F491331

General Info

Members Datasets Scaffolds Average Seq Length
1183 347 2366 110

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100478991|Ga0075435_1004789911
Length 125
Sequence MSRARLFVSHLASLKHAVEKLDIPQGTLDLMILTILSREPMHGYGVSQRLAALSRGEFQVNPGSLFPSLYRLEQDGKLKAEWRPTENNRRAKYYRLTAAGKRQLGQHRERWNRATFAVTCVLEGA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
239 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
344 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 3.8
Rhizosphere 94.84
Stem 0
Stem Tuber 0
Unclassified 25.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100478991 3300007076 Unclassified 1075
2 JGI24750J21931_1090479 3300002070 Unclassified 518
3 Ga0065714_10193873 3300005288 Bacteria 918
4 Ga0065712_10000935 3300005290 Bacteria 7377
5 Ga0065712_10001231 3300005290 Bacteria 9475
6 Ga0065712_10068943 3300005290 Bacteria 8504
7 Ga0065712_10200713 3300005290 Unclassified 1105
8 Ga0065715_10010891 3300005293 Unclassified 3609
9 Ga0065715_10056914 3300005293 Unclassified 884
10 Ga0065715_10089526 3300005293 Bacteria 9704
11 Ga0065715_10108236 3300005293 Bacteria 2727
12 Ga0065715_10109433 3300005293 Bacteria 2669
13 Ga0065715_10314974 3300005293 Bacteria 1011
14 Ga0065715_10343169 3300005293 Bacteria 963
15 Ga0065715_10388102 3300005293 Bacteria 898
16 Ga0065715_10579522 3300005293 Bacteria 721
17 Ga0065715_10680731 3300005293 Unclassified 663
18 Ga0065715_11182389 3300005293 Unclassified 502
19 Ga0065707_10008908 3300005295 Bacteria 2253
20 Ga0065707_10107203 3300005295 Bacteria 2548
21 Ga0065707_10183430 3300005295 Bacteria 1404
22 Ga0070676_10008513 3300005328 Bacteria 5530
23 Ga0070676_10109125 3300005328 Bacteria 1721
24 Ga0070676_10189584 3300005328 Bacteria 1342
25 Ga0070676_10442872 3300005328 Bacteria 912
26 Ga0070683_100030196 3300005329 Bacteria 4915
27 Ga0070683_100169473 3300005329 Bacteria 2072
28 Ga0070683_100414790 3300005329 Bacteria 1284
29 Ga0070690_100048824 3300005330 Bacteria 2697
30 Ga0070690_100116120 3300005330 Bacteria 1791
31 Ga0070690_100529058 3300005330 Bacteria 886
32 Ga0070690_100550431 3300005330 Bacteria 870
33 Ga0070670_100001419 3300005331 Bacteria 19255
34 Ga0070670_100126254 3300005331 Bacteria 2208
35 Ga0070670_100131328 3300005331 Bacteria 2163
36 Ga0070670_100544343 3300005331 Bacteria 1035
37 Ga0070670_101096269 3300005331 Bacteria 726
38 Ga0070670_101942263 3300005331 Bacteria 542
39 Ga0070670_102267242 3300005331 Unclassified 500
40 Ga0068869_100026041 3300005334 Bacteria 4067
41 Ga0068869_100039868 3300005334 Bacteria 3355
42 Ga0068869_100555073 3300005334 Bacteria 965
43 Ga0070666_10028299 3300005335 Bacteria 3677
44 Ga0070666_10043616 3300005335 Bacteria 3003
45 Ga0070666_10060203 3300005335 Bacteria 2569
46 Ga0070666_10102250 3300005335 Bacteria 1976
47 Ga0070666_10374180 3300005335 Unclassified 1022
48 Ga0070666_10768553 3300005335 Unclassified 709
49 Ga0070666_11376978 3300005335 Bacteria 527
50 Ga0070680_100113080 3300005336 Unclassified 2261
51 Ga0068868_100022575 3300005338 Bacteria 4751
52 Ga0068868_100034488 3300005338 Bacteria 3907
53 Ga0068868_100102825 3300005338 Bacteria 2314
54 Ga0068868_100272951 3300005338 Bacteria 1429
55 Ga0068868_100704187 3300005338 Bacteria 904
56 Ga0070660_100153107 3300005339 Bacteria 1855
57 Ga0070660_100283841 3300005339 Bacteria 1355
58 Ga0070660_101620724 3300005339 Unclassified 551
59 Ga0070689_100085022 3300005340 Bacteria 2487
60 Ga0070689_100108501 3300005340 Unclassified 2205
61 Ga0070689_100431384 3300005340 Bacteria 1118
62 Ga0070689_100676516 3300005340 Bacteria 899
63 Ga0070689_100946073 3300005340 Bacteria 764
64 Ga0070691_10046119 3300005341 Bacteria 2069
65 Ga0070687_100032680 3300005343 Bacteria 2562
66 Ga0070687_100129595 3300005343 Bacteria 1455
67 Ga0070687_100273273 3300005343 Bacteria 1060
68 Ga0070687_100288383 3300005343 Bacteria 1036
69 Ga0070687_100328085 3300005343 Unclassified 980
70 Ga0070687_100533917 3300005343 Bacteria 795
71 Ga0070687_100907276 3300005343 Bacteria 632
72 Ga0070661_100001979 3300005344 Bacteria 14166
73 Ga0070661_100043124 3300005344 Bacteria 3295
74 Ga0070661_100514044 3300005344 Bacteria 960
75 Ga0070661_101710539 3300005344 Unclassified 533
76 Ga0070668_100287801 3300005347 Bacteria 1374
77 Ga0070669_100005873 3300005353 Bacteria 8853
78 Ga0070669_100011200 3300005353 Bacteria 6364
79 Ga0070669_100037906 3300005353 Bacteria 3498
80 Ga0070669_100137783 3300005353 Bacteria 1878
81 Ga0070669_101572131 3300005353 Bacteria 572
82 Ga0070675_100004236 3300005354 Bacteria 10910
83 Ga0070675_100012385 3300005354 Bacteria 6683
84 Ga0070675_100035008 3300005354 Unclassified 4078
85 Ga0070675_100083308 3300005354 Bacteria 2669
86 Ga0070675_100144448 3300005354 Bacteria 2036
87 Ga0070675_100146007 3300005354 Bacteria 2025
88 Ga0070675_100181366 3300005354 Bacteria 1821
89 Ga0070675_100235250 3300005354 Bacteria 1599
90 Ga0070671_100015492 3300005355 Bacteria 6159
91 Ga0070671_100216321 3300005355 Unclassified 1625
92 Ga0070671_100275915 3300005355 Bacteria 1429
93 Ga0070674_100235200 3300005356 Bacteria 1432
94 Ga0070674_100243341 3300005356 Bacteria 1410
95 Ga0070674_100523597 3300005356 Bacteria 991
96 Ga0070673_100007331 3300005364 Bacteria 7263
97 Ga0070673_100009117 3300005364 Bacteria 6645
98 Ga0070673_100022360 3300005364 Bacteria 4601
99 Ga0070673_100213523 3300005364 Bacteria 1667
100 Ga0070673_101394566 3300005364 Unclassified 659
101 Ga0070688_100002772 3300005365 Bacteria 8901
102 Ga0070688_100023721 3300005365 Bacteria 3612
103 Ga0070688_100109269 3300005365 Bacteria 1836
104 Ga0070688_100274762 3300005365 Bacteria 1208
105 Ga0070688_100426362 3300005365 Unclassified 987
106 Ga0070688_101127029 3300005365 Unclassified 628
107 Ga0070659_100010473 3300005366 Bacteria 6822
108 Ga0070659_100045614 3300005366 Bacteria 3434
109 Ga0070659_100078409 3300005366 Bacteria 2635
110 Ga0070659_100516125 3300005366 Bacteria 1020
111 Ga0070667_100042111 3300005367 Bacteria 3831
112 Ga0070667_100193065 3300005367 Bacteria 1804
113 Ga0070667_100238535 3300005367 Unclassified 1623
114 Ga0070667_100772549 3300005367 Bacteria 891
115 Ga0070703_10056834 3300005406 Unclassified 1268
116 Ga0070713_100025941 3300005436 Bacteria 4592
117 Ga0070713_100477319 3300005436 Unclassified 1174
118 Ga0070713_100509910 3300005436 Unclassified 1136
119 Ga0070701_10467583 3300005438 Bacteria 812
120 Ga0070701_10566164 3300005438 Bacteria 748
121 Ga0070701_10804854 3300005438 Unclassified 641
122 Ga0070711_100048604 3300005439 Bacteria 2902
123 Ga0070711_100254295 3300005439 Bacteria 1379
124 Ga0070705_100455082 3300005440 Unclassified 961
125 Ga0070705_100977503 3300005440 Bacteria 686
126 Ga0070700_100014828 3300005441 Bacteria 4404
127 Ga0070700_101220790 3300005441 Bacteria 629
128 Ga0070700_101384155 3300005441 Bacteria 594
129 Ga0070700_101710956 3300005441 Bacteria 540
130 Ga0070694_100112429 3300005444 Bacteria 1942
131 Ga0070694_101348034 3300005444 Bacteria 601
132 Ga0070694_101873119 3300005444 Unclassified 512
133 Ga0070708_100049646 3300005445 Unclassified 3713
134 Ga0070708_100823010 3300005445 Unclassified 873
135 Ga0070708_101462738 3300005445 Bacteria 637
136 Ga0070708_101524362 3300005445 Bacteria 623
137 Ga0070663_100159683 3300005455 Bacteria 1734
138 Ga0070678_100393193 3300005456 Bacteria 1203
139 Ga0070678_100594142 3300005456 Bacteria 987
140 Ga0070662_100003381 3300005457 Bacteria 9944
141 Ga0070662_100090893 3300005457 Bacteria 2292
142 Ga0070662_100104986 3300005457 Bacteria 2144
143 Ga0070662_100131141 3300005457 Bacteria 1933
144 Ga0070662_100241903 3300005457 Unclassified 1448
145 Ga0070681_10000788 3300005458 Bacteria 26423
146 Ga0068867_100025345 3300005459 Bacteria 4255
147 Ga0068867_100061007 3300005459 Bacteria 2799
148 Ga0068867_100066091 3300005459 Bacteria 2693
149 Ga0068867_100967905 3300005459 Bacteria 770
150 Ga0068867_101334095 3300005459 Bacteria 663
151 Ga0070685_10010131 3300005466 Bacteria 4892
152 Ga0070685_10021408 3300005466 Bacteria 3514
153 Ga0070685_10284798 3300005466 Unclassified 1108
154 Ga0070685_10400192 3300005466 Unclassified 951
155 Ga0070685_10466745 3300005466 Bacteria 887
156 Ga0070685_11051556 3300005466 Unclassified 613
157 Ga0070685_11571265 3300005466 Unclassified 508
158 Ga0070706_100521948 3300005467 Bacteria 1105
159 Ga0070706_101216176 3300005467 Bacteria 692
160 Ga0070706_101302922 3300005467 Bacteria 666
161 Ga0070707_100181644 3300005468 Bacteria 2051
162 Ga0070707_100940618 3300005468 Unclassified 829
163 Ga0070707_101941771 3300005468 Unclassified 556
164 Ga0070707_102195250 3300005468 Unclassified 520
165 Ga0070707_102335842 3300005468 Unclassified 502
166 Ga0070698_100243260 3300005471 Bacteria 1732
167 Ga0070698_100312400 3300005471 Bacteria 1502
168 Ga0070698_101094350 3300005471 Unclassified 745
169 Ga0070699_100417840 3300005518 Bacteria 1214
170 Ga0070699_100570315 3300005518 Bacteria 1031
171 Ga0070699_100661405 3300005518 Unclassified 954
172 Ga0070699_100720041 3300005518 Bacteria 912
173 Ga0070699_100770645 3300005518 Bacteria 880
174 Ga0070699_100794985 3300005518 Bacteria 866
175 Ga0070699_102157706 3300005518 Unclassified 508
176 Ga0070679_100021152 3300005530 Bacteria 6347
177 Ga0070679_100302428 3300005530 Bacteria 1550
178 Ga0070684_100073311 3300005535 Bacteria 3016
179 Ga0070684_100399387 3300005535 Bacteria 1267
180 Ga0070684_100501043 3300005535 Bacteria 1125
181 Ga0070697_100229082 3300005536 Bacteria 1585
182 Ga0070697_100744080 3300005536 Bacteria 866
183 Ga0070697_101836712 3300005536 Bacteria 542
184 Ga0068853_101299937 3300005539 Unclassified 703
185 Ga0068853_102078879 3300005539 Unclassified 551
186 Ga0070672_100025374 3300005543 Bacteria 4394
187 Ga0070672_100101475 3300005543 Bacteria 2334
188 Ga0070672_100135853 3300005543 Bacteria 2025
189 Ga0070672_100256489 3300005543 Bacteria 1474
190 Ga0070672_100313377 3300005543 Bacteria 1332
191 Ga0070672_101043745 3300005543 Bacteria 725
192 Ga0070686_100078712 3300005544 Bacteria 2177
193 Ga0070686_100119246 3300005544 Bacteria 1809
194 Ga0070686_100204361 3300005544 Bacteria 1418
195 Ga0070686_100435924 3300005544 Bacteria 1004
196 Ga0070686_101630847 3300005544 Bacteria 546
197 Ga0070695_100025027 3300005545 Bacteria 3682
198 Ga0070695_100141073 3300005545 Bacteria 1671
199 Ga0070695_100267546 3300005545 Unclassified 1251
200 Ga0070695_100314938 3300005545 Bacteria 1161
201 Ga0070695_100664136 3300005545 Unclassified 824
202 Ga0070695_100714868 3300005545 Bacteria 796
203 Ga0070696_100432211 3300005546 Bacteria 1036
204 Ga0070696_100576183 3300005546 Unclassified 905
205 Ga0070696_100817753 3300005546 Unclassified 768
206 Ga0070696_101036229 3300005546 Bacteria 687
207 Ga0070693_100135388 3300005547 Bacteria 1545
208 Ga0070693_100654583 3300005547 Unclassified 764
209 Ga0070693_101146694 3300005547 Bacteria 595
210 Ga0070665_100005959 3300005548 Bacteria 12477
211 Ga0070665_100055011 3300005548 Bacteria 3991
212 Ga0070665_100109361 3300005548 Bacteria 2767
213 Ga0070665_100306301 3300005548 Bacteria 1592
214 Ga0070665_100724229 3300005548 Unclassified 1008
215 Ga0070665_101147518 3300005548 Bacteria 788
216 Ga0070665_101235020 3300005548 Bacteria 758
