760_10099672 Ga0265760_100996722 138
36 3300031090 Ga0265760_10144149 Ga0265760_101441492 138
37 3300042876 Ga0451577_0000157 Ga0451577_0000157_87578_87994 138
38 3300042876 Ga0451577_0140764 Ga0451577_0140764_726_1142 138
39 3300044673 Ga0453683_0034110 Ga0453683_0034110_2333_2749 138
40 3300044712 Ga0453684_0001152 Ga0453684_0001152_17574_17990 138
41 3300044842 Ga0466957_0117077 Ga0466957_0117077_793_1221 138
42 3300045051 Ga0451576_0013453 Ga0451576_0013453_5093_5509 138
43 3300004800 Ga0058861_10190843 Ga0058861_101908432 139
44 3300004800 Ga0058861_11938866 Ga0058861_119388663 139
45 3300004803 Ga0058862_12837641 Ga0058862_128376413 139
46 3300005336 Ga0070680_100182554 Ga0070680_1001825542 139
47 3300005336 Ga0070680_100973201 Ga0070680_1009732011 139
48 3300005337 Ga0070682_100017177 Ga0070682_1000171772 139
49 3300005337 Ga0070682_100247376 Ga0070682_1002473762 139
50 3300005341 Ga0070691_10267994 Ga0070691_102679941 139
51 3300005458 Ga0070681_10003422 Ga0070681_1000342217 139
52 3300005458 Ga0070681_10954820 Ga0070681_109548202 139
53 3300005530 Ga0070679_100005449 Ga0070679_10000544911 139
54 3300005530 Ga0070679_100571212 Ga0070679_1005712122 139
55 3300005535 Ga0070684_100302902 Ga0070684_1003029023 139
56 3300005539 Ga0068853_100406710 Ga0068853_1004067102 139
57 3300005563 Ga0068855_100611337 Ga0068855_1006113372 139
58 3300005578 Ga0068854_100139004 Ga0068854_1001390042 139
59 3300005616 Ga0068852_100151271 Ga0068852_1001512712 139
60 3300005842 Ga0068858_100110119 Ga0068858_1001101192 139
61 3300005843 Ga0068860_100997561 Ga0068860_1009975612 139
62 3300006844 Ga0075428_100262328 Ga0075428_1002623282 139
63 3300006847 Ga0075431_100034985 Ga0075431_1000349852 139
64 3300009093 Ga0105240_10081263 Ga0105240_100812634 139
65 3300009093 Ga0105240_10542342 Ga0105240_105423422 139
66 3300009177 Ga0105248_10159546 Ga0105248_101595463 139
67 3300009177 Ga0105248_10395243 Ga0105248_103952432 139
68 3300009545 Ga0105237_10384657 Ga0105237_103846572 139
69 3300009545 Ga0105237_10719320 Ga0105237_107193202 139
70 3300009551 Ga0105238_11214486 Ga0105238_112144862 139
71 3300009828 Ga0130087_1098374 Ga0130087_10983741 139
72 3300009829 Ga0130086_1025278 Ga0130086_10252781 139
73 3300013100 Ga0157373_10089065 Ga0157373_100890652 139
74 3300013100 Ga0157373_10831837 Ga0157373_108318372 139
75 3300013104 Ga0157370_10262579 Ga0157370_102625792 139
76 3300013105 Ga0157369_10040273 Ga0157369_100402734 139
77 3300013307 Ga0157372_11266817 Ga0157372_112668172 139
78 3300014968 Ga0157379_10245060 Ga0157379_102450601 139
79 3300020070 Ga0206356_10466912 Ga0206356_104669122 139
80 3300020081 Ga0206354_11514623 Ga0206354_115146232 139
81 3300020082 Ga0206353_10611514 Ga0206353_106115142 139
82 3300020082 Ga0206353_11871440 Ga0206353_118714402 139
83 3300022467 Ga0224712_10001945 Ga0224712_100019454 139
84 3300025912 Ga0207707_10008260 Ga0207707_100082603 139
85 3300025912 Ga0207707_10291955 Ga0207707_102919552 139
86 3300025913 Ga0207695_10345697 Ga0207695_103456972 139
87 3300025914 Ga0207671_10549358 Ga0207671_105493582 139
88 3300025917 Ga0207660_10002880 Ga0207660_100028808 139
89 3300025921 Ga0207652_10000885 Ga0207652_1000088517 139
90 3300025921 Ga0207652_10577441 Ga0207652_105774412 139
91 3300025924 Ga0207694_11192573 Ga0207694_111925731 139
92 3300025941 Ga0207711_10194575 Ga0207711_101945753 139
93 3300026035 Ga0207703_10968599 Ga0207703_109685992 139
94 3300026041 Ga0207639_10777087 Ga0207639_107770872 139
95 3300026078 Ga0207702_10314391 Ga0207702_103143912 139
96 3300026142 Ga0207698_10611863 Ga0207698_106118632 139
97 3300026142 Ga0207698_12311462 Ga0207698_123114622 139
98 3300028381 Ga0268264_10924880 Ga0268264_109248801 139
99 3300035119 Ga0373956_0284857 Ga0373956_0284857_244_663 139
100 3300037466 Ga0395898_0414804 Ga0395898_0414804_177_596 139
101 3300038443 Ga0395901_0178836 Ga0395901_0178836_754_1173 139
102 3300038443 Ga0395901_0373666 Ga0395901_0373666_652_1071 139
103 3300044694 Ga0466963_0003309 Ga0466963_0003309_6403_6822 139
104 3300044694 Ga0466963_0464938 Ga0466963_0464938_187_606 139
105 3300045976 Ga0466967_0003997 Ga0466967_0003997_5898_6317 139
106 3300045976 Ga0466967_0133478 Ga0466967_0133478_646_1065 139
107 3300046472 Ga0495580_0067263 Ga0495580_0067263_852_1277 139
108 3300046472 Ga0495580_0750430 Ga0495580_0750430_138_557 139
109 3300048903 Ga0496100_0605589 Ga0496100_0605589_316_735 139
110 3300048907 Ga0496104_0113152 Ga0496104_0113152_785_1210 139
111 3300048913 Ga0496110_1304265 Ga0496110_1304265_12_431 139
112 3300048915 Ga0496112_0037860 Ga0496112_0037860_1834_2259 139
113 3300048918 Ga0496115_0037201 Ga0496115_0037201_3182_3601 139
114 3300048929 Ga0496126_0001061 Ga0496126_0001061_18681_19100 139
115 3300049688 Ga0501259_160682 Ga0501259_160682_107_526 139
116 3300059490 Ga0587066_013801 Ga0587066_013801_471_890 139
117 3300059491 Ga0587070_041643 Ga0587070_041643_183_602 139
118 3300059492 Ga0587073_0047469 Ga0587073_0047469_150_569 139
119 3300059492 Ga0587073_0071726 Ga0587073_0071726_281_700 139
120 3300059493 Ga0587077_025197 Ga0587077_025197_85_504 139
121 3300059493 Ga0587077_025511 Ga0587077_025511_366_785 139
122 3300059504 Ga0587082_036179 Ga0587082_036179_106_525 139
123 3300059505 Ga0587083_0197556 Ga0587083_0197556_88_507 139
124 3300059508 Ga0587088_034982 Ga0587088_034982_324_743 139
125 3300059509 Ga0587089_046486 Ga0587089_046486_113_532 139
126 3300059512 Ga0587092_066326 Ga0587092_066326_192_611 139
127 3300059512 Ga0587092_073852 Ga0587092_073852_27_446 139
128 3300059640 Ga0587067_027596 Ga0587067_027596_220_639 139
129 3300059640 Ga0587067_234555 Ga0587067_234555_70_489 139
130 3300059642 Ga0587069_072903 Ga0587069_072903_170_589 139
131 3300059645 Ga0587076_037858 Ga0587076_037858_218_637 139
132 3300059647 Ga0587079_026803 Ga0587079_026803_139_558 139
133 3300059647 Ga0587079_044062 Ga0587079_044062_150_569 139
134 3300060243 Ga0587060_024539 Ga0587060_024539_136_555 139
135 3300060344 Ga0587071_046155 Ga0587071_046155_323_742 139
136 3300060344 Ga0587071_048794 Ga0587071_048794_84_503 139
137 3300060346 Ga0587111_0222759 Ga0587111_0222759_27_446 139
138 3300061719 Ga0466962_0541354 Ga0466962_0541354_88_507 139
139 3300005327 Ga0070658_10411978 Ga0070658_104119781 140
140 3300005327 Ga0070658_11053063 Ga0070658_110530631 140
141 3300005329 Ga0070683_100084489 Ga0070683_1000844893 140
142 3300005329 Ga0070683_100089019 Ga0070683_1000890193 140
143 3300005329 Ga0070683_100133954 Ga0070683_1001339543 140
144 3300005329 Ga0070683_100650618 Ga0070683_1006506181 140
145 3300005329 Ga0070683_100765340 Ga0070683_1007653402 140
146 3300005331 Ga0070670_100056892 Ga0070670_1000568923 140
147 3300005334 Ga0068869_100010983 Ga0068869_1000109834 140
148 3300005337 Ga0070682_101471696 Ga0070682_1014716962 140
149 3300005338 Ga0068868_100008407 Ga0068868_1000084076 140
150 3300005338 Ga0068868_100036900 Ga0068868_1000369002 140
151 3300005344 Ga0070661_100294897 Ga0070661_1002948972 140
152 3300005344 Ga0070661_100615297 Ga0070661_1006152972 140
153 3300005355 Ga0070671_100028795 Ga0070671_1000287953 140
154 3300005355 Ga0070671_100059908 Ga0070671_1000599083 140
155 3300005367 Ga0070667_100136947 Ga0070667_1001369472 140
156 3300005406 Ga0070703_10078451 Ga0070703_100784512 140
157 3300005436 Ga0070713_100051036 Ga0070713_1000510363 140
158 3300005436 Ga0070713_100066658 Ga0070713_1000666582 140
159 3300005436 Ga0070713_100436423 Ga0070713_1004364232 140
160 3300005436 Ga0070713_101918693 Ga0070713_1019186931 140
161 3300005437 Ga0070710_10239736 Ga0070710_102397362 140
162 3300005441 Ga0070700_100050694 Ga0070700_1000506943 140
163 3300005455 Ga0070663_100023403 Ga0070663_1000234032 140
164 3300005458 Ga0070681_10285436 Ga0070681_102854362 140
165 3300005535 Ga0070684_100105716 Ga0070684_1001057163 140
166 3300005535 Ga0070684_100111171 Ga0070684_1001111713 140
167 3300005535 Ga0070684_100306853 Ga0070684_1003068532 140
168 3300005539 Ga0068853_100001553 Ga0068853_10000155315 140
169 3300005539 Ga0068853_100027048 Ga0068853_1000270483 140
170 3300005539 Ga0068853_100103927 Ga0068853_1001039272 140
171 3300005548 Ga0070665_100112272 Ga0070665_1001122723 140
172 3300005549 Ga0070704_101158574 Ga0070704_1011585741 140
173 3300005563 Ga0068855_100004015 Ga0068855_1000040153 140
174 3300005563 Ga0068855_100016465 Ga0068855_1000164654 140
175 3300005563 Ga0068855_100067912 Ga0068855_1000679124 140
176 3300005563 Ga0068855_100154219 Ga0068855_1001542193 140
177 3300005564 Ga0070664_100132986 Ga0070664_1001329862 140
178 3300005577 Ga0068857_100002569 Ga0068857_10000256914 140
179 3300005577 Ga0068857_100931717 Ga0068857_1009317171 140
180 3300005578 Ga0068854_100019800 Ga0068854_1000198004 140
181 3300005578 Ga0068854_100141279 Ga0068854_1001412792 140
182 3300005578 Ga0068854_100700606 Ga0068854_1007006062 140
