F491286

General Info

Members Datasets Scaffolds Average Seq Length
1179 467 1168 199

Family's Representative Sequence

Representative Sequence 3300034818|Ga0373950_0010349|Ga0373950_0010349_812_1465
Length 217
Sequence MKNPKTSKSNKDSGGSKASSTMSSLFDKIRVKPEQDRRPKTGGPVCEWHGCEQKATNKAPKGRGNDKEYWNYCLKHAREYNQSYNFFAGMNDAAVLAFQKDALTGHRPTWKMGTGKRQAKAGIAGMAGGDDPFGLFGAGMKTEQKQQNEQRQVRNAERKALDKLGLDVGATPAQVKVRFKELVKQFHPDVNGGDRSTEDRLVEVIQSYNYLKSAGFG

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
8 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
9 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
10 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
11 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
12 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
13 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
14 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
15 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
16 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
17 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
21 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
28 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
31 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
32 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
33 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
34 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
35 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
36 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
37 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
134 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
140 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
157 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
158 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
159 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
181 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
261 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
277 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
278 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
279 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
280 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
281 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
282 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
283 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
284 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
287 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
288 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
291 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
292 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
293 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
294 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
295 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
297 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
300 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
301 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
306 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
307 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
319 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
320 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
321 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
322 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
323 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
324 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
325 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
326 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
327 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
346 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
378 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
379 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
394 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
430 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
431 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
440 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
441 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
452 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
456 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
457 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
458 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
459 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
460 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
461 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
462 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
463 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
464 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
467 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.08
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0.85
Rhizoplane 5.77
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214761890 2209111006 Bacteria 2898
2 ARcpr5oldR_c000088 3300000041 Bacteria 16690
3 ARcpr5yngRDRAFT_c000056 3300000043 Bacteria 18019
4 ARSoilOldRDRAFT_c000084 3300000044 Bacteria 17583
5 ARCol0oldRDRAFT_c00490 3300000045 Bacteria 3665
6 ARCol0yngRDRAFT_1000059 3300000652 Bacteria 19852
7 JGI24032J14994_100059 3300001430 Bacteria 4545
8 JGI24741J21665_1002679 3300001915 Bacteria 4537
9 JGI24752J21851_1000628 3300001976 Bacteria 4716
10 JGI24746J21847_1000020 3300001977 Bacteria 15802
11 JGI24747J21853_1000015 3300001978 Bacteria 6858
12 JGI24740J21852_10006056 3300001979 Bacteria 5055
13 JGI24739J22299_10000555 3300001989 Bacteria 13393
14 JGI24737J22298_10000446 3300001990 Bacteria 14169
15 JGI24737J22298_10001295 3300001990 Bacteria 8861
16 JGI24743J22301_10005422 3300001991 Bacteria 2128
17 JGI24735J21928_10097057 3300002067 Bacteria 846
18 JGI24750J21931_1000321 3300002070 Bacteria 8166
19 JGI24748J21848_1006494 3300002074 Bacteria 1361
20 JGI24738J21930_10000478 3300002075 Bacteria 11322
21 JGI24749J21850_1000191 3300002076 Bacteria 9824
22 JGI24744J21845_10000650 3300002077 Bacteria 6363
23 JGI24035J26624_1000088 3300002126 Bacteria 7690
24 JGI24033J26618_1002030 3300002155 Bacteria 2037
25 JGI24034J26672_10000148 3300002239 Bacteria 10065
26 JGI24742J22300_10000055 3300002244 Bacteria 16895
27 JGI24751J29686_10001781 3300002459 Bacteria 4421
28 JGI25405J52794_10016452 3300003911 Bacteria 1461
29 Ga0065716_1001694 3300005277 Bacteria 4116
30 Ga0065704_10081261 3300005289 Bacteria 3794
31 Ga0065712_10004602 3300005290 Bacteria 4360
32 Ga0065712_10014918 3300005290 Bacteria 2334
33 Ga0065712_10069614 3300005290 Bacteria 6970
34 Ga0065715_10094105 3300005293 Bacteria 4442
35 Ga0065715_10351250 3300005293 Bacteria 950
36 Ga0065707_10284269 3300005295 Bacteria 985
37 Ga0070658_10057341 3300005327 Bacteria 3168
38 Ga0070676_10000186 3300005328 Bacteria 25797
39 Ga0070676_10136143 3300005328 Bacteria 1558
40 Ga0070683_100000064 3300005329 Bacteria 76343
41 Ga0070683_100065841 3300005329 Bacteria 3375
42 Ga0070690_100005166 3300005330 Bacteria 7307
43 Ga0070690_100115693 3300005330 Bacteria 1794
44 Ga0070690_100138780 3300005330 Bacteria 1649
45 Ga0070670_100020384 3300005331 Bacteria 5699
46 Ga0070670_100072694 3300005331 Bacteria 2953
47 Ga0070670_100200564 3300005331 Bacteria 1734
48 Ga0070670_100209543 3300005331 Bacteria 1694
49 Ga0070670_100369895 3300005331 Bacteria 1262
50 Ga0070670_100499014 3300005331 Unclassified 1082
51 Ga0070677_10000330 3300005333 Bacteria 16588
52 Ga0068869_100000191 3300005334 Bacteria 31688
53 Ga0068869_100090893 3300005334 Bacteria 2296
54 Ga0068869_101076306 3300005334 Bacteria 703
55 Ga0070666_10020150 3300005335 Bacteria 4309
56 Ga0070666_10341171 3300005335 Bacteria 1071
57 Ga0070666_10378693 3300005335 Bacteria 1016
58 Ga0070680_100008982 3300005336 Bacteria 7662
59 Ga0070680_100009358 3300005336 Bacteria 7526
60 Ga0070680_100027510 3300005336 Bacteria 4553
61 Ga0070680_100196508 3300005336 Bacteria 1700
62 Ga0070680_100199924 3300005336 Bacteria 1685
63 Ga0070682_100001165 3300005337 Bacteria 15006
64 Ga0070682_100032175 3300005337 Bacteria 3178
65 Ga0070682_100047563 3300005337 Bacteria 2667
66 Ga0070682_100050010 3300005337 Bacteria 2608
67 Ga0068868_100000233 3300005338 Bacteria 37955
68 Ga0068868_100015794 3300005338 Bacteria 5593
69 Ga0068868_100631904 3300005338 Bacteria 952
70 Ga0070660_100000523 3300005339 Bacteria 25559
71 Ga0070660_100049478 3300005339 Bacteria 3232
72 Ga0070660_100083409 3300005339 Bacteria 2511
73 Ga0070660_100160965 3300005339 Bacteria 1809
74 Ga0070660_100412565 3300005339 Bacteria 1117
75 Ga0070660_100416381 3300005339 Bacteria 1112
76 Ga0070689_100000764 3300005340 Bacteria 19669
77 Ga0070689_100022766 3300005340 Bacteria 4682
78 Ga0070689_100024145 3300005340 Bacteria 4558
79 Ga0070689_100069466 3300005340 Bacteria 2748
80 Ga0070691_10002775 3300005341 Bacteria 7813
81 Ga0070691_10069908 3300005341 Bacteria 1702
82 Ga0070687_100000911 3300005343 Bacteria 9967
83 Ga0070687_100019895 3300005343 Bacteria 3130
84 Ga0070687_100061266 3300005343 Bacteria 1988
85 Ga0070687_100497940 3300005343 Bacteria 820
86 Ga0070661_100000188 3300005344 Bacteria 51025
87 Ga0070692_10002184 3300005345 Bacteria 7493
88 Ga0070692_10003843 3300005345 Bacteria 6181
89 Ga0070668_100000409 3300005347 Bacteria 28506
90 Ga0070669_100000523 3300005353 Bacteria 28564
91 Ga0070669_100120166 3300005353 Bacteria 2003
92 Ga0070675_100000034 3300005354 Bacteria 87135
93 Ga0070675_100262633 3300005354 Bacteria 1513
94 Ga0070671_100000111 3300005355 Bacteria 52298
95 Ga0070671_100015028 3300005355 Bacteria 6252
96 Ga0070671_100040483 3300005355 Bacteria 3871
97 Ga0070671_100102043 3300005355 Bacteria 2407
98 Ga0070671_100189771 3300005355 Bacteria 1742
99 Ga0070674_100000457 3300005356 Bacteria 20583
100 Ga0070674_100042528 3300005356 Bacteria 3087
101 Ga0070674_100103524 3300005356 Bacteria 2078
102 Ga0070674_100163489 3300005356 Bacteria 1691
103 Ga0070673_100000105 3300005364 Bacteria 38116
104 Ga0070673_100057580 3300005364 Bacteria 3070
105 Ga0070673_100077554 3300005364 Bacteria 2685