217 Ga0070704_100205496 3300005549 Bacteria 1592
218 Ga0070704_100353279 3300005549 Bacteria 1241
219 Ga0070704_100493138 3300005549 Bacteria 1062
220 Ga0070704_101514981 3300005549 Unclassified 617
221 Ga0070704_101991337 3300005549 Bacteria 539
222 Ga0070704_102248427 3300005549 Unclassified 507
223 Ga0068855_100639149 3300005563 Bacteria 1144
224 Ga0068855_102599096 3300005563 Bacteria 502
225 Ga0070664_100002932 3300005564 Bacteria 13805
226 Ga0070664_100004735 3300005564 Bacteria 10910
227 Ga0070664_100037437 3300005564 Bacteria 4080
228 Ga0070664_100251631 3300005564 Bacteria 1588
229 Ga0070664_101794086 3300005564 Unclassified 582
230 Ga0070664_102372262 3300005564 Unclassified 503
231 Ga0068857_100004424 3300005577 Bacteria 11884
232 Ga0068857_100010325 3300005577 Bacteria 8112
233 Ga0068857_100053500 3300005577 Bacteria 3581
234 Ga0068854_100136135 3300005578 Bacteria 1880
235 Ga0068854_100272717 3300005578 Bacteria 1359
236 Ga0068854_100811859 3300005578 Bacteria 816
237 Ga0068856_100191428 3300005614 Bacteria 2059
238 Ga0068856_100254276 3300005614 Bacteria 1772
239 Ga0068856_101933509 3300005614 Bacteria 601
240 Ga0070702_100943207 3300005615 Bacteria 679
241 Ga0070702_101449788 3300005615 Unclassified 563
242 Ga0068852_100106365 3300005616 Bacteria 2543
243 Ga0068852_100388382 3300005616 Bacteria 1370
244 Ga0068852_101653835 3300005616 Bacteria 663
245 Ga0068852_102222081 3300005616 Bacteria 570
246 Ga0068859_100065348 3300005617 Bacteria 3672
247 Ga0068859_100171763 3300005617 Unclassified 2249
248 Ga0068859_100248056 3300005617 Unclassified 1870
249 Ga0068859_100440308 3300005617 Bacteria 1399
250 Ga0068859_101450293 3300005617 Unclassified 757
251 Ga0068864_100004841 3300005618 Bacteria 11031
252 Ga0068864_100011363 3300005618 Bacteria 7359
253 Ga0068864_100059802 3300005618 Bacteria 3298
254 Ga0068864_100145914 3300005618 Unclassified 2139
255 Ga0068864_100264657 3300005618 Bacteria 1600
256 Ga0068864_100486180 3300005618 Bacteria 1186
257 Ga0068864_101104984 3300005618 Unclassified 789
258 Ga0068864_102655648 3300005618 Unclassified 507
259 Ga0068866_10050479 3300005718 Bacteria 2113
260 Ga0068866_10053689 3300005718 Bacteria 2061
261 Ga0068866_10142639 3300005718 Bacteria 1377
262 Ga0068866_10248082 3300005718 Unclassified 1088
263 Ga0068861_100020232 3300005719 Bacteria 4762
264 Ga0068861_100040848 3300005719 Bacteria 3471
265 Ga0068861_100087927 3300005719 Bacteria 2446
266 Ga0068861_100564047 3300005719 Bacteria 1040
267 Ga0068861_101892566 3300005719 Unclassified 593
268 Ga0068851_10014755 3300005834 Bacteria 3714
269 Ga0068851_10312773 3300005834 Bacteria 905
270 Ga0068851_10314547 3300005834 Unclassified 903
271 Ga0068870_10004204 3300005840 Bacteria 6184
272 Ga0068870_10377886 3300005840 Bacteria 916
273 Ga0068870_10421536 3300005840 Bacteria 873
274 Ga0068870_10467081 3300005840 Bacteria 835
275 Ga0068863_100046982 3300005841 Bacteria 4097
276 Ga0068863_100057829 3300005841 Bacteria 3670
277 Ga0068863_101392267 3300005841 Unclassified 709
278 Ga0068858_100002440 3300005842 Bacteria 18793
279 Ga0068858_100013640 3300005842 Bacteria 7669
280 Ga0068858_100046062 3300005842 Bacteria 4043
281 Ga0068858_100511683 3300005842 Bacteria 1160
282 Ga0068858_101334766 3300005842 Bacteria 706
283 Ga0068858_102235223 3300005842 Bacteria 541
284 Ga0068860_100019119 3300005843 Bacteria 6652
285 Ga0068860_100100552 3300005843 Bacteria 2759
286 Ga0068860_100157205 3300005843 Unclassified 2191
287 Ga0068860_100236804 3300005843 Bacteria 1775
288 Ga0068860_100342532 3300005843 Bacteria 1470
289 Ga0068860_100932473 3300005843 Bacteria 885
290 Ga0068860_101146423 3300005843 Unclassified 797
291 Ga0068862_100015871 3300005844 Bacteria 6259
292 Ga0068862_100097395 3300005844 Bacteria 2568
293 Ga0068862_100186590 3300005844 Bacteria 1864
294 Ga0068862_100333450 3300005844 Unclassified 1403
295 Ga0068862_100726649 3300005844 Unclassified 964
296 Ga0081455_10891608 3300005937 Bacteria 554
297 Ga0081455_10898620 3300005937 Bacteria 551
298 Ga0081539_10208930 3300005985 Bacteria 896
299 Ga0070717_10651608 3300006028 Bacteria 956
300 Ga0070717_10862245 3300006028 Unclassified 824
301 Ga0070717_11458300 3300006028 Bacteria 621
302 Ga0075365_10000208 3300006038 Bacteria 19673
303 Ga0075368_10035449 3300006042 Bacteria 1947
304 Ga0075364_10053576 3300006051 Unclassified 2637
305 Ga0070715_10649814 3300006163 Unclassified 624
306 Ga0070715_10906058 3300006163 Unclassified 543
307 Ga0070716_100310444 3300006173 Bacteria 1101
308 Ga0070712_100031332 3300006175 Bacteria 3582
309 Ga0075367_10096135 3300006178 Bacteria 1807
310 Ga0075367_10576861 3300006178 Bacteria 715
311 Ga0075366_10017717 3300006195 Bacteria 4104
312 Ga0097621_100269792 3300006237 Unclassified 1495
313 Ga0097621_101182647 3300006237 Bacteria 720
314 Ga0068871_100108515 3300006358 Unclassified 2333
315 Ga0068871_101108226 3300006358 Bacteria 740
316 Ga0075428_100014900 3300006844 Bacteria 8638
317 Ga0075428_100065604 3300006844 Unclassified 3976
318 Ga0075428_100116554 3300006844 Unclassified 2909
319 Ga0075428_100129681 3300006844 Bacteria 2743
320 Ga0075428_100541347 3300006844 Bacteria 1245
321 Ga0075428_100660315 3300006844 Unclassified 1115
322 Ga0075428_101147755 3300006844 Unclassified 820
323 Ga0075430_100004139 3300006846 Bacteria 12245
324 Ga0075430_100078842 3300006846 Unclassified 2761
325 Ga0075430_100102056 3300006846 Unclassified 2395
326 Ga0075430_100328055 3300006846 Bacteria 1265
327 Ga0075431_100020296 3300006847 Bacteria 6787
328 Ga0075431_100064022 3300006847 Bacteria 3796
329 Ga0075431_100084539 3300006847 Bacteria 3276
330 Ga0075431_100088707 3300006847 Bacteria 3192
331 Ga0075431_100130102 3300006847 Unclassified 2597
332 Ga0075431_100156407 3300006847 Bacteria 2345
333 Ga0075431_100275318 3300006847 Unclassified 1705
334 Ga0075431_100436154 3300006847 Bacteria 1307
335 Ga0075431_100720735 3300006847 Bacteria 974
336 Ga0075431_101168545 3300006847 Bacteria 733
337 Ga0075433_10000568 3300006852 Bacteria 24386
338 Ga0075433_10007894 3300006852 Bacteria 8463
339 Ga0075433_10009380 3300006852 Bacteria 7820
340 Ga0075433_10010728 3300006852 Bacteria 7369
341 Ga0075433_10058184 3300006852 Unclassified 3380
342 Ga0075433_10064339 3300006852 Bacteria 3215
343 Ga0075433_10084756 3300006852 Bacteria 2797
344 Ga0075433_10125392 3300006852 Bacteria 2280
345 Ga0075433_10413617 3300006852 Bacteria 1189
346 Ga0075433_10475448 3300006852 Bacteria 1101
347 Ga0075433_10960273 3300006852 Unclassified 745
348 Ga0075433_11141483 3300006852 Bacteria 677
349 Ga0075433_11469623 3300006852 Bacteria 589
350 Ga0075433_11790306 3300006852 Unclassified 528
351 Ga0075434_100000258 3300006871 Bacteria 37512
352 Ga0075434_100002170 3300006871 Bacteria 17107
353 Ga0075434_100004349 3300006871 Bacteria 12749
354 Ga0075434_100008903 3300006871 Bacteria 9344
355 Ga0075434_100016301 3300006871 Bacteria 7142
356 Ga0075434_100026885 3300006871 Bacteria 5644
357 Ga0075434_100052491 3300006871 Bacteria 4051
358 Ga0075434_100055078 3300006871 Bacteria 3952
359 Ga0075434_100089733 3300006871 Bacteria 3075
360 Ga0075434_100143453 3300006871 Bacteria 2408
361 Ga0075434_100156881 3300006871 Bacteria 2295
362 Ga0075434_100312368 3300006871 Unclassified 1592
363 Ga0075434_100340319 3300006871 Bacteria 1521
364 Ga0075434_100483640 3300006871 Bacteria 1259
365 Ga0075434_100508538 3300006871 Bacteria 1225
366 Ga0075434_100562097 3300006871 Bacteria 1160
367 Ga0075434_100822822 3300006871 Bacteria 944
368 Ga0075434_101035478 3300006871 Unclassified 834
369 Ga0075434_101051610 3300006871 Bacteria 828
370 Ga0075434_101066936 3300006871 Bacteria 821
371 Ga0075434_101117115 3300006871 Bacteria 801
372 Ga0075434_101166159 3300006871 Bacteria 783
373 Ga0075434_101661773 3300006871 Bacteria 647
374 Ga0075434_101812851 3300006871 Unclassified 617
375 Ga0075434_102350197 3300006871 Unclassified 536
376 Ga0075429_100012498 3300006880 Bacteria 7363
377 Ga0075429_100052732 3300006880 Bacteria 3539
378 Ga0075429_100173191 3300006880 Bacteria 1891
379 Ga0075429_100230573 3300006880 Bacteria 1622
380 Ga0075429_100238200 3300006880 Bacteria 1594
381 Ga0075429_100442712 3300006880 Unclassified 1139
382 Ga0068865_100004117 3300006881 Bacteria 8744
383 Ga0068865_100244252 3300006881 Bacteria 1414
384 Ga0068865_100335122 3300006881 Unclassified 1221
385 Ga0075436_100000349 3300006914 Bacteria 29469
386 Ga0075436_100001199 3300006914 Bacteria 17620
387 Ga0075436_100005515 3300006914 Bacteria 8697
388 Ga0075436_100012989 3300006914 Bacteria 5710
389 Ga0075436_100028164 3300006914 Unclassified 3865
390 Ga0075436_100056841 3300006914 Bacteria 2702
391 Ga0075436_100168579 3300006914 Bacteria 1546
392 Ga0075436_100256113 3300006914 Bacteria 1247
393 Ga0075436_100493607 3300006914 Bacteria 895
394 Ga0075436_100615116 3300006914 Unclassified 801
395 Ga0075436_100653009 3300006914 Unclassified 777
396 Ga0075436_100753089 3300006914 Unclassified 723
397 Ga0075436_100850945 3300006914 Unclassified 681
398 Ga0075436_101048933 3300006914 Unclassified 613
399 Ga0075436_101109017 3300006914 Unclassified 596
400 Ga0097620_100065351 3300006931 Bacteria 3672
401 Ga0097620_100171756 3300006931 Unclassified 2249
402 Ga0097620_100248087 3300006931 Unclassified 1870
403 Ga0097620_100440309 3300006931 Bacteria 1399
404 Ga0097620_101450521 3300006931 Unclassified 757
405 Ga0075435_100000011 3300007076 Bacteria 110108
406 Ga0075435_100000043 3300007076 Bacteria 64194
407 Ga0075435_100026322 3300007076 Unclassified 4536
408 Ga0075435_100044659 3300007076 Bacteria 3550
409 Ga0075435_100063114 3300007076 Unclassified 3008
410 Ga0075435_100079728 3300007076 Bacteria 2687
411 Ga0075435_100106747 3300007076 Bacteria 2325
412 Ga0075435_100121814 3300007076 Bacteria 2177
413 Ga0075435_100169727 3300007076 Bacteria 1840
414 Ga0075435_100220108 3300007076 Bacteria 1612
415 Ga0075435_100256965 3300007076 Bacteria 1488
416 Ga0075435_100571526 3300007076 Bacteria 980
417 Ga0075435_100704502 3300007076 Unclassified 878
418 Ga0075435_100736636 3300007076 Bacteria 857
419 Ga0075435_100743426 3300007076 Bacteria 853
420 Ga0075435_100893427 3300007076 Bacteria 775
421 Ga0075435_101078730 3300007076 Unclassified 702
422 Ga0099794_10023052 3300007265 Unclassified 2843
423 Ga0099794_10381891 3300007265 Unclassified 735
424 Ga0105251_10128471 3300009011 Bacteria 1149
425 Ga0105240_10291861 3300009093 Unclassified 1869
426 Ga0105240_11399346 3300009093 Unclassified 735
427 Ga0105240_11530717 3300009093 Unclassified 699
428 Ga0111539_10004303 3300009094 Bacteria 18623
429 Ga0111539_10009745 3300009094 Bacteria 12124
430 Ga0111539_10011849 3300009094 Bacteria 10932
431 Ga0111539_10103761 3300009094 Unclassified 3336
432 Ga0111539_10117688 3300009094 Bacteria 3114
433 Ga0111539_10127782 3300009094 Bacteria 2977
434 Ga0111539_10248630 3300009094 Bacteria 2071
435 Ga0111539_10338936 3300009094 Bacteria 1750
436 Ga0111539_11680464 3300009094 Bacteria 736
437 Ga0111539_12070864 3300009094 Bacteria 660
438 Ga0111539_13276152 3300009094 Unclassified 521
439 Ga0105245_10087079 3300009098 Bacteria 2866
440 Ga0105245_10366222 3300009098 Bacteria 1432