183 3300005614 Ga0068856_100030129 Ga0068856_1000301293 140
184 3300005614 Ga0068856_100055262 Ga0068856_1000552625 140
185 3300005614 Ga0068856_100064707 Ga0068856_1000647071 140
186 3300005614 Ga0068856_100572190 Ga0068856_1005721902 140
187 3300005616 Ga0068852_100000034 Ga0068852_10000003414 140
188 3300005616 Ga0068852_100000210 Ga0068852_1000002107 140
189 3300005616 Ga0068852_100023711 Ga0068852_1000237113 140
190 3300005616 Ga0068852_100164032 Ga0068852_1001640323 140
191 3300005616 Ga0068852_100341090 Ga0068852_1003410901 140
192 3300005616 Ga0068852_100546729 Ga0068852_1005467292 140
193 3300005617 Ga0068859_100063383 Ga0068859_1000633833 140
194 3300005618 Ga0068864_100007241 Ga0068864_1000072416 140
195 3300005834 Ga0068851_10006214 Ga0068851_100062143 140
196 3300005834 Ga0068851_10024116 Ga0068851_100241162 140
197 3300005834 Ga0068851_10097923 Ga0068851_100979232 140
198 3300005841 Ga0068863_100041585 Ga0068863_1000415853 140
199 3300005842 Ga0068858_100014663 Ga0068858_1000146633 140
200 3300005843 Ga0068860_100002858 Ga0068860_10000285815 140
201 3300005844 Ga0068862_100078136 Ga0068862_1000781363 140
202 3300005844 Ga0068862_100130615 Ga0068862_1001306152 140
203 3300006028 Ga0070717_10092511 Ga0070717_100925112 140
204 3300006028 Ga0070717_10395263 Ga0070717_103952632 140
205 3300006237 Ga0097621_100025548 Ga0097621_1000255482 140
206 3300006358 Ga0068871_100014144 Ga0068871_1000141442 140
207 3300006358 Ga0068871_100016777 Ga0068871_1000167774 140
208 3300006358 Ga0068871_100259331 Ga0068871_1002593311 140
209 3300006844 Ga0075428_100340525 Ga0075428_1003405252 140
210 3300006852 Ga0075433_10088550 Ga0075433_100885502 140
211 3300006852 Ga0075433_10150687 Ga0075433_101506872 140
212 3300006871 Ga0075434_100001985 Ga0075434_1000019859 140
213 3300006871 Ga0075434_100436848 Ga0075434_1004368482 140
214 3300006880 Ga0075429_100206588 Ga0075429_1002065882 140
215 3300006931 Ga0097620_100063382 Ga0097620_1000633823 140
216 3300007076 Ga0075435_100312949 Ga0075435_1003129493 140
217 3300007076 Ga0075435_100423967 Ga0075435_1004239671 140
218 3300009011 Ga0105251_10381597 Ga0105251_103815972 140
219 3300009093 Ga0105240_10000612 Ga0105240_1000061212 140
220 3300009093 Ga0105240_10002617 Ga0105240_100026172 140
221 3300009093 Ga0105240_10026848 Ga0105240_100268483 140
222 3300009093 Ga0105240_10026860 Ga0105240_100268602 140
223 3300009093 Ga0105240_10032717 Ga0105240_100327172 140
224 3300009093 Ga0105240_10098003 Ga0105240_100980033 140
225 3300009093 Ga0105240_10258022 Ga0105240_102580223 140
226 3300009093 Ga0105240_10260847 Ga0105240_102608472 140
227 3300009098 Ga0105245_10009603 Ga0105245_100096035 140
228 3300009098 Ga0105245_10032408 Ga0105245_100324083 140
229 3300009098 Ga0105245_10140224 Ga0105245_101402243 140
230 3300009101 Ga0105247_10030064 Ga0105247_100300643 140
231 3300009101 Ga0105247_11224158 Ga0105247_112241581 140
232 3300009147 Ga0114129_10026137 Ga0114129_100261376 140
233 3300009147 Ga0114129_10113916 Ga0114129_101139163 140
234 3300009148 Ga0105243_10511651 Ga0105243_105116512 140
235 3300009174 Ga0105241_10000034 Ga0105241_1000003434 140
236 3300009174 Ga0105241_10007113 Ga0105241_100071135 140
237 3300009174 Ga0105241_10106883 Ga0105241_101068832 140
238 3300009174 Ga0105241_10411807 Ga0105241_104118072 140
239 3300009174 Ga0105241_10690066 Ga0105241_106900662 140
240 3300009177 Ga0105248_10007097 Ga0105248_100070976 140
241 3300009177 Ga0105248_10178140 Ga0105248_101781402 140
242 3300009545 Ga0105237_10009255 Ga0105237_100092554 140
243 3300009545 Ga0105237_10051387 Ga0105237_100513873 140
244 3300009545 Ga0105237_10110924 Ga0105237_101109242 140
245 3300009545 Ga0105237_10157165 Ga0105237_101571652 140
246 3300009545 Ga0105237_10229279 Ga0105237_102292792 140
247 3300009545 Ga0105237_10666233 Ga0105237_106662332 140
248 3300009545 Ga0105237_10853432 Ga0105237_108534322 140
249 3300009545 Ga0105237_11969385 Ga0105237_119693852 140
250 3300009551 Ga0105238_10000559 Ga0105238_100005593 140
251 3300009551 Ga0105238_10001495 Ga0105238_1000149519 140
252 3300009551 Ga0105238_10014313 Ga0105238_100143135 140
253 3300009551 Ga0105238_10116298 Ga0105238_101162982 140
254 3300009551 Ga0105238_10175168 Ga0105238_101751682 140
255 3300009553 Ga0105249_10158736 Ga0105249_101587362 140
256 3300010375 Ga0105239_10000325 Ga0105239_1000032530 140
257 3300010375 Ga0105239_10019346 Ga0105239_100193468 140
258 3300010375 Ga0105239_10065257 Ga0105239_100652573 140
259 3300010375 Ga0105239_10339952 Ga0105239_103399523 140
260 3300010375 Ga0105239_10465627 Ga0105239_104656272 140
261 3300011119 Ga0105246_10023366 Ga0105246_100233662 140
262 3300013100 Ga0157373_10175255 Ga0157373_101752552 140
263 3300013100 Ga0157373_10475374 Ga0157373_104753741 140
264 3300013104 Ga0157370_10000094 Ga0157370_1000009412 140
265 3300013105 Ga0157369_10000144 Ga0157369_1000014412 140
266 3300013105 Ga0157369_10027478 Ga0157369_100274785 140
267 3300013105 Ga0157369_10064108 Ga0157369_100641083 140
268 3300013105 Ga0157369_10068718 Ga0157369_100687184 140
269 3300013105 Ga0157369_10190881 Ga0157369_101908814 140
270 3300013105 Ga0157369_10241773 Ga0157369_102417733 140
271 3300013105 Ga0157369_10575335 Ga0157369_105753352 140
272 3300013105 Ga0157369_11091553 Ga0157369_110915531 140
273 3300013105 Ga0157369_11345998 Ga0157369_113459982 140
274 3300013105 Ga0157369_11857136 Ga0157369_118571361 140
275 3300013296 Ga0157374_10007237 Ga0157374_100072376 140
276 3300013296 Ga0157374_10057003 Ga0157374_100570033 140
277 3300013297 Ga0157378_10010671 Ga0157378_100106714 140
278 3300013297 Ga0157378_10014390 Ga0157378_100143902 140
279 3300013297 Ga0157378_10205685 Ga0157378_102056853 140
280 3300013306 Ga0163162_11156679 Ga0163162_111566792 140
281 3300013307 Ga0157372_10000275 Ga0157372_1000027512 140
282 3300013307 Ga0157372_10014129 Ga0157372_100141296 140
283 3300013307 Ga0157372_10127989 Ga0157372_101279892 140
284 3300013307 Ga0157372_10176843 Ga0157372_101768432 140
285 3300013307 Ga0157372_10201886 Ga0157372_102018863 140
286 3300013307 Ga0157372_10204676 Ga0157372_102046761 140
287 3300013307 Ga0157372_10326009 Ga0157372_103260092 140
288 3300013307 Ga0157372_11133243 Ga0157372_111332432 140
289 3300013307 Ga0157372_12022904 Ga0157372_120229042 140
290 3300013308 Ga0157375_10136060 Ga0157375_101360603 140
291 3300013308 Ga0157375_10300296 Ga0157375_103002962 140
292 3300013308 Ga0157375_10919688 Ga0157375_109196882 140
293 3300014325 Ga0163163_10038347 Ga0163163_100383473 140
294 3300014326 Ga0157380_10317757 Ga0157380_103177572 140
295 3300014968 Ga0157379_10001316 Ga0157379_1000131611 140
296 3300014968 Ga0157379_10360292 Ga0157379_103602922 140
297 3300014969 Ga0157376_10017619 Ga0157376_100176194 140
298 3300024227 Ga0228598_1048423 Ga0228598_10484232 140
299 3300025321 Ga0207656_10295402 Ga0207656_102954022 140
300 3300025321 Ga0207656_10301099 Ga0207656_103010992 140
301 3300025900 Ga0207710_10004110 Ga0207710_100041102 140
302 3300025909 Ga0207705_10150175 Ga0207705_101501752 140
303 3300025909 Ga0207705_10833987 Ga0207705_108339872 140
304 3300025911 Ga0207654_10000029 Ga0207654_1000002952 140
305 3300025911 Ga0207654_10000085 Ga0207654_100000853 140
306 3300025911 Ga0207654_10007149 Ga0207654_100071493 140
307 3300025912 Ga0207707_10598899 Ga0207707_105988992 140
308 3300025913 Ga0207695_10000063 Ga0207695_10000063306 140
309 3300025913 Ga0207695_10000192 Ga0207695_10000192135 140
310 3300025913 Ga0207695_10001427 Ga0207695_1000142733 140
311 3300025913 Ga0207695_10009869 Ga0207695_100098693 140
312 3300025913 Ga0207695_10020786 Ga0207695_100207868 140
313 3300025914 Ga0207671_10000395 Ga0207671_1000039536 140
314 3300025914 Ga0207671_10002488 Ga0207671_1000248815 140
315 3300025914 Ga0207671_10155202 Ga0207671_101552022 140
316 3300025919 Ga0207657_10750781 Ga0207657_107507811 140
317 3300025920 Ga0207649_10021802 Ga0207649_100218023 140
318 3300025920 Ga0207649_10060496 Ga0207649_100604961 140
319 3300025920 Ga0207649_10803792 Ga0207649_108037922 140
320 3300025924 Ga0207694_10000370 Ga0207694_1000037032 140
321 3300025924 Ga0207694_10003761 Ga0207694_100037613 140
322 3300025924 Ga0207694_10178101 Ga0207694_101781012 140
323 3300025925 Ga0207650_10082389 Ga0207650_100823892 140
324 3300025927 Ga0207687_10069322 Ga0207687_100693223 140
325 3300025927 Ga0207687_10428409 Ga0207687_104284092 140
326 3300025928 Ga0207700_10039508 Ga0207700_100395083 140
327 3300025931 Ga0207644_10044962 Ga0207644_100449622 140
328 3300025931 Ga0207644_10075817 Ga0207644_100758172 140
329 3300025941 Ga0207711_10200542 Ga0207711_102005421 140
330 3300025941 Ga0207711_10237154 Ga0207711_102371542 140
331 3300025942 Ga0207689_10006589 Ga0207689_100065895 140
332 3300025944 Ga0207661_10135912 Ga0207661_101359122 140
333 3300025944 Ga0207661_10603878 Ga0207661_106038782 140