106 Ga0070688_100000401 3300005365 Bacteria 21994
107 Ga0070688_100004970 3300005365 Bacteria 6958
108 Ga0070688_100032762 3300005365 Bacteria 3137
109 Ga0070688_100244366 3300005365 Bacteria 1275
110 Ga0070688_100275607 3300005365 Bacteria 1207
111 Ga0070659_100000590 3300005366 Bacteria 26572
112 Ga0070659_100048051 3300005366 Bacteria 3350
113 Ga0070659_100048885 3300005366 Bacteria 3324
114 Ga0070659_100265566 3300005366 Bacteria 1425
115 Ga0070667_100004839 3300005367 Bacteria 11281
116 Ga0070667_100117095 3300005367 Bacteria 2314
117 Ga0070667_100694085 3300005367 Bacteria 942
118 Ga0070703_10020953 3300005406 Bacteria 1907
119 Ga0070709_10003572 3300005434 Bacteria 8349
120 Ga0070709_10009284 3300005434 Bacteria 5419
121 Ga0070709_10024715 3300005434 Bacteria 3539
122 Ga0070709_10058454 3300005434 Bacteria 2445
123 Ga0070714_100017451 3300005435 Bacteria 5815
124 Ga0070714_100222407 3300005435 Bacteria 1735
125 Ga0070713_100000830 3300005436 Bacteria 19766
126 Ga0070713_100014528 3300005436 Bacteria 5853
127 Ga0070713_100345515 3300005436 Bacteria 1379
128 Ga0070710_10002223 3300005437 Bacteria 9168
129 Ga0070710_10008148 3300005437 Bacteria 5094
130 Ga0070710_10224483 3300005437 Bacteria 1197
131 Ga0070701_10001631 3300005438 Bacteria 8380
132 Ga0070701_10073231 3300005438 Bacteria 1836
133 Ga0070711_100025054 3300005439 Bacteria 3899
134 Ga0070711_100031041 3300005439 Bacteria 3543
135 Ga0070711_100032473 3300005439 Bacteria 3470
136 Ga0070711_100049912 3300005439 Bacteria 2867
137 Ga0070711_100157975 3300005439 Bacteria 1716
138 Ga0070711_100438417 3300005439 Bacteria 1067
139 Ga0070705_100000252 3300005440 Bacteria 31840
140 Ga0070705_100884950 3300005440 Bacteria 717
141 Ga0070700_100009718 3300005441 Bacteria 5286
142 Ga0070700_100225394 3300005441 Bacteria 1331
143 Ga0070694_100002271 3300005444 Bacteria 11362
144 Ga0070694_100049276 3300005444 Bacteria 2836
145 Ga0070708_100025000 3300005445 Bacteria 5103
146 Ga0070663_100001002 3300005455 Bacteria 15401
147 Ga0070663_100057226 3300005455 Bacteria 2796
148 Ga0070663_100067388 3300005455 Bacteria 2596
149 Ga0070663_100083501 3300005455 Bacteria 2352
150 Ga0070663_100571252 3300005455 Bacteria 948
151 Ga0070678_100000033 3300005456 Bacteria 45283
152 Ga0070678_100187110 3300005456 Bacteria 1700
153 Ga0070678_100384874 3300005456 Bacteria 1214
154 Ga0070662_100002444 3300005457 Bacteria 11436
155 Ga0070662_100008859 3300005457 Bacteria 6558
156 Ga0070681_10003475 3300005458 Bacteria 14760
157 Ga0070681_10006724 3300005458 Bacteria 11187
158 Ga0070681_10061299 3300005458 Bacteria 3737
159 Ga0070681_10113593 3300005458 Bacteria 2648
160 Ga0070681_10140401 3300005458 Bacteria 2346
161 Ga0070681_10580382 3300005458 Bacteria 1035
162 Ga0068867_100002276 3300005459 Bacteria 13502
163 Ga0068867_100101463 3300005459 Bacteria 2198
164 Ga0070685_10014131 3300005466 Bacteria 4223
165 Ga0070685_10049048 3300005466 Bacteria 2434
166 Ga0070699_100081552 3300005518 Bacteria 2820
167 Ga0070699_100832246 3300005518 Bacteria 845
168 Ga0070679_100010016 3300005530 Bacteria 8975
169 Ga0070679_100022664 3300005530 Bacteria 6140
170 Ga0070679_100092473 3300005530 Bacteria 3012
171 Ga0070679_100609994 3300005530 Bacteria 1034
172 Ga0070684_100000275 3300005535 Bacteria 35701
173 Ga0070684_100153294 3300005535 Bacteria 2088
174 Ga0070684_100666655 3300005535 Bacteria 969
175 Ga0070684_100983172 3300005535 Bacteria 792
176 Ga0068853_100009622 3300005539 Bacteria 7788
177 Ga0068853_100305029 3300005539 Bacteria 1473
178 Ga0068853_100630149 3300005539 Bacteria 1019
179 Ga0070672_100000008 3300005543 Bacteria 91782
180 Ga0070672_100022535 3300005543 Bacteria 4628
181 Ga0070672_100085799 3300005543 Bacteria 2531
182 Ga0070686_100000309 3300005544 Bacteria 32158
183 Ga0070686_100011935 3300005544 Bacteria 4939
184 Ga0070686_100015096 3300005544 Bacteria 4466
185 Ga0070686_100262906 3300005544 Bacteria 1266
186 Ga0070686_100654043 3300005544 Bacteria 834
187 Ga0070695_100000270 3300005545 Bacteria 26216
188 Ga0070695_100008070 3300005545 Bacteria 6240
189 Ga0070696_100001699 3300005546 Bacteria 14443
190 Ga0070696_100087396 3300005546 Bacteria 2214
191 Ga0070696_100136655 3300005546 Bacteria 1787
192 Ga0070696_100331039 3300005546 Bacteria 1174
193 Ga0070693_100000453 3300005547 Bacteria 18425
194 Ga0070693_100006956 3300005547 Bacteria 5503
195 Ga0070693_100138161 3300005547 Bacteria 1531
196 Ga0070665_100071774 3300005548 Bacteria 3469
197 Ga0070704_100001241 3300005549 Bacteria 13447
198 Ga0068855_100011392 3300005563 Bacteria 10739
199 Ga0068855_100063943 3300005563 Bacteria 4292
200 Ga0068855_100122511 3300005563 Bacteria 2975
201 Ga0068855_100149266 3300005563 Bacteria 2658
202 Ga0068855_100192777 3300005563 Bacteria 2297
203 Ga0068855_100393503 3300005563 Bacteria 1520
204 Ga0070664_100000419 3300005564 Bacteria 31758
205 Ga0070664_100083276 3300005564 Bacteria 2759
206 Ga0070664_100225349 3300005564 Bacteria 1678
207 Ga0070664_100417159 3300005564 Bacteria 1229
208 Ga0070664_100626623 3300005564 Bacteria 999
209 Ga0070664_100712422 3300005564 Bacteria 935
210 Ga0068857_100005226 3300005577 Bacteria 11057
211 Ga0068857_100218836 3300005577 Bacteria 1739
212 Ga0068857_100409686 3300005577 Bacteria 1262
213 Ga0068854_100040383 3300005578 Bacteria 3292
214 Ga0068854_100131394 3300005578 Bacteria 1912
215 Ga0068854_100384774 3300005578 Bacteria 1157
216 Ga0068856_100000963 3300005614 Bacteria 30708
217 Ga0068856_100275336 3300005614 Bacteria 1699
218 Ga0068856_100838421 3300005614 Bacteria 939
219 Ga0070702_100068997 3300005615 Bacteria 2082
220 Ga0070702_100075961 3300005615 Bacteria 1998
221 Ga0068852_100024652 3300005616 Bacteria 4865
222 Ga0068852_100198211 3300005616 Bacteria 1899
223 Ga0068852_100327035 3300005616 Bacteria 1490
224 Ga0068859_100010517 3300005617 Bacteria 9311
225 Ga0068859_100038950 3300005617 Bacteria 4767
226 Ga0068859_100041077 3300005617 Bacteria 4646
227 Ga0068859_100158936 3300005617 Bacteria 2339
228 Ga0068864_100013519 3300005618 Bacteria 6768
229 Ga0068864_100041276 3300005618 Bacteria 3946
230 Ga0068864_100344145 3300005618 Bacteria 1406
231 Ga0068864_100819726 3300005618 Bacteria 915
232 Ga0068864_101604943 3300005618 Bacteria 654
233 Ga0068866_10000291 3300005718 Bacteria 23901
234 Ga0068866_10101656 3300005718 Bacteria 1587
235 Ga0068861_100001375 3300005719 Bacteria 15262
236 Ga0068861_100031191 3300005719 Bacteria 3913
237 Ga0068861_100252446 3300005719 Bacteria 1506
238 Ga0068861_100286527 3300005719 Bacteria 1421
239 Ga0068851_10028004 3300005834 Bacteria 2781
240 Ga0068870_10000005 3300005840 Bacteria 79445
241 Ga0068870_10162270 3300005840 Bacteria 1326
242 Ga0068863_100000608 3300005841 Bacteria 36316
243 Ga0068863_100066955 3300005841 Bacteria 3397
244 Ga0068863_100157381 3300005841 Bacteria 2176
245 Ga0068858_100014751 3300005842 Bacteria 7353
246 Ga0068858_100024402 3300005842 Bacteria 5634
247 Ga0068858_100043968 3300005842 Bacteria 4142
248 Ga0068858_100367397 3300005842 Bacteria 1379
249 Ga0068858_100404091 3300005842 Bacteria 1313
250 Ga0068860_100001183 3300005843 Bacteria 28556
251 Ga0068860_100172126 3300005843 Bacteria 2092
252 Ga0068860_100317499 3300005843 Bacteria 1529
253 Ga0068862_100010075 3300005844 Bacteria 7803
254 Ga0068862_100013288 3300005844 Bacteria 6811
255 Ga0068862_100968330 3300005844 Bacteria 840
256 Ga0081455_10000002 3300005937 Bacteria 460472
257 Ga0081455_10004074 3300005937 Bacteria 16551
258 Ga0081455_10406209 3300005937 Bacteria 944
259 Ga0070717_10002981 3300006028 Bacteria 12049
260 Ga0075365_10037930 3300006038 Bacteria 3129
261 Ga0075368_10009624 3300006042 Bacteria 3478
262 Ga0075368_10180832 3300006042 Bacteria 889
263 Ga0075363_100021775 3300006048 Bacteria 3235
264 Ga0075363_100483214 3300006048 Bacteria 734
265 Ga0075364_10400130 3300006051 Bacteria 937
266 Ga0075432_10005509 3300006058 Bacteria 4312
267 Ga0075432_10015716 3300006058 Bacteria 2583
268 Ga0070715_10034535 3300006163 Bacteria 2074
269 Ga0070715_10099511 3300006163 Bacteria 1353
270 Ga0070716_100093235 3300006173 Bacteria 1828
271 Ga0070716_100170001 3300006173 Bacteria 1421
272 Ga0070716_100376753 3300006173 Bacteria 1013
273 Ga0070712_100016065 3300006175 Bacteria 4830
274 Ga0070712_100123683 3300006175 Bacteria 1951
275 Ga0070712_100230144 3300006175 Bacteria 1472
276 Ga0075367_10031675 3300006178 Bacteria 3038
277 Ga0075367_10051919 3300006178 Bacteria 2425
278 Ga0075427_10001679 3300006194 Bacteria 2877
279 Ga0075366_10017677 3300006195 Bacteria 4108
280 Ga0075366_10092822 3300006195 Bacteria 1809
281 Ga0097621_100000006 3300006237 Bacteria 134536
282 Ga0097621_100054592 3300006237 Bacteria 3259
283 Ga0097621_100212178 3300006237 Bacteria 1684
284 Ga0075370_10053913 3300006353 Bacteria 2282
285 Ga0075370_10114307 3300006353 Bacteria 1569
286 Ga0075370_10173773 3300006353 Bacteria 1267
287 Ga0068871_100000022 3300006358 Bacteria 82775
288 Ga0068871_100004373 3300006358 Bacteria 9821
289 Ga0068871_100052461 3300006358 Bacteria 3302
290 Ga0068871_100402199 3300006358 Bacteria 1220
291 Ga0075428_100010613 3300006844 Bacteria 10238
292 Ga0075430_100000485 3300006846 Bacteria 29753
293 Ga0075431_100002570 3300006847 Bacteria 17523
294 Ga0075433_10001502 3300006852 Bacteria 17233
295 Ga0075433_10010359 3300006852 Bacteria 7477
296 Ga0075433_10117392 3300006852 Bacteria 2361
297 Ga0075433_10622926 3300006852 Bacteria 947
298 Ga0075434_100000877 3300006871 Bacteria 24056
299 Ga0075434_100001706 3300006871 Bacteria 18809
300 Ga0075434_100159920 3300006871 Bacteria 2272
301 Ga0075434_100296944 3300006871 Bacteria 1636
302 Ga0075429_100000667 3300006880 Bacteria 26600
303 Ga0068865_100000196 3300006881 Bacteria 33650
304 Ga0068865_100017462 3300006881 Bacteria 4614
305 Ga0068865_100024862 3300006881 Bacteria 3933
306 Ga0068865_100088317 3300006881 Bacteria 2243
307 Ga0068865_100471102 3300006881 Bacteria 1042
308 Ga0075436_100207518 3300006914 Bacteria 1388
309 Ga0097620_100010517 3300006931 Bacteria 9311
310 Ga0097620_100038950 3300006931 Bacteria 4767