441 Ga0105245_10591988 3300009098 Bacteria 1135
442 Ga0105245_10613494 3300009098 Bacteria 1115
443 Ga0105245_10817312 3300009098 Bacteria 971
444 Ga0105245_12533057 3300009098 Bacteria 566
445 Ga0105245_13233490 3300009098 Unclassified 505
446 Ga0105247_10003326 3300009101 Bacteria 10531
447 Ga0105247_10277284 3300009101 Bacteria 1155
448 Ga0105247_10636732 3300009101 Unclassified 795
449 Ga0114129_10001250 3300009147 Bacteria 33869
450 Ga0114129_10006261 3300009147 Bacteria 16874
451 Ga0114129_10007356 3300009147 Bacteria 15676
452 Ga0114129_10019280 3300009147 Bacteria 9716
453 Ga0114129_10025511 3300009147 Bacteria 8375
454 Ga0114129_10040840 3300009147 Bacteria 6539
455 Ga0114129_10040926 3300009147 Bacteria 6530
456 Ga0114129_10041367 3300009147 Bacteria 6495
457 Ga0114129_10055181 3300009147 Bacteria 5569
458 Ga0114129_10055909 3300009147 Bacteria 5530
459 Ga0114129_10071756 3300009147 Unclassified 4828
460 Ga0114129_10077456 3300009147 Bacteria 4625
461 Ga0114129_10092106 3300009147 Bacteria 4199
462 Ga0114129_10106261 3300009147 Bacteria 3878
463 Ga0114129_10113648 3300009147 Unclassified 3734
464 Ga0114129_10114251 3300009147 Bacteria 3723
465 Ga0114129_10134519 3300009147 Bacteria 3393
466 Ga0114129_10158615 3300009147 Bacteria 3093
467 Ga0114129_10407285 3300009147 Bacteria 1791
468 Ga0114129_10501582 3300009147 Bacteria 1585
469 Ga0114129_10532938 3300009147 Bacteria 1530
470 Ga0114129_10638512 3300009147 Bacteria 1375
471 Ga0114129_10811593 3300009147 Bacteria 1193
472 Ga0114129_10843252 3300009147 Bacteria 1166
473 Ga0114129_10982722 3300009147 Bacteria 1064
474 Ga0114129_11315185 3300009147 Bacteria 895
475 Ga0114129_11512954 3300009147 Unclassified 824
476 Ga0114129_12965389 3300009147 Bacteria 559
477 Ga0105243_10116757 3300009148 Bacteria 2242
478 Ga0105243_10279933 3300009148 Unclassified 1502
479 Ga0105243_10366051 3300009148 Bacteria 1329
480 Ga0105243_11643485 3300009148 Bacteria 670
481 Ga0105243_12691418 3300009148 Unclassified 538
482 Ga0105241_10348236 3300009174 Unclassified 1285
483 Ga0105241_10402479 3300009174 Bacteria 1201
484 Ga0105241_11442412 3300009174 Bacteria 660
485 Ga0105241_11549534 3300009174 Unclassified 639
486 Ga0105241_12096326 3300009174 Bacteria 559
487 Ga0105242_10003641 3300009176 Bacteria 11998
488 Ga0105242_10014666 3300009176 Bacteria 6068
489 Ga0105242_10147208 3300009176 Bacteria 2050
490 Ga0105242_10496774 3300009176 Bacteria 1160
491 Ga0105242_10520770 3300009176 Bacteria 1134
492 Ga0105242_12102002 3300009176 Unclassified 608
493 Ga0105248_10010762 3300009177 Bacteria 10099
494 Ga0105248_10041108 3300009177 Bacteria 5183
495 Ga0105248_10045410 3300009177 Bacteria 4927
496 Ga0105248_10047141 3300009177 Bacteria 4832
497 Ga0105248_10075643 3300009177 Unclassified 3784
498 Ga0105248_10086630 3300009177 Bacteria 3524
499 Ga0105248_10370807 3300009177 Bacteria 1612
500 Ga0105248_10388111 3300009177 Bacteria 1572
501 Ga0105248_10493499 3300009177 Bacteria 1380
502 Ga0105248_11121371 3300009177 Bacteria 889
503 Ga0105248_12119035 3300009177 Bacteria 639
504 Ga0105248_12181319 3300009177 Unclassified 630
505 Ga0105248_12663953 3300009177 Unclassified 570
506 Ga0105237_10227357 3300009545 Bacteria 1866
507 Ga0105237_10292331 3300009545 Unclassified 1632
508 Ga0105238_10002117 3300009551 Bacteria 20055
509 Ga0105238_11370792 3300009551 Unclassified 734
510 Ga0105238_11805772 3300009551 Bacteria 643
511 Ga0105238_12632230 3300009551 Bacteria 539
512 Ga0105249_10015732 3300009553 Bacteria 6699
513 Ga0105249_10017950 3300009553 Bacteria 6288
514 Ga0105249_10024276 3300009553 Bacteria 5448
515 Ga0105249_10101913 3300009553 Bacteria 2701
516 Ga0105249_10215297 3300009553 Bacteria 1888
517 Ga0105249_10466839 3300009553 Bacteria 1303
518 Ga0105249_11079801 3300009553 Unclassified 872
519 Ga0105239_10008685 3300010375 Bacteria 11504
520 Ga0105239_10087990 3300010375 Bacteria 3424
521 Ga0105239_10211127 3300010375 Unclassified 2176
522 Ga0105239_10262710 3300010375 Bacteria 1940
523 Ga0105239_10427179 3300010375 Bacteria 1502
524 Ga0105239_10749821 3300010375 Bacteria 1117
525 Ga0105239_12456555 3300010375 Unclassified 607
526 Ga0105246_10226789 3300011119 Bacteria 1468
527 Ga0105246_10412320 3300011119 Bacteria 1125
528 Ga0105246_10438068 3300011119 Unclassified 1095
529 Ga0105246_10677839 3300011119 Bacteria 901
530 Ga0105246_11038056 3300011119 Bacteria 744
531 Ga0157373_11305220 3300013100 Unclassified 550
532 Ga0157371_10047821 3300013102 Bacteria 3041
533 Ga0157369_10308367 3300013105 Bacteria 1646
534 Ga0157374_10071551 3300013296 Bacteria 3270
535 Ga0157374_10532036 3300013296 Bacteria 1182
536 Ga0157374_10583258 3300013296 Bacteria 1127
537 Ga0157374_10592902 3300013296 Unclassified 1118
538 Ga0157374_10866442 3300013296 Bacteria 920
539 Ga0157378_10013179 3300013297 Bacteria 7233
540 Ga0157378_10433938 3300013297 Bacteria 1301
541 Ga0157378_10757188 3300013297 Bacteria 994
542 Ga0157378_10766085 3300013297 Bacteria 989
543 Ga0157378_10813773 3300013297 Unclassified 961
544 Ga0157378_11415942 3300013297 Unclassified 738
545 Ga0163162_10398556 3300013306 Bacteria 1509
546 Ga0163162_10526936 3300013306 Bacteria 1311
547 Ga0163162_10609406 3300013306 Bacteria 1217
548 Ga0163162_10930177 3300013306 Bacteria 981
549 Ga0163162_12468323 3300013306 Unclassified 598
550 Ga0157372_10034785 3300013307 Bacteria 5542
551 Ga0157372_10782469 3300013307 Unclassified 1109
552 Ga0157375_10013318 3300013308 Bacteria 7314
553 Ga0157375_10115020 3300013308 Bacteria 2793
554 Ga0157375_11327954 3300013308 Unclassified 846
555 Ga0157375_11929018 3300013308 Unclassified 701
556 Ga0157375_12384751 3300013308 Unclassified 631
557 Ga0157375_12932421 3300013308 Unclassified 570
558 Ga0157375_13796983 3300013308 Bacteria 501
559 Ga0163163_10032648 3300014325 Bacteria 5030
560 Ga0163163_10033246 3300014325 Bacteria 4988
561 Ga0163163_10126121 3300014325 Bacteria 2598
562 Ga0163163_10138980 3300014325 Bacteria 2471
563 Ga0163163_10255720 3300014325 Unclassified 1802
564 Ga0163163_11345019 3300014325 Bacteria 776
565 Ga0157380_10282470 3300014326 Bacteria 1520
566 Ga0157380_10285268 3300014326 Bacteria 1513
567 Ga0157380_10477383 3300014326 Bacteria 1205
568 Ga0157380_11098104 3300014326 Bacteria 834
569 Ga0157380_11926050 3300014326 Bacteria 652
570 Ga0157380_12327896 3300014326 Unclassified 600
571 Ga0157377_10024199 3300014745 Bacteria 3226
572 Ga0157377_10029022 3300014745 Bacteria 2983
573 Ga0157377_10059969 3300014745 Bacteria 2171
574 Ga0157377_10683589 3300014745 Unclassified 743
575 Ga0157379_10009325 3300014968 Bacteria 8546
576 Ga0157379_10010126 3300014968 Bacteria 8219
577 Ga0157379_10036926 3300014968 Bacteria 4356
578 Ga0157379_10285873 3300014968 Bacteria 1501
579 Ga0157379_11120705 3300014968 Unclassified 754
580 Ga0157376_10045951 3300014969 Bacteria 3598
581 Ga0157376_10053630 3300014969 Bacteria 3358
582 Ga0157376_10125628 3300014969 Unclassified 2281
583 Ga0157376_10939621 3300014969 Bacteria 885
584 Ga0163161_10052776 3300017792 Unclassified 2947
585 Ga0207697_10004072 3300025315 Bacteria 7073
586 Ga0207697_10044787 3300025315 Bacteria 1821
587 Ga0207697_10049493 3300025315 Bacteria 1735
588 Ga0207697_10417823 3300025315 Unclassified 595
589 Ga0207656_10029057 3300025321 Bacteria 2274
590 Ga0207656_10071389 3300025321 Bacteria 1543
591 Ga0207656_10258545 3300025321 Bacteria 854
592 Ga0207656_10531824 3300025321 Unclassified 598
593 Ga0207653_10401929 3300025885 Unclassified 537
594 Ga0207682_10123388 3300025893 Bacteria 1151
595 Ga0207642_10048023 3300025899 Bacteria 1911
596 Ga0207642_10049098 3300025899 Bacteria 1895
597 Ga0207642_10304214 3300025899 Bacteria 925
598 Ga0207710_10016371 3300025900 Bacteria 3136
599 Ga0207710_10617049 3300025900 Unclassified 567
600 Ga0207688_10034819 3300025901 Bacteria 2789
601 Ga0207688_10058041 3300025901 Bacteria 2177
602 Ga0207688_10075727 3300025901 Bacteria 1916
603 Ga0207688_10568611 3300025901 Unclassified 713
604 Ga0207680_10007082 3300025903 Bacteria 5450
605 Ga0207680_10112857 3300025903 Bacteria 1766
606 Ga0207680_10135764 3300025903 Bacteria 1626
607 Ga0207647_10051041 3300025904 Bacteria 2558
608 Ga0207645_10001526 3300025907 Bacteria 18916
609 Ga0207645_10006576 3300025907 Bacteria 8318
610 Ga0207645_10027305 3300025907 Bacteria 3687
611 Ga0207643_10000729 3300025908 Bacteria 20174
612 Ga0207643_10391402 3300025908 Bacteria 878
613 Ga0207643_10413601 3300025908 Bacteria 854
614 Ga0207684_10261742 3300025910 Bacteria 1492
615 Ga0207654_10880697 3300025911 Bacteria 649
616 Ga0207707_10012466 3300025912 Bacteria 7390
617 Ga0207707_10413977 3300025912 Bacteria 1156
618 Ga0207695_11083675 3300025913 Unclassified 681
619 Ga0207671_10245095 3300025914 Unclassified 1408
620 Ga0207693_10055667 3300025915 Bacteria 3103
621 Ga0207663_10128985 3300025916 Bacteria 1744
622 Ga0207660_10095350 3300025917 Bacteria 2213
623 Ga0207662_10011100 3300025918 Bacteria 4984
624 Ga0207662_10022599 3300025918 Bacteria 3607
625 Ga0207662_10858611 3300025918 Unclassified 641
626 Ga0207662_10878368 3300025918 Bacteria 634
627 Ga0207662_10918034 3300025918 Bacteria 620
628 Ga0207657_10051297 3300025919 Bacteria 3586
629 Ga0207657_10196589 3300025919 Bacteria 1624
630 Ga0207657_10482499 3300025919 Unclassified 971
631 Ga0207657_10564108 3300025919 Bacteria 890
632 Ga0207649_10006649 3300025920 Bacteria 6282
633 Ga0207649_10154359 3300025920 Bacteria 1584
634 Ga0207649_10503939 3300025920 Unclassified 921
635 Ga0207649_11187273 3300025920 Bacteria 603
636 Ga0207652_10003224 3300025921 Bacteria 13559
637 Ga0207646_10532487 3300025922 Bacteria 1057
638 Ga0207646_10728088 3300025922 Unclassified 886
639 Ga0207646_10804196 3300025922 Unclassified 837
640 Ga0207681_10002179 3300025923 Bacteria 12483
641 Ga0207681_10056900 3300025923 Unclassified 2669
642 Ga0207681_10057704 3300025923 Bacteria 2654
643 Ga0207681_10076335 3300025923 Bacteria 2353
644 Ga0207681_10185489 3300025923 Bacteria 1588
645 Ga0207681_10377188 3300025923 Bacteria 1141
646 Ga0207681_10601990 3300025923 Bacteria 908
647 Ga0207694_10002358 3300025924 Bacteria 15446
648 Ga0207694_11643350 3300025924 Bacteria 541
649 Ga0207650_10014792 3300025925 Bacteria 5425
650 Ga0207650_10199372 3300025925 Bacteria 1602
651 Ga0207650_10215514 3300025925 Bacteria 1543
652 Ga0207650_10361670 3300025925 Bacteria 1196
653 Ga0207650_10535479 3300025925 Bacteria 981
654 Ga0207650_10705642 3300025925 Unclassified 852
655 Ga0207650_10977457 3300025925 Unclassified 720
656 Ga0207659_10004879 3300025926 Bacteria 8128
657 Ga0207659_10008543 3300025926 Bacteria 6364
658 Ga0207659_10008608 3300025926 Bacteria 6346
659 Ga0207659_10212457 3300025926 Bacteria 1551
660 Ga0207659_10240549 3300025926 Bacteria 1464
661 Ga0207659_10474939 3300025926 Bacteria 1056
662 Ga0207659_11003588 3300025926 Bacteria 718
663 Ga0207687_10051663 3300025927 Bacteria 2866
664 Ga0207687_10115280 3300025927 Bacteria 2001
665 Ga0207687_10206095 3300025927 Bacteria 1540
666 Ga0207687_11127231 3300025927 Bacteria 674
667 Ga0207687_11229060 3300025927 Bacteria 644
668 Ga0207700_10140729 3300025928 Bacteria 1982
669 Ga0207700_10163100 3300025928 Bacteria 1852