334 3300025945 Ga0207679_10703302 Ga0207679_107033022 140
335 3300025949 Ga0207667_10005355 Ga0207667_1000535511 140
336 3300025949 Ga0207667_10014310 Ga0207667_100143104 140
337 3300025949 Ga0207667_10064551 Ga0207667_100645513 140
338 3300025949 Ga0207667_10507078 Ga0207667_105070782 140
339 3300025949 Ga0207667_10648859 Ga0207667_106488591 140
340 3300025986 Ga0207658_10419625 Ga0207658_104196252 140
341 3300026023 Ga0207677_10008122 Ga0207677_100081225 140
342 3300026023 Ga0207677_10828073 Ga0207677_108280732 140
343 3300026035 Ga0207703_10054572 Ga0207703_100545723 140
344 3300026041 Ga0207639_10000119 Ga0207639_1000011938 140
345 3300026041 Ga0207639_10232529 Ga0207639_102325292 140
346 3300026041 Ga0207639_10798603 Ga0207639_107986031 140
347 3300026067 Ga0207678_10040651 Ga0207678_100406513 140
348 3300026075 Ga0207708_10067352 Ga0207708_100673523 140
349 3300026078 Ga0207702_10005686 Ga0207702_100056862 140
350 3300026078 Ga0207702_10062172 Ga0207702_100621723 140
351 3300026078 Ga0207702_10066393 Ga0207702_100663932 140
352 3300026078 Ga0207702_10173272 Ga0207702_101732722 140
353 3300026078 Ga0207702_12310832 Ga0207702_123108321 140
354 3300026088 Ga0207641_10043523 Ga0207641_100435233 140
355 3300026089 Ga0207648_10567290 Ga0207648_105672902 140
356 3300026095 Ga0207676_10031738 Ga0207676_100317383 140
357 3300026116 Ga0207674_10000601 Ga0207674_1000060137 140
358 3300026116 Ga0207674_10633914 Ga0207674_106339142 140
359 3300026142 Ga0207698_10000069 Ga0207698_1000006912 140
360 3300026142 Ga0207698_10000230 Ga0207698_1000023023 140
361 3300026142 Ga0207698_10542880 Ga0207698_105428801 140
362 3300027907 Ga0207428_10168643 Ga0207428_101686432 140
363 3300028379 Ga0268266_10054113 Ga0268266_100541133 140
364 3300028380 Ga0268265_10600952 Ga0268265_106009521 140
365 3300028380 Ga0268265_10898922 Ga0268265_108989222 140
366 3300028381 Ga0268264_10004880 Ga0268264_100048806 140
367 3300028666 Ga0265336_10001878 Ga0265336_100018788 140
368 3300028800 Ga0265338_10077754 Ga0265338_100777543 140
369 3300028800 Ga0265338_10159635 Ga0265338_101596352 140
370 3300029957 Ga0265324_10176510 Ga0265324_101765102 140
371 3300031235 Ga0265330_10172446 Ga0265330_101724462 140
372 3300031344 Ga0265316_10015829 Ga0265316_100158293 140
373 3300031711 Ga0265314_10090780 Ga0265314_100907803 140
374 3300031711 Ga0265314_10108330 Ga0265314_101083302 140
375 3300031711 Ga0265314_10120586 Ga0265314_101205862 140
376 3300031712 Ga0265342_10198302 Ga0265342_101983022 140
377 3300035118 Ga0373954_0244409 Ga0373954_0244409_395_817 140
378 3300035119 Ga0373956_0147722 Ga0373956_0147722_641_1063 140
379 3300035172 Ga0373955_0073014 Ga0373955_0073014_1050_1472 140
380 3300035692 Ga0373935_0572185 Ga0373935_0572185_73_495 140
381 3300035724 Ga0373933_0788982 Ga0373933_0788982_119_541 140
382 3300036401 Ga0373937_0009850 Ga0373937_0009850_148_570 140
383 3300036401 Ga0373937_0387476 Ga0373937_0387476_718_1140 140
384 3300039450 Ga0436363_0353117 Ga0436363_0353117_73_495 140
385 3300042876 Ga0451577_0213873 Ga0451577_0213873_476_901 140
386 3300044694 Ga0466963_0230481 Ga0466963_0230481_840_1262 140
387 3300044842 Ga0466957_0192132 Ga0466957_0192132_516_944 140
388 3300045051 Ga0451576_0027054 Ga0451576_0027054_498_923 140
389 3300045051 Ga0451576_0118137 Ga0451576_0118137_955_1377 140
390 3300045976 Ga0466967_0024446 Ga0466967_0024446_2692_3120 140
391 3300045976 Ga0466967_1798381 Ga0466967_1798381_52_474 140
392 3300046459 Ga0495629_0071067 Ga0495629_0071067_998_1420 140
393 3300046477 Ga0495664_0689180 Ga0495664_0689180_129_551 140
394 3300046529 Ga0495652_0276359 Ga0495652_0276359_625_1047 140
395 3300046531 Ga0495665_0340174 Ga0495665_0340174_150_572 140
396 3300046689 Ga0495613_0497149 Ga0495613_0497149_327_749 140
397 3300047317 Ga0495604_0595008 Ga0495604_0595008_154_576 140
398 3300047471 Ga0495684_0693283 Ga0495684_0693283_77_499 140
399 3300047471 Ga0495684_0814588 Ga0495684_0814588_10_432 140
400 3300048088 Ga0495602_0198642 Ga0495602_0198642_299_721 140
401 3300048088 Ga0495602_0381002 Ga0495602_0381002_479_901 140
402 3300048088 Ga0495602_0524835 Ga0495602_0524835_380_808 140
403 3300048903 Ga0496100_0177546 Ga0496100_0177546_599_1021 140
404 3300048904 Ga0496101_0277963 Ga0496101_0277963_666_1088 140
405 3300048907 Ga0496104_0773624 Ga0496104_0773624_398_820 140
406 3300048908 Ga0496105_0133416 Ga0496105_0133416_177_599 140
407 3300048910 Ga0496107_0381638 Ga0496107_0381638_28_450 140
408 3300048913 Ga0496110_0080440 Ga0496110_0080440_1020_1442 140
409 3300048917 Ga0496114_0178138 Ga0496114_0178138_1368_1790 140
410 3300048918 Ga0496115_0035376 Ga0496115_0035376_1893_2315 140
411 3300050507 nmdc:mga05p37_1235354_c1 nmdc:mga05p37_1235354_c1_82_504 140
412 3300050507 nmdc:mga05p37_19207_c1 nmdc:mga05p37_19207_c1_3316_3738 140
413 3300050508 nmdc:mga09592_71144_c1 nmdc:mga09592_71144_c1_202_624 140
414 3300050511 nmdc:mga08y16_84944_c1 nmdc:mga08y16_84944_c1_1267_1689 140
415 3300050512 nmdc:mga0n895_1826_c1 nmdc:mga0n895_1826_c1_4825_5247 140
416 3300050512 nmdc:mga0n895_208203_c1 nmdc:mga0n895_208203_c1_757_1179 140
417 3300050513 nmdc:mga0rr50_125979_c1 nmdc:mga0rr50_125979_c1_1239_1661 140
418 3300050515 nmdc:mga0a205_14096_c1 nmdc:mga0a205_14096_c1_1300_1722 140
419 3300050515 nmdc:mga0a205_219721_c1 nmdc:mga0a205_219721_c1_971_1393 140
420 3300059648 Ga0587100_010620 Ga0587100_010620_47_469 140
421 3300005329 Ga0070683_100484665 Ga0070683_1004846652 141
422 3300005331 Ga0070670_100006721 Ga0070670_1000067215 141
423 3300005334 Ga0068869_100018873 Ga0068869_1000188735 141
424 3300005334 Ga0068869_100033268 Ga0068869_1000332682 141
425 3300005335 Ga0070666_10318487 Ga0070666_103184871 141
426 3300005336 Ga0070680_100231220 Ga0070680_1002312203 141
427 3300005338 Ga0068868_100202723 Ga0068868_1002027233 141
428 3300005339 Ga0070660_100273465 Ga0070660_1002734651 141
429 3300005343 Ga0070687_100037398 Ga0070687_1000373983 141
430 3300005344 Ga0070661_100016970 Ga0070661_1000169705 141
431 3300005353 Ga0070669_101667207 Ga0070669_1016672072 141
432 3300005365 Ga0070688_101113930 Ga0070688_1011139301 141
433 3300005434 Ga0070709_10003260 Ga0070709_100032606 141
434 3300005434 Ga0070709_10039309 Ga0070709_100393093 141
435 3300005434 Ga0070709_10077637 Ga0070709_100776372 141
436 3300005434 Ga0070709_10097707 Ga0070709_100977072 141
437 3300005435 Ga0070714_100706336 Ga0070714_1007063362 141
438 3300005435 Ga0070714_100743803 Ga0070714_1007438032 141
439 3300005436 Ga0070713_100000200 Ga0070713_10000020028 141
440 3300005436 Ga0070713_100049628 Ga0070713_1000496282 141
441 3300005436 Ga0070713_100069600 Ga0070713_1000696004 141
442 3300005436 Ga0070713_100190929 Ga0070713_1001909292 141
443 3300005436 Ga0070713_100322086 Ga0070713_1003220862 141
444 3300005436 Ga0070713_100954261 Ga0070713_1009542612 141
445 3300005436 Ga0070713_101215468 Ga0070713_1012154682 141
446 3300005437 Ga0070710_10025312 Ga0070710_100253124 141
447 3300005439 Ga0070711_100056241 Ga0070711_1000562412 141
448 3300005458 Ga0070681_10008702 Ga0070681_100087027 141
449 3300005458 Ga0070681_10288069 Ga0070681_102880692 141
450 3300005458 Ga0070681_10985299 Ga0070681_109852992 141
451 3300005459 Ga0068867_100077644 Ga0068867_1000776442 141
452 3300005459 Ga0068867_100442779 Ga0068867_1004427791 141
453 3300005466 Ga0070685_11010371 Ga0070685_110103711 141
454 3300005530 Ga0070679_100432256 Ga0070679_1004322562 141
455 3300005535 Ga0070684_100063302 Ga0070684_1000633022 141
456 3300005535 Ga0070684_100470307 Ga0070684_1004703072 141
457 3300005539 Ga0068853_100027679 Ga0068853_1000276794 141
458 3300005544 Ga0070686_100261478 Ga0070686_1002614782 141
459 3300005546 Ga0070696_100394531 Ga0070696_1003945312 141
460 3300005548 Ga0070665_100353179 Ga0070665_1003531792 141
461 3300005563 Ga0068855_100263428 Ga0068855_1002634283 141
462 3300005564 Ga0070664_100002302 Ga0070664_10000230211 141
463 3300005577 Ga0068857_100000704 Ga0068857_10000070418 141
464 3300005614 Ga0068856_100005368 Ga0068856_1000053682 141
465 3300005614 Ga0068856_100864946 Ga0068856_1008649462 141
466 3300005614 Ga0068856_102497944 Ga0068856_1024979441 141
467 3300005617 Ga0068859_100000183 Ga0068859_10000018351 141
468 3300005617 Ga0068859_100075701 Ga0068859_1000757013 141
469 3300005618 Ga0068864_100000838 Ga0068864_10000083829 141
470 3300005718 Ga0068866_10029740 Ga0068866_100297403 141
471 3300005841 Ga0068863_100015920 Ga0068863_1000159205 141
472 3300005841 Ga0068863_101566388 Ga0068863_1015663881 141
473 3300005842 Ga0068858_100003853 Ga0068858_10000385312 141
474 3300005842 Ga0068858_100009794 Ga0068858_1000097945 141
475 3300005842 Ga0068858_100280344 Ga0068858_1002803442 141
476 3300005842 Ga0068858_101307173 Ga0068858_1013071732 141
477 3300005843 Ga0068860_100018135 Ga0068860_1000181355 141
478 3300005844 Ga0068862_100118881 Ga0068862_1001188813 141