311 Ga0097620_100041079 3300006931 Bacteria 4646
312 Ga0097620_100158937 3300006931 Bacteria 2339
313 Ga0075435_100007750 3300007076 Bacteria 7674
314 Ga0075435_100220275 3300007076 Bacteria 1611
315 Ga0075435_100735858 3300007076 Bacteria 858
316 Ga0105251_10011249 3300009011 Bacteria 5122
317 Ga0105251_10020989 3300009011 Bacteria 3419
318 Ga0105250_10013540 3300009092 Bacteria 3360
319 Ga0105250_10193910 3300009092 Bacteria 855
320 Ga0105240_10179599 3300009093 Bacteria 2499
321 Ga0105240_10205550 3300009093 Bacteria 2305
322 Ga0105240_10490741 3300009093 Bacteria 1367
323 Ga0105240_10493529 3300009093 Bacteria 1363
324 Ga0105240_10561446 3300009093 Bacteria 1262
325 Ga0105240_10885784 3300009093 Bacteria 961
326 Ga0111539_10000817 3300009094 Bacteria 40427
327 Ga0111539_10001765 3300009094 Bacteria 28723
328 Ga0111539_10001792 3300009094 Bacteria 28559
329 Ga0111539_10047909 3300009094 Bacteria 5105
330 Ga0111539_10371175 3300009094 Bacteria 1665
331 Ga0111539_10417137 3300009094 Bacteria 1563
332 Ga0105245_10001176 3300009098 Bacteria 23698
333 Ga0105245_10056482 3300009098 Bacteria 3529
334 Ga0105245_10065447 3300009098 Bacteria 3287
335 Ga0105245_10577791 3300009098 Bacteria 1148
336 Ga0105247_10001410 3300009101 Bacteria 17436
337 Ga0105247_10037063 3300009101 Bacteria 2974
338 Ga0105247_10078581 3300009101 Bacteria 2076
339 Ga0105247_10096434 3300009101 Bacteria 1885
340 Ga0105247_10384478 3300009101 Bacteria 996
341 Ga0114129_10005250 3300009147 Bacteria 18260
342 Ga0114129_10045189 3300009147 Bacteria 6192
343 Ga0105243_10002512 3300009148 Bacteria 15312
344 Ga0105243_10002946 3300009148 Bacteria 14068
345 Ga0105243_10155191 3300009148 Bacteria 1968
346 Ga0105243_10160393 3300009148 Bacteria 1938
347 Ga0105243_10243132 3300009148 Bacteria 1603
348 Ga0105243_10387998 3300009148 Bacteria 1294
349 Ga0105241_10006541 3300009174 Bacteria 8588
350 Ga0105241_10103578 3300009174 Bacteria 2266
351 Ga0105241_10138834 3300009174 Bacteria 1977
352 Ga0105241_10409578 3300009174 Bacteria 1191
353 Ga0105241_11458188 3300009174 Bacteria 657
354 Ga0105242_10000879 3300009176 Bacteria 23309
355 Ga0105242_10015607 3300009176 Bacteria 5901
356 Ga0105242_10473463 3300009176 Bacteria 1185
357 Ga0105242_10505322 3300009176 Bacteria 1150
358 Ga0105242_10850631 3300009176 Bacteria 908
359 Ga0105248_10012400 3300009177 Bacteria 9403
360 Ga0105248_10034418 3300009177 Bacteria 5664
361 Ga0105248_10174583 3300009177 Bacteria 2422
362 Ga0105248_10233587 3300009177 Bacteria 2070
363 Ga0105248_11205731 3300009177 Bacteria 856
364 Ga0105237_10043805 3300009545 Bacteria 4507
365 Ga0105237_10135140 3300009545 Bacteria 2461
366 Ga0105238_10119323 3300009551 Bacteria 2618
367 Ga0105238_10161226 3300009551 Bacteria 2218
368 Ga0105238_10221644 3300009551 Bacteria 1867
369 Ga0105238_10386325 3300009551 Bacteria 1392
370 Ga0105238_11149496 3300009551 Bacteria 800
371 Ga0105249_10003131 3300009553 Bacteria 14300
372 Ga0105249_10003187 3300009553 Bacteria 14200
373 Ga0105249_10328827 3300009553 Bacteria 1542
374 Ga0105249_10673586 3300009553 Bacteria 1093
375 Ga0105249_11246231 3300009553 Unclassified 815
376 Ga0105239_10001436 3300010375 Bacteria 31755
377 Ga0105239_10010581 3300010375 Bacteria 10313
378 Ga0105239_10607302 3300010375 Bacteria 1248
379 Ga0105246_10000984 3300011119 Bacteria 16373
380 Ga0105246_10141254 3300011119 Bacteria 1811
381 Ga0157341_1014616 3300012494 Bacteria 714
382 Ga0157339_1004819 3300012505 Bacteria 1040
383 Ga0157326_1004464 3300012513 Bacteria 1469
384 Ga0157338_1000604 3300012515 Bacteria 2209
385 Ga0157338_1001184 3300012515 Bacteria 1803
386 Ga0157373_10023028 3300013100 Bacteria 4518
387 Ga0157373_10033867 3300013100 Bacteria 3671
388 Ga0157373_10067713 3300013100 Bacteria 2524
389 Ga0157373_10129589 3300013100 Bacteria 1774
390 Ga0157371_10227785 3300013102 Bacteria 1339
391 Ga0157371_10242990 3300013102 Bacteria 1295
392 Ga0157371_10316006 3300013102 Bacteria 1133
393 Ga0157370_10035810 3300013104 Bacteria 4821
394 Ga0157370_10062601 3300013104 Bacteria 3528
395 Ga0157369_10123103 3300013105 Bacteria 2751
396 Ga0157369_10135939 3300013105 Bacteria 2603
397 Ga0157369_10154077 3300013105 Bacteria 2428
398 Ga0157369_10596731 3300013105 Bacteria 1140
399 Ga0157369_10701506 3300013105 Bacteria 1042
400 Ga0157369_11180794 3300013105 Bacteria 781
401 Ga0157374_10012602 3300013296 Bacteria 7361
402 Ga0157374_10071928 3300013296 Bacteria 3262
403 Ga0157374_10116537 3300013296 Bacteria 2574
404 Ga0157374_10284941 3300013296 Bacteria 1631
405 Ga0157378_10001496 3300013297 Bacteria 21127
406 Ga0157378_10058064 3300013297 Bacteria 3450
407 Ga0157378_10076403 3300013297 Bacteria 3018
408 Ga0157378_10266059 3300013297 Bacteria 1647
409 Ga0157378_10624355 3300013297 Bacteria 1091
410 Ga0163162_10004276 3300013306 Bacteria 13741
411 Ga0163162_10006826 3300013306 Bacteria 11074
412 Ga0163162_10653248 3300013306 Bacteria 1175
413 Ga0157372_10060986 3300013307 Bacteria 4221
414 Ga0157372_10530411 3300013307 Bacteria 1372
415 Ga0157375_10000732 3300013308 Bacteria 28957
416 Ga0157375_10082399 3300013308 Bacteria 3259
417 Ga0157375_10099660 3300013308 Bacteria 2985
418 Ga0157375_10202201 3300013308 Bacteria 2143
419 Ga0157375_10476507 3300013308 Bacteria 1413
420 Ga0157375_11402191 3300013308 Bacteria 823
421 Ga0163163_10005114 3300014325 Bacteria 11310
422 Ga0163163_10111377 3300014325 Bacteria 2766
423 Ga0157380_10000551 3300014326 Bacteria 23076
424 Ga0157380_10140684 3300014326 Bacteria 2073
425 Ga0157380_10490820 3300014326 Bacteria 1190
426 Ga0157380_10796026 3300014326 Bacteria 962
427 Ga0157380_11367712 3300014326 Bacteria 757
428 Ga0182008_10013043 3300014497 Bacteria 4372
429 Ga0157377_10000127 3300014745 Bacteria 49198
430 Ga0157377_10489399 3300014745 Bacteria 857
431 Ga0157379_10016175 3300014968 Bacteria 6563
432 Ga0157379_10017453 3300014968 Bacteria 6320
433 Ga0157379_10203258 3300014968 Bacteria 1792
434 Ga0157379_10537674 3300014968 Bacteria 1086
435 Ga0157376_10000126 3300014969 Bacteria 52844
436 Ga0157376_10106117 3300014969 Bacteria 2464
437 Ga0157376_10237405 3300014969 Bacteria 1697
438 Ga0182007_10044881 3300015262 Bacteria 1465
439 Ga0163161_10000562 3300017792 Bacteria 29937
440 Ga0163161_10061780 3300017792 Bacteria 2728
441 Ga0163161_10192788 3300017792 Bacteria 1567
442 Ga0163161_10209982 3300017792 Bacteria 1504
443 Ga0206356_11340422 3300020070 Bacteria 1623
444 Ga0213876_10017621 3300021384 Bacteria 3769
445 Ga0213876_10082674 3300021384 Bacteria 1699
446 Ga0207666_1000211 3300025271 Bacteria 8699
447 Ga0207666_1000213 3300025271 Bacteria 8672
448 Ga0207673_1000023 3300025290 Bacteria 11945
449 Ga0207697_10000369 3300025315 Bacteria 25213
450 Ga0207696_1042459 3300025711 Bacteria 1325
451 Ga0207713_1040519 3300025735 Bacteria 1954
452 Ga0207653_10004957 3300025885 Bacteria 4158
453 Ga0207682_10000001 3300025893 Bacteria 152713
454 Ga0207682_10002328 3300025893 Bacteria 8562
455 Ga0207692_10043533 3300025898 Bacteria 2234
456 Ga0207692_10090640 3300025898 Bacteria 1657
457 Ga0207692_10312665 3300025898 Bacteria 959
458 Ga0207642_10000346 3300025899 Bacteria 13892
459 Ga0207642_10009174 3300025899 Bacteria 3430
460 Ga0207710_10002668 3300025900 Bacteria 8215
461 Ga0207710_10014949 3300025900 Bacteria 3278
462 Ga0207710_10016601 3300025900 Bacteria 3116
463 Ga0207710_10017400 3300025900 Bacteria 3049
464 Ga0207688_10000694 3300025901 Bacteria 16633
465 Ga0207688_10038648 3300025901 Bacteria 2650
466 Ga0207688_10081821 3300025901 Bacteria 1845
467 Ga0207688_10236699 3300025901 Bacteria 1103
468 Ga0207688_10461644 3300025901 Bacteria 793
469 Ga0207680_10002770 3300025903 Bacteria 8198
470 Ga0207680_10083500 3300025903 Bacteria 2013
471 Ga0207647_10005072 3300025904 Bacteria 9712
472 Ga0207647_10006956 3300025904 Bacteria 8199
473 Ga0207685_10043858 3300025905 Bacteria 1688
474 Ga0207699_10000333 3300025906 Bacteria 25003
475 Ga0207699_10014241 3300025906 Bacteria 4094
476 Ga0207699_10053871 3300025906 Bacteria 2387
477 Ga0207645_10000862 3300025907 Bacteria 25213
478 Ga0207645_10041411 3300025907 Bacteria 2948
479 Ga0207645_10061456 3300025907 Bacteria 2399
480 Ga0207645_10137055 3300025907 Bacteria 1594
481 Ga0207645_10323823 3300025907 Bacteria 1028
482 Ga0207643_10000041 3300025908 Bacteria 85133
483 Ga0207643_10084137 3300025908 Bacteria 1846
484 Ga0207705_10026744 3300025909 Bacteria 4112
485 Ga0207705_10060008 3300025909 Bacteria 2746
486 Ga0207654_10001213 3300025911 Bacteria 13786
487 Ga0207654_10096705 3300025911 Bacteria 1811
488 Ga0207654_10103935 3300025911 Bacteria 1755
489 Ga0207707_10001359 3300025912 Bacteria 22742
490 Ga0207707_10040910 3300025912 Bacteria 4047
491 Ga0207707_10089808 3300025912 Bacteria 2685
492 Ga0207707_10126818 3300025912 Bacteria 2232
493 Ga0207707_10187380 3300025912 Bacteria 1806
494 Ga0207707_10284810 3300025912 Bacteria 1431
495 Ga0207707_10288584 3300025912 Bacteria 1420
496 Ga0207695_10053991 3300025913 Bacteria 4199
497 Ga0207695_10240990 3300025913 Bacteria 1710
498 Ga0207671_10022738 3300025914 Bacteria 4737
499 Ga0207671_10371231 3300025914 Bacteria 1136
500 Ga0207693_10003835 3300025915 Bacteria 12800
501 Ga0207693_10040557 3300025915 Bacteria 3667
502 Ga0207693_10309096 3300025915 Bacteria 1238
503 Ga0207663_10011514 3300025916 Bacteria 4750
504 Ga0207663_10018037 3300025916 Bacteria 3944
505 Ga0207663_10022636 3300025916 Bacteria 3596
506 Ga0207663_10059718 3300025916 Bacteria 2414
507 Ga0207660_10000006 3300025917 Bacteria 106298
508 Ga0207660_10024028 3300025917 Bacteria 4122
509 Ga0207660_10091681 3300025917 Bacteria 2254
510 Ga0207660_10364100 3300025917 Bacteria 1160
511 Ga0207662_10000207 3300025918 Bacteria 27378
512 Ga0207662_10003071 3300025918 Bacteria 8518
513 Ga0207662_10107951 3300025918 Bacteria 1732
514 Ga0207657_10005584 3300025919 Bacteria 13136
515 Ga0207657_10029437 3300025919 Bacteria 4999
516 Ga0207657_10077821 3300025919 Bacteria 2795
517 Ga0207657_10128448 3300025919 Bacteria 2080
518 Ga0207657_10267183 3300025919 Bacteria 1360