670 Ga0207644_10473687 3300025931 Unclassified 1031
671 Ga0207644_10672485 3300025931 Bacteria 862
672 Ga0207644_10954763 3300025931 Bacteria 719
673 Ga0207690_10009687 3300025932 Bacteria 5721
674 Ga0207690_10120675 3300025932 Bacteria 1904
675 Ga0207690_10366138 3300025932 Bacteria 1143
676 Ga0207690_11009955 3300025932 Bacteria 692
677 Ga0207706_10002505 3300025933 Bacteria 17899
678 Ga0207706_10028481 3300025933 Bacteria 4989
679 Ga0207706_10104029 3300025933 Bacteria 2498
680 Ga0207706_10158776 3300025933 Bacteria 1988
681 Ga0207706_11575089 3300025933 Bacteria 533
682 Ga0207686_10011813 3300025934 Unclassified 4790
683 Ga0207686_10056364 3300025934 Bacteria 2470
684 Ga0207686_10400505 3300025934 Bacteria 1045
685 Ga0207686_10730745 3300025934 Bacteria 789
686 Ga0207709_10427408 3300025935 Unclassified 1019
687 Ga0207709_11657721 3300025935 Unclassified 531
688 Ga0207670_10018216 3300025936 Bacteria 4263
689 Ga0207670_10047240 3300025936 Bacteria 2866
690 Ga0207670_10091512 3300025936 Bacteria 2151
691 Ga0207670_10147608 3300025936 Bacteria 1741
692 Ga0207670_10292801 3300025936 Unclassified 1272
693 Ga0207669_10162905 3300025937 Bacteria 1578
694 Ga0207669_10245201 3300025937 Bacteria 1330
695 Ga0207704_10189806 3300025938 Bacteria 1494
696 Ga0207704_10304499 3300025938 Bacteria 1222
697 Ga0207704_10789189 3300025938 Bacteria 792
698 Ga0207704_11912845 3300025938 Unclassified 510
699 Ga0207691_10029551 3300025940 Bacteria 5127
700 Ga0207691_10033116 3300025940 Bacteria 4813
701 Ga0207691_10048568 3300025940 Bacteria 3891
702 Ga0207691_10054204 3300025940 Bacteria 3658
703 Ga0207691_10251515 3300025940 Bacteria 1525
704 Ga0207711_10022698 3300025941 Bacteria 5249
705 Ga0207711_10038894 3300025941 Bacteria 4045
706 Ga0207711_10043839 3300025941 Unclassified 3818
707 Ga0207711_10062457 3300025941 Bacteria 3213
708 Ga0207711_10105917 3300025941 Bacteria 2494
709 Ga0207711_10136000 3300025941 Unclassified 2207
710 Ga0207711_10229824 3300025941 Bacteria 1699
711 Ga0207711_10965237 3300025941 Unclassified 791
712 Ga0207711_11297189 3300025941 Unclassified 670
713 Ga0207711_12049191 3300025941 Bacteria 515
714 Ga0207689_10018941 3300025942 Bacteria 5805
715 Ga0207689_10037713 3300025942 Bacteria 4007
716 Ga0207689_10047493 3300025942 Bacteria 3544
717 Ga0207689_10062992 3300025942 Bacteria 3050
718 Ga0207689_10499901 3300025942 Bacteria 1019
719 Ga0207661_10079521 3300025944 Bacteria 2702
720 Ga0207661_10711115 3300025944 Bacteria 924
721 Ga0207679_10005095 3300025945 Bacteria 8216
722 Ga0207679_10007392 3300025945 Bacteria 6964
723 Ga0207679_10020526 3300025945 Bacteria 4459
724 Ga0207679_10110951 3300025945 Unclassified 2165
725 Ga0207679_10377953 3300025945 Bacteria 1241
726 Ga0207679_12174017 3300025945 Unclassified 503
727 Ga0207667_10780269 3300025949 Bacteria 953
728 Ga0207651_10399167 3300025960 Bacteria 1169
729 Ga0207651_10617326 3300025960 Bacteria 949
730 Ga0207651_10660470 3300025960 Bacteria 918
731 Ga0207712_10005722 3300025961 Bacteria 7836
732 Ga0207712_10020245 3300025961 Bacteria 4355
733 Ga0207712_10238214 3300025961 Bacteria 1464
734 Ga0207712_10274989 3300025961 Bacteria 1372
735 Ga0207712_10700346 3300025961 Bacteria 884
736 Ga0207712_10719847 3300025961 Unclassified 872
737 Ga0207668_10047506 3300025972 Bacteria 2939
738 Ga0207668_11252653 3300025972 Unclassified 667
739 Ga0207640_10079901 3300025981 Bacteria 2230
740 Ga0207640_10147441 3300025981 Bacteria 1724
741 Ga0207640_10247368 3300025981 Bacteria 1382
742 Ga0207640_10456301 3300025981 Bacteria 1054
743 Ga0207658_10207548 3300025986 Bacteria 1640
744 Ga0207658_10497652 3300025986 Bacteria 1085
745 Ga0207658_10712561 3300025986 Bacteria 907
746 Ga0207677_10121092 3300026023 Bacteria 1969
747 Ga0207677_10247776 3300026023 Bacteria 1445
748 Ga0207677_10365478 3300026023 Bacteria 1213
749 Ga0207677_10543944 3300026023 Bacteria 1011
750 Ga0207677_10575963 3300026023 Bacteria 985
751 Ga0207677_11339419 3300026023 Unclassified 658
752 Ga0207703_10019756 3300026035 Bacteria 5266
753 Ga0207703_10053566 3300026035 Unclassified 3279
754 Ga0207703_10184219 3300026035 Bacteria 1844
755 Ga0207703_11572592 3300026035 Bacteria 633
756 Ga0207639_11272488 3300026041 Bacteria 690
757 Ga0207678_10473834 3300026067 Bacteria 1090
758 Ga0207678_10779438 3300026067 Unclassified 844
759 Ga0207708_10015216 3300026075 Bacteria 5768
760 Ga0207708_10033098 3300026075 Bacteria 3926
761 Ga0207708_10642399 3300026075 Bacteria 903
762 Ga0207708_10693083 3300026075 Bacteria 870
763 Ga0207708_11233385 3300026075 Bacteria 654
764 Ga0207708_11392918 3300026075 Bacteria 615
765 Ga0207708_11449292 3300026075 Bacteria 603
766 Ga0207702_10835230 3300026078 Bacteria 911
767 Ga0207641_10150248 3300026088 Bacteria 2109
768 Ga0207641_10665986 3300026088 Bacteria 1023
769 Ga0207641_10815231 3300026088 Unclassified 924
770 Ga0207641_10832250 3300026088 Bacteria 914
771 Ga0207641_11189079 3300026088 Unclassified 762
772 Ga0207641_11302266 3300026088 Unclassified 727
773 Ga0207648_10032284 3300026089 Bacteria 4623
774 Ga0207648_10060729 3300026089 Bacteria 3296
775 Ga0207648_10123463 3300026089 Bacteria 2277
776 Ga0207648_10246788 3300026089 Bacteria 1591
777 Ga0207648_11976713 3300026089 Bacteria 544
778 Ga0207676_10032453 3300026095 Bacteria 3935
779 Ga0207676_10048918 3300026095 Bacteria 3285
780 Ga0207676_10809501 3300026095 Unclassified 914
781 Ga0207676_11011397 3300026095 Bacteria 819
782 Ga0207676_11985522 3300026095 Unclassified 580
783 Ga0207674_10000996 3300026116 Bacteria 36967
784 Ga0207674_10008372 3300026116 Bacteria 11962
785 Ga0207674_10012123 3300026116 Bacteria 9652
786 Ga0207674_10072664 3300026116 Bacteria 3455
787 Ga0207674_10116055 3300026116 Bacteria 2648
788 Ga0207674_10142636 3300026116 Unclassified 2355
789 Ga0207675_100000772 3300026118 Bacteria 31941
790 Ga0207675_100037311 3300026118 Bacteria 4534
791 Ga0207675_100301584 3300026118 Bacteria 1560
792 Ga0207675_100839203 3300026118 Bacteria 933
793 Ga0207675_101336828 3300026118 Bacteria 737
794 Ga0207675_101585903 3300026118 Unclassified 675
795 Ga0207683_10347455 3300026121 Bacteria 1361
796 Ga0207683_10441552 3300026121 Bacteria 1199
797 Ga0207698_10068179 3300026142 Unclassified 2808
798 Ga0207698_10338250 3300026142 Bacteria 1417
799 Ga0207698_10347909 3300026142 Unclassified 1399
800 Ga0207698_10625521 3300026142 Bacteria 1064
801 Ga0207698_11079843 3300026142 Bacteria 815
802 Ga0207698_11540048 3300026142 Bacteria 680
803 Ga0209967_1067680 3300027364 Unclassified 556
804 Ga0209813_10156899 3300027866 Bacteria 819
805 Ga0209974_10065533 3300027876 Unclassified 1233
806 Ga0207428_10062884 3300027907 Bacteria 2933
807 Ga0207428_10115585 3300027907 Unclassified 2061
808 Ga0207428_10326839 3300027907 Bacteria 1132
809 Ga0268266_10006601 3300028379 Bacteria 10593
810 Ga0268266_10089244 3300028379 Bacteria 2699
811 Ga0268266_10385223 3300028379 Bacteria 1323
812 Ga0268266_10718582 3300028379 Bacteria 963
813 Ga0268265_10008187 3300028380 Bacteria 7061
814 Ga0268265_10531318 3300028380 Bacteria 1113
815 Ga0268264_10065814 3300028381 Bacteria 3054
816 Ga0268264_10177738 3300028381 Bacteria 1930
817 Ga0268264_10198714 3300028381 Unclassified 1833
818 Ga0268264_10861535 3300028381 Bacteria 908
819 Ga0268264_11327298 3300028381 Unclassified 729
820 Ga0268264_11757260 3300028381 Bacteria 630
821 Ga0307408_100593541 3300031548 Bacteria 983
822 Ga0307408_100773846 3300031548 Bacteria 869
823 Ga0307408_101562829 3300031548 Bacteria 625
824 Ga0307405_11321245 3300031731 Unclassified 628
825 Ga0307413_10831538 3300031824 Bacteria 779
826 Ga0307410_10039142 3300031852 Unclassified 3111
827 Ga0307410_10352919 3300031852 Bacteria 1176
828 Ga0307410_10487643 3300031852 Unclassified 1012
829 Ga0307406_10027018 3300031901 Bacteria 3453
830 Ga0307406_10337053 3300031901 Unclassified 1173
831 Ga0307406_11385261 3300031901 Bacteria 616
832 Ga0307409_100117923 3300031995 Bacteria 2241
833 Ga0307409_100294747 3300031995 Bacteria 1506
834 Ga0307409_100327953 3300031995 Bacteria 1435
835 Ga0307409_100853995 3300031995 Bacteria 921
836 Ga0307409_102197636 3300031995 Unclassified 581
837 Ga0307416_100119792 3300032002 Bacteria 2342
838 Ga0307416_101752842 3300032002 Bacteria 725
839 Ga0307416_102294522 3300032002 Unclassified 640
840 Ga0307416_102581724 3300032002 Unclassified 606
841 Ga0307414_10385788 3300032004 Bacteria 1213
842 Ga0307411_10029281 3300032005 Bacteria 3360
843 Ga0307411_10038046 3300032005 Bacteria 3031
844 Ga0307411_10158491 3300032005 Bacteria 1691
845 Ga0307411_10372331 3300032005 Bacteria 1172
846 Ga0307415_100617297 3300032126 Unclassified 967
847 Ga0307415_102303274 3300032126 Bacteria 528
848 Ga0373930_0000265 3300034816 Bacteria 6668
849 Ga0373948_0001320 3300034817 Bacteria 3408
850 Ga0373950_0003944 3300034818 Bacteria 2155
851 Ga0373938_0005491 3300034957 Bacteria 2157
852 Ga0373929_0002420 3300035085 Bacteria 3426
853 Ga0373934_0267566 3300035086 Bacteria 707
854 Ga0373940_0001591 3300035088 Bacteria 4173
855 Ga0373949_0001606 3300035090 Bacteria 6357
856 Ga0373949_0217356 3300035090 Bacteria 580
857 Ga0373951_0001127 3300035091 Bacteria 7103
858 Ga0373952_0029100 3300035092 Bacteria 1216
859 Ga0373932_0003217 3300035112 Bacteria 3964
860 Ga0373939_0000668 3300035114 Bacteria 8501
861 Ga0373939_0281558 3300035114 Bacteria 657
862 Ga0373939_0356904 3300035114 Unclassified 596
863 Ga0373939_0378200 3300035114 Bacteria 582
864 Ga0373941_0000688 3300035115 Bacteria 6871
865 Ga0373945_0227240 3300035116 Bacteria 782
866 Ga0373956_0236699 3300035119 Unclassified 867
867 Ga0373956_0272040 3300035119 Bacteria 806
868 Ga0373957_0088090 3300035120 Unclassified 1231
869 Ga0373957_0198923 3300035120 Unclassified 835
870 Ga0373960_0001171 3300035121 Bacteria 5705
871 Ga0373943_0585721 3300035170 Bacteria 656
872 Ga0373946_0777147 3300035171 Bacteria 504
873 Ga0373955_0052190 3300035172 Unclassified 2230
874 Ga0373955_0138272 3300035172 Bacteria 1427
875 Ga0373955_0685548 3300035172 Bacteria 629
876 Ga0373942_0000187 3300035207 Bacteria 15756
877 Ga0373942_0187560 3300035207 Unclassified 680
878 Ga0373962_0001018 3300035242 Bacteria 6483
879 Ga0373931_0003382 3300035691 Bacteria 7156
880 Ga0373931_0141549 3300035691 Bacteria 1394
881 Ga0373935_0677258 3300035692 Bacteria 758
882 Ga0373927_0517170 3300035695 Bacteria 789
883 Ga0373927_0656606 3300035695 Bacteria 693
884 Ga0373933_0244316 3300035724 Unclassified 1155
885 Ga0373947_0039042 3300035725 Bacteria 2824
886 Ga0373937_0200775 3300036401 Unclassified 1874
887 Ga0373937_0476938 3300036401 Bacteria 1185
888 Ga0373937_1013255 3300036401 Bacteria 779
889 Ga0373925_0251430 3300037068 Bacteria 1418
890 Ga0373925_0263806 3300037068 Bacteria 1384
891 Ga0373925_1017662 3300037068 Unclassified 682
892 Ga0436364_0277176 3300037853 Unclassified 943
893 Ga0395901_0665351 3300038443 Bacteria 1043
894 Ga0439453_0062649 3300041408 Unclassified 773
895 Ga0439461_0014243 3300041410 Unclassified 1510
896 Ga0439431_0164013 3300041997 Bacteria 636
897 Ga0439441_137132 3300042001 Bacteria 570
898 Ga0439450_157747 3300042008 Unclassified 597
899 Ga0450923_007387 3300042125 Unclassified 1858