479 3300006028 Ga0070717_10002732 Ga0070717_100027325 141
480 3300006028 Ga0070717_10212528 Ga0070717_102125282 141
481 3300006028 Ga0070717_10510279 Ga0070717_105102792 141
482 3300006028 Ga0070717_10580695 Ga0070717_105806952 141
483 3300006163 Ga0070715_10051175 Ga0070715_100511753 141
484 3300006175 Ga0070712_100000010 Ga0070712_10000001016 141
485 3300006175 Ga0070712_100005291 Ga0070712_1000052913 141
486 3300006237 Ga0097621_100023882 Ga0097621_1000238823 141
487 3300006237 Ga0097621_100448085 Ga0097621_1004480852 141
488 3300006358 Ga0068871_100346190 Ga0068871_1003461902 141
489 3300006852 Ga0075433_10324881 Ga0075433_103248812 141
490 3300006871 Ga0075434_100015065 Ga0075434_1000150655 141
491 3300006881 Ga0068865_100046586 Ga0068865_1000465863 141
492 3300006914 Ga0075436_100103408 Ga0075436_1001034082 141
493 3300006914 Ga0075436_100615185 Ga0075436_1006151852 141
494 3300006914 Ga0075436_101319593 Ga0075436_1013195932 141
495 3300006931 Ga0097620_100000183 Ga0097620_10000018351 141
496 3300006931 Ga0097620_100075698 Ga0097620_1000756983 141
497 3300007076 Ga0075435_100032082 Ga0075435_1000320823 141
498 3300009093 Ga0105240_10028975 Ga0105240_100289755 141
499 3300009093 Ga0105240_11662236 Ga0105240_116622362 141
500 3300009093 Ga0105240_12095943 Ga0105240_120959431 141
501 3300009098 Ga0105245_10036700 Ga0105245_100367003 141
502 3300009098 Ga0105245_10384626 Ga0105245_103846262 141
503 3300009148 Ga0105243_10104427 Ga0105243_101044272 141
504 3300009148 Ga0105243_10388467 Ga0105243_103884672 141
505 3300009174 Ga0105241_10089155 Ga0105241_100891552 141
506 3300009174 Ga0105241_10888947 Ga0105241_108889472 141
507 3300009176 Ga0105242_10123848 Ga0105242_101238483 141
508 3300009177 Ga0105248_10000004 Ga0105248_10000004530 141
509 3300009177 Ga0105248_10016900 Ga0105248_100169003 141
510 3300009177 Ga0105248_10024598 Ga0105248_100245987 141
511 3300009545 Ga0105237_10053017 Ga0105237_100530174 141
512 3300009545 Ga0105237_10628857 Ga0105237_106288572 141
513 3300009551 Ga0105238_10280787 Ga0105238_102807873 141
514 3300009553 Ga0105249_10417154 Ga0105249_104171542 141
515 3300010375 Ga0105239_10165171 Ga0105239_101651713 141
516 3300010375 Ga0105239_10207643 Ga0105239_102076433 141
517 3300013102 Ga0157371_10158935 Ga0157371_101589352 141
518 3300013104 Ga0157370_10323875 Ga0157370_103238752 141
519 3300013105 Ga0157369_10042594 Ga0157369_100425943 141
520 3300013296 Ga0157374_10000556 Ga0157374_1000055639 141
521 3300013296 Ga0157374_10017333 Ga0157374_100173335 141
522 3300013297 Ga0157378_10000046 Ga0157378_1000004681 141
523 3300013297 Ga0157378_10019310 Ga0157378_100193105 141
524 3300013297 Ga0157378_12518725 Ga0157378_125187251 141
525 3300013306 Ga0163162_10177649 Ga0163162_101776493 141
526 3300013307 Ga0157372_10000701 Ga0157372_1000070125 141
527 3300013307 Ga0157372_10000958 Ga0157372_1000095819 141
528 3300013307 Ga0157372_10255399 Ga0157372_102553993 141
529 3300013307 Ga0157372_10305808 Ga0157372_103058083 141
530 3300013307 Ga0157372_11723367 Ga0157372_117233672 141
531 3300013308 Ga0157375_11770967 Ga0157375_117709671 141
532 3300014968 Ga0157379_10044416 Ga0157379_100444164 141
533 3300014968 Ga0157379_10084926 Ga0157379_100849261 141
534 3300014968 Ga0157379_10405716 Ga0157379_104057162 141
535 3300014969 Ga0157376_10024059 Ga0157376_100240592 141
536 3300014969 Ga0157376_10148573 Ga0157376_101485732 141
537 3300014969 Ga0157376_10349611 Ga0157376_103496112 141
538 3300025321 Ga0207656_10084167 Ga0207656_100841673 141
539 3300025898 Ga0207692_10284921 Ga0207692_102849212 141
540 3300025898 Ga0207692_10920578 Ga0207692_109205781 141
541 3300025899 Ga0207642_10006280 Ga0207642_100062803 141
542 3300025903 Ga0207680_10453990 Ga0207680_104539902 141
543 3300025904 Ga0207647_10011620 Ga0207647_100116205 141
544 3300025904 Ga0207647_10016929 Ga0207647_100169293 141
545 3300025905 Ga0207685_10038013 Ga0207685_100380132 141
546 3300025906 Ga0207699_10000400 Ga0207699_100004005 141
547 3300025906 Ga0207699_10096251 Ga0207699_100962512 141
548 3300025906 Ga0207699_10284390 Ga0207699_102843902 141
549 3300025911 Ga0207654_10046565 Ga0207654_100465653 141
550 3300025912 Ga0207707_10006821 Ga0207707_100068212 141
551 3300025912 Ga0207707_10168907 Ga0207707_101689073 141
552 3300025912 Ga0207707_10327554 Ga0207707_103275542 141
553 3300025913 Ga0207695_10121858 Ga0207695_101218583 141
554 3300025913 Ga0207695_10233630 Ga0207695_102336302 141
555 3300025914 Ga0207671_10047033 Ga0207671_100470334 141
556 3300025915 Ga0207693_10000051 Ga0207693_1000005159 141
557 3300025915 Ga0207693_10008481 Ga0207693_100084818 141
558 3300025916 Ga0207663_10009977 Ga0207663_100099773 141
559 3300025916 Ga0207663_10678711 Ga0207663_106787112 141
560 3300025919 Ga0207657_10441804 Ga0207657_104418042 141
561 3300025921 Ga0207652_10046345 Ga0207652_100463455 141
562 3300025921 Ga0207652_10094323 Ga0207652_100943233 141
563 3300025921 Ga0207652_10180386 Ga0207652_101803862 141
564 3300025927 Ga0207687_10413277 Ga0207687_104132772 141
565 3300025927 Ga0207687_10854945 Ga0207687_108549452 141
566 3300025928 Ga0207700_10000100 Ga0207700_1000010015 141
567 3300025928 Ga0207700_10164350 Ga0207700_101643502 141
568 3300025928 Ga0207700_10411712 Ga0207700_104117122 141
569 3300025928 Ga0207700_10426971 Ga0207700_104269712 141
570 3300025928 Ga0207700_10527358 Ga0207700_105273582 141
571 3300025929 Ga0207664_10354871 Ga0207664_103548712 141
572 3300025929 Ga0207664_10671194 Ga0207664_106711941 141
573 3300025929 Ga0207664_10698581 Ga0207664_106985812 141
574 3300025929 Ga0207664_10947585 Ga0207664_109475851 141
575 3300025933 Ga0207706_10336595 Ga0207706_103365952 141
576 3300025938 Ga0207704_10303940 Ga0207704_103039401 141
577 3300025939 Ga0207665_10272338 Ga0207665_102723382 141
578 3300025939 Ga0207665_11131185 Ga0207665_111311852 141
579 3300025941 Ga0207711_10000032 Ga0207711_1000003248 141
580 3300025941 Ga0207711_10052956 Ga0207711_100529563 141
581 3300025941 Ga0207711_10062004 Ga0207711_100620043 141
582 3300025942 Ga0207689_10000185 Ga0207689_1000018550 141
583 3300025944 Ga0207661_10126119 Ga0207661_101261193 141
584 3300025945 Ga0207679_10018593 Ga0207679_100185934 141
585 3300025949 Ga0207667_10013091 Ga0207667_100130916 141
586 3300025949 Ga0207667_10150173 Ga0207667_101501733 141
587 3300025949 Ga0207667_10380854 Ga0207667_103808543 141
588 3300025960 Ga0207651_10717618 Ga0207651_107176181 141
589 3300026023 Ga0207677_10012943 Ga0207677_100129433 141
590 3300026035 Ga0207703_10008164 Ga0207703_100081649 141
591 3300026035 Ga0207703_10022015 Ga0207703_100220155 141
592 3300026035 Ga0207703_10459315 Ga0207703_104593152 141
593 3300026041 Ga0207639_10033168 Ga0207639_100331683 141
594 3300026078 Ga0207702_10002128 Ga0207702_100021289 141
595 3300026078 Ga0207702_10895145 Ga0207702_108951451 141
596 3300026088 Ga0207641_10227447 Ga0207641_102274473 141
597 3300026088 Ga0207641_10238468 Ga0207641_102384683 141
598 3300026089 Ga0207648_10028945 Ga0207648_100289454 141
599 3300026089 Ga0207648_10445166 Ga0207648_104451662 141
600 3300026116 Ga0207674_10000444 Ga0207674_1000044419 141
601 3300028379 Ga0268266_10289255 Ga0268266_102892552 141
602 3300028380 Ga0268265_10216596 Ga0268265_102165963 141
603 3300028380 Ga0268265_11201872 Ga0268265_112018722 141
604 3300028381 Ga0268264_10014897 Ga0268264_100148974 141
605 3300028381 Ga0268264_10225676 Ga0268264_102256762 141
606 3300028800 Ga0265338_10107048 Ga0265338_101070482 141
607 3300028800 Ga0265338_10157759 Ga0265338_101577592 141
608 3300028800 Ga0265338_10607077 Ga0265338_106070772 141
609 3300031247 Ga0265340_10014250 Ga0265340_100142504 141
610 3300031249 Ga0265339_10156554 Ga0265339_101565541 141
611 3300031344 Ga0265316_10080823 Ga0265316_100808233 141
612 3300035113 Ga0373936_0122954 Ga0373936_0122954_270_695 141
613 3300035170 Ga0373943_0088580 Ga0373943_0088580_519_944 141
614 3300035691 Ga0373931_0253271 Ga0373931_0253271_132_557 141
615 3300035695 Ga0373927_1177502 Ga0373927_1177502_44_469 141
616 3300035724 Ga0373933_0168056 Ga0373933_0168056_248_673 141
617 3300035725 Ga0373947_0073444 Ga0373947_0073444_382_807 141
618 3300036401 Ga0373937_0026166 Ga0373937_0026166_516_941 141
619 3300036401 Ga0373937_0183688 Ga0373937_0183688_63_488 141
620 3300036401 Ga0373937_0588223 Ga0373937_0588223_86_511 141
621 3300036401 Ga0373937_1600305 Ga0373937_1600305_12_437 141
622 3300037068 Ga0373925_0010808 Ga0373925_0010808_558_983 141
623 3300037466 Ga0395898_1365404 Ga0395898_1365404_46_471 141
624 3300044684 Ga0466966_0042838 Ga0466966_0042838_689_1114 141
625 3300044684 Ga0466966_0751555 Ga0466966_0751555_144_569 141
626 3300045049 Ga0466959_0119174 Ga0466959_0119174_685_1110 141
627 3300045836 Ga0466958_0698682 Ga0466958_0698682_63_488 141
628 3300046454 Ga0495592_0737946 Ga0495592_0737946_23_454 141