519 Ga0207657_10298785 3300025919 Bacteria 1276
520 Ga0207649_10000049 3300025920 Bacteria 109723
521 Ga0207649_10341178 3300025920 Bacteria 1106
522 Ga0207652_10000300 3300025921 Bacteria 51095
523 Ga0207652_10021269 3300025921 Bacteria 5353
524 Ga0207652_10026585 3300025921 Bacteria 4822
525 Ga0207652_10062764 3300025921 Bacteria 3211
526 Ga0207652_10161541 3300025921 Bacteria 2009
527 Ga0207652_10214373 3300025921 Bacteria 1734
528 Ga0207652_10299759 3300025921 Bacteria 1451
529 Ga0207646_10499612 3300025922 Bacteria 1096
530 Ga0207681_10000024 3300025923 Bacteria 206607
531 Ga0207694_10064079 3300025924 Bacteria 2864
532 Ga0207694_10172650 3300025924 Bacteria 1751
533 Ga0207650_10005629 3300025925 Bacteria 8554
534 Ga0207650_10090190 3300025925 Bacteria 2341
535 Ga0207650_10302567 3300025925 Bacteria 1306
536 Ga0207650_10430355 3300025925 Unclassified 1096
537 Ga0207659_10000042 3300025926 Bacteria 90881
538 Ga0207659_10165515 3300025926 Bacteria 1740
539 Ga0207659_10335578 3300025926 Bacteria 1251
540 Ga0207659_10350242 3300025926 Bacteria 1225
541 Ga0207687_10000476 3300025927 Bacteria 27260
542 Ga0207687_10064144 3300025927 Bacteria 2604
543 Ga0207687_10155565 3300025927 Bacteria 1749
544 Ga0207687_10536967 3300025927 Bacteria 980
545 Ga0207700_10003404 3300025928 Bacteria 9238
546 Ga0207700_10086425 3300025928 Bacteria 2464
547 Ga0207664_10072138 3300025929 Bacteria 2783
548 Ga0207664_10159241 3300025929 Bacteria 1924
549 Ga0207644_10000041 3300025931 Bacteria 114951
550 Ga0207644_10018193 3300025931 Bacteria 4751
551 Ga0207644_10062431 3300025931 Bacteria 2702
552 Ga0207644_10320097 3300025931 Bacteria 1254
553 Ga0207690_10000137 3300025932 Bacteria 59768
554 Ga0207690_10020306 3300025932 Bacteria 4103
555 Ga0207706_10010775 3300025933 Bacteria 8345
556 Ga0207706_10056164 3300025933 Bacteria 3472
557 Ga0207706_10113807 3300025933 Bacteria 2380
558 Ga0207706_10123367 3300025933 Bacteria 2279
559 Ga0207686_10001872 3300025934 Bacteria 11683
560 Ga0207686_10364711 3300025934 Bacteria 1091
561 Ga0207709_10000220 3300025935 Bacteria 72291
562 Ga0207709_10008968 3300025935 Bacteria 5517
563 Ga0207709_10080964 3300025935 Bacteria 2092
564 Ga0207709_10361788 3300025935 Bacteria 1099
565 Ga0207709_10658941 3300025935 Bacteria 834
566 Ga0207670_10000323 3300025936 Bacteria 28564
567 Ga0207670_10109615 3300025936 Bacteria 1987
568 Ga0207670_10361414 3300025936 Bacteria 1152
569 Ga0207669_10000005 3300025937 Bacteria 185218
570 Ga0207669_10029133 3300025937 Bacteria 3048
571 Ga0207669_10029285 3300025937 Bacteria 3043
572 Ga0207669_10033772 3300025937 Bacteria 2891
573 Ga0207704_10000060 3300025938 Bacteria 76535
574 Ga0207704_10017052 3300025938 Bacteria 3753
575 Ga0207704_10313975 3300025938 Bacteria 1206
576 Ga0207704_10367216 3300025938 Bacteria 1125
577 Ga0207665_10000210 3300025939 Bacteria 39483
578 Ga0207691_10001272 3300025940 Bacteria 25213
579 Ga0207691_10017131 3300025940 Bacteria 6873
580 Ga0207711_10011312 3300025941 Bacteria 7414
581 Ga0207711_10016725 3300025941 Bacteria 6091
582 Ga0207711_10031220 3300025941 Bacteria 4496
583 Ga0207711_10054949 3300025941 Bacteria 3418
584 Ga0207711_10057776 3300025941 Bacteria 3335
585 Ga0207689_10000053 3300025942 Bacteria 88245
586 Ga0207689_10033493 3300025942 Bacteria 4269
587 Ga0207661_10000036 3300025944 Bacteria 149720
588 Ga0207661_10233033 3300025944 Bacteria 1631
589 Ga0207679_10000060 3300025945 Bacteria 100711
590 Ga0207679_10259210 3300025945 Bacteria 1482
591 Ga0207679_10486478 3300025945 Bacteria 1099
592 Ga0207679_10728592 3300025945 Bacteria 901
593 Ga0207667_10024638 3300025949 Bacteria 6602
594 Ga0207667_10045229 3300025949 Bacteria 4664
595 Ga0207667_10263521 3300025949 Bacteria 1762
596 Ga0207667_10392647 3300025949 Bacteria 1413
597 Ga0207667_10618642 3300025949 Bacteria 1091
598 Ga0207651_10000014 3300025960 Bacteria 166931
599 Ga0207651_10085220 3300025960 Bacteria 2292
600 Ga0207651_10480743 3300025960 Bacteria 1070
601 Ga0207712_10000134 3300025961 Bacteria 78054
602 Ga0207712_10101883 3300025961 Bacteria 2136
603 Ga0207712_10713818 3300025961 Bacteria 876
604 Ga0207668_10000350 3300025972 Bacteria 29956
605 Ga0207668_10058222 3300025972 Bacteria 2700
606 Ga0207640_10000352 3300025981 Bacteria 30066
607 Ga0207640_10164931 3300025981 Bacteria 1644
608 Ga0207640_10308538 3300025981 Bacteria 1255
609 Ga0207658_10004967 3300025986 Bacteria 9167
610 Ga0207658_10097729 3300025986 Bacteria 2293
611 Ga0207658_10646205 3300025986 Bacteria 953
612 Ga0207677_10001126 3300026023 Bacteria 14572
613 Ga0207677_10669024 3300026023 Bacteria 918
614 Ga0207677_10753259 3300026023 Bacteria 868
615 Ga0207703_10001140 3300026035 Bacteria 25115
616 Ga0207703_10005127 3300026035 Bacteria 10603
617 Ga0207703_10015688 3300026035 Bacteria 5909
618 Ga0207703_10060573 3300026035 Bacteria 3096
619 Ga0207703_10488795 3300026035 Bacteria 1154
620 Ga0207639_10000411 3300026041 Bacteria 29662
621 Ga0207639_10090851 3300026041 Bacteria 2443
622 Ga0207639_10218915 3300026041 Bacteria 1643
623 Ga0207639_11053817 3300026041 Bacteria 762
624 Ga0207678_10000892 3300026067 Bacteria 27377
625 Ga0207678_10014646 3300026067 Bacteria 6902
626 Ga0207678_10057977 3300026067 Bacteria 3333
627 Ga0207678_10122419 3300026067 Bacteria 2219
628 Ga0207708_10002664 3300026075 Bacteria 13116
629 Ga0207708_10048230 3300026075 Bacteria 3242
630 Ga0207702_10000228 3300026078 Bacteria 64998
631 Ga0207702_10434257 3300026078 Bacteria 1271
632 Ga0207702_10924324 3300026078 Bacteria 865
633 Ga0207641_10000664 3300026088 Bacteria 37481
634 Ga0207641_10035734 3300026088 Bacteria 4142
635 Ga0207641_10064132 3300026088 Bacteria 3139
636 Ga0207641_10333219 3300026088 Bacteria 1442
637 Ga0207641_10420855 3300026088 Bacteria 1286
638 Ga0207641_11179568 3300026088 Bacteria 765
639 Ga0207648_10001423 3300026089 Bacteria 26403
640 Ga0207648_10203846 3300026089 Bacteria 1755
641 Ga0207648_10231977 3300026089 Bacteria 1642
642 Ga0207676_10000358 3300026095 Bacteria 38949
643 Ga0207676_10004777 3300026095 Bacteria 9609
644 Ga0207674_10000314 3300026116 Bacteria 61753
645 Ga0207674_10016649 3300026116 Bacteria 8038
646 Ga0207674_10037269 3300026116 Bacteria 5059
647 Ga0207674_10159097 3300026116 Bacteria 2213
648 Ga0207674_10351076 3300026116 Bacteria 1426
649 Ga0207674_10405397 3300026116 Bacteria 1318
650 Ga0207674_10969539 3300026116 Unclassified 819
651 Ga0207675_100004673 3300026118 Bacteria 13186
652 Ga0207675_100063045 3300026118 Bacteria 3463
653 Ga0207675_100075170 3300026118 Bacteria 3162
654 Ga0207675_100212039 3300026118 Bacteria 1863
655 Ga0207683_10000001 3300026121 Bacteria 352047
656 Ga0207683_10003914 3300026121 Bacteria 12911
657 Ga0207683_10005246 3300026121 Bacteria 11127
658 Ga0207683_10005378 3300026121 Bacteria 10975
659 Ga0207698_10000999 3300026142 Bacteria 16426
660 Ga0207698_10065013 3300026142 Bacteria 2862
661 Ga0207698_10923965 3300026142 Bacteria 881
662 Ga0209996_1004434 3300027395 Bacteria 1780
663 Ga0209984_1001890 3300027424 Bacteria 2309
664 Ga0210000_1009970 3300027462 Bacteria 1403
665 Ga0209968_1016232 3300027526 Bacteria 1182
666 Ga0209999_1007612 3300027543 Bacteria 1949
667 Ga0209982_1004169 3300027552 Bacteria 2067
668 Ga0209970_1018978 3300027614 Bacteria 1157
669 Ga0210002_1000546 3300027617 Bacteria 5074
670 Ga0210002_1032379 3300027617 Bacteria 872
671 Ga0209983_1015238 3300027665 Bacteria 1585
672 Ga0209983_1085077 3300027665 Bacteria 710
673 Ga0209966_1001821 3300027695 Bacteria 3608
674 Ga0209998_10001014 3300027717 Bacteria 7058
675 Ga0209998_10001223 3300027717 Bacteria 6316
676 Ga0209998_10002226 3300027717 Bacteria 4496
677 Ga0209813_10090092 3300027866 Bacteria 1028
678 Ga0209974_10003271 3300027876 Bacteria 5858
679 Ga0209974_10106402 3300027876 Bacteria 984
680 Ga0207428_10000316 3300027907 Bacteria 63363
681 Ga0207428_10000897 3300027907 Bacteria 33272
682 Ga0207428_10000923 3300027907 Bacteria 32854
683 Ga0207428_10302598 3300027907 Bacteria 1183
684 Ga0268266_10011674 3300028379 Bacteria 7625
685 Ga0268265_10000146 3300028380 Bacteria 88615
686 Ga0268265_10012031 3300028380 Bacteria 5857
687 Ga0268264_10000976 3300028381 Bacteria 29278
688 Ga0268264_10202635 3300028381 Bacteria 1816
689 Ga0268264_10249514 3300028381 Bacteria 1648
690 Ga0265337_1000979 3300028556 Bacteria 14962
691 Ga0265338_10100432 3300028800 Bacteria 2360
692 Ga0265338_10158624 3300028800 Bacteria 1750
693 Ga0265330_10012738 3300031235 Bacteria 3926
694 Ga0265325_10000097 3300031241 Bacteria 61606
695 Ga0265325_10020634 3300031241 Bacteria 3630
696 Ga0265340_10027609 3300031247 Bacteria 2860
697 Ga0265339_10037773 3300031249 Bacteria 2697
698 Ga0265331_10070035 3300031250 Bacteria 1642
699 Ga0265316_10225647 3300031344 Bacteria 1381
700 Ga0265316_10482761 3300031344 Bacteria 887
701 Ga0307408_100582029 3300031548 Bacteria 992
702 Ga0265313_10009818 3300031595 Bacteria 6164
703 Ga0265313_10036332 3300031595 Bacteria 2473
704 Ga0316575_10005354 3300031665 Bacteria 4573
705 Ga0265314_10000829 3300031711 Bacteria 36749
706 Ga0265314_10036151 3300031711 Bacteria 3592
707 Ga0265314_10154477 3300031711 Bacteria 1403
708 Ga0265314_10366826 3300031711 Bacteria 788
709 Ga0265342_10029877 3300031712 Bacteria 3381
710 Ga0265342_10034349 3300031712 Bacteria 3111
711 Ga0316583_10000713 3300032133 Bacteria 10304
712 Ga0373930_0000210 3300034816 Bacteria 7212
713 Ga0373948_0000429 3300034817 Bacteria 5186
714 Ga0373950_0000149 3300034818 Bacteria 10950
715 Ga0373950_0010349 3300034818 Bacteria 1505
716 Ga0373958_0005446 3300034819 Bacteria 1935
717 Ga0373959_0005882 3300034820 Bacteria 2019
718 Ga0373938_0000214 3300034957 Bacteria 8820
719 Ga0373938_0000487 3300034957 Bacteria 6433
720 Ga0373926_0013860 3300035083 Bacteria 2737
721 Ga0373928_0000527 3300035084 Bacteria 7464
722 Ga0373929_0001507 3300035085 Bacteria 4429
723 Ga0373929_0002034 3300035085 Bacteria 3763
724 Ga0373929_0002354 3300035085 Bacteria 3475
725 Ga0373934_0046367 3300035086 Bacteria 1719
726 Ga0373940_0000101 3300035088 Bacteria 10405