900 Ga0439435_0080925 3300042436 Bacteria 975
901 Ga0439435_0182521 3300042436 Unclassified 686
902 Ga0439435_0351348 3300042436 Bacteria 512
903 Ga0450893_0107899 3300042532 Bacteria 572
904 Ga0453683_0190379 3300044673 Bacteria 1302
905 Ga0453683_0889165 3300044673 Unclassified 589
906 Ga0466963_0023625 3300044694 Bacteria 3907
907 Ga0466960_0792617 3300044901 Bacteria 573
908 Ga0451576_0041493 3300045051 Bacteria 4864
909 Ga0451576_0117266 3300045051 Bacteria 2771
910 Ga0451576_0617442 3300045051 Bacteria 1139
911 Ga0451576_0619162 3300045051 Bacteria 1138
912 Ga0451576_0792867 3300045051 Unclassified 995
913 Ga0466967_0469091 3300045976 Unclassified 1232
914 Ga0495592_0457716 3300046454 Unclassified 798
915 Ga0495629_0298377 3300046459 Unclassified 1104
916 Ga0495629_0593826 3300046459 Unclassified 741
917 Ga0495629_0957222 3300046459 Unclassified 559
918 Ga0495638_0082003 3300046460 Bacteria 1957
919 Ga0495638_0264692 3300046460 Unclassified 941
920 Ga0495638_0426339 3300046460 Bacteria 682
921 Ga0495651_0246303 3300046462 Bacteria 1223
922 Ga0495653_0437382 3300046463 Bacteria 825
923 Ga0495582_0123201 3300046473 Unclassified 1462
924 Ga0495664_0425123 3300046477 Bacteria 797
925 Ga0495664_0482747 3300046477 Unclassified 741
926 Ga0495628_0061629 3300046516 Bacteria 2942
927 Ga0495630_0061225 3300046517 Unclassified 2827
928 Ga0495643_0019787 3300046522 Bacteria 3891
929 Ga0495665_0232355 3300046531 Unclassified 952
930 Ga0495640_0175997 3300046533 Bacteria 1366
931 Ga0495587_0680675 3300046536 Unclassified 564
932 Ga0495587_0721326 3300046536 Unclassified 546
933 Ga0495645_0001784 3300046543 Bacteria 14615
934 Ga0495645_0467053 3300046543 Bacteria 794
935 Ga0495667_0209238 3300046559 Bacteria 1247
936 Ga0495667_0246624 3300046559 Unclassified 1137
937 Ga0495635_0615612 3300046663 Unclassified 708
938 Ga0495599_0278943 3300046678 Bacteria 1013
939 Ga0495658_0010236 3300046683 Unclassified 4688
940 Ga0495658_0383804 3300046683 Unclassified 895
941 Ga0495658_0693193 3300046683 Bacteria 652
942 Ga0495613_0463968 3300046689 Bacteria 857
943 Ga0495670_0362524 3300046691 Unclassified 781
944 Ga0495600_0183243 3300046809 Unclassified 1349
945 Ga0495674_0464185 3300047319 Bacteria 1016
946 Ga0495672_0167149 3300047320 Unclassified 1125
947 Ga0495672_0316117 3300047320 Bacteria 735
948 Ga0495680_0164898 3300047322 Unclassified 1607
949 Ga0495677_0466670 3300047445 Unclassified 500
950 Ga0496100_0457572 3300048903 Unclassified 979
951 Ga0496101_0226902 3300048904 Bacteria 1451
952 Ga0496102_0023841 3300048905 Bacteria 5438
953 Ga0496102_0426833 3300048905 Bacteria 1245
954 Ga0496102_0896924 3300048905 Bacteria 808
955 Ga0496102_1180751 3300048905 Bacteria 685
956 Ga0496104_0005919 3300048907 Bacteria 10708
957 Ga0496104_0512077 3300048907 Bacteria 1111
958 Ga0496104_0513630 3300048907 Bacteria 1109
959 Ga0496105_0217694 3300048908 Unclassified 1555
960 Ga0496105_0808496 3300048908 Bacteria 712
961 Ga0496106_0570090 3300048909 Bacteria 908
962 Ga0496106_0604663 3300048909 Unclassified 878
963 Ga0496106_0609257 3300048909 Unclassified 874
964 Ga0496107_0525846 3300048910 Bacteria 877
965 Ga0496107_0704081 3300048910 Bacteria 743
966 Ga0496108_0026282 3300048911 Bacteria 4801
967 Ga0496108_0117468 3300048911 Bacteria 2279
968 Ga0496108_0207217 3300048911 Bacteria 1702
969 Ga0496108_0564546 3300048911 Bacteria 992
970 Ga0496108_1167893 3300048911 Bacteria 652
971 Ga0496109_0105218 3300048912 Bacteria 2621
972 Ga0496109_0107424 3300048912 Bacteria 2592
973 Ga0496109_0411528 3300048912 Bacteria 1278
974 Ga0496109_1287098 3300048912 Bacteria 667
975 Ga0496110_0081231 3300048913 Bacteria 2890
976 Ga0496110_0229172 3300048913 Bacteria 1689
977 Ga0496110_1323078 3300048913 Unclassified 630
978 Ga0496111_0314063 3300048914 Bacteria 1161
979 Ga0496111_1227196 3300048914 Unclassified 530
980 Ga0496112_0003865 3300048915 Bacteria 12515
981 Ga0496112_0011568 3300048915 Bacteria 8065
982 Ga0496112_0221715 3300048915 Unclassified 1847
983 Ga0496112_0521820 3300048915 Bacteria 1122
984 Ga0496112_0777182 3300048915 Bacteria 883
985 Ga0496112_0963848 3300048915 Bacteria 774
986 Ga0496112_1309211 3300048915 Bacteria 640
987 Ga0496113_0052107 3300048916 Bacteria 3055
988 Ga0496113_0151006 3300048916 Bacteria 1833
989 Ga0496113_0185392 3300048916 Bacteria 1650
990 Ga0496113_1213605 3300048916 Unclassified 589
991 Ga0496114_0022578 3300048917 Bacteria 5129
992 Ga0496114_0234401 3300048917 Unclassified 1613
993 Ga0496114_0390014 3300048917 Unclassified 1233
994 Ga0496115_1163713 3300048918 Unclassified 581
995 Ga0501031_0059867 3300049568 Bacteria 2482
996 Ga0501032_0319187 3300049569 Bacteria 1003
997 Ga0501032_0744667 3300049569 Bacteria 620
998 Ga0501032_0784806 3300049569 Unclassified 602
999 Ga0501034_0088755 3300049571 Bacteria 3089
1000 Ga0501034_0296738 3300049571 Unclassified 1553
1001 Ga0501036_0665864 3300049572 Bacteria 861
1002 Ga0501037_0136377 3300049573 Unclassified 1758
1003 Ga0501038_0279265 3300049574 Unclassified 1315
1004 Ga0501038_1401826 3300049574 Bacteria 502
1005 Ga0501039_0022560 3300049575 Bacteria 4832
1006 Ga0501039_1119333 3300049575 Bacteria 610
1007 Ga0501040_0249727 3300049576 Bacteria 1265
1008 Ga0501040_0734341 3300049576 Unclassified 714
1009 Ga0501040_1140780 3300049576 Bacteria 565
1010 Ga0501041_0239957 3300049577 Bacteria 1139
1011 Ga0501041_1040764 3300049577 Bacteria 527
1012 Ga0501042_0215760 3300049578 Bacteria 1384
1013 Ga0501042_0243113 3300049578 Bacteria 1299
1014 Ga0501042_0321407 3300049578 Bacteria 1118
1015 Ga0501046_0072013 3300049580 Bacteria 2684
1016 Ga0501046_0335782 3300049580 Bacteria 1099
1017 Ga0501046_1037731 3300049580 Bacteria 568
1018 Ga0501047_0086737 3300049581 Unclassified 3007
1019 Ga0501048_0216030 3300049582 Bacteria 1360
1020 Ga0501048_0477087 3300049582 Bacteria 894
1021 Ga0501067_0734985 3300049583 Unclassified 555
1022 Ga0501068_0015207 3300049584 Bacteria 4416
1023 Ga0501069_0189943 3300049585 Unclassified 1188
1024 Ga0501071_0052870 3300049587 Bacteria 2929
1025 Ga0501072_1536616 3300049588 Unclassified 513
1026 Ga0501073_0036938 3300049589 Unclassified 3469
1027 Ga0501074_0074510 3300049590 Bacteria 2437
1028 Ga0501075_0045715 3300049591 Unclassified 3287
1029 Ga0501075_0415705 3300049591 Bacteria 1025
1030 Ga0501075_0872583 3300049591 Bacteria 684
1031 Ga0501076_0047847 3300049592 Bacteria 3382
1032 Ga0501076_0071354 3300049592 Bacteria 2778
1033 Ga0501076_0558452 3300049592 Unclassified 944
1034 Ga0501076_0653918 3300049592 Unclassified 867
1035 Ga0501077_0062153 3300049593 Bacteria 2370
1036 Ga0501077_0070274 3300049593 Bacteria 2219
1037 Ga0501221_261465 3300049704 Unclassified 500
1038 Ga0501079_0059053 3300049741 Unclassified 2959
1039 Ga0501079_0318776 3300049741 Bacteria 1217
1040 Ga0501080_0036398 3300049742 Bacteria 4594
1041 Ga0501081_0202953 3300049743 Bacteria 1438
1042 Ga0501081_0355277 3300049743 Bacteria 1080
1043 Ga0501083_0339649 3300049744 Unclassified 976
1044 Ga0501271_052539 3300049768 Unclassified 556
1045 Ga0501035_0190341 3300049822 Unclassified 1764
1046 Ga0501045_0050274 3300049824 Unclassified 3041
1047 Ga0501045_0096288 3300049824 Bacteria 2190
1048 Ga0501045_0100044 3300049824 Bacteria 2146
1049 Ga0501045_0620119 3300049824 Bacteria 800
1050 Ga0501045_0848472 3300049824 Unclassified 672
1051 Ga0501045_1038501 3300049824 Bacteria 600
1052 nmdc:mga00v17_225711_c1 3300050491 Bacteria 1213
1053 nmdc:mga0yw44_518801_c1 3300050492 Bacteria 809
1054 nmdc:mga0k408_11438_c1 3300050493 Bacteria 4833
1055 nmdc:mga06z11_807680_c1 3300050494 Bacteria 572
1056 nmdc:mga05p37_111672_c1 3300050507 Bacteria 3361
1057 nmdc:mga05p37_164085_c1 3300050507 Bacteria 2712
1058 nmdc:mga05p37_170566_c1 3300050507 Bacteria 2653
1059 nmdc:mga05p37_1948099_c1 3300050507 Bacteria 559
1060 nmdc:mga05p37_215224_c1 3300050507 Bacteria 2321
1061 nmdc:mga05p37_22010_c1 3300050507 Bacteria 7724
1062 nmdc:mga05p37_22841_c1 3300050507 Bacteria 7586
1063 nmdc:mga05p37_28159_c1 3300050507 Bacteria 6849
1064 nmdc:mga05p37_360802_c1 3300050507 Unclassified 1708
1065 nmdc:mga05p37_4186_c1 3300050507 Bacteria 16862
1066 nmdc:mga05p37_456837_c1 3300050507 Bacteria 1477
1067 nmdc:mga05p37_48_c1 3300050507 Bacteria 104863
1068 nmdc:mga05p37_50100_c1 3300050507 Bacteria 5135
1069 nmdc:mga05p37_51629_c1 3300050507 Bacteria 5056
1070 nmdc:mga05p37_61402_c1 3300050507 Unclassified 4626
1071 nmdc:mga05p37_634240_c1 3300050507 Bacteria 1200
1072 nmdc:mga05p37_74970_c1 3300050507 Unclassified 4164
1073 nmdc:mga05p37_97928_c1 3300050507 Bacteria 3613
1074 nmdc:mga09592_128094_c1 3300050508 Bacteria 2183
1075 nmdc:mga09592_142651_c1 3300050508 Bacteria 2065
1076 nmdc:mga09592_281984_c1 3300050508 Bacteria 1441
1077 nmdc:mga09592_324378_c1 3300050508 Unclassified 1334
1078 nmdc:mga09592_389344_c1 3300050508 Bacteria 1205
1079 nmdc:mga09592_408379_c1 3300050508 Unclassified 1173
1080 nmdc:mga09592_60207_c1 3300050508 Bacteria 3210
1081 nmdc:mga0qj67_105519_c1 3300050509 Unclassified 2273
1082 nmdc:mga0qj67_115547_c1 3300050509 Unclassified 2168
1083 nmdc:mga0qj67_1564520_c1 3300050509 Unclassified 506
1084 nmdc:mga0qj67_30281_c1 3300050509 Bacteria 4211
1085 nmdc:mga0qj67_56647_c1 3300050509 Bacteria 3107
1086 nmdc:mga06r32_10263_c1 3300050510 Bacteria 8450
1087 nmdc:mga06r32_1101382_c1 3300050510 Bacteria 743
1088 nmdc:mga06r32_20988_c1 3300050510 Bacteria 6024
1089 nmdc:mga06r32_31571_c1 3300050510 Bacteria 4976
1090 nmdc:mga06r32_364690_c1 3300050510 Bacteria 1428
1091 nmdc:mga06r32_427223_c1 3300050510 Unclassified 1306
1092 nmdc:mga06r32_502705_c1 3300050510 Unclassified 1189
1093 nmdc:mga06r32_510886_c1 3300050510 Unclassified 1178
1094 nmdc:mga06r32_645019_c1 3300050510 Bacteria 1027
1095 nmdc:mga06r32_80461_c1 3300050510 Bacteria 3171
1096 nmdc:mga06r32_841276_c1 3300050510 Bacteria 876
1097 nmdc:mga06r32_943067_c1 3300050510 Bacteria 818
1098 nmdc:mga06r32_973838_c1 3300050510 Bacteria 802
1099 nmdc:mga08y16_134373_c1 3300050511 Bacteria 2571
1100 nmdc:mga08y16_284973_c1 3300050511 Bacteria 1704
1101 nmdc:mga08y16_338380_c1 3300050511 Unclassified 1547
1102 nmdc:mga08y16_39614_c1 3300050511 Bacteria 4944
1103 nmdc:mga08y16_518033_c1 3300050511 Bacteria 1210
1104 nmdc:mga08y16_65082_c1 3300050511 Bacteria 3806
1105 nmdc:mga0n895_101730_c1 3300050512 Unclassified 2884
1106 nmdc:mga0n895_1061629_c1 3300050512 Unclassified 789
1107 nmdc:mga0n895_11366_c1 3300050512 Bacteria 7938
1108 nmdc:mga0n895_1147373_c1 3300050512 Bacteria 753
1109 nmdc:mga0n895_135146_c1 3300050512 Unclassified 2492
1110 nmdc:mga0n895_149521_c1 3300050512 Bacteria 2365
1111 nmdc:mga0n895_1620083_c1 3300050512 Unclassified 611
1112 nmdc:mga0n895_220134_c1 3300050512 Bacteria 1927
1113 nmdc:mga0n895_27837_c1 3300050512 Bacteria 5372
1114 nmdc:mga0n895_298742_c1 3300050512 Unclassified 1632
1115 nmdc:mga0n895_29908_c1 3300050512 Bacteria 5200
1116 nmdc:mga0n895_386117_c1 3300050512 Bacteria 1417
1117 nmdc:mga0n895_531352_c1 3300050512 Bacteria 1183
1118 nmdc:mga0n895_5618_c1 3300050512 Bacteria 10507
1119 nmdc:mga0n895_629811_c1 3300050512 Unclassified 1073
1120 nmdc:mga0n895_638838_c1 3300050512 Bacteria 1064