629 3300046472 Ga0495580_0003815 Ga0495580_0003815_6028_6453 141
630 3300048088 Ga0495602_0177900 Ga0495602_0177900_664_1089 141
631 3300048907 Ga0496104_0063488 Ga0496104_0063488_549_974 141
632 3300048908 Ga0496105_0977694 Ga0496105_0977694_142_567 141
633 3300048912 Ga0496109_0500239 Ga0496109_0500239_280_711 141
634 3300048915 Ga0496112_0018802 Ga0496112_0018802_2178_2603 141
635 3300048915 Ga0496112_0338993 Ga0496112_0338993_25_450 141
636 3300048915 Ga0496112_0817967 Ga0496112_0817967_280_705 141
637 3300048917 Ga0496114_0345027 Ga0496114_0345027_107_532 141
638 3300048918 Ga0496115_0088211 Ga0496115_0088211_1371_1796 141
639 3300048921 Ga0496118_0250036 Ga0496118_0250036_51_476 141
640 3300050512 nmdc:mga0n895_13968_c1 nmdc:mga0n895_13968_c1_2559_2984 141
641 3300050513 nmdc:mga0rr50_2275_c1 nmdc:mga0rr50_2275_c1_9332_9757 141
642 3300050514 nmdc:mga08x19_543525_c1 nmdc:mga08x19_543525_c1_87_512 141
643 3300050514 nmdc:mga08x19_878219_c1 nmdc:mga08x19_878219_c1_188_613 141
644 3300050514 nmdc:mga08x19_97756_c1 nmdc:mga08x19_97756_c1_215_640 141
645 3300000546 LJNas_1007190 LJNas_10071902 142
646 3300003320 rootH2_10065200 rootH2_100652002 142
647 3300005290 Ga0065712_10288886 Ga0065712_102888862 142
648 3300005329 Ga0070683_100336452 Ga0070683_1003364522 142
649 3300005331 Ga0070670_100470631 Ga0070670_1004706311 142
650 3300005336 Ga0070680_100022347 Ga0070680_1000223474 142
651 3300005336 Ga0070680_100111175 Ga0070680_1001111752 142
652 3300005336 Ga0070680_100455728 Ga0070680_1004557282 142
653 3300005338 Ga0068868_100272672 Ga0068868_1002726722 142
654 3300005339 Ga0070660_100039738 Ga0070660_1000397383 142
655 3300005339 Ga0070660_100110273 Ga0070660_1001102731 142
656 3300005344 Ga0070661_100475988 Ga0070661_1004759882 142
657 3300005345 Ga0070692_10248976 Ga0070692_102489762 142
658 3300005353 Ga0070669_100157681 Ga0070669_1001576813 142
659 3300005355 Ga0070671_100088494 Ga0070671_1000884942 142
660 3300005355 Ga0070671_101505546 Ga0070671_1015055461 142
661 3300005366 Ga0070659_100074859 Ga0070659_1000748592 142
662 3300005434 Ga0070709_10005394 Ga0070709_100053947 142
663 3300005434 Ga0070709_10027776 Ga0070709_100277764 142
664 3300005434 Ga0070709_10077651 Ga0070709_100776512 142
665 3300005434 Ga0070709_10453962 Ga0070709_104539622 142
666 3300005435 Ga0070714_100000168 Ga0070714_10000016819 142
667 3300005435 Ga0070714_100007372 Ga0070714_1000073725 142
668 3300005435 Ga0070714_100274812 Ga0070714_1002748122 142
669 3300005435 Ga0070714_100465155 Ga0070714_1004651552 142
670 3300005435 Ga0070714_101071088 Ga0070714_1010710882 142
671 3300005435 Ga0070714_101082640 Ga0070714_1010826402 142
672 3300005435 Ga0070714_101105310 Ga0070714_1011053101 142
673 3300005435 Ga0070714_101362819 Ga0070714_1013628191 142
674 3300005436 Ga0070713_100000037 Ga0070713_10000003761 142
675 3300005436 Ga0070713_100140121 Ga0070713_1001401212 142
676 3300005436 Ga0070713_100276254 Ga0070713_1002762542 142
677 3300005436 Ga0070713_100282874 Ga0070713_1002828742 142
678 3300005436 Ga0070713_100934609 Ga0070713_1009346092 142
679 3300005437 Ga0070710_10001589 Ga0070710_1000158912 142
680 3300005437 Ga0070710_10391080 Ga0070710_103910802 142
681 3300005437 Ga0070710_10551878 Ga0070710_105518782 142
682 3300005439 Ga0070711_100000165 Ga0070711_1000001655 142
683 3300005439 Ga0070711_100085290 Ga0070711_1000852902 142
684 3300005439 Ga0070711_100107326 Ga0070711_1001073261 142
685 3300005439 Ga0070711_100253817 Ga0070711_1002538172 142
686 3300005444 Ga0070694_100461634 Ga0070694_1004616341 142
687 3300005445 Ga0070708_100095788 Ga0070708_1000957882 142
688 3300005445 Ga0070708_100106269 Ga0070708_1001062693 142
689 3300005445 Ga0070708_100155885 Ga0070708_1001558852 142
690 3300005445 Ga0070708_100306309 Ga0070708_1003063092 142
691 3300005445 Ga0070708_100383756 Ga0070708_1003837562 142
692 3300005455 Ga0070663_100726203 Ga0070663_1007262032 142
693 3300005455 Ga0070663_101640549 Ga0070663_1016405491 142
694 3300005456 Ga0070678_100844041 Ga0070678_1008440412 142
695 3300005458 Ga0070681_10007293 Ga0070681_100072933 142
696 3300005458 Ga0070681_10072249 Ga0070681_100722493 142
697 3300005458 Ga0070681_10072357 Ga0070681_100723572 142
698 3300005458 Ga0070681_10082589 Ga0070681_100825892 142
699 3300005458 Ga0070681_10253597 Ga0070681_102535972 142
700 3300005467 Ga0070706_100003030 Ga0070706_10000303010 142
701 3300005467 Ga0070706_100080381 Ga0070706_1000803813 142
702 3300005467 Ga0070706_100152319 Ga0070706_1001523192 142
703 3300005467 Ga0070706_100174186 Ga0070706_1001741862 142
704 3300005467 Ga0070706_100324263 Ga0070706_1003242632 142
705 3300005467 Ga0070706_101066383 Ga0070706_1010663831 142
706 3300005468 Ga0070707_100002615 Ga0070707_1000026154 142
707 3300005468 Ga0070707_100038533 Ga0070707_1000385332 142
708 3300005468 Ga0070707_100220708 Ga0070707_1002207083 142
709 3300005468 Ga0070707_100326989 Ga0070707_1003269892 142
710 3300005468 Ga0070707_100601578 Ga0070707_1006015782 142
711 3300005468 Ga0070707_101032189 Ga0070707_1010321892 142
712 3300005468 Ga0070707_101066876 Ga0070707_1010668762 142
713 3300005471 Ga0070698_100000956 Ga0070698_10000095617 142
714 3300005471 Ga0070698_100250450 Ga0070698_1002504502 142
715 3300005471 Ga0070698_100323633 Ga0070698_1003236332 142
716 3300005518 Ga0070699_100001599 Ga0070699_1000015994 142
717 3300005518 Ga0070699_100008452 Ga0070699_1000084523 142
718 3300005518 Ga0070699_100206477 Ga0070699_1002064772 142
719 3300005518 Ga0070699_100408058 Ga0070699_1004080582 142
720 3300005530 Ga0070679_100000926 Ga0070679_10000092612 142
721 3300005530 Ga0070679_100018151 Ga0070679_1000181514 142
722 3300005530 Ga0070679_100072145 Ga0070679_1000721454 142
723 3300005530 Ga0070679_100396355 Ga0070679_1003963552 142
724 3300005535 Ga0070684_100181169 Ga0070684_1001811693 142
725 3300005535 Ga0070684_101212338 Ga0070684_1012123382 142
726 3300005536 Ga0070697_100000573 Ga0070697_10000057310 142
727 3300005536 Ga0070697_100111175 Ga0070697_1001111752 142
728 3300005536 Ga0070697_100818293 Ga0070697_1008182932 142
729 3300005536 Ga0070697_101161898 Ga0070697_1011618981 142
730 3300005539 Ga0068853_100036136 Ga0068853_1000361364 142
731 3300005539 Ga0068853_100254257 Ga0068853_1002542571 142
732 3300005539 Ga0068853_101317100 Ga0068853_1013171001 142
733 3300005543 Ga0070672_101102984 Ga0070672_1011029842 142
734 3300005547 Ga0070693_100162240 Ga0070693_1001622402 142
735 3300005547 Ga0070693_100644100 Ga0070693_1006441002 142
736 3300005563 Ga0068855_100001917 Ga0068855_10000191712 142
737 3300005563 Ga0068855_100643796 Ga0068855_1006437962 142
738 3300005563 Ga0068855_100973488 Ga0068855_1009734882 142
739 3300005563 Ga0068855_101421166 Ga0068855_1014211662 142
740 3300005564 Ga0070664_100157054 Ga0070664_1001570542 142
741 3300005564 Ga0070664_101128672 Ga0070664_1011286722 142
742 3300005577 Ga0068857_100843541 Ga0068857_1008435412 142
743 3300005578 Ga0068854_100056908 Ga0068854_1000569083 142
744 3300005614 Ga0068856_100004417 Ga0068856_1000044173 142
745 3300005614 Ga0068856_100004783 Ga0068856_1000047832 142
746 3300005614 Ga0068856_100059239 Ga0068856_1000592392 142
747 3300005614 Ga0068856_101145443 Ga0068856_1011454432 142
748 3300005616 Ga0068852_100017573 Ga0068852_1000175733 142
749 3300005616 Ga0068852_101519792 Ga0068852_1015197921 142
750 3300005618 Ga0068864_100466039 Ga0068864_1004660392 142
751 3300005834 Ga0068851_10554727 Ga0068851_105547271 142
752 3300005841 Ga0068863_100107626 Ga0068863_1001076263 142
753 3300005841 Ga0068863_100298242 Ga0068863_1002982421 142
754 3300005842 Ga0068858_100215651 Ga0068858_1002156513 142
755 3300005842 Ga0068858_101344858 Ga0068858_1013448582 142
756 3300005842 Ga0068858_101439038 Ga0068858_1014390382 142
757 3300005843 Ga0068860_100333548 Ga0068860_1003335482 142
758 3300005983 Ga0081540_1010434 Ga0081540_10104347 142
759 3300005983 Ga0081540_1084639 Ga0081540_10846392 142
760 3300006028 Ga0070717_10023487 Ga0070717_100234875 142
761 3300006028 Ga0070717_10043221 Ga0070717_100432213 142
762 3300006028 Ga0070717_10173286 Ga0070717_101732863 142
763 3300006028 Ga0070717_10270138 Ga0070717_102701382 142
764 3300006028 Ga0070717_10789849 Ga0070717_107898492 142
765 3300006173 Ga0070716_100146128 Ga0070716_1001461282 142
766 3300006173 Ga0070716_100376928 Ga0070716_1003769282 142
767 3300006173 Ga0070716_100432247 Ga0070716_1004322472 142
768 3300006175 Ga0070712_100001120 Ga0070712_1000011209 142
769 3300006175 Ga0070712_100202561 Ga0070712_1002025612 142
770 3300006237 Ga0097621_100006016 Ga0097621_1000060169 142
771 3300006237 Ga0097621_100648911 Ga0097621_1006489112 142
772 3300006358 Ga0068871_100006586 Ga0068871_1000065867 142
773 3300006358 Ga0068871_100048401 Ga0068871_1000484014 142
774 3300006871 Ga0075434_101667861 Ga0075434_1016678612 142