727 Ga0373940_0008665 3300035088 Bacteria 2343
728 Ga0373940_0038487 3300035088 Bacteria 1306
729 Ga0373944_0007027 3300035089 Bacteria 3007
730 Ga0373944_0042024 3300035089 Bacteria 1416
731 Ga0373949_0001142 3300035090 Bacteria 7975
732 Ga0373949_0002647 3300035090 Bacteria 4518
733 Ga0373951_0000243 3300035091 Bacteria 18417
734 Ga0373951_0007521 3300035091 Bacteria 2472
735 Ga0373951_0039492 3300035091 Bacteria 1134
736 Ga0373952_0000399 3300035092 Bacteria 7434
737 Ga0373952_0000485 3300035092 Bacteria 6919
738 Ga0373952_0019099 3300035092 Bacteria 1424
739 Ga0373952_0053797 3300035092 Bacteria 967
740 Ga0373923_0002068 3300035111 Bacteria 6064
741 Ga0373923_0023489 3300035111 Bacteria 2426
742 Ga0373923_0220504 3300035111 Bacteria 881
743 Ga0373932_0000461 3300035112 Bacteria 12467
744 Ga0373936_0022431 3300035113 Bacteria 2458
745 Ga0373936_0026728 3300035113 Bacteria 2261
746 Ga0373936_0231403 3300035113 Bacteria 822
747 Ga0373939_0000710 3300035114 Bacteria 8245
748 Ga0373939_0007703 3300035114 Bacteria 2621
749 Ga0373939_0013941 3300035114 Bacteria 2077
750 Ga0373939_0024392 3300035114 Bacteria 1684
751 Ga0373941_0000067 3300035115 Bacteria 16393
752 Ga0373941_0002487 3300035115 Bacteria 4065
753 Ga0373941_0017762 3300035115 Bacteria 1954
754 Ga0373941_0060405 3300035115 Bacteria 1232
755 Ga0373945_0002631 3300035116 Bacteria 5623
756 Ga0373945_0002786 3300035116 Bacteria 5485
757 Ga0373953_0002762 3300035117 Bacteria 5333
758 Ga0373953_0059206 3300035117 Bacteria 1563
759 Ga0373953_0060854 3300035117 Bacteria 1543
760 Ga0373954_0006315 3300035118 Bacteria 5166
761 Ga0373954_0039933 3300035118 Bacteria 2185
762 Ga0373954_0081640 3300035118 Bacteria 1545
763 Ga0373956_0020187 3300035119 Bacteria 2832
764 Ga0373956_0031722 3300035119 Bacteria 2317
765 Ga0373956_0161385 3300035119 Bacteria 1056
766 Ga0373957_0001485 3300035120 Bacteria 6357
767 Ga0373957_0019662 3300035120 Bacteria 2379
768 Ga0373960_0001028 3300035121 Bacteria 6016
769 Ga0373960_0009902 3300035121 Bacteria 2318
770 Ga0373960_0035083 3300035121 Bacteria 1422
771 Ga0373960_0077211 3300035121 Bacteria 1041
772 Ga0373943_0001307 3300035170 Bacteria 11185
773 Ga0373943_0006960 3300035170 Bacteria 5073
774 Ga0373955_0004746 3300035172 Bacteria 6046
775 Ga0373955_0009093 3300035172 Bacteria 4639
776 Ga0373955_0099589 3300035172 Bacteria 1666
777 Ga0373955_0170572 3300035172 Bacteria 1287
778 Ga0373955_0343054 3300035172 Bacteria 904
779 Ga0373961_0000474 3300035241 Bacteria 15794
780 Ga0373961_0003232 3300035241 Bacteria 4067
781 Ga0373962_0000225 3300035242 Bacteria 11882
782 Ga0373962_0001550 3300035242 Bacteria 5443
783 Ga0373962_0011626 3300035242 Bacteria 2209
784 Ga0373924_0039474 3300035410 Bacteria 1929
785 Ga0373924_0050401 3300035410 Bacteria 1724
786 Ga0373931_0000204 3300035691 Bacteria 25161
787 Ga0373931_0001800 3300035691 Bacteria 9318
788 Ga0373931_0007564 3300035691 Bacteria 5115
789 Ga0373931_0368068 3300035691 Bacteria 903
790 Ga0373931_0476868 3300035691 Bacteria 801
791 Ga0373935_0019987 3300035692 Bacteria 4087
792 Ga0373935_0067496 3300035692 Bacteria 2299
793 Ga0373935_0165611 3300035692 Bacteria 1509
794 Ga0373935_0476239 3300035692 Bacteria 904
795 Ga0373927_0391626 3300035695 Bacteria 916
796 Ga0373933_0002804 3300035724 Bacteria 9737
797 Ga0373933_0004059 3300035724 Bacteria 8069
798 Ga0373933_0008656 3300035724 Bacteria 5548
799 Ga0373933_0009970 3300035724 Bacteria 5201
800 Ga0373933_0181557 3300035724 Bacteria 1342
801 Ga0373937_0013055 3300036401 Bacteria 7316
802 Ga0373937_0029608 3300036401 Bacteria 4959
803 Ga0373937_0045711 3300036401 Bacteria 4001
804 Ga0373937_0089164 3300036401 Bacteria 2855
805 Ga0373937_0091412 3300036401 Bacteria 2820
806 Ga0373937_0285934 3300036401 Bacteria 1558
807 Ga0373925_0012284 3300037068 Bacteria 6197
808 Ga0373925_0027312 3300037068 Bacteria 4179
809 Ga0373925_0028900 3300037068 Bacteria 4064
810 Ga0373925_0345948 3300037068 Bacteria 1206
811 Ga0436365_0784090 3300039437 Bacteria 26500
812 Ga0436365_1113291 3300039437 Bacteria 1863
813 Ga0451839_0363298 3300041496 Bacteria 728
814 Ga0439441_000656 3300042001 Bacteria 3952
815 Ga0439448_0197091 3300042005 Bacteria 705
816 Ga0439455_0020196 3300042012 Bacteria 1577
817 Ga0439456_054694 3300042013 Bacteria 874
818 Ga0439446_0062200 3300042156 Bacteria 1130
819 Ga0439435_0000291 3300042436 Bacteria 7445
820 Ga0439464_0042680 3300042439 Bacteria 1295
821 Ga0439460_0033457 3300042461 Bacteria 1476
822 Ga0439440_0023919 3300042993 Bacteria 1397
823 Ga0466963_0091724 3300044694 Bacteria 2070
824 Ga0451576_0020613 3300045051 Bacteria 7175
825 Ga0466967_0263209 3300045976 Bacteria 1650
826 Ga0495592_0006121 3300046454 Bacteria 8946
827 Ga0495592_0014824 3300046454 Bacteria 5918
828 Ga0495603_0017070 3300046455 Bacteria 4394
829 Ga0495603_0032483 3300046455 Bacteria 3140
830 Ga0495603_0061336 3300046455 Bacteria 2220
831 Ga0495629_0000485 3300046459 Bacteria 33241
832 Ga0495629_0064402 3300046459 Bacteria 2559
833 Ga0495641_0076207 3300046461 Bacteria 1503
834 Ga0495651_0070438 3300046462 Bacteria 2661
835 Ga0495651_0084304 3300046462 Bacteria 2394
836 Ga0495651_0102731 3300046462 Bacteria 2125
837 Ga0495651_0131734 3300046462 Bacteria 1824
838 Ga0495653_0012478 3300046463 Bacteria 6937
839 Ga0495580_0043224 3300046472 Bacteria 3207
840 Ga0495580_0067968 3300046472 Bacteria 2492
841 Ga0495582_0010176 3300046473 Bacteria 5179
842 Ga0495582_0025877 3300046473 Bacteria 3215
843 Ga0495605_0025657 3300046474 Bacteria 3070
844 Ga0495639_0229392 3300046475 Bacteria 914
845 Ga0495662_0004378 3300046476 Bacteria 7091
846 Ga0495662_0061907 3300046476 Bacteria 1808
847 Ga0495662_0260393 3300046476 Bacteria 854
848 Ga0495664_0004210 3300046477 Bacteria 7855
849 Ga0495664_0012302 3300046477 Bacteria 4845
850 Ga0495664_0029424 3300046477 Bacteria 3212
851 Ga0495664_0071505 3300046477 Bacteria 2072
852 Ga0495584_0007346 3300046491 Bacteria 5745
853 Ga0495584_0042546 3300046491 Bacteria 2293
854 Ga0495585_0000734 3300046492 Bacteria 29222
855 Ga0495594_0006008 3300046499 Bacteria 6231
856 Ga0495594_0029074 3300046499 Bacteria 2985
857 Ga0495594_0086067 3300046499 Bacteria 1758
858 Ga0495596_0165411 3300046500 Bacteria 860
859 Ga0495607_0005042 3300046501 Bacteria 9580
860 Ga0495608_0001184 3300046511 Bacteria 18506
861 Ga0495608_0015967 3300046511 Bacteria 5199
862 Ga0495618_0015523 3300046514 Bacteria 4648
863 Ga0495618_0049089 3300046514 Bacteria 2665
864 Ga0495628_0004412 3300046516 Bacteria 12482
865 Ga0495628_0025451 3300046516 Bacteria 4834
866 Ga0495628_0025562 3300046516 Bacteria 4823
867 Ga0495630_0032755 3300046517 Bacteria 3874
868 Ga0495630_0040411 3300046517 Bacteria 3485
869 Ga0495630_0251395 3300046517 Bacteria 1350
870 Ga0495630_0959304 3300046517 Bacteria 650
871 Ga0495643_0206727 3300046522 Bacteria 939
872 Ga0495644_0000828 3300046523 Bacteria 12770
873 Ga0495663_0005863 3300046525 Bacteria 3402
874 Ga0495666_0014716 3300046526 Bacteria 3893
875 Ga0495666_0027794 3300046526 Bacteria 2784
876 Ga0495652_0004969 3300046529 Bacteria 12597
877 Ga0495652_0010574 3300046529 Bacteria 8363
878 Ga0495652_0051717 3300046529 Bacteria 3506
879 Ga0495652_0115826 3300046529 Unclassified 2147
880 Ga0495665_0002225 3300046531 Bacteria 10511
881 Ga0495665_0200322 3300046531 Bacteria 1035
882 Ga0495640_0018787 3300046533 Bacteria 5115
883 Ga0495640_0033111 3300046533 Bacteria 3674
884 Ga0495640_0036221 3300046533 Bacteria 3486
885 Ga0495586_0026174 3300046535 Bacteria 3121
886 Ga0495586_0032495 3300046535 Bacteria 2797
887 Ga0495587_0017832 3300046536 Bacteria 4404
888 Ga0495587_0055108 3300046536 Bacteria 2342
889 Ga0495598_0063893 3300046537 Bacteria 1142
890 Ga0495609_0017622 3300046538 Bacteria 3316
891 Ga0495645_0008947 3300046543 Bacteria 6995
892 Ga0495645_0017944 3300046543 Bacteria 5077
893 Ga0495645_0154406 3300046543 Bacteria 1592
894 Ga0495622_0017962 3300046557 Bacteria 3294
895 Ga0495633_0002950 3300046558 Bacteria 11631
896 Ga0495667_0003221 3300046559 Bacteria 10945
897 Ga0495667_0015894 3300046559 Bacteria 5088
898 Ga0495667_0021566 3300046559 Bacteria 4347
899 Ga0495667_0076919 3300046559 Bacteria 2171
900 Ga0495656_0088924 3300046615 Bacteria 1409
901 Ga0495611_0004234 3300046648 Bacteria 6246
902 Ga0495635_0009913 3300046663 Bacteria 6659
903 Ga0495635_0021211 3300046663 Bacteria 4528
904 Ga0495635_0080227 3300046663 Bacteria 2233
905 Ga0495635_0364505 3300046663 Bacteria 963
906 Ga0495661_0077965 3300046665 Bacteria 1918
907 Ga0495657_0013292 3300046675 Bacteria 6078
908 Ga0495657_0026726 3300046675 Bacteria 4084
909 Ga0495657_0036583 3300046675 Bacteria 3392
910 Ga0495657_0107258 3300046675 Bacteria 1773
911 Ga0495599_0004093 3300046678 Bacteria 8597
912 Ga0495599_0015147 3300046678 Bacteria 4781
913 Ga0495599_0029880 3300046678 Bacteria 3418
914 Ga0495623_0002124 3300046679 Bacteria 13244
915 Ga0495623_0013014 3300046679 Bacteria 5388
916 Ga0495646_0016363 3300046680 Bacteria 4706
917 Ga0495646_0044110 3300046680 Bacteria 2727
918 Ga0495647_0018720 3300046681 Bacteria 2469
919 Ga0495647_0098961 3300046681 Bacteria 1205
920 Ga0495658_0007123 3300046683 Bacteria 5525
921 Ga0495658_0009853 3300046683 Bacteria 4766
922 Ga0495658_0026369 3300046683 Bacteria 3114
923 Ga0495613_0169792 3300046689 Bacteria 1548
924 Ga0495613_0317934 3300046689 Bacteria 1075
925 Ga0495624_0005521 3300046690 Bacteria 9102
926 Ga0495624_0069844 3300046690 Bacteria 2187
927 Ga0495624_0284805 3300046690 Bacteria 997
928 Ga0495670_0001621 3300046691 Bacteria 11023
929 Ga0495671_0220583 3300046692 Bacteria 918
930 Ga0495600_0016706 3300046809 Bacteria 4663
931 Ga0495600_0075579 3300046809 Bacteria 2200
932 Ga0495600_0094497 3300046809 Bacteria 1949
933 Ga0495581_0002320 3300047315 Bacteria 10722
934 Ga0495581_0023391 3300047315 Bacteria 3580
935 Ga0495604_0005566 3300047317 Bacteria 9985
936 Ga0495604_0007478 3300047317 Bacteria 8649
937 Ga0495604_0019133 3300047317 Bacteria 5483
938 Ga0495604_0111998 3300047317 Bacteria 1989
939 Ga0495636_0054585 3300047318 Bacteria 1679