1121 nmdc:mga0n895_6635_c1 3300050512 Bacteria 9857
1122 nmdc:mga0n895_728_c1 3300050512 Bacteria 23161
1123 nmdc:mga0n895_736177_c1 3300050512 Bacteria 980
1124 nmdc:mga0n895_80343_c1 3300050512 Bacteria 3249
1125 nmdc:mga0n895_846623_c1 3300050512 Bacteria 903
1126 nmdc:mga0n895_9_c1 3300050512 Bacteria 119566
1127 nmdc:mga0rr50_10373_c1 3300050513 Bacteria 5908
1128 nmdc:mga0rr50_11226_c1 3300050513 Bacteria 5721
1129 nmdc:mga0rr50_1611914_c1 3300050513 Unclassified 548
1130 nmdc:mga0rr50_191308_c1 3300050513 Bacteria 1677
1131 nmdc:mga0rr50_23608_c1 3300050513 Unclassified 4244
1132 nmdc:mga0rr50_238191_c1 3300050513 Bacteria 1508
1133 nmdc:mga0rr50_260879_c1 3300050513 Bacteria 1442
1134 nmdc:mga0rr50_288794_c1 3300050513 Bacteria 1370
1135 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
1136 nmdc:mga0rr50_431272_c1 3300050513 Bacteria 1116
1137 nmdc:mga0rr50_62_c1 3300050513 Bacteria 64188
1138 nmdc:mga0rr50_63336_c1 3300050513 Bacteria 2792
1139 nmdc:mga0rr50_84402_c1 3300050513 Bacteria 2459
1140 nmdc:mga0rr50_875429_c1 3300050513 Unclassified 766
1141 nmdc:mga08x19_100267_c1 3300050514 Bacteria 1921
1142 nmdc:mga08x19_1006960_c1 3300050514 Bacteria 592
1143 nmdc:mga08x19_108628_c1 3300050514 Bacteria 1848
1144 nmdc:mga08x19_1315179_c1 3300050514 Unclassified 512
1145 nmdc:mga08x19_1371_c1 3300050514 Bacteria 15084
1146 nmdc:mga08x19_155383_c1 3300050514 Bacteria 1551
1147 nmdc:mga08x19_17257_c2 3300050514 Bacteria 3740
1148 nmdc:mga08x19_176_c1 3300050514 Bacteria 51743
1149 nmdc:mga08x19_23347_c1 3300050514 Unclassified 3837
1150 nmdc:mga08x19_251836_c1 3300050514 Unclassified 685
1151 nmdc:mga08x19_842392_c1 3300050514 Bacteria 651
1152 nmdc:mga08x19_8476_c1 3300050514 Bacteria 6123
1153 nmdc:mga0a205_110945_c1 3300050515 Bacteria 2642
1154 nmdc:mga0a205_1207648_c1 3300050515 Unclassified 604
1155 nmdc:mga0a205_1226777_c1 3300050515 Bacteria 598
1156 nmdc:mga0a205_125003_c1 3300050515 Bacteria 2472
1157 nmdc:mga0a205_17091_c1 3300050515 Bacteria 6793
1158 nmdc:mga0a205_179164_c1 3300050515 Bacteria 2014
1159 nmdc:mga0a205_18345_c1 3300050515 Bacteria 6576
1160 nmdc:mga0a205_3255_c1 3300050515 Bacteria 14444
1161 nmdc:mga0a205_389149_c1 3300050515 Bacteria 1259
1162 nmdc:mga0a205_6125_c1 3300050515 Bacteria 10854
1163 nmdc:mga0a205_72940_c1 3300050515 Bacteria 3317
1164 Ga0495601_0114667 3300053077 Bacteria 1747
1165 Ga0495601_0266721 3300053077 Unclassified 1117
1166 Ga0495601_0996514 3300053077 Unclassified 527
1167 Ga0495612_0452331 3300053078 Unclassified 587
1168 Ga0495595_0138672 3300053084 Bacteria 1192
1169 Ga0495619_0048704 3300053085 Bacteria 2793
1170 Ga0495619_0715321 3300053085 Bacteria 680
1171 Ga0500556_0018333 3300053104 Bacteria 2207
1172 Ga0500592_002005 3300053116 Bacteria 3278
1173 Ga0500592_017785 3300053116 Bacteria 1142
1174 Ga0500627_0398095 3300053158 Unclassified 587
1175 Ga0501084_0055879 3300054114 Bacteria 3303
1176 Ga0590071_002545 3300059421 Bacteria 4587
1177 Ga0590071_054028 3300059421 Unclassified 976
1178 Ga0590074_000245 3300059423 Bacteria 7228
1179 Ga0590075_001914 3300059424 Bacteria 5043
1180 Ga0590077_000236 3300059426 Bacteria 15756
1181 Ga0590077_031095 3300059426 Unclassified 1166
1182 Ga0501082_0366573 3300060353 Bacteria 1257
1183 Ga0530510_1485784 3300061734 Unclassified 520
1184 Ga0075435_100478991
1185 JGI24750J21931_1090479
1186 Ga0065714_10193873
1187 Ga0065712_10000935
1188 Ga0065712_10001231
1189 Ga0065712_10068943
1190 Ga0065712_10200713
1191 Ga0065715_10010891
1192 Ga0065715_10056914
1193 Ga0065715_10089526
1194 Ga0065715_10108236
1195 Ga0065715_10109433
1196 Ga0065715_10314974
1197 Ga0065715_10343169
1198 Ga0065715_10388102
1199 Ga0065715_10579522
1200 Ga0065715_10680731
1201 Ga0065715_11182389
1202 Ga0065707_10008908
1203 Ga0065707_10107203
1204 Ga0065707_10183430
1205 Ga0070676_10008513
1206 Ga0070676_10109125
1207 Ga0070676_10189584
1208 Ga0070676_10442872
1209 Ga0070683_100030196
1210 Ga0070683_100169473
1211 Ga0070683_100414790
1212 Ga0070690_100048824
1213 Ga0070690_100116120
1214 Ga0070690_100529058
1215 Ga0070690_100550431
1216 Ga0070670_100001419
1217 Ga0070670_100126254
1218 Ga0070670_100131328
1219 Ga0070670_100544343
1220 Ga0070670_101096269
1221 Ga0070670_101942263
1222 Ga0070670_102267242
1223 Ga0068869_100026041
1224 Ga0068869_100039868
1225 Ga0068869_100555073
1226 Ga0070666_10028299
1227 Ga0070666_10043616
1228 Ga0070666_10060203
1229 Ga0070666_10102250
1230 Ga0070666_10374180
1231 Ga0070666_10768553
1232 Ga0070666_11376978
1233 Ga0070680_100113080
1234 Ga0068868_100022575
1235 Ga0068868_100034488
1236 Ga0068868_100102825
1237 Ga0068868_100272951
1238 Ga0068868_100704187
1239 Ga0070660_100153107
1240 Ga0070660_100283841
1241 Ga0070660_101620724
1242 Ga0070689_100085022
1243 Ga0070689_100108501
1244 Ga0070689_100431384
1245 Ga0070689_100676516
1246 Ga0070689_100946073
1247 Ga0070691_10046119
1248 Ga0070687_100032680
1249 Ga0070687_100129595
1250 Ga0070687_100273273
1251 Ga0070687_100288383
1252 Ga0070687_100328085
1253 Ga0070687_100533917
1254 Ga0070687_100907276
1255 Ga0070661_100001979
1256 Ga0070661_100043124
1257 Ga0070661_100514044
1258 Ga0070661_101710539
1259 Ga0070668_100287801
1260 Ga0070669_100005873
1261 Ga0070669_100011200
1262 Ga0070669_100037906
1263 Ga0070669_100137783
1264 Ga0070669_101572131
1265 Ga0070675_100004236
1266 Ga0070675_100012385
1267 Ga0070675_100035008
1268 Ga0070675_100083308
1269 Ga0070675_100144448
1270 Ga0070675_100146007
1271 Ga0070675_100181366
1272 Ga0070675_100235250
1273 Ga0070671_100015492
1274 Ga0070671_100216321
1275 Ga0070671_100275915
1276 Ga0070674_100235200
1277 Ga0070674_100243341
1278 Ga0070674_100523597
1279 Ga0070673_100007331
1280 Ga0070673_100009117
1281 Ga0070673_100022360
1282 Ga0070673_100213523
1283 Ga0070673_101394566
1284 Ga0070688_100002772
1285 Ga0070688_100023721
1286 Ga0070688_100109269
1287 Ga0070688_100274762
1288 Ga0070688_100426362
1289 Ga0070688_101127029
1290 Ga0070659_100010473
1291 Ga0070659_100045614
1292 Ga0070659_100078409
1293 Ga0070659_100516125
1294 Ga0070667_100042111
1295 Ga0070667_100193065
1296 Ga0070667_100238535
1297 Ga0070667_100772549
1298 Ga0070703_10056834
1299 Ga0070713_100025941
1300 Ga0070713_100477319
1301 Ga0070713_100509910
1302 Ga0070701_10467583
1303 Ga0070701_10566164
1304 Ga0070701_10804854
1305 Ga0070711_100048604
1306 Ga0070711_100254295
1307 Ga0070705_100455082
1308 Ga0070705_100977503
1309 Ga0070700_100014828
1310 Ga0070700_101220790
1311 Ga0070700_101384155
1312 Ga0070700_101710956
1313 Ga0070694_100112429
1314 Ga0070694_101348034
1315 Ga0070694_101873119
1316 Ga0070708_100049646
1317 Ga0070708_100823010
1318 Ga0070708_101462738
1319 Ga0070708_101524362
1320 Ga0070663_100159683
1321 Ga0070678_100393193
1322 Ga0070678_100594142
1323 Ga0070662_100003381
1324 Ga0070662_100090893
1325 Ga0070662_100104986
1326 Ga0070662_100131141
1327 Ga0070662_100241903
1328 Ga0070681_10000788
1329 Ga0068867_100025345
1330 Ga0068867_100061007
1331 Ga0068867_100066091
1332 Ga0068867_100967905
1333 Ga0068867_101334095
1334 Ga0070685_10010131
1335 Ga0070685_10021408
1336 Ga0070685_10284798
1337 Ga0070685_10400192
1338 Ga0070685_10466745
1339 Ga0070685_11051556
1340 Ga0070685_11571265
1341 Ga0070706_100521948
1342 Ga0070706_101216176
1343 Ga0070706_101302922
1344 Ga0070707_100181644
1345 Ga0070707_100940618
1346 Ga0070707_101941771
1347 Ga0070707_102195250
1348 Ga0070707_102335842
1349 Ga0070698_100243260
1350 Ga0070698_100312400
1351 Ga0070698_101094350
1352 Ga0070699_100417840
1353 Ga0070699_100570315
1354 Ga0070699_100661405
1355 Ga0070699_100720041
1356 Ga0070699_100770645
1357 Ga0070699_100794985
1358 Ga0070699_102157706
1359 Ga0070679_100021152
1360 Ga0070679_100302428
1361 Ga0070684_100073311
1362 Ga0070684_100399387
1363 Ga0070684_100501043
1364 Ga0070697_100229082
1365 Ga0070697_100744080
1366 Ga0070697_101836712
1367 Ga0068853_101299937
1368 Ga0068853_102078879
1369 Ga0070672_100025374
1370 Ga0070672_100101475
1371 Ga0070672_100135853
1372 Ga0070672_100256489
1373 Ga0070672_100313377
1374 Ga0070672_101043745
1375 Ga0070686_100078712
1376 Ga0070686_100119246
1377 Ga0070686_100204361
1378 Ga0070686_100435924
1379 Ga0070686_101630847
1380 Ga0070695_100025027
1381 Ga0070695_100141073
1382 Ga0070695_100267546
1383 Ga0070695_100314938
1384 Ga0070695_100664136
1385 Ga0070695_100714868
1386 Ga0070696_100432211
1387 Ga0070696_100576183
1388 Ga0070696_100817753
1389 Ga0070696_101036229
1390 Ga0070693_100135388
1391 Ga0070693_100654583
1392 Ga0070693_101146694
1393 Ga0070665_100005959
1394 Ga0070665_100055011
1395 Ga0070665_100109361
1396 Ga0070665_100306301
1397 Ga0070665_100724229
1398 Ga0070665_101147518
1399 Ga0070665_101235020
1400 Ga0070704_100205496
1401 Ga0070704_100353279
1402 Ga0070704_100493138
1403 Ga0070704_101514981
1404 Ga0070704_101991337
1405 Ga0070704_102248427
1406 Ga0068855_100639149
1407 Ga0068855_102599096
1408 Ga0070664_100002932
1409 Ga0070664_100004735
1410 Ga0070664_100037437
1411 Ga0070664_100251631
1412 Ga0070664_101794086
1413 Ga0070664_102372262
1414 Ga0068857_100004424
1415 Ga0068857_100010325
1416 Ga0068857_100053500
1417 Ga0068854_100136135
1418 Ga0068854_100272717
1419 Ga0068854_100811859
1420 Ga0068856_100191428
1421 Ga0068856_100254276
1422 Ga0068856_101933509
1423 Ga0070702_100943207
1424 Ga0070702_101449788
1425 Ga0068852_100106365
1426 Ga0068852_100388382
1427 Ga0068852_101653835
1428 Ga0068852_102222081
1429 Ga0068859_100065348
1430 Ga0068859_100171763
1431 Ga0068859_100248056
1432 Ga0068859_100440308
1433 Ga0068859_101450293
1434 Ga0068864_100004841
1435 Ga0068864_100011363
1436 Ga0068864_100059802
1437 Ga0068864_100145914
1438 Ga0068864_100264657
1439 Ga0068864_100486180
1440 Ga0068864_101104984
1441 Ga0068864_102655648
1442 Ga0068866_10050479
1443 Ga0068866_10053689
1444 Ga0068866_10142639
1445 Ga0068866_10248082
1446 Ga0068861_100020232
1447 Ga0068861_100040848
1448 Ga0068861_100087927
1449 Ga0068861_100564047
1450 Ga0068861_101892566
1451 Ga0068851_10014755
1452 Ga0068851_10312773
1453 Ga0068851_10314547
1454 Ga0068870_10004204
1455 Ga0068870_10377886
1456 Ga0068870_10421536
1457 Ga0068870_10467081
1458 Ga0068863_100046982
1459 Ga0068863_100057829
1460 Ga0068863_101392267
1461 Ga0068858_100002440
1462 Ga0068858_100013640
1463 Ga0068858_100046062
1464 Ga0068858_100511683
1465 Ga0068858_101334766
1466 Ga0068858_102235223
1467 Ga0068860_100019119
1468 Ga0068860_100100552
1469 Ga0068860_100157205
1470 Ga0068860_100236804
1471 Ga0068860_100342532
1472 Ga0068860_100932473
1473 Ga0068860_101146423
1474 Ga0068862_100015871
1475 Ga0068862_100097395
1476 Ga0068862_100186590
1477 Ga0068862_100333450
1478 Ga0068862_100726649
1479 Ga0081455_10891608
1480 Ga0081455_10898620
1481 Ga0081539_10208930
1482 Ga0070717_10651608
1483 Ga0070717_10862245
1484 Ga0070717_11458300
1485 Ga0075365_10000208
1486 Ga0075368_10035449
1487 Ga0075364_10053576
1488 Ga0070715_10649814
1489 Ga0070715_10906058
1490 Ga0070716_100310444
1491 Ga0070712_100031332
1492 Ga0075367_10096135
1493 Ga0075367_10576861
1494 Ga0075366_10017717
1495 Ga0097621_100269792
1496 Ga0097621_101182647
1497 Ga0068871_100108515
1498 Ga0068871_101108226
1499 Ga0075428_100014900