775 3300006914 Ga0075436_100158031 Ga0075436_1001580312 142
776 3300007076 Ga0075435_100040020 Ga0075435_1000400203 142
777 3300007265 Ga0099794_10655051 Ga0099794_106550512 142
778 3300007788 Ga0099795_10162176 Ga0099795_101621762 142
779 3300009093 Ga0105240_10000077 Ga0105240_10000077103 142
780 3300009093 Ga0105240_10008055 Ga0105240_100080559 142
781 3300009093 Ga0105240_10104641 Ga0105240_101046412 142
782 3300009093 Ga0105240_10151581 Ga0105240_101515812 142
783 3300009093 Ga0105240_10192655 Ga0105240_101926553 142
784 3300009098 Ga0105245_10038322 Ga0105245_100383224 142
785 3300009098 Ga0105245_10564180 Ga0105245_105641802 142
786 3300009098 Ga0105245_11811613 Ga0105245_118116132 142
787 3300009101 Ga0105247_10165847 Ga0105247_101658472 142
788 3300009174 Ga0105241_10015796 Ga0105241_100157967 142
789 3300009174 Ga0105241_10149486 Ga0105241_101494862 142
790 3300009177 Ga0105248_10038208 Ga0105248_100382083 142
791 3300009177 Ga0105248_10332108 Ga0105248_103321083 142
792 3300009545 Ga0105237_10047147 Ga0105237_100471474 142
793 3300009545 Ga0105237_10546549 Ga0105237_105465492 142
794 3300009545 Ga0105237_10684300 Ga0105237_106843002 142
795 3300009551 Ga0105238_10001285 Ga0105238_100012853 142
796 3300009551 Ga0105238_10013086 Ga0105238_100130863 142
797 3300009551 Ga0105238_10031256 Ga0105238_100312564 142
798 3300010159 Ga0099796_10344618 Ga0099796_103446182 142
799 3300010159 Ga0099796_10387295 Ga0099796_103872952 142
800 3300010375 Ga0105239_10188672 Ga0105239_101886722 142
801 3300010375 Ga0105239_10596896 Ga0105239_105968962 142
802 3300013100 Ga0157373_10044556 Ga0157373_100445562 142
803 3300013102 Ga0157371_10048060 Ga0157371_100480602 142
804 3300013102 Ga0157371_10420494 Ga0157371_104204942 142
805 3300013104 Ga0157370_10001457 Ga0157370_100014575 142
806 3300013104 Ga0157370_10065467 Ga0157370_100654673 142
807 3300013105 Ga0157369_10112753 Ga0157369_101127534 142
808 3300013105 Ga0157369_10136444 Ga0157369_101364442 142
809 3300013105 Ga0157369_10865545 Ga0157369_108655452 142
810 3300013296 Ga0157374_10011657 Ga0157374_100116579 142
811 3300013296 Ga0157374_10020227 Ga0157374_100202273 142
812 3300013296 Ga0157374_10020811 Ga0157374_100208114 142
813 3300013296 Ga0157374_10082182 Ga0157374_100821822 142
814 3300013296 Ga0157374_10765015 Ga0157374_107650152 142
815 3300013297 Ga0157378_10031312 Ga0157378_100313124 142
816 3300013297 Ga0157378_10045885 Ga0157378_100458852 142
817 3300013306 Ga0163162_10002202 Ga0163162_100022029 142
818 3300013306 Ga0163162_11189939 Ga0163162_111899392 142
819 3300013307 Ga0157372_10000076 Ga0157372_1000007613 142
820 3300013307 Ga0157372_10086108 Ga0157372_100861083 142
821 3300013307 Ga0157372_10149334 Ga0157372_101493343 142
822 3300013307 Ga0157372_10353233 Ga0157372_103532333 142
823 3300013307 Ga0157372_10354148 Ga0157372_103541483 142
824 3300014325 Ga0163163_10041061 Ga0163163_100410615 142
825 3300014325 Ga0163163_10080044 Ga0163163_100800442 142
826 3300014325 Ga0163163_10182534 Ga0163163_101825343 142
827 3300014497 Ga0182008_10006174 Ga0182008_100061744 142
828 3300014968 Ga0157379_10082946 Ga0157379_100829463 142
829 3300014968 Ga0157379_10098779 Ga0157379_100987792 142
830 3300014969 Ga0157376_10009032 Ga0157376_100090323 142
831 3300014969 Ga0157376_10161960 Ga0157376_101619602 142
832 3300014969 Ga0157376_10423277 Ga0157376_104232772 142
833 3300015261 Ga0182006_1006060 Ga0182006_10060603 142
834 3300015262 Ga0182007_10029489 Ga0182007_100294893 142
835 3300015265 Ga0182005_1011183 Ga0182005_10111833 142
836 3300021361 Ga0213872_10031946 Ga0213872_100319463 142
837 3300021361 Ga0213872_10260083 Ga0213872_102600832 142
838 3300024225 Ga0224572_1007280 Ga0224572_10072803 142
839 3300024225 Ga0224572_1007429 Ga0224572_10074292 142
840 3300024227 Ga0228598_1001426 Ga0228598_10014262 142
841 3300024227 Ga0228598_1001628 Ga0228598_10016285 142
842 3300025321 Ga0207656_10146403 Ga0207656_101464032 142
843 3300025898 Ga0207692_10008566 Ga0207692_100085664 142
844 3300025898 Ga0207692_10241052 Ga0207692_102410522 142
845 3300025898 Ga0207692_10948925 Ga0207692_109489252 142
846 3300025900 Ga0207710_10609165 Ga0207710_106091652 142
847 3300025903 Ga0207680_10232840 Ga0207680_102328402 142
848 3300025906 Ga0207699_10020437 Ga0207699_100204371 142
849 3300025906 Ga0207699_10024423 Ga0207699_100244232 142
850 3300025906 Ga0207699_10087768 Ga0207699_100877683 142
851 3300025906 Ga0207699_10108949 Ga0207699_101089492 142
852 3300025909 Ga0207705_10172215 Ga0207705_101722152 142
853 3300025910 Ga0207684_10000426 Ga0207684_1000042619 142
854 3300025910 Ga0207684_10030237 Ga0207684_100302376 142
855 3300025910 Ga0207684_10182801 Ga0207684_101828012 142
856 3300025910 Ga0207684_10187610 Ga0207684_101876102 142
857 3300025910 Ga0207684_10285282 Ga0207684_102852822 142
858 3300025910 Ga0207684_10894643 Ga0207684_108946432 142
859 3300025911 Ga0207654_10013595 Ga0207654_100135953 142
860 3300025911 Ga0207654_10141886 Ga0207654_101418861 142
861 3300025912 Ga0207707_10004349 Ga0207707_100043499 142
862 3300025912 Ga0207707_10008380 Ga0207707_100083809 142
863 3300025912 Ga0207707_10091121 Ga0207707_100911212 142
864 3300025912 Ga0207707_10309675 Ga0207707_103096752 142
865 3300025912 Ga0207707_10766937 Ga0207707_107669372 142
866 3300025913 Ga0207695_10000707 Ga0207695_1000070727 142
867 3300025913 Ga0207695_10071518 Ga0207695_100715182 142
868 3300025913 Ga0207695_10094515 Ga0207695_100945152 142
869 3300025913 Ga0207695_10108434 Ga0207695_101084343 142
870 3300025913 Ga0207695_10451670 Ga0207695_104516702 142
871 3300025914 Ga0207671_10146525 Ga0207671_101465253 142
872 3300025914 Ga0207671_10560701 Ga0207671_105607012 142
873 3300025915 Ga0207693_10000004 Ga0207693_1000000457 142
874 3300025915 Ga0207693_10029941 Ga0207693_100299415 142
875 3300025915 Ga0207693_11390159 Ga0207693_113901591 142
876 3300025916 Ga0207663_10012865 Ga0207663_100128652 142
877 3300025916 Ga0207663_10057872 Ga0207663_100578723 142
878 3300025916 Ga0207663_10116619 Ga0207663_101166192 142
879 3300025916 Ga0207663_10123167 Ga0207663_101231673 142
880 3300025917 Ga0207660_10015331 Ga0207660_100153313 142
881 3300025917 Ga0207660_10044750 Ga0207660_100447503 142
882 3300025917 Ga0207660_10333449 Ga0207660_103334492 142
883 3300025917 Ga0207660_10339170 Ga0207660_103391702 142
884 3300025917 Ga0207660_11028511 Ga0207660_110285112 142
885 3300025919 Ga0207657_10000830 Ga0207657_1000083027 142
886 3300025919 Ga0207657_10051050 Ga0207657_100510503 142
887 3300025920 Ga0207649_10103973 Ga0207649_101039732 142
888 3300025920 Ga0207649_10488536 Ga0207649_104885362 142
889 3300025921 Ga0207652_10008135 Ga0207652_100081353 142
890 3300025921 Ga0207652_10260500 Ga0207652_102605002 142
891 3300025921 Ga0207652_10334070 Ga0207652_103340702 142
892 3300025921 Ga0207652_10638643 Ga0207652_106386432 142
893 3300025921 Ga0207652_10786128 Ga0207652_107861282 142
894 3300025921 Ga0207652_11117658 Ga0207652_111176582 142
895 3300025922 Ga0207646_10000614 Ga0207646_1000061441 142
896 3300025922 Ga0207646_10038225 Ga0207646_100382255 142
897 3300025922 Ga0207646_10124272 Ga0207646_101242722 142
898 3300025922 Ga0207646_10155508 Ga0207646_101555082 142
899 3300025922 Ga0207646_10281600 Ga0207646_102816002 142
900 3300025922 Ga0207646_10411483 Ga0207646_104114832 142
901 3300025924 Ga0207694_10078342 Ga0207694_100783423 142
902 3300025924 Ga0207694_10126806 Ga0207694_101268063 142
903 3300025925 Ga0207650_11062960 Ga0207650_110629602 142
904 3300025927 Ga0207687_10141581 Ga0207687_101415813 142
905 3300025928 Ga0207700_10001993 Ga0207700_100019935 142
906 3300025928 Ga0207700_10016139 Ga0207700_100161393 142
907 3300025928 Ga0207700_10341379 Ga0207700_103413792 142
908 3300025928 Ga0207700_10684008 Ga0207700_106840081 142
909 3300025929 Ga0207664_10000133 Ga0207664_1000013318 142
910 3300025929 Ga0207664_10005816 Ga0207664_100058165 142
911 3300025929 Ga0207664_10336689 Ga0207664_103366892 142
912 3300025929 Ga0207664_10706156 Ga0207664_107061562 142
913 3300025929 Ga0207664_10749260 Ga0207664_107492601 142
914 3300025931 Ga0207644_10066079 Ga0207644_100660793 142
915 3300025932 Ga0207690_10082547 Ga0207690_100825472 142
916 3300025932 Ga0207690_10171722 Ga0207690_101717222 142
917 3300025933 Ga0207706_10727194 Ga0207706_107271942 142
918 3300025939 Ga0207665_10009619 Ga0207665_100096192 142
919 3300025939 Ga0207665_10399241 Ga0207665_103992412 142
920 3300025939 Ga0207665_10429015 Ga0207665_104290152 142
921 3300025939 Ga0207665_10627286 Ga0207665_106272862 142
922 3300025941 Ga0207711_11311601 Ga0207711_113116012 142
923 3300025944 Ga0207661_10331596 Ga0207661_103315962 142
924 3300025945 Ga0207679_10143520 Ga0207679_101435202 142
925 3300025945 Ga0207679_10179629 Ga0207679_101796292 142
926 3300025949 Ga0207667_10001339 Ga0207667_1000133924 142