940 Ga0495674_0009473 3300047319 Bacteria 9251
941 Ga0495674_0024592 3300047319 Bacteria 5531
942 Ga0495674_0105765 3300047319 Bacteria 2390
943 Ga0495676_0071208 3300047321 Bacteria 2673
944 Ga0495680_0002398 3300047322 Bacteria 19232
945 Ga0495680_0007387 3300047322 Bacteria 10080
946 Ga0495680_0040982 3300047322 Bacteria 3684
947 Ga0495680_0050177 3300047322 Bacteria 3264
948 Ga0495675_0036217 3300047444 Bacteria 3147
949 Ga0495675_0113642 3300047444 Unclassified 1689
950 Ga0495675_0211153 3300047444 Bacteria 1178
951 Ga0495679_069851 3300047446 Bacteria 1014
952 Ga0495684_0004228 3300047471 Bacteria 11209
953 Ga0495684_0193084 3300047471 Bacteria 1504
954 Ga0495684_0381774 3300047471 Bacteria 993
955 Ga0495593_0011971 3300047673 Bacteria 4973
956 Ga0495593_0012764 3300047673 Bacteria 4797
957 Ga0495593_0025938 3300047673 Bacteria 3242
958 Ga0495602_0027747 3300048088 Bacteria 5435
959 Ga0495602_0060542 3300048088 Bacteria 3298
960 Ga0495602_0259762 3300048088 Bacteria 1289
961 Ga0495614_0012071 3300048089 Bacteria 3794
962 Ga0495615_0001620 3300048090 Bacteria 3391
963 Ga0496100_0000177 3300048903 Bacteria 35417
964 Ga0496100_0006867 3300048903 Bacteria 6234
965 Ga0496100_0070940 3300048903 Bacteria 2324
966 Ga0496100_0232352 3300048903 Bacteria 1357
967 Ga0496101_0000180 3300048904 Bacteria 50929
968 Ga0496101_0039291 3300048904 Bacteria 3364
969 Ga0496101_0042835 3300048904 Bacteria 3232
970 Ga0496101_0229502 3300048904 Bacteria 1442
971 Ga0496102_0000607 3300048905 Bacteria 37245
972 Ga0496102_0006549 3300048905 Bacteria 9944
973 Ga0496102_0030810 3300048905 Bacteria 4803
974 Ga0496102_0161797 3300048905 Bacteria 2105
975 Ga0496103_0000130 3300048906 Bacteria 80826
976 Ga0496103_0007817 3300048906 Bacteria 6354
977 Ga0496103_0038232 3300048906 Bacteria 2943
978 Ga0496104_0000289 3300048907 Bacteria 44331
979 Ga0496104_0027792 3300048907 Bacteria 5236
980 Ga0496104_0139519 3300048907 Bacteria 2329
981 Ga0496104_0186264 3300048907 Bacteria 1986
982 Ga0496104_0209397 3300048907 Bacteria 1861
983 Ga0496104_0827632 3300048907 Bacteria 831
984 Ga0496105_0000144 3300048908 Bacteria 46774
985 Ga0496105_0025199 3300048908 Bacteria 4838
986 Ga0496105_0049741 3300048908 Bacteria 3461
987 Ga0496106_0000381 3300048909 Bacteria 31520
988 Ga0496106_0007902 3300048909 Bacteria 7861
989 Ga0496106_0027792 3300048909 Bacteria 4212
990 Ga0496106_0086866 3300048909 Bacteria 2409
991 Ga0496106_0446136 3300048909 Bacteria 1039
992 Ga0496107_0001002 3300048910 Bacteria 16859
993 Ga0496107_0005222 3300048910 Bacteria 8866
994 Ga0496107_0015427 3300048910 Bacteria 5355
995 Ga0496107_0161729 3300048910 Bacteria 1659
996 Ga0496108_0001153 3300048911 Bacteria 20645
997 Ga0496108_0003419 3300048911 Bacteria 12742
998 Ga0496108_0013287 3300048911 Bacteria 6712
999 Ga0496108_0019246 3300048911 Bacteria 5604
1000 Ga0496108_0025933 3300048911 Bacteria 4834
1001 Ga0496108_0201008 3300048911 Bacteria 1729
1002 Ga0496109_0000490 3300048912 Bacteria 33902
1003 Ga0496109_0001283 3300048912 Bacteria 20857
1004 Ga0496109_0015162 3300048912 Bacteria 6709
1005 Ga0496109_0054678 3300048912 Bacteria 3641
1006 Ga0496109_0188697 3300048912 Bacteria 1936
1007 Ga0496110_0006458 3300048913 Bacteria 9291
1008 Ga0496110_0089756 3300048913 Bacteria 2747
1009 Ga0496110_0099991 3300048913 Bacteria 2599
1010 Ga0496110_0102603 3300048913 Bacteria 2565
1011 Ga0496111_0017198 3300048914 Bacteria 4996
1012 Ga0496111_0024875 3300048914 Bacteria 4223
1013 Ga0496111_0101084 3300048914 Bacteria 2118
1014 Ga0496111_0533303 3300048914 Bacteria 862
1015 Ga0496112_0015716 3300048915 Bacteria 7069
1016 Ga0496112_0024562 3300048915 Bacteria 5773
1017 Ga0496112_0243128 3300048915 Bacteria 1752
1018 Ga0496112_0674750 3300048915 Bacteria 962
1019 Ga0496113_0003541 3300048916 Bacteria 9363
1020 Ga0496113_0109941 3300048916 Bacteria 2144
1021 Ga0496113_0269158 3300048916 Bacteria 1361
1022 Ga0496113_0443815 3300048916 Bacteria 1042
1023 Ga0496114_0000973 3300048917 Bacteria 21454
1024 Ga0496114_0008867 3300048917 Bacteria 7972
1025 Ga0496114_0093052 3300048917 Bacteria 2562
1026 Ga0496115_0000939 3300048918 Bacteria 21150
1027 Ga0496115_0052739 3300048918 Bacteria 3263
1028 Ga0496115_0082814 3300048918 Bacteria 2614
1029 Ga0496115_0083703 3300048918 Bacteria 2600
1030 Ga0496115_0175217 3300048918 Bacteria 1773
1031 Ga0496119_0372319 3300048922 Bacteria 687
1032 Ga0496125_0155976 3300048928 Bacteria 1560
1033 Ga0501031_0004683 3300049568 Bacteria 8875
1034 Ga0501031_0175551 3300049568 Bacteria 1400
1035 Ga0501032_0180192 3300049569 Bacteria 1383
1036 Ga0501032_0252822 3300049569 Bacteria 1144
1037 Ga0501032_0603138 3300049569 Bacteria 698
1038 Ga0501033_0044841 3300049570 Bacteria 3291
1039 Ga0501034_0174585 3300049571 Bacteria 2115
1040 Ga0501034_0180077 3300049571 Bacteria 2078
1041 Ga0501034_0205325 3300049571 Bacteria 1927
1042 Ga0501034_0230349 3300049571 Bacteria 1802
1043 Ga0501034_0383467 3300049571 Bacteria 1330
1044 Ga0501034_0385524 3300049571 Bacteria 1326
1045 Ga0501036_0152438 3300049572 Bacteria 1949
1046 Ga0501037_0308461 3300049573 Bacteria 1097
1047 Ga0501037_0374012 3300049573 Bacteria 980
1048 Ga0501039_0070373 3300049575 Bacteria 2718
1049 Ga0501043_0072619 3300049579 Bacteria 2703
1050 Ga0501043_0378793 3300049579 Bacteria 1071
1051 Ga0501047_0013763 3300049581 Bacteria 7682
1052 Ga0501047_0082204 3300049581 Bacteria 3096
1053 Ga0501047_0143184 3300049581 Bacteria 2268
1054 Ga0501047_0217227 3300049581 Bacteria 1769
1055 Ga0501047_0253955 3300049581 Bacteria 1606
1056 Ga0501048_0306071 3300049582 Bacteria 1131
1057 Ga0501067_0062076 3300049583 Bacteria 2069
1058 Ga0501067_0247756 3300049583 Bacteria 992
1059 Ga0501069_0010790 3300049585 Bacteria 4844
1060 Ga0501070_0003223 3300049586 Bacteria 14190
1061 Ga0501070_0049525 3300049586 Bacteria 3489
1062 Ga0501070_0069981 3300049586 Bacteria 2905
1063 Ga0501070_0126246 3300049586 Bacteria 2114
1064 Ga0501070_0127313 3300049586 Bacteria 2104
1065 Ga0501070_0142271 3300049586 Bacteria 1980
1066 Ga0501070_0622226 3300049586 Bacteria 859
1067 Ga0501071_0023980 3300049587 Bacteria 4265
1068 Ga0501071_0205289 3300049587 Bacteria 1481
1069 Ga0501073_0035920 3300049589 Bacteria 3521
1070 Ga0501073_0242232 3300049589 Bacteria 1245
1071 Ga0501073_0624266 3300049589 Bacteria 744
1072 Ga0501074_0076829 3300049590 Bacteria 2396
1073 Ga0501074_0126660 3300049590 Bacteria 1827
1074 Ga0501076_0013068 3300049592 Bacteria 6216
1075 Ga0501079_0048358 3300049741 Bacteria 3282
1076 Ga0501079_0355967 3300049741 Bacteria 1147
1077 Ga0501080_0024694 3300049742 Bacteria 5574
1078 Ga0501080_0104149 3300049742 Bacteria 2631
1079 Ga0501080_0118735 3300049742 Bacteria 2452
1080 Ga0501080_0257833 3300049742 Bacteria 1589
1081 Ga0501080_0308707 3300049742 Bacteria 1434
1082 Ga0501080_0363385 3300049742 Bacteria 1306
1083 Ga0501080_0401714 3300049742 Bacteria 1233
1084 Ga0501080_0455271 3300049742 Bacteria 1147
1085 Ga0501083_0005209 3300049744 Bacteria 9202
1086 Ga0501083_0033190 3300049744 Bacteria 3535
1087 Ga0501083_0038727 3300049744 Bacteria 3240
1088 Ga0501035_0000371 3300049822 Bacteria 51668
1089 Ga0501035_0047743 3300049822 Bacteria 3842
1090 Ga0501035_0159651 3300049822 Bacteria 1952
1091 Ga0501035_0889255 3300049822 Bacteria 706
1092 Ga0501044_0022389 3300049823 Bacteria 6735
1093 Ga0501044_0092944 3300049823 Bacteria 3042
1094 Ga0501044_0108177 3300049823 Bacteria 2791
1095 Ga0501044_0402588 3300049823 Bacteria 1281
1096 Ga0501044_0565159 3300049823 Bacteria 1033
1097 Ga0501044_1025764 3300049823 Bacteria 696
1098 nmdc:mga00v17_366232_c1 3300050491 Bacteria 937
1099 nmdc:mga0yw44_228834_c1 3300050492 Bacteria 1234
1100 nmdc:mga0yw44_448866_c1 3300050492 Bacteria 874
1101 nmdc:mga0k408_147555_c1 3300050493 Bacteria 1400
1102 nmdc:mga06z11_373772_c1 3300050494 Bacteria 856
1103 nmdc:mga06z11_7327_c1 3300050494 Bacteria 4533
1104 nmdc:mga04h51_92901_c1 3300050495 Bacteria 1088
1105 nmdc:mga07m45_168571_c1 3300050496 Bacteria 1272
1106 nmdc:mga07m45_97397_c1 3300050496 Bacteria 1688
1107 nmdc:mga05p37_222_c1 3300050507 Bacteria 57449
1108 nmdc:mga05p37_5864_c1 3300050507 Bacteria 14447
1109 nmdc:mga09592_2841_c1 3300050508 Bacteria 14047
1110 nmdc:mga0qj67_418_c1 3300050509 Bacteria 29088
1111 nmdc:mga06r32_1436_c1 3300050510 Bacteria 21509
1112 nmdc:mga08y16_1566_c1 3300050511 Bacteria 23071
1113 nmdc:mga08y16_41995_c1 3300050511 Bacteria 4789
1114 nmdc:mga08y16_4988_c1 3300050511 Bacteria 13877
1115 nmdc:mga08y16_587_c1 3300050511 Bacteria 33873
1116 nmdc:mga08y16_799686_c1 3300050511 Bacteria 936
1117 nmdc:mga0n895_14048_c1 3300050512 Bacteria 7257
1118 nmdc:mga0n895_1683_c1 3300050512 Bacteria 16689
1119 nmdc:mga0n895_34469_c1 3300050512 Bacteria 4873
1120 nmdc:mga0n895_437_c1 3300050512 Bacteria 28072
1121 nmdc:mga0n895_471926_c1 3300050512 Bacteria 1266
1122 nmdc:mga0rr50_93865_c1 3300050513 Bacteria 2342
1123 nmdc:mga08x19_218446_c1 3300050514 Bacteria 1309
1124 nmdc:mga0a205_3971_c1 3300050515 Bacteria 13224
1125 nmdc:mga0a205_440909_c1 3300050515 Bacteria 1163
1126 nmdc:mga0a205_4474_c1 3300050515 Bacteria 12544
1127 nmdc:mga0a205_721199_c1 3300050515 Bacteria 846
1128 nmdc:mga0sz30_184845_c1 3300050516 Bacteria 925
1129 Ga0495601_0000279 3300053077 Bacteria 27517
1130 Ga0495601_0000558 3300053077 Bacteria 19769
1131 Ga0495601_0002117 3300053077 Bacteria 11172
1132 Ga0495601_0002312 3300053077 Bacteria 10768
1133 Ga0495601_0033559 3300053077 Bacteria 3198
1134 Ga0495601_0207955 3300053077 Bacteria 1278
1135 Ga0495612_0001484 3300053078 Bacteria 9659
1136 Ga0495612_0003350 3300053078 Bacteria 6640
1137 Ga0495612_0012895 3300053078 Bacteria 3367
1138 Ga0495612_0017559 3300053078 Bacteria 2864
1139 Ga0495612_0058377 3300053078 Bacteria 1594
1140 Ga0495595_0002455 3300053084 Bacteria 7248
1141 Ga0495595_0003977 3300053084 Bacteria 5908
1142 Ga0495595_0005137 3300053084 Bacteria 5293
1143 Ga0495595_0031107 3300053084 Bacteria 2397
1144 Ga0495619_0000170 3300053085 Bacteria 47706
1145 Ga0495619_0000175 3300053085 Bacteria 47129