1500 Ga0075428_100065604
1501 Ga0075428_100116554
1502 Ga0075428_100129681
1503 Ga0075428_100541347
1504 Ga0075428_100660315
1505 Ga0075428_101147755
1506 Ga0075430_100004139
1507 Ga0075430_100078842
1508 Ga0075430_100102056
1509 Ga0075430_100328055
1510 Ga0075431_100020296
1511 Ga0075431_100064022
1512 Ga0075431_100084539
1513 Ga0075431_100088707
1514 Ga0075431_100130102
1515 Ga0075431_100156407
1516 Ga0075431_100275318
1517 Ga0075431_100436154
1518 Ga0075431_100720735
1519 Ga0075431_101168545
1520 Ga0075433_10000568
1521 Ga0075433_10007894
1522 Ga0075433_10009380
1523 Ga0075433_10010728
1524 Ga0075433_10058184
1525 Ga0075433_10064339
1526 Ga0075433_10084756
1527 Ga0075433_10125392
1528 Ga0075433_10413617
1529 Ga0075433_10475448
1530 Ga0075433_10960273
1531 Ga0075433_11141483
1532 Ga0075433_11469623
1533 Ga0075433_11790306
1534 Ga0075434_100000258
1535 Ga0075434_100002170
1536 Ga0075434_100004349
1537 Ga0075434_100008903
1538 Ga0075434_100016301
1539 Ga0075434_100026885
1540 Ga0075434_100052491
1541 Ga0075434_100055078
1542 Ga0075434_100089733
1543 Ga0075434_100143453
1544 Ga0075434_100156881
1545 Ga0075434_100312368
1546 Ga0075434_100340319
1547 Ga0075434_100483640
1548 Ga0075434_100508538
1549 Ga0075434_100562097
1550 Ga0075434_100822822
1551 Ga0075434_101035478
1552 Ga0075434_101051610
1553 Ga0075434_101066936
1554 Ga0075434_101117115
1555 Ga0075434_101166159
1556 Ga0075434_101661773
1557 Ga0075434_101812851
1558 Ga0075434_102350197
1559 Ga0075429_100012498
1560 Ga0075429_100052732
1561 Ga0075429_100173191
1562 Ga0075429_100230573
1563 Ga0075429_100238200
1564 Ga0075429_100442712
1565 Ga0068865_100004117
1566 Ga0068865_100244252
1567 Ga0068865_100335122
1568 Ga0075436_100000349
1569 Ga0075436_100001199
1570 Ga0075436_100005515
1571 Ga0075436_100012989
1572 Ga0075436_100028164
1573 Ga0075436_100056841
1574 Ga0075436_100168579
1575 Ga0075436_100256113
1576 Ga0075436_100493607
1577 Ga0075436_100615116
1578 Ga0075436_100653009
1579 Ga0075436_100753089
1580 Ga0075436_100850945
1581 Ga0075436_101048933
1582 Ga0075436_101109017
1583 Ga0097620_100065351
1584 Ga0097620_100171756
1585 Ga0097620_100248087
1586 Ga0097620_100440309
1587 Ga0097620_101450521
1588 Ga0075435_100000011
1589 Ga0075435_100000043
1590 Ga0075435_100026322
1591 Ga0075435_100044659
1592 Ga0075435_100063114
1593 Ga0075435_100079728
1594 Ga0075435_100106747
1595 Ga0075435_100121814
1596 Ga0075435_100169727
1597 Ga0075435_100220108
1598 Ga0075435_100256965
1599 Ga0075435_100571526
1600 Ga0075435_100704502
1601 Ga0075435_100736636
1602 Ga0075435_100743426
1603 Ga0075435_100893427
1604 Ga0075435_101078730
1605 Ga0099794_10023052
1606 Ga0099794_10381891
1607 Ga0105251_10128471
1608 Ga0105240_10291861
1609 Ga0105240_11399346
1610 Ga0105240_11530717
1611 Ga0111539_10004303
1612 Ga0111539_10009745
1613 Ga0111539_10011849
1614 Ga0111539_10103761
1615 Ga0111539_10117688
1616 Ga0111539_10127782
1617 Ga0111539_10248630
1618 Ga0111539_10338936
1619 Ga0111539_11680464
1620 Ga0111539_12070864
1621 Ga0111539_13276152
1622 Ga0105245_10087079
1623 Ga0105245_10366222
1624 Ga0105245_10591988
1625 Ga0105245_10613494
1626 Ga0105245_10817312
1627 Ga0105245_12533057
1628 Ga0105245_13233490
1629 Ga0105247_10003326
1630 Ga0105247_10277284
1631 Ga0105247_10636732
1632 Ga0114129_10001250
1633 Ga0114129_10006261
1634 Ga0114129_10007356
1635 Ga0114129_10019280
1636 Ga0114129_10025511
1637 Ga0114129_10040840
1638 Ga0114129_10040926
1639 Ga0114129_10041367
1640 Ga0114129_10055181
1641 Ga0114129_10055909
1642 Ga0114129_10071756
1643 Ga0114129_10077456
1644 Ga0114129_10092106
1645 Ga0114129_10106261
1646 Ga0114129_10113648
1647 Ga0114129_10114251
1648 Ga0114129_10134519
1649 Ga0114129_10158615
1650 Ga0114129_10407285
1651 Ga0114129_10501582
1652 Ga0114129_10532938
1653 Ga0114129_10638512
1654 Ga0114129_10811593
1655 Ga0114129_10843252
1656 Ga0114129_10982722
1657 Ga0114129_11315185
1658 Ga0114129_11512954
1659 Ga0114129_12965389
1660 Ga0105243_10116757
1661 Ga0105243_10279933
1662 Ga0105243_10366051
1663 Ga0105243_11643485
1664 Ga0105243_12691418
1665 Ga0105241_10348236
1666 Ga0105241_10402479
1667 Ga0105241_11442412
1668 Ga0105241_11549534
1669 Ga0105241_12096326
1670 Ga0105242_10003641
1671 Ga0105242_10014666
1672 Ga0105242_10147208
1673 Ga0105242_10496774
1674 Ga0105242_10520770
1675 Ga0105242_12102002
1676 Ga0105248_10010762
1677 Ga0105248_10041108
1678 Ga0105248_10045410
1679 Ga0105248_10047141
1680 Ga0105248_10075643
1681 Ga0105248_10086630
1682 Ga0105248_10370807
1683 Ga0105248_10388111
1684 Ga0105248_10493499
1685 Ga0105248_11121371
1686 Ga0105248_12119035
1687 Ga0105248_12181319
1688 Ga0105248_12663953
1689 Ga0105237_10227357
1690 Ga0105237_10292331
1691 Ga0105238_10002117
1692 Ga0105238_11370792
1693 Ga0105238_11805772
1694 Ga0105238_12632230
1695 Ga0105249_10015732
1696 Ga0105249_10017950
1697 Ga0105249_10024276
1698 Ga0105249_10101913
1699 Ga0105249_10215297
1700 Ga0105249_10466839
1701 Ga0105249_11079801
1702 Ga0105239_10008685
1703 Ga0105239_10087990
1704 Ga0105239_10211127
1705 Ga0105239_10262710
1706 Ga0105239_10427179
1707 Ga0105239_10749821
1708 Ga0105239_12456555
1709 Ga0105246_10226789
1710 Ga0105246_10412320
1711 Ga0105246_10438068
1712 Ga0105246_10677839
1713 Ga0105246_11038056
1714 Ga0157373_11305220
1715 Ga0157371_10047821
1716 Ga0157369_10308367
1717 Ga0157374_10071551
1718 Ga0157374_10532036
1719 Ga0157374_10583258
1720 Ga0157374_10592902
1721 Ga0157374_10866442
1722 Ga0157378_10013179
1723 Ga0157378_10433938
1724 Ga0157378_10757188
1725 Ga0157378_10766085
1726 Ga0157378_10813773
1727 Ga0157378_11415942
1728 Ga0163162_10398556
1729 Ga0163162_10526936
1730 Ga0163162_10609406
1731 Ga0163162_10930177
1732 Ga0163162_12468323
1733 Ga0157372_10034785
1734 Ga0157372_10782469
1735 Ga0157375_10013318
1736 Ga0157375_10115020
1737 Ga0157375_11327954
1738 Ga0157375_11929018
1739 Ga0157375_12384751
1740 Ga0157375_12932421
1741 Ga0157375_13796983
1742 Ga0163163_10032648
1743 Ga0163163_10033246
1744 Ga0163163_10126121
1745 Ga0163163_10138980
1746 Ga0163163_10255720
1747 Ga0163163_11345019
1748 Ga0157380_10282470
1749 Ga0157380_10285268
1750 Ga0157380_10477383
1751 Ga0157380_11098104
1752 Ga0157380_11926050
1753 Ga0157380_12327896
1754 Ga0157377_10024199
1755 Ga0157377_10029022
1756 Ga0157377_10059969
1757 Ga0157377_10683589
1758 Ga0157379_10009325
1759 Ga0157379_10010126
1760 Ga0157379_10036926
1761 Ga0157379_10285873
1762 Ga0157379_11120705
1763 Ga0157376_10045951
1764 Ga0157376_10053630
1765 Ga0157376_10125628
1766 Ga0157376_10939621
1767 Ga0163161_10052776
1768 Ga0207697_10004072
1769 Ga0207697_10044787
1770 Ga0207697_10049493
1771 Ga0207697_10417823
1772 Ga0207656_10029057
1773 Ga0207656_10071389
1774 Ga0207656_10258545
1775 Ga0207656_10531824
1776 Ga0207653_10401929
1777 Ga0207682_10123388
1778 Ga0207642_10048023
1779 Ga0207642_10049098
1780 Ga0207642_10304214
1781 Ga0207710_10016371
1782 Ga0207710_10617049
1783 Ga0207688_10034819
1784 Ga0207688_10058041
1785 Ga0207688_10075727
1786 Ga0207688_10568611
1787 Ga0207680_10007082
1788 Ga0207680_10112857
1789 Ga0207680_10135764
1790 Ga0207647_10051041
1791 Ga0207645_10001526
1792 Ga0207645_10006576
1793 Ga0207645_10027305
1794 Ga0207643_10000729
1795 Ga0207643_10391402
1796 Ga0207643_10413601
1797 Ga0207684_10261742
1798 Ga0207654_10880697
1799 Ga0207707_10012466
1800 Ga0207707_10413977
1801 Ga0207695_11083675
1802 Ga0207671_10245095
1803 Ga0207693_10055667
1804 Ga0207663_10128985
1805 Ga0207660_10095350
1806 Ga0207662_10011100
1807 Ga0207662_10022599
1808 Ga0207662_10858611
1809 Ga0207662_10878368
1810 Ga0207662_10918034
1811 Ga0207657_10051297
1812 Ga0207657_10196589
1813 Ga0207657_10482499
1814 Ga0207657_10564108
1815 Ga0207649_10006649
1816 Ga0207649_10154359
1817 Ga0207649_10503939
1818 Ga0207649_11187273
1819 Ga0207652_10003224
1820 Ga0207646_10532487
1821 Ga0207646_10728088
1822 Ga0207646_10804196
1823 Ga0207681_10002179
1824 Ga0207681_10056900
1825 Ga0207681_10057704
1826 Ga0207681_10076335
1827 Ga0207681_10185489
1828 Ga0207681_10377188
1829 Ga0207681_10601990
1830 Ga0207694_10002358
1831 Ga0207694_11643350
1832 Ga0207650_10014792
1833 Ga0207650_10199372
1834 Ga0207650_10215514
1835 Ga0207650_10361670
1836 Ga0207650_10535479
1837 Ga0207650_10705642
1838 Ga0207650_10977457
1839 Ga0207659_10004879
1840 Ga0207659_10008543
1841 Ga0207659_10008608
1842 Ga0207659_10212457
1843 Ga0207659_10240549
1844 Ga0207659_10474939
1845 Ga0207659_11003588
1846 Ga0207687_10051663
1847 Ga0207687_10115280
1848 Ga0207687_10206095
1849 Ga0207687_11127231
1850 Ga0207687_11229060
1851 Ga0207700_10140729
1852 Ga0207700_10163100
1853 Ga0207644_10473687
1854 Ga0207644_10672485
1855 Ga0207644_10954763
1856 Ga0207690_10009687
1857 Ga0207690_10120675
1858 Ga0207690_10366138
1859 Ga0207690_11009955
1860 Ga0207706_10002505
1861 Ga0207706_10028481
1862 Ga0207706_10104029
1863 Ga0207706_10158776
1864 Ga0207706_11575089
1865 Ga0207686_10011813
1866 Ga0207686_10056364
1867 Ga0207686_10400505
1868 Ga0207686_10730745
1869 Ga0207709_10427408
1870 Ga0207709_11657721
1871 Ga0207670_10018216
1872 Ga0207670_10047240
1873 Ga0207670_10091512
1874 Ga0207670_10147608
1875 Ga0207670_10292801
1876 Ga0207669_10162905
1877 Ga0207669_10245201
1878 Ga0207704_10189806
1879 Ga0207704_10304499
1880 Ga0207704_10789189
1881 Ga0207704_11912845
1882 Ga0207691_10029551
1883 Ga0207691_10033116
1884 Ga0207691_10048568
1885 Ga0207691_10054204
1886 Ga0207691_10251515
1887 Ga0207711_10022698
1888 Ga0207711_10038894
1889 Ga0207711_10043839
1890 Ga0207711_10062457
1891 Ga0207711_10105917
1892 Ga0207711_10136000
1893 Ga0207711_10229824
1894 Ga0207711_10965237
1895 Ga0207711_11297189
1896 Ga0207711_12049191
1897 Ga0207689_10018941
1898 Ga0207689_10037713
1899 Ga0207689_10047493
1900 Ga0207689_10062992
1901 Ga0207689_10499901
1902 Ga0207661_10079521
1903 Ga0207661_10711115
1904 Ga0207679_10005095
1905 Ga0207679_10007392
1906 Ga0207679_10020526
1907 Ga0207679_10110951
1908 Ga0207679_10377953
1909 Ga0207679_12174017
1910 Ga0207667_10780269
1911 Ga0207651_10399167
1912 Ga0207651_10617326
1913 Ga0207651_10660470
1914 Ga0207712_10005722
1915 Ga0207712_10020245
1916 Ga0207712_10238214
1917 Ga0207712_10274989
1918 Ga0207712_10700346
1919 Ga0207712_10719847
1920 Ga0207668_10047506
1921 Ga0207668_11252653
1922 Ga0207640_10079901
1923 Ga0207640_10147441
1924 Ga0207640_10247368
1925 Ga0207640_10456301
1926 Ga0207658_10207548
1927 Ga0207658_10497652
1928 Ga0207658_10712561
1929 Ga0207677_10121092
1930 Ga0207677_10247776
1931 Ga0207677_10365478
1932 Ga0207677_10543944
1933 Ga0207677_10575963
1934 Ga0207677_11339419
1935 Ga0207703_10019756
1936 Ga0207703_10053566
1937 Ga0207703_10184219
1938 Ga0207703_11572592
1939 Ga0207639_11272488
1940 Ga0207678_10473834
1941 Ga0207678_10779438
1942 Ga0207708_10015216
1943 Ga0207708_10033098
1944 Ga0207708_10642399
1945 Ga0207708_10693083
1946 Ga0207708_11233385
1947 Ga0207708_11392918
1948 Ga0207708_11449292
1949 Ga0207702_10835230
1950 Ga0207641_10150248
1951 Ga0207641_10665986
1952 Ga0207641_10815231
1953 Ga0207641_10832250
1954 Ga0207641_11189079
1955 Ga0207641_11302266
1956 Ga0207648_10032284
1957 Ga0207648_10060729
1958 Ga0207648_10123463
1959 Ga0207648_10246788