927 3300025949 Ga0207667_10616455 Ga0207667_106164552 142
928 3300025981 Ga0207640_10642353 Ga0207640_106423531 142
929 3300026023 Ga0207677_10173309 Ga0207677_101733092 142
930 3300026023 Ga0207677_10228291 Ga0207677_102282912 142
931 3300026035 Ga0207703_10187654 Ga0207703_101876542 142
932 3300026041 Ga0207639_12236179 Ga0207639_122361791 142
933 3300026067 Ga0207678_10572682 Ga0207678_105726822 142
934 3300026078 Ga0207702_10002334 Ga0207702_100023343 142
935 3300026078 Ga0207702_10030516 Ga0207702_100305163 142
936 3300026078 Ga0207702_10342495 Ga0207702_103424952 142
937 3300026088 Ga0207641_10776973 Ga0207641_107769731 142
938 3300026095 Ga0207676_10228538 Ga0207676_102285382 142
939 3300026116 Ga0207674_10211528 Ga0207674_102115282 142
940 3300026116 Ga0207674_10273074 Ga0207674_102730742 142
941 3300026116 Ga0207674_10432127 Ga0207674_104321272 142
942 3300026142 Ga0207698_10010674 Ga0207698_100106743 142
943 3300026142 Ga0207698_11442379 Ga0207698_114423791 142
944 3300028017 Ga0265356_1000349 Ga0265356_10003497 142
945 3300028017 Ga0265356_1012164 Ga0265356_10121642 142
946 3300028017 Ga0265356_1037211 Ga0265356_10372111 142
947 3300028036 Ga0265355_1017435 Ga0265355_10174352 142
948 3300028381 Ga0268264_11233909 Ga0268264_112339091 142
949 3300028558 Ga0265326_10047833 Ga0265326_100478332 142
950 3300028653 Ga0265323_10095612 Ga0265323_100956122 142
951 3300028666 Ga0265336_10021494 Ga0265336_100214943 142
952 3300028800 Ga0265338_10002959 Ga0265338_1000295915 142
953 3300028800 Ga0265338_10003184 Ga0265338_1000318418 142
954 3300028800 Ga0265338_10005440 Ga0265338_100054408 142
955 3300028800 Ga0265338_10016693 Ga0265338_100166937 142
956 3300028800 Ga0265338_10033453 Ga0265338_100334533 142
957 3300028800 Ga0265338_10052707 Ga0265338_100527072 142
958 3300028800 Ga0265338_10421551 Ga0265338_104215512 142
959 3300028800 Ga0265338_10542874 Ga0265338_105428742 142
960 3300028800 Ga0265338_10779783 Ga0265338_107797831 142
961 3300030760 Ga0265762_1000898 Ga0265762_10008983 142
962 3300030760 Ga0265762_1002331 Ga0265762_10023313 142
963 3300030760 Ga0265762_1011840 Ga0265762_10118403 142
964 3300030760 Ga0265762_1046806 Ga0265762_10468062 142
965 3300030879 Ga0265765_1013026 Ga0265765_10130262 142
966 3300031090 Ga0265760_10000507 Ga0265760_1000050711 142
967 3300031090 Ga0265760_10000556 Ga0265760_100005567 142
968 3300031090 Ga0265760_10019053 Ga0265760_100190532 142
969 3300031090 Ga0265760_10022397 Ga0265760_100223972 142
970 3300031090 Ga0265760_10066032 Ga0265760_100660322 142
971 3300031235 Ga0265330_10000079 Ga0265330_1000007967 142
972 3300031235 Ga0265330_10000828 Ga0265330_100008289 142
973 3300031235 Ga0265330_10018444 Ga0265330_100184442 142
974 3300031235 Ga0265330_10028694 Ga0265330_100286942 142
975 3300031235 Ga0265330_10076759 Ga0265330_100767591 142
976 3300031235 Ga0265330_10092325 Ga0265330_100923252 142
977 3300031235 Ga0265330_10107453 Ga0265330_101074532 142
978 3300031238 Ga0265332_10030604 Ga0265332_100306042 142
979 3300031238 Ga0265332_10037397 Ga0265332_100373972 142
980 3300031239 Ga0265328_10006930 Ga0265328_100069304 142
981 3300031240 Ga0265320_10101866 Ga0265320_101018662 142
982 3300031241 Ga0265325_10000269 Ga0265325_1000026911 142
983 3300031241 Ga0265325_10000664 Ga0265325_1000066413 142
984 3300031241 Ga0265325_10004556 Ga0265325_100045565 142
985 3300031241 Ga0265325_10009565 Ga0265325_100095655 142
986 3300031241 Ga0265325_10029196 Ga0265325_100291962 142
987 3300031241 Ga0265325_10048764 Ga0265325_100487642 142
988 3300031241 Ga0265325_10050267 Ga0265325_100502672 142
989 3300031241 Ga0265325_10052532 Ga0265325_100525322 142
990 3300031242 Ga0265329_10012908 Ga0265329_100129082 142
991 3300031242 Ga0265329_10131947 Ga0265329_101319472 142
992 3300031247 Ga0265340_10003189 Ga0265340_100031894 142
993 3300031247 Ga0265340_10013452 Ga0265340_100134523 142
994 3300031247 Ga0265340_10026330 Ga0265340_100263303 142
995 3300031247 Ga0265340_10043205 Ga0265340_100432053 142
996 3300031247 Ga0265340_10090959 Ga0265340_100909592 142
997 3300031247 Ga0265340_10227405 Ga0265340_102274051 142
998 3300031249 Ga0265339_10002137 Ga0265339_100021377 142
999 3300031249 Ga0265339_10007786 Ga0265339_100077866 142
1000 3300031249 Ga0265339_10010524 Ga0265339_100105244 142
1001 3300031249 Ga0265339_10014373 Ga0265339_100143737 142
1002 3300031249 Ga0265339_10028226 Ga0265339_100282265 142
1003 3300031249 Ga0265339_10038843 Ga0265339_100388433 142
1004 3300031249 Ga0265339_10064493 Ga0265339_100644932 142
1005 3300031250 Ga0265331_10013219 Ga0265331_100132193 142
1006 3300031250 Ga0265331_10154354 Ga0265331_101543542 142
1007 3300031250 Ga0265331_10174303 Ga0265331_101743032 142
1008 3300031250 Ga0265331_10196951 Ga0265331_101969512 142
1009 3300031251 Ga0265327_10007910 Ga0265327_100079105 142
1010 3300031344 Ga0265316_10000687 Ga0265316_1000068727 142
1011 3300031344 Ga0265316_10001007 Ga0265316_1000100723 142
1012 3300031344 Ga0265316_10004970 Ga0265316_100049708 142
1013 3300031344 Ga0265316_10005155 Ga0265316_1000515511 142
1014 3300031344 Ga0265316_10014095 Ga0265316_100140952 142
1015 3300031344 Ga0265316_10028528 Ga0265316_100285285 142
1016 3300031344 Ga0265316_10040159 Ga0265316_100401594 142
1017 3300031344 Ga0265316_10077681 Ga0265316_100776813 142
1018 3300031344 Ga0265316_10191129 Ga0265316_101911292 142
1019 3300031344 Ga0265316_10293950 Ga0265316_102939502 142
1020 3300031344 Ga0265316_10334310 Ga0265316_103343102 142
1021 3300031344 Ga0265316_10691444 Ga0265316_106914442 142
1022 3300031548 Ga0307408_100093043 Ga0307408_1000930433 142
1023 3300031595 Ga0265313_10004047 Ga0265313_100040477 142
1024 3300031595 Ga0265313_10004402 Ga0265313_100044023 142
1025 3300031595 Ga0265313_10005676 Ga0265313_100056762 142
1026 3300031595 Ga0265313_10038923 Ga0265313_100389232 142
1027 3300031595 Ga0265313_10070179 Ga0265313_100701792 142
1028 3300031595 Ga0265313_10112988 Ga0265313_101129882 142
1029 3300031711 Ga0265314_10000064 Ga0265314_1000006492 142
1030 3300031711 Ga0265314_10003032 Ga0265314_100030324 142
1031 3300031711 Ga0265314_10011561 Ga0265314_100115613 142
1032 3300031711 Ga0265314_10012941 Ga0265314_100129413 142
1033 3300031711 Ga0265314_10107760 Ga0265314_101077602 142
1034 3300031711 Ga0265314_10192228 Ga0265314_101922282 142
1035 3300031712 Ga0265342_10001845 Ga0265342_100018455 142
1036 3300031712 Ga0265342_10003868 Ga0265342_100038682 142
1037 3300031712 Ga0265342_10006161 Ga0265342_100061617 142
1038 3300031712 Ga0265342_10113000 Ga0265342_101130002 142
1039 3300031712 Ga0265342_10127761 Ga0265342_101277612 142
1040 3300031712 Ga0265342_10210266 Ga0265342_102102662 142
1041 3300031712 Ga0265342_10315431 Ga0265342_103154312 142
1042 3300032002 Ga0307416_100854016 Ga0307416_1008540162 142
1043 3300035083 Ga0373926_0162658 Ga0373926_0162658_90_518 142
1044 3300035086 Ga0373934_0240717 Ga0373934_0240717_152_580 142
1045 3300035111 Ga0373923_0143464 Ga0373923_0143464_121_549 142
1046 3300035113 Ga0373936_0000533 Ga0373936_0000533_9885_10313 142
1047 3300035116 Ga0373945_0003319 Ga0373945_0003319_4132_4560 142
1048 3300035117 Ga0373953_0395864 Ga0373953_0395864_10_438 142
1049 3300035118 Ga0373954_0038348 Ga0373954_0038348_1380_1808 142
1050 3300035118 Ga0373954_0061913 Ga0373954_0061913_799_1227 142
1051 3300035119 Ga0373956_0028844 Ga0373956_0028844_1326_1754 142
1052 3300035120 Ga0373957_0033697 Ga0373957_0033697_1415_1843 142
1053 3300035170 Ga0373943_0009149 Ga0373943_0009149_990_1418 142
1054 3300035171 Ga0373946_0023484 Ga0373946_0023484_1025_1453 142
1055 3300035171 Ga0373946_0241068 Ga0373946_0241068_291_719 142
1056 3300035172 Ga0373955_0011959 Ga0373955_0011959_3240_3668 142
1057 3300035410 Ga0373924_0013341 Ga0373924_0013341_1668_2096 142
1058 3300035410 Ga0373924_0052741 Ga0373924_0052741_593_1021 142
1059 3300035410 Ga0373924_0396683 Ga0373924_0396683_94_522 142
1060 3300035691 Ga0373931_0363943 Ga0373931_0363943_14_442 142
1061 3300035692 Ga0373935_0001852 Ga0373935_0001852_218_646 142
1062 3300035692 Ga0373935_0004543 Ga0373935_0004543_1852_2280 142
1063 3300035692 Ga0373935_0226224 Ga0373935_0226224_572_1000 142
1064 3300035692 Ga0373935_0226735 Ga0373935_0226735_26_454 142
1065 3300035692 Ga0373935_0475808 Ga0373935_0475808_341_769 142
1066 3300035692 Ga0373935_1066678 Ga0373935_1066678_162_590 142
1067 3300035695 Ga0373927_0003241 Ga0373927_0003241_5347_5775 142
1068 3300035695 Ga0373927_0106783 Ga0373927_0106783_628_1056 142
1069 3300035695 Ga0373927_0674731 Ga0373927_0674731_29_457 142
1070 3300035695 Ga0373927_0697103 Ga0373927_0697103_36_464 142
1071 3300035724 Ga0373933_0032235 Ga0373933_0032235_2084_2512 142
1072 3300035724 Ga0373933_0180598 Ga0373933_0180598_789_1217 142
1073 3300035725 Ga0373947_0000052 Ga0373947_0000052_14367_14795 142
1074 3300035725 Ga0373947_0155592 Ga0373947_0155592_352_780 142