1146 Ga0495619_0003531 3300053085 Bacteria 10085
1147 Ga0495619_0013000 3300053085 Bacteria 5244
1148 Ga0495619_0019630 3300053085 Bacteria 4298
1149 Ga0495619_0023515 3300053085 Bacteria 3951
1150 Ga0495619_0042668 3300053085 Bacteria 2971
1151 Ga0495619_0203927 3300053085 Bacteria 1369
1152 Ga0500643_004624 3300053087 Bacteria 6150
1153 Ga0500644_0001616 3300053088 Bacteria 5881
1154 Ga0500651_0010263 3300053093 Bacteria 5608
1155 Ga0500566_0110663 3300053094 Bacteria 1493
1156 Ga0500566_0137171 3300053094 Bacteria 1302
1157 Ga0500650_0020033 3300053098 Bacteria 2929
1158 Ga0500595_000085 3300053119 Bacteria 65800
1159 Ga0500618_017763 3300053125 Bacteria 1767
1160 Ga0500616_0000001 3300053153 Bacteria 1986011
1161 Ga0500616_0174395 3300053153 Bacteria 973
1162 Ga0500645_000015 3300053730 Bacteria 150140
1163 Ga0501084_0077816 3300054114 Bacteria 2780
1164 Ga0501084_0291964 3300054114 Bacteria 1377
1165 Ga0501082_0000010 3300060353 Bacteria 122899
1166 Ga0501082_0018641 3300060353 Bacteria 5981
1167 Ga0501082_0702057 3300060353 Bacteria 885
1168 Ga0530510_0452400 3300061734 Bacteria 971

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_0363298 Ga0451839_0363298_36_560 172
2 3300060353 Ga0501082_0000010 Ga0501082_0000010_112587_113186 174
3 3300049582 Ga0501048_0306071 Ga0501048_0306071_449_1063 178
4 3300049583 Ga0501067_0247756 Ga0501067_0247756_361_966 183
5 3300039437 Ga0436365_1113291 Ga0436365_1113291_1145_1765 184
6 3300046663 Ga0495635_0080227 Ga0495635_0080227_736_1308 190
7 3300005937 Ga0081455_10406209 Ga0081455_104062091 192
8 3300006048 Ga0075363_100483214 Ga0075363_1004832141 192
9 3300013297 Ga0157378_10076403 Ga0157378_100764034 192
10 3300049744 Ga0501083_0033190 Ga0501083_0033190_1477_2076 192
11 3300054114 Ga0501084_0077816 Ga0501084_0077816_967_1566 192
12 3300060353 Ga0501082_0018641 Ga0501082_0018641_2648_3247 192
13 3300005331 Ga0070670_100369895 Ga0070670_1003698952 193
14 3300005338 Ga0068868_100631904 Ga0068868_1006319042 193
15 3300005343 Ga0070687_100061266 Ga0070687_1000612663 193
16 3300005577 Ga0068857_100409686 Ga0068857_1004096862 193
17 3300005617 Ga0068859_100041077 Ga0068859_1000410774 193
18 3300005618 Ga0068864_100819726 Ga0068864_1008197261 193
19 3300005618 Ga0068864_101604943 Ga0068864_1016049431 193
20 3300005719 Ga0068861_100286527 Ga0068861_1002865272 193
21 3300006931 Ga0097620_100041079 Ga0097620_1000410793 193
22 3300009101 Ga0105247_10078581 Ga0105247_100785813 193
23 3300009148 Ga0105243_10387998 Ga0105243_103879982 193
24 3300009174 Ga0105241_10103578 Ga0105241_101035782 193
25 3300009177 Ga0105248_10233587 Ga0105248_102335873 193
26 3300009551 Ga0105238_10386325 Ga0105238_103863251 193
27 3300025900 Ga0207710_10017400 Ga0207710_100174004 193
28 3300025901 Ga0207688_10236699 Ga0207688_102366992 193
29 3300025911 Ga0207654_10103935 Ga0207654_101039353 193
30 3300025918 Ga0207662_10107951 Ga0207662_101079512 193
31 3300025926 Ga0207659_10335578 Ga0207659_103355781 193
32 3300025941 Ga0207711_10054949 Ga0207711_100549494 193
33 3300026035 Ga0207703_10488795 Ga0207703_104887951 193
34 3300026041 Ga0207639_10090851 Ga0207639_100908512 193
35 3300026088 Ga0207641_10035734 Ga0207641_100357343 193
36 3300026116 Ga0207674_10037269 Ga0207674_100372696 193
37 3300026118 Ga0207675_100212039 Ga0207675_1002120393 193
38 3300042156 Ga0439446_0062200 Ga0439446_0062200_12_611 193
39 3300046474 Ga0495605_0025657 Ga0495605_0025657_2026_2625 193
40 3300048915 Ga0496112_0674750 Ga0496112_0674750_107_706 193
41 iso_pu_bacteria 2513237095 2513653036 193
42 iso_pu_bacteria 2513237102 2513706718 193
43 iso_pu_bacteria 2513237139 2513879620 193
44 iso_pu_bacteria 2517093001 2517107362 193
45 iso_pu_bacteria 2528768022 2528857749 193
46 iso_pu_bacteria 2816332527 2818244043 193
47 iso_pu_bacteria 2847939898 2847940745 193
48 iso_pu_bacteria 2929615660 2929623990 193
49 iso_pu_bacteria 2929624759 2929633376 193
50 iso_pu_bacteria 2933577622 2933585892 193
51 iso_pu_bacteria 8055742211 8055743969 193
52 3300021384 Ga0213876_10017621 Ga0213876_100176214 194
53 3300031250 Ga0265331_10070035 Ga0265331_100700353 194
54 3300031548 Ga0307408_100582029 Ga0307408_1005820291 194
55 3300039437 Ga0436365_0784090 Ga0436365_0784090_11412_12014 194
56 3300049571 Ga0501034_0385524 Ga0501034_0385524_23_625 194
57 3300049589 Ga0501073_0035920 Ga0501073_0035920_1790_2392 194
58 3300049741 Ga0501079_0048358 Ga0501079_0048358_325_927 194
59 3300049742 Ga0501080_0024694 Ga0501080_0024694_2605_3207 194
60 3300050492 nmdc:mga0yw44_448866_c1 nmdc:mga0yw44_448866_c1_15_617 194
61 3300005293 Ga0065715_10351250 Ga0065715_103512502 195
62 3300005295 Ga0065707_10284269 Ga0065707_102842691 195
63 3300005328 Ga0070676_10136143 Ga0070676_101361432 195
64 3300005331 Ga0070670_100072694 Ga0070670_1000726943 195
65 3300005331 Ga0070670_100499014 Ga0070670_1004990142 195
66 3300005334 Ga0068869_101076306 Ga0068869_1010763061 195
67 3300005335 Ga0070666_10341171 Ga0070666_103411711 195
68 3300005339 Ga0070660_100416381 Ga0070660_1004163811 195
69 3300005340 Ga0070689_100024145 Ga0070689_1000241453 195
70 3300005343 Ga0070687_100497940 Ga0070687_1004979401 195
71 3300005353 Ga0070669_100120166 Ga0070669_1001201662 195
72 3300005355 Ga0070671_100102043 Ga0070671_1001020431 195
73 3300005356 Ga0070674_100103524 Ga0070674_1001035242 195
74 3300005364 Ga0070673_100077554 Ga0070673_1000775542 195
75 3300005365 Ga0070688_100244366 Ga0070688_1002443662 195
76 3300005438 Ga0070701_10073231 Ga0070701_100732312 195
77 3300005456 Ga0070678_100187110 Ga0070678_1001871102 195
78 3300005459 Ga0068867_100101463 Ga0068867_1001014632 195
79 3300005466 Ga0070685_10049048 Ga0070685_100490484 195
80 3300005543 Ga0070672_100022535 Ga0070672_1000225355 195
81 3300005564 Ga0070664_100712422 Ga0070664_1007124221 195
82 3300005718 Ga0068866_10101656 Ga0068866_101016563 195
83 3300005840 Ga0068870_10162270 Ga0068870_101622702 195
84 3300006051 Ga0075364_10400130 Ga0075364_104001302 195
85 3300006353 Ga0075370_10114307 Ga0075370_101143072 195
86 3300006358 Ga0068871_100402199 Ga0068871_1004021991 195
87 3300006881 Ga0068865_100471102 Ga0068865_1004711021 195
88 3300009094 Ga0111539_10371175 Ga0111539_103711752 195
89 3300009098 Ga0105245_10056482 Ga0105245_100564821 195
90 3300009553 Ga0105249_11246231 Ga0105249_112462311 195
91 3300011119 Ga0105246_10141254 Ga0105246_101412542 195
92 3300013296 Ga0157374_10284941 Ga0157374_102849412 195
93 3300013297 Ga0157378_10624355 Ga0157378_106243552 195
94 3300013306 Ga0163162_10653248 Ga0163162_106532482 195
95 3300013308 Ga0157375_10476507 Ga0157375_104765072 195
96 3300014326 Ga0157380_10140684 Ga0157380_101406841 195
97 3300014745 Ga0157377_10489399 Ga0157377_104893992 195
98 3300014969 Ga0157376_10237405 Ga0157376_102374052 195
99 3300017792 Ga0163161_10192788 Ga0163161_101927882 195
100 3300025893 Ga0207682_10002328 Ga0207682_100023288 195
101 3300025901 Ga0207688_10461644 Ga0207688_104616441 195
102 3300025903 Ga0207680_10083500 Ga0207680_100835004 195
103 3300025907 Ga0207645_10041411 Ga0207645_100414111 195
104 3300025908 Ga0207643_10084137 Ga0207643_100841372 195
105 3300025919 Ga0207657_10298785 Ga0207657_102987852 195
106 3300025925 Ga0207650_10430355 Ga0207650_104303552 195
107 3300025926 Ga0207659_10165515 Ga0207659_101655152 195
108 3300025933 Ga0207706_10123367 Ga0207706_101233673 195
109 3300025935 Ga0207709_10080964 Ga0207709_100809643 195
110 3300025936 Ga0207670_10361414 Ga0207670_103614141 195
111 3300025937 Ga0207669_10029133 Ga0207669_100291332 195
112 3300025938 Ga0207704_10367216 Ga0207704_103672161 195
113 3300025940 Ga0207691_10017131 Ga0207691_100171316 195
114 3300025960 Ga0207651_10480743 Ga0207651_104807432 195
115 3300026023 Ga0207677_10753259 Ga0207677_107532592 195
116 3300026089 Ga0207648_10203846 Ga0207648_102038462 195
117 3300026116 Ga0207674_10969539 Ga0207674_109695392 195
118 3300026121 Ga0207683_10003914 Ga0207683_100039146 195
119 3300026142 Ga0207698_10923965 Ga0207698_109239652 195
120 3300046500 Ga0495596_0165411 Ga0495596_0165411_75_680 195
121 3300046537 Ga0495598_0063893 Ga0495598_0063893_156_761 195
122 3300046615 Ga0495656_0088924 Ga0495656_0088924_463_1068 195
123 3300047318 Ga0495636_0054585 Ga0495636_0054585_1030_1635 195
124 3300048090 Ga0495615_0001620 Ga0495615_0001620_2004_2609 195
125 3300049568 Ga0501031_0004683 Ga0501031_0004683_6087_6692 195
126 3300049569 Ga0501032_0180192 Ga0501032_0180192_193_798 195
127 3300049570 Ga0501033_0044841 Ga0501033_0044841_96_701 195
128 3300049571 Ga0501034_0180077 Ga0501034_0180077_711_1316 195
129 3300049573 Ga0501037_0308461 Ga0501037_0308461_433_1038 195
130 3300049575 Ga0501039_0070373 Ga0501039_0070373_1245_1850 195
131 3300049579 Ga0501043_0378793 Ga0501043_0378793_359_964 195
132 3300049581 Ga0501047_0013763 Ga0501047_0013763_6030_6635 195
133 3300049586 Ga0501070_0069981 Ga0501070_0069981_1075_1680 195
134 3300049822 Ga0501035_0159651 Ga0501035_0159651_440_1045 195
135 3300049823 Ga0501044_0022389 Ga0501044_0022389_5091_5696 195
136 3300050491 nmdc:mga00v17_366232_c1 nmdc:mga00v17_366232_c1_34_636 195
137 3300050496 nmdc:mga07m45_97397_c1 nmdc:mga07m45_97397_c1_807_1409 195
138 3300005329 Ga0070683_100065841 Ga0070683_1000658414 196
139 3300005337 Ga0070682_100047563 Ga0070682_1000475632 196
140 3300005434 Ga0070709_10058454 Ga0070709_100584543 196
141 3300005435 Ga0070714_100222407 Ga0070714_1002224071 196
142 3300005437 Ga0070710_10224483 Ga0070710_102244832 196
143 3300005439 Ga0070711_100157975 Ga0070711_1001579753 196
144 3300005458 Ga0070681_10140401 Ga0070681_101404012 196
145 3300005539 Ga0068853_100630149 Ga0068853_1006301491 196
146 3300005547 Ga0070693_100138161 Ga0070693_1001381612 196
147 3300005563 Ga0068855_100393503 Ga0068855_1003935032 196
148 3300006173 Ga0070716_100093235 Ga0070716_1000932353 196
149 3300006175 Ga0070712_100123683 Ga0070712_1001236833 196
150 3300009093 Ga0105240_10561446 Ga0105240_105614461 196
151 3300009174 Ga0105241_10409578 Ga0105241_104095782 196
152 3300009551 Ga0105238_10161226 Ga0105238_101612263 196