1960 Ga0207648_11976713
1961 Ga0207676_10032453
1962 Ga0207676_10048918
1963 Ga0207676_10809501
1964 Ga0207676_11011397
1965 Ga0207676_11985522
1966 Ga0207674_10000996
1967 Ga0207674_10008372
1968 Ga0207674_10012123
1969 Ga0207674_10072664
1970 Ga0207674_10116055
1971 Ga0207674_10142636
1972 Ga0207675_100000772
1973 Ga0207675_100037311
1974 Ga0207675_100301584
1975 Ga0207675_100839203
1976 Ga0207675_101336828
1977 Ga0207675_101585903
1978 Ga0207683_10347455
1979 Ga0207683_10441552
1980 Ga0207698_10068179
1981 Ga0207698_10338250
1982 Ga0207698_10347909
1983 Ga0207698_10625521
1984 Ga0207698_11079843
1985 Ga0207698_11540048
1986 Ga0209967_1067680
1987 Ga0209813_10156899
1988 Ga0209974_10065533
1989 Ga0207428_10062884
1990 Ga0207428_10115585
1991 Ga0207428_10326839
1992 Ga0268266_10006601
1993 Ga0268266_10089244
1994 Ga0268266_10385223
1995 Ga0268266_10718582
1996 Ga0268265_10008187
1997 Ga0268265_10531318
1998 Ga0268264_10065814
1999 Ga0268264_10177738
2000 Ga0268264_10198714
2001 Ga0268264_10861535
2002 Ga0268264_11327298
2003 Ga0268264_11757260
2004 Ga0307408_100593541
2005 Ga0307408_100773846
2006 Ga0307408_101562829
2007 Ga0307405_11321245
2008 Ga0307413_10831538
2009 Ga0307410_10039142
2010 Ga0307410_10352919
2011 Ga0307410_10487643
2012 Ga0307406_10027018
2013 Ga0307406_10337053
2014 Ga0307406_11385261
2015 Ga0307409_100117923
2016 Ga0307409_100294747
2017 Ga0307409_100327953
2018 Ga0307409_100853995
2019 Ga0307409_102197636
2020 Ga0307416_100119792
2021 Ga0307416_101752842
2022 Ga0307416_102294522
2023 Ga0307416_102581724
2024 Ga0307414_10385788
2025 Ga0307411_10029281
2026 Ga0307411_10038046
2027 Ga0307411_10158491
2028 Ga0307411_10372331
2029 Ga0307415_100617297
2030 Ga0307415_102303274
2031 Ga0373930_0000265
2032 Ga0373948_0001320
2033 Ga0373950_0003944
2034 Ga0373938_0005491
2035 Ga0373929_0002420
2036 Ga0373934_0267566
2037 Ga0373940_0001591
2038 Ga0373949_0001606
2039 Ga0373949_0217356
2040 Ga0373951_0001127
2041 Ga0373952_0029100
2042 Ga0373932_0003217
2043 Ga0373939_0000668
2044 Ga0373939_0281558
2045 Ga0373939_0356904
2046 Ga0373939_0378200
2047 Ga0373941_0000688
2048 Ga0373945_0227240
2049 Ga0373956_0236699
2050 Ga0373956_0272040
2051 Ga0373957_0088090
2052 Ga0373957_0198923
2053 Ga0373960_0001171
2054 Ga0373943_0585721
2055 Ga0373946_0777147
2056 Ga0373955_0052190
2057 Ga0373955_0138272
2058 Ga0373955_0685548
2059 Ga0373942_0000187
2060 Ga0373942_0187560
2061 Ga0373962_0001018
2062 Ga0373931_0003382
2063 Ga0373931_0141549
2064 Ga0373935_0677258
2065 Ga0373927_0517170
2066 Ga0373927_0656606
2067 Ga0373933_0244316
2068 Ga0373947_0039042
2069 Ga0373937_0200775
2070 Ga0373937_0476938
2071 Ga0373937_1013255
2072 Ga0373925_0251430
2073 Ga0373925_0263806
2074 Ga0373925_1017662
2075 Ga0436364_0277176
2076 Ga0395901_0665351
2077 Ga0439453_0062649
2078 Ga0439461_0014243
2079 Ga0439431_0164013
2080 Ga0439441_137132
2081 Ga0439450_157747
2082 Ga0450923_007387
2083 Ga0439435_0080925
2084 Ga0439435_0182521
2085 Ga0439435_0351348
2086 Ga0450893_0107899
2087 Ga0453683_0190379
2088 Ga0453683_0889165
2089 Ga0466963_0023625
2090 Ga0466960_0792617
2091 Ga0451576_0041493
2092 Ga0451576_0117266
2093 Ga0451576_0617442
2094 Ga0451576_0619162
2095 Ga0451576_0792867
2096 Ga0466967_0469091
2097 Ga0495592_0457716
2098 Ga0495629_0298377
2099 Ga0495629_0593826
2100 Ga0495629_0957222
2101 Ga0495638_0082003
2102 Ga0495638_0264692
2103 Ga0495638_0426339
2104 Ga0495651_0246303
2105 Ga0495653_0437382
2106 Ga0495582_0123201
2107 Ga0495664_0425123
2108 Ga0495664_0482747
2109 Ga0495628_0061629
2110 Ga0495630_0061225
2111 Ga0495643_0019787
2112 Ga0495665_0232355
2113 Ga0495640_0175997
2114 Ga0495587_0680675
2115 Ga0495587_0721326
2116 Ga0495645_0001784
2117 Ga0495645_0467053
2118 Ga0495667_0209238
2119 Ga0495667_0246624
2120 Ga0495635_0615612
2121 Ga0495599_0278943
2122 Ga0495658_0010236
2123 Ga0495658_0383804
2124 Ga0495658_0693193
2125 Ga0495613_0463968
2126 Ga0495670_0362524
2127 Ga0495600_0183243
2128 Ga0495674_0464185
2129 Ga0495672_0167149
2130 Ga0495672_0316117
2131 Ga0495680_0164898
2132 Ga0495677_0466670
2133 Ga0496100_0457572
2134 Ga0496101_0226902
2135 Ga0496102_0023841
2136 Ga0496102_0426833
2137 Ga0496102_0896924
2138 Ga0496102_1180751
2139 Ga0496104_0005919
2140 Ga0496104_0512077
2141 Ga0496104_0513630
2142 Ga0496105_0217694
2143 Ga0496105_0808496
2144 Ga0496106_0570090
2145 Ga0496106_0604663
2146 Ga0496106_0609257
2147 Ga0496107_0525846
2148 Ga0496107_0704081
2149 Ga0496108_0026282
2150 Ga0496108_0117468
2151 Ga0496108_0207217
2152 Ga0496108_0564546
2153 Ga0496108_1167893
2154 Ga0496109_0105218
2155 Ga0496109_0107424
2156 Ga0496109_0411528
2157 Ga0496109_1287098
2158 Ga0496110_0081231
2159 Ga0496110_0229172
2160 Ga0496110_1323078
2161 Ga0496111_0314063
2162 Ga0496111_1227196
2163 Ga0496112_0003865
2164 Ga0496112_0011568
2165 Ga0496112_0221715
2166 Ga0496112_0521820
2167 Ga0496112_0777182
2168 Ga0496112_0963848
2169 Ga0496112_1309211
2170 Ga0496113_0052107
2171 Ga0496113_0151006
2172 Ga0496113_0185392
2173 Ga0496113_1213605
2174 Ga0496114_0022578
2175 Ga0496114_0234401
2176 Ga0496114_0390014
2177 Ga0496115_1163713
2178 Ga0501031_0059867
2179 Ga0501032_0319187
2180 Ga0501032_0744667
2181 Ga0501032_0784806
2182 Ga0501034_0088755
2183 Ga0501034_0296738
2184 Ga0501036_0665864
2185 Ga0501037_0136377
2186 Ga0501038_0279265
2187 Ga0501038_1401826
2188 Ga0501039_0022560
2189 Ga0501039_1119333
2190 Ga0501040_0249727
2191 Ga0501040_0734341
2192 Ga0501040_1140780
2193 Ga0501041_0239957
2194 Ga0501041_1040764
2195 Ga0501042_0215760
2196 Ga0501042_0243113
2197 Ga0501042_0321407
2198 Ga0501046_0072013
2199 Ga0501046_0335782
2200 Ga0501046_1037731
2201 Ga0501047_0086737
2202 Ga0501048_0216030
2203 Ga0501048_0477087
2204 Ga0501067_0734985
2205 Ga0501068_0015207
2206 Ga0501069_0189943
2207 Ga0501071_0052870
2208 Ga0501072_1536616
2209 Ga0501073_0036938
2210 Ga0501074_0074510
2211 Ga0501075_0045715
2212 Ga0501075_0415705
2213 Ga0501075_0872583
2214 Ga0501076_0047847
2215 Ga0501076_0071354
2216 Ga0501076_0558452
2217 Ga0501076_0653918
2218 Ga0501077_0062153
2219 Ga0501077_0070274
2220 Ga0501221_261465
2221 Ga0501079_0059053
2222 Ga0501079_0318776
2223 Ga0501080_0036398
2224 Ga0501081_0202953
2225 Ga0501081_0355277
2226 Ga0501083_0339649
2227 Ga0501271_052539
2228 Ga0501035_0190341
2229 Ga0501045_0050274
2230 Ga0501045_0096288
2231 Ga0501045_0100044
2232 Ga0501045_0620119
2233 Ga0501045_0848472
2234 Ga0501045_1038501
2235 nmdc:mga00v17_225711_c1
2236 nmdc:mga0yw44_518801_c1
2237 nmdc:mga0k408_11438_c1
2238 nmdc:mga06z11_807680_c1
2239 nmdc:mga05p37_111672_c1
2240 nmdc:mga05p37_164085_c1
2241 nmdc:mga05p37_170566_c1
2242 nmdc:mga05p37_1948099_c1
2243 nmdc:mga05p37_215224_c1
2244 nmdc:mga05p37_22010_c1
2245 nmdc:mga05p37_22841_c1
2246 nmdc:mga05p37_28159_c1
2247 nmdc:mga05p37_360802_c1
2248 nmdc:mga05p37_4186_c1
2249 nmdc:mga05p37_456837_c1
2250 nmdc:mga05p37_48_c1
2251 nmdc:mga05p37_50100_c1
2252 nmdc:mga05p37_51629_c1
2253 nmdc:mga05p37_61402_c1
2254 nmdc:mga05p37_634240_c1
2255 nmdc:mga05p37_74970_c1
2256 nmdc:mga05p37_97928_c1
2257 nmdc:mga09592_128094_c1
2258 nmdc:mga09592_142651_c1
2259 nmdc:mga09592_281984_c1
2260 nmdc:mga09592_324378_c1
2261 nmdc:mga09592_389344_c1
2262 nmdc:mga09592_408379_c1
2263 nmdc:mga09592_60207_c1
2264 nmdc:mga0qj67_105519_c1
2265 nmdc:mga0qj67_115547_c1
2266 nmdc:mga0qj67_1564520_c1
2267 nmdc:mga0qj67_30281_c1
2268 nmdc:mga0qj67_56647_c1
2269 nmdc:mga06r32_10263_c1
2270 nmdc:mga06r32_1101382_c1
2271 nmdc:mga06r32_20988_c1
2272 nmdc:mga06r32_31571_c1
2273 nmdc:mga06r32_364690_c1
2274 nmdc:mga06r32_427223_c1
2275 nmdc:mga06r32_502705_c1
2276 nmdc:mga06r32_510886_c1
2277 nmdc:mga06r32_645019_c1
2278 nmdc:mga06r32_80461_c1
2279 nmdc:mga06r32_841276_c1
2280 nmdc:mga06r32_943067_c1
2281 nmdc:mga06r32_973838_c1
2282 nmdc:mga08y16_134373_c1
2283 nmdc:mga08y16_284973_c1
2284 nmdc:mga08y16_338380_c1
2285 nmdc:mga08y16_39614_c1
2286 nmdc:mga08y16_518033_c1
2287 nmdc:mga08y16_65082_c1
2288 nmdc:mga0n895_101730_c1
2289 nmdc:mga0n895_1061629_c1
2290 nmdc:mga0n895_11366_c1
2291 nmdc:mga0n895_1147373_c1
2292 nmdc:mga0n895_135146_c1
2293 nmdc:mga0n895_149521_c1
2294 nmdc:mga0n895_1620083_c1
2295 nmdc:mga0n895_220134_c1
2296 nmdc:mga0n895_27837_c1
2297 nmdc:mga0n895_298742_c1
2298 nmdc:mga0n895_29908_c1
2299 nmdc:mga0n895_386117_c1
2300 nmdc:mga0n895_531352_c1
2301 nmdc:mga0n895_5618_c1
2302 nmdc:mga0n895_629811_c1
2303 nmdc:mga0n895_638838_c1
2304 nmdc:mga0n895_6635_c1
2305 nmdc:mga0n895_728_c1
2306 nmdc:mga0n895_736177_c1
2307 nmdc:mga0n895_80343_c1
2308 nmdc:mga0n895_846623_c1
2309 nmdc:mga0n895_9_c1
2310 nmdc:mga0rr50_10373_c1
2311 nmdc:mga0rr50_11226_c1
2312 nmdc:mga0rr50_1611914_c1
2313 nmdc:mga0rr50_191308_c1
2314 nmdc:mga0rr50_23608_c1
2315 nmdc:mga0rr50_238191_c1
2316 nmdc:mga0rr50_260879_c1
2317 nmdc:mga0rr50_288794_c1
2318 nmdc:mga0rr50_3_c1
2319 nmdc:mga0rr50_431272_c1
2320 nmdc:mga0rr50_62_c1
2321 nmdc:mga0rr50_63336_c1
2322 nmdc:mga0rr50_84402_c1
2323 nmdc:mga0rr50_875429_c1
2324 nmdc:mga08x19_100267_c1
2325 nmdc:mga08x19_1006960_c1
2326 nmdc:mga08x19_108628_c1
2327 nmdc:mga08x19_1315179_c1
2328 nmdc:mga08x19_1371_c1
2329 nmdc:mga08x19_155383_c1
2330 nmdc:mga08x19_17257_c2
2331 nmdc:mga08x19_176_c1
2332 nmdc:mga08x19_23347_c1
2333 nmdc:mga08x19_251836_c1
2334 nmdc:mga08x19_842392_c1
2335 nmdc:mga08x19_8476_c1
2336 nmdc:mga0a205_110945_c1
2337 nmdc:mga0a205_1207648_c1
2338 nmdc:mga0a205_1226777_c1
2339 nmdc:mga0a205_125003_c1
2340 nmdc:mga0a205_17091_c1
2341 nmdc:mga0a205_179164_c1
2342 nmdc:mga0a205_18345_c1
2343 nmdc:mga0a205_3255_c1
2344 nmdc:mga0a205_389149_c1
2345 nmdc:mga0a205_6125_c1
2346 nmdc:mga0a205_72940_c1
2347 Ga0495601_0114667
2348 Ga0495601_0266721
2349 Ga0495601_0996514
2350 Ga0495612_0452331
2351 Ga0495595_0138672
2352 Ga0495619_0048704
2353 Ga0495619_0715321
2354 Ga0500556_0018333
2355 Ga0500592_002005
2356 Ga0500592_017785
2357 Ga0500627_0398095
2358 Ga0501084_0055879
2359 Ga0590071_002545
2360 Ga0590071_054028
2361 Ga0590074_000245
2362 Ga0590075_001914
2363 Ga0590077_000236
2364 Ga0590077_031095
2365 Ga0501082_0366573
2366 Ga0530510_1485784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9612 11 104
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9476 8 103
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9474 4 107
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9396 8 106
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9364 8 104
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9492 8 103 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9371 4 107 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9337 8 103 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9297 8 104 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.926 8 104 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1BIP0-F1-model_v4 PadR family transcriptional regulator 0.9922 8 105
AF-A0A2V8J1R4-F1-model_v4 PadR family transcriptional regulator 0.9899 8 107
AF-A0A2V8VSP9-F1-model_v4 PadR family transcriptional regulator 0.9881 8 105
AF-A0A143PLJ9-F1-model_v4 Lineage-specific thermal regulator protein 0.9875 14 107
AF-A0A1I4FIW9-F1-model_v4 Transcriptional regulator, PadR family 0.9873 13 107

Map