1075 3300035725 Ga0373947_0417524 Ga0373947_0417524_202_630 142
1076 3300036401 Ga0373937_0033230 Ga0373937_0033230_2691_3119 142
1077 3300036401 Ga0373937_0096889 Ga0373937_0096889_394_822 142
1078 3300036401 Ga0373937_0217625 Ga0373937_0217625_773_1201 142
1079 3300036401 Ga0373937_0332171 Ga0373937_0332171_145_573 142
1080 3300036401 Ga0373937_0813997 Ga0373937_0813997_101_529 142
1081 3300036401 Ga0373937_0871953 Ga0373937_0871953_31_459 142
1082 3300037068 Ga0373925_0015262 Ga0373925_0015262_4264_4692 142
1083 3300037068 Ga0373925_0072626 Ga0373925_0072626_957_1385 142
1084 3300037068 Ga0373925_0201268 Ga0373925_0201268_684_1112 142
1085 3300037068 Ga0373925_0467119 Ga0373925_0467119_493_921 142
1086 3300037068 Ga0373925_0642626 Ga0373925_0642626_291_719 142
1087 3300037418 Ga0395900_0112474 Ga0395900_0112474_2109_2540 142
1088 3300037466 Ga0395898_0043466 Ga0395898_0043466_1716_2147 142
1089 3300038443 Ga0395901_0576011 Ga0395901_0576011_621_1052 142
1090 3300039438 Ga0436360_0199375 Ga0436360_0199375_4249_4680 142
1091 3300039447 Ga0436361_0274684 Ga0436361_0274684_6781_7212 142
1092 3300039447 Ga0436361_0396041 Ga0436361_0396041_2437_2868 142
1093 3300039447 Ga0436361_0430533 Ga0436361_0430533_824_1255 142
1094 3300039447 Ga0436361_0464047 Ga0436361_0464047_32955_33386 142
1095 3300039447 Ga0436361_1050554 Ga0436361_1050554_988_1416 142
1096 3300039450 Ga0436363_0137489 Ga0436363_0137489_588_1028 142
1097 3300039450 Ga0436363_0160947 Ga0436363_0160947_76_504 142
1098 3300039453 Ga0436362_1012151 Ga0436362_1012151_2111_2539 142
1099 3300042876 Ga0451577_1237573 Ga0451577_1237573_220_648 142
1100 3300045051 Ga0451576_0246022 Ga0451576_0246022_984_1412 142
1101 3300045051 Ga0451576_2051296 Ga0451576_2051296_118_549 142
1102 3300045976 Ga0466967_0071278 Ga0466967_0071278_1614_2054 142
1103 3300045976 Ga0466967_0271155 Ga0466967_0271155_260_688 142
1104 3300046455 Ga0495603_0628094 Ga0495603_0628094_176_604 142
1105 3300046457 Ga0495590_0169828 Ga0495590_0169828_86_514 142
1106 3300046459 Ga0495629_0039205 Ga0495629_0039205_86_514 142
1107 3300046459 Ga0495629_0403671 Ga0495629_0403671_142_570 142
1108 3300046462 Ga0495651_0263820 Ga0495651_0263820_655_1083 142
1109 3300046463 Ga0495653_0359635 Ga0495653_0359635_469_897 142
1110 3300046463 Ga0495653_0459359 Ga0495653_0459359_337_765 142
1111 3300046472 Ga0495580_0000055 Ga0495580_0000055_27747_28175 142
1112 3300046472 Ga0495580_0001081 Ga0495580_0001081_14798_15226 142
1113 3300046472 Ga0495580_0107798 Ga0495580_0107798_124_552 142
1114 3300046473 Ga0495582_0006528 Ga0495582_0006528_4918_5346 142
1115 3300046477 Ga0495664_0102600 Ga0495664_0102600_906_1334 142
1116 3300046511 Ga0495608_0073411 Ga0495608_0073411_1223_1651 142
1117 3300046516 Ga0495628_0270629 Ga0495628_0270629_315_743 142
1118 3300046517 Ga0495630_0127681 Ga0495630_0127681_880_1308 142
1119 3300046517 Ga0495630_0377752 Ga0495630_0377752_623_1051 142
1120 3300046517 Ga0495630_0936963 Ga0495630_0936963_25_453 142
1121 3300046526 Ga0495666_0124177 Ga0495666_0124177_517_945 142
1122 3300046531 Ga0495665_0054442 Ga0495665_0054442_221_649 142
1123 3300046531 Ga0495665_0454230 Ga0495665_0454230_77_505 142
1124 3300046533 Ga0495640_0339916 Ga0495640_0339916_428_856 142
1125 3300046543 Ga0495645_0153618 Ga0495645_0153618_270_698 142
1126 3300046559 Ga0495667_0674849 Ga0495667_0674849_188_616 142
1127 3300046663 Ga0495635_0139894 Ga0495635_0139894_637_1065 142
1128 3300046674 Ga0495588_0770309 Ga0495588_0770309_23_451 142
1129 3300046678 Ga0495599_0191185 Ga0495599_0191185_443_871 142
1130 3300046679 Ga0495623_0135832 Ga0495623_0135832_596_1024 142
1131 3300046681 Ga0495647_0037481 Ga0495647_0037481_741_1169 142
1132 3300046683 Ga0495658_0034973 Ga0495658_0034973_2042_2470 142
1133 3300046689 Ga0495613_0108597 Ga0495613_0108597_1433_1861 142
1134 3300046809 Ga0495600_0611916 Ga0495600_0611916_88_516 142
1135 3300047319 Ga0495674_0030511 Ga0495674_0030511_3498_3926 142
1136 3300047319 Ga0495674_0037940 Ga0495674_0037940_3820_4248 142
1137 3300047319 Ga0495674_0079862 Ga0495674_0079862_1913_2341 142
1138 3300047319 Ga0495674_0250616 Ga0495674_0250616_132_560 142
1139 3300047322 Ga0495680_0202856 Ga0495680_0202856_588_1016 142
1140 3300047471 Ga0495684_0220202 Ga0495684_0220202_927_1355 142
1141 3300047471 Ga0495684_0245912 Ga0495684_0245912_772_1200 142
1142 3300047673 Ga0495593_0219083 Ga0495593_0219083_160_588 142
1143 3300047673 Ga0495593_0375772 Ga0495593_0375772_13_441 142
1144 3300048088 Ga0495602_0303439 Ga0495602_0303439_390_818 142
1145 3300048088 Ga0495602_0541428 Ga0495602_0541428_147_575 142
1146 3300048903 Ga0496100_0003993 Ga0496100_0003993_5298_5726 142
1147 3300048903 Ga0496100_0094577 Ga0496100_0094577_1287_1715 142
1148 3300048904 Ga0496101_0029509 Ga0496101_0029509_1848_2276 142
1149 3300048904 Ga0496101_0153595 Ga0496101_0153595_132_560 142
1150 3300048905 Ga0496102_0026165 Ga0496102_0026165_287_715 142
1151 3300048905 Ga0496102_0028121 Ga0496102_0028121_2860_3288 142
1152 3300048905 Ga0496102_0048015 Ga0496102_0048015_137_565 142
1153 3300048906 Ga0496103_0085280 Ga0496103_0085280_1238_1666 142
1154 3300048907 Ga0496104_0043090 Ga0496104_0043090_736_1164 142
1155 3300048907 Ga0496104_0115870 Ga0496104_0115870_490_918 142
1156 3300048907 Ga0496104_0420567 Ga0496104_0420567_388_816 142
1157 3300048908 Ga0496105_0103952 Ga0496105_0103952_1246_1674 142
1158 3300048908 Ga0496105_0105691 Ga0496105_0105691_13_441 142
1159 3300048908 Ga0496105_0113235 Ga0496105_0113235_223_651 142
1160 3300048909 Ga0496106_0119205 Ga0496106_0119205_1197_1625 142
1161 3300048910 Ga0496107_0322343 Ga0496107_0322343_46_474 142
1162 3300048911 Ga0496108_0088137 Ga0496108_0088137_1347_1775 142
1163 3300048911 Ga0496108_0335517 Ga0496108_0335517_633_1061 142
1164 3300048912 Ga0496109_0021961 Ga0496109_0021961_3657_4085 142
1165 3300048913 Ga0496110_0011347 Ga0496110_0011347_5490_5918 142
1166 3300048913 Ga0496110_0520200 Ga0496110_0520200_333_761 142
1167 3300048914 Ga0496111_0056434 Ga0496111_0056434_1963_2391 142
1168 3300048915 Ga0496112_0027057 Ga0496112_0027057_2662_3090 142
1169 3300048915 Ga0496112_0065583 Ga0496112_0065583_1663_2091 142
1170 3300048915 Ga0496112_1352692 Ga0496112_1352692_180_608 142
1171 3300048916 Ga0496113_0014960 Ga0496113_0014960_3271_3699 142
1172 3300048917 Ga0496114_0004511 Ga0496114_0004511_628_1056 142
1173 3300048918 Ga0496115_0001265 Ga0496115_0001265_2182_2610 142
1174 3300048918 Ga0496115_0004512 Ga0496115_0004512_2891_3319 142
1175 3300049779 Ga0501283_024569 Ga0501283_024569_425_874 142
1176 3300050512 nmdc:mga0n895_1440242_c1 nmdc:mga0n895_1440242_c1_80_508 142
1177 3300050513 nmdc:mga0rr50_25863_c1 nmdc:mga0rr50_25863_c1_2265_2693 142
1178 3300050514 nmdc:mga08x19_41460_c1 nmdc:mga08x19_41460_c1_2083_2511 142
1179 3300053077 Ga0495601_0023552 Ga0495601_0023552_2113_2541 142
1180 3300053084 Ga0495595_0307258 Ga0495595_0307258_76_504 142
1181 3300053085 Ga0495619_0036897 Ga0495619_0036897_1289_1717 142
1182 3300053085 Ga0495619_0433415 Ga0495619_0433415_408_836 142
1183 3300059490 Ga0587066_053853 Ga0587066_053853_273_701 142
1184 3300059492 Ga0587073_0255653 Ga0587073_0255653_17_445 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

37

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8938 60 131
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8718 60 131
3rqs-assembly1.cif.gz_B crystal structure of human l-3- hydroxyacyl-coa dehydrogenase (ec1.1.1.35) from mitochondria at the resolution 2.0 a, northeast structural genomics consortium target hr487, mitochondrial protein partnership 0.8415 99 132
1f0y-assembly1.cif.gz_B l-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and nad+ 0.8278 99 134
1vdm-assembly1.cif.gz_F crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8166 94 132
ID Description Score Start End Superfamily
af_P77399_309_494_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8652 99 132 3.40.50.720
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8509 99 133 3.40.50.720
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.789 81 133 3.40.50.2300
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7779 62 129 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7644 94 132 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3M3A539-F1-model_v4 TonB system transport protein ExbD2 0.9026 57 133 GO:0005886
GO:0015031
GO:0022857
AF-A0A349UJD8-F1-model_v4 Uncharacterized protein 0.8851 61 137
AF-A0A3D2ZB14-F1-model_v4 Biopolymer transporter ExbD 0.8751 64 137 GO:0005886
GO:0015031
GO:0022857
AF-A0A3M3A539-F1-model_v4 TonB system transport protein ExbD2 0.8712 57 133 GO:0005886
GO:0015031
GO:0022857
AF-A0A529FAN7-F1-model_v4 Biopolymer transporter ExbD 0.8587 56 138 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
75.56 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map