153 3300013100 Ga0157373_10129589 Ga0157373_101295893 196
154 3300013105 Ga0157369_10135939 Ga0157369_101359392 196
155 3300013307 Ga0157372_10530411 Ga0157372_105304113 196
156 3300021384 Ga0213876_10082674 Ga0213876_100826742 196
157 3300025898 Ga0207692_10043533 Ga0207692_100435332 196
158 3300025906 Ga0207699_10053871 Ga0207699_100538713 196
159 3300025915 Ga0207693_10040557 Ga0207693_100405574 196
160 3300025921 Ga0207652_10026585 Ga0207652_100265856 196
161 3300025929 Ga0207664_10072138 Ga0207664_100721382 196
162 3300025944 Ga0207661_10233033 Ga0207661_102330332 196
163 3300026116 Ga0207674_10351076 Ga0207674_103510763 196
164 3300031711 Ga0265314_10154477 Ga0265314_101544773 196
165 3300049569 Ga0501032_0603138 Ga0501032_0603138_48_656 196
166 3300049571 Ga0501034_0205325 Ga0501034_0205325_928_1536 196
167 3300049572 Ga0501036_0152438 Ga0501036_0152438_1203_1811 196
168 3300049579 Ga0501043_0072619 Ga0501043_0072619_999_1607 196
169 3300049581 Ga0501047_0143184 Ga0501047_0143184_863_1471 196
170 3300049583 Ga0501067_0062076 Ga0501067_0062076_194_802 196
171 3300049585 Ga0501069_0010790 Ga0501069_0010790_4155_4763 196
172 3300049586 Ga0501070_0003223 Ga0501070_0003223_13256_13864 196
173 3300049586 Ga0501070_0126246 Ga0501070_0126246_675_1283 196
174 3300049586 Ga0501070_0127313 Ga0501070_0127313_979_1587 196
175 3300049586 Ga0501070_0142271 Ga0501070_0142271_1299_1907 196
176 3300049586 Ga0501070_0622226 Ga0501070_0622226_11_619 196
177 3300049587 Ga0501071_0023980 Ga0501071_0023980_3532_4140 196
178 3300049590 Ga0501074_0076829 Ga0501074_0076829_1643_2251 196
179 3300049742 Ga0501080_0104149 Ga0501080_0104149_1078_1686 196
180 3300049742 Ga0501080_0118735 Ga0501080_0118735_498_1106 196
181 3300049742 Ga0501080_0455271 Ga0501080_0455271_230_838 196
182 3300049744 Ga0501083_0005209 Ga0501083_0005209_8168_8776 196
183 3300049822 Ga0501035_0000371 Ga0501035_0000371_50001_50609 196
184 3300049823 Ga0501044_0565159 Ga0501044_0565159_225_833 196
185 3300050514 nmdc:mga08x19_218446_c1 nmdc:mga08x19_218446_c1_27_617 196
186 3300006038 Ga0075365_10037930 Ga0075365_100379304 197
187 3300006042 Ga0075368_10009624 Ga0075368_100096242 197
188 3300006048 Ga0075363_100021775 Ga0075363_1000217755 197
189 3300006178 Ga0075367_10051919 Ga0075367_100519193 197
190 3300006195 Ga0075366_10017677 Ga0075366_100176774 197
191 3300006195 Ga0075366_10092822 Ga0075366_100928223 197
192 3300006353 Ga0075370_10053913 Ga0075370_100539132 197
193 3300014326 Ga0157380_10490820 Ga0157380_104908201 197
194 3300014497 Ga0182008_10013043 Ga0182008_100130433 197
195 3300015262 Ga0182007_10044881 Ga0182007_100448811 197
196 3300027866 Ga0209813_10090092 Ga0209813_100900921 197
197 3300035114 Ga0373939_0013941 Ga0373939_0013941_1426_2019 197
198 3300042005 Ga0439448_0197091 Ga0439448_0197091_69_683 197
199 3300042013 Ga0439456_054694 Ga0439456_054694_119_730 197
200 3300042436 Ga0439435_0000291 Ga0439435_0000291_2462_3073 197
201 3300046522 Ga0495643_0206727 Ga0495643_0206727_236_847 197
202 3300049568 Ga0501031_0175551 Ga0501031_0175551_764_1360 197
203 3300049569 Ga0501032_0252822 Ga0501032_0252822_198_794 197
204 3300049581 Ga0501047_0253955 Ga0501047_0253955_156_752 197
205 3300049744 Ga0501083_0038727 Ga0501083_0038727_2412_3008 197
206 3300049823 Ga0501044_0108177 Ga0501044_0108177_1937_2533 197
207 3300050492 nmdc:mga0yw44_228834_c1 nmdc:mga0yw44_228834_c1_295_912 197
208 3300050493 nmdc:mga0k408_147555_c1 nmdc:mga0k408_147555_c1_264_875 197
209 3300050494 nmdc:mga06z11_373772_c1 nmdc:mga06z11_373772_c1_79_696 197
210 3300050516 nmdc:mga0sz30_184845_c1 nmdc:mga0sz30_184845_c1_51_668 197
211 3300053087 Ga0500643_004624 Ga0500643_004624_3152_3808 197
212 3300053094 Ga0500566_0110663 Ga0500566_0110663_697_1353 197
213 3300053098 Ga0500650_0020033 Ga0500650_0020033_319_930 197
214 3300053119 Ga0500595_000085 Ga0500595_000085_45067_45723 197
215 3300053153 Ga0500616_0174395 Ga0500616_0174395_156_767 197
216 3300009177 Ga0105248_11205731 Ga0105248_112057311 198
217 3300028800 Ga0265338_10158624 Ga0265338_101586242 198
218 3300031344 Ga0265316_10225647 Ga0265316_102256471 198
219 3300031344 Ga0265316_10482761 Ga0265316_104827612 198
220 3300031711 Ga0265314_10036151 Ga0265314_100361512 198
221 3300036401 Ga0373937_0091412 Ga0373937_0091412_89_688 198
222 3300047444 Ga0495675_0211153 Ga0495675_0211153_172_771 198
223 3300053085 Ga0495619_0203927 Ga0495619_0203927_282_881 198
224 2209111006 2214761890 2213777783 199
225 3300000041 ARcpr5oldR_c000088 ARcpr5oldR_00008811 199
226 3300000043 ARcpr5yngRDRAFT_c000056 ARcpr5yngRDRAFT_0000567 199
227 3300000044 ARSoilOldRDRAFT_c000084 ARSoilOldRDRAFT_0000847 199
228 3300000045 ARCol0oldRDRAFT_c00490 ARCol0oldRDRAFT_004903 199
229 3300000652 ARCol0yngRDRAFT_1000059 ARCol0yngRDRAFT_100005911 199
230 3300001430 JGI24032J14994_100059 JGI24032J14994_1000595 199
231 3300001915 JGI24741J21665_1002679 JGI24741J21665_10026793 199
232 3300001976 JGI24752J21851_1000628 JGI24752J21851_10006282 199
233 3300001977 JGI24746J21847_1000020 JGI24746J21847_10000205 199
234 3300001978 JGI24747J21853_1000015 JGI24747J21853_10000152 199
235 3300001979 JGI24740J21852_10006056 JGI24740J21852_100060565 199
236 3300001989 JGI24739J22299_10000555 JGI24739J22299_100005559 199
237 3300001990 JGI24737J22298_10000446 JGI24737J22298_100004467 199
238 3300001990 JGI24737J22298_10001295 JGI24737J22298_100012959 199
239 3300001991 JGI24743J22301_10005422 JGI24743J22301_100054222 199
240 3300002067 JGI24735J21928_10097057 JGI24735J21928_100970572 199
241 3300002070 JGI24750J21931_1000321 JGI24750J21931_10003215 199
242 3300002074 JGI24748J21848_1006494 JGI24748J21848_10064941 199
243 3300002075 JGI24738J21930_10000478 JGI24738J21930_100004787 199
244 3300002076 JGI24749J21850_1000191 JGI24749J21850_10001913 199
245 3300002077 JGI24744J21845_10000650 JGI24744J21845_100006506 199
246 3300002126 JGI24035J26624_1000088 JGI24035J26624_10000883 199
247 3300002155 JGI24033J26618_1002030 JGI24033J26618_10020302 199
248 3300002239 JGI24034J26672_10000148 JGI24034J26672_100001485 199
249 3300002244 JGI24742J22300_10000055 JGI24742J22300_100000558 199
250 3300002459 JGI24751J29686_10001781 JGI24751J29686_100017812 199
251 3300003911 JGI25405J52794_10016452 JGI25405J52794_100164523 199
252 3300005277 Ga0065716_1001694 Ga0065716_10016944 199
253 3300005289 Ga0065704_10081261 Ga0065704_100812613 199
254 3300005290 Ga0065712_10004602 Ga0065712_100046022 199
255 3300005290 Ga0065712_10014918 Ga0065712_100149182 199
256 3300005290 Ga0065712_10069614 Ga0065712_100696147 199
257 3300005293 Ga0065715_10094105 Ga0065715_100941055 199
258 3300005327 Ga0070658_10057341 Ga0070658_100573413 199
259 3300005328 Ga0070676_10000186 Ga0070676_1000018625 199
260 3300005329 Ga0070683_100000064 Ga0070683_10000006447 199
261 3300005330 Ga0070690_100005166 Ga0070690_1000051662 199
262 3300005330 Ga0070690_100115693 Ga0070690_1001156932 199
263 3300005330 Ga0070690_100138780 Ga0070690_1001387802 199
264 3300005331 Ga0070670_100020384 Ga0070670_1000203841 199
265 3300005331 Ga0070670_100200564 Ga0070670_1002005641 199
266 3300005331 Ga0070670_100209543 Ga0070670_1002095432 199
267 3300005333 Ga0070677_10000330 Ga0070677_100003302 199
268 3300005334 Ga0068869_100000191 Ga0068869_10000019125 199
269 3300005334 Ga0068869_100090893 Ga0068869_1000908933 199
270 3300005335 Ga0070666_10020150 Ga0070666_100201503 199
271 3300005335 Ga0070666_10378693 Ga0070666_103786931 199
272 3300005336 Ga0070680_100008982 Ga0070680_1000089826 199
273 3300005336 Ga0070680_100009358 Ga0070680_1000093588 199
274 3300005336 Ga0070680_100027510 Ga0070680_1000275103 199
275 3300005336 Ga0070680_100196508 Ga0070680_1001965082 199
276 3300005336 Ga0070680_100199924 Ga0070680_1001999242 199
277 3300005337 Ga0070682_100001165 Ga0070682_1000011657 199
278 3300005337 Ga0070682_100032175 Ga0070682_1000321753 199
279 3300005337 Ga0070682_100050010 Ga0070682_1000500103 199
280 3300005338 Ga0068868_100000233 Ga0068868_10000023311 199
281 3300005338 Ga0068868_100015794 Ga0068868_1000157943 199
282 3300005339 Ga0070660_100000523 Ga0070660_10000052323 199
283 3300005339 Ga0070660_100049478 Ga0070660_1000494783 199
284 3300005339 Ga0070660_100083409 Ga0070660_1000834092 199
285 3300005339 Ga0070660_100160965 Ga0070660_1001609652 199
286 3300005339 Ga0070660_100412565 Ga0070660_1004125652 199
287 3300005340 Ga0070689_100000764 Ga0070689_10000076414 199
288 3300005340 Ga0070689_100022766 Ga0070689_1000227665 199
289 3300005340 Ga0070689_100069466 Ga0070689_1000694663 199
290 3300005341 Ga0070691_10002775 Ga0070691_100027751 199
291 3300005341 Ga0070691_10069908 Ga0070691_100699082 199
292 3300005343 Ga0070687_100000911 Ga0070687_1000009113 199
293 3300005343 Ga0070687_100019895 Ga0070687_1000198954 199
294 3300005344 Ga0070661_100000188 Ga0070661_10000018824 199
295 3300005345 Ga0070692_10002184 Ga0070692_100021844 199
296 3300005345 Ga0070692_10003843 Ga0070692_100038437 199
297 3300005347 Ga0070668_100000409 Ga0070668_10000040925 199
298 3300005353 Ga0070669_100000523 Ga0070669_1000005237 199
299 3300005354 Ga0070675_100000034 Ga0070675_10000003460 199
300 3300005354 Ga0070675_100262633 Ga0070675_1002626332 199
301 3300005355 Ga0070671_100000111 Ga0070671_10000011128 199
302 3300005355 Ga0070671_100015028 Ga0070671_1000150283 199
303 3300005355 Ga0070671_100040483 Ga0070671_1000404833 199
304 3300005355 Ga0070671_100189771 Ga0070671_1001897711 199
305 3300005356 Ga0070674_100000457 Ga0070674_1000004577 199
306 3300005356 Ga0070674_100042528 Ga0070674_1000425284 199
307 3300005356 Ga0070674_100163489 Ga0070674_1001634892 199
308 3300005364 Ga0070673_100000105 Ga0070673_1000001059 199
309 3300005364 Ga0070673_100057580 Ga0070673_1000575803 199
310 3300005365 Ga0070688_100000401 Ga0070688_1000004012 199
311 3300005365 Ga0070688_100004970 Ga0070688_1000049705 199
312 3300005365 Ga0070688_100032762 Ga0070688_1000327623 199
313 3300005365 Ga0070688_100275607 Ga0070688_1002756072 199
314 3300005366 Ga0070659_100000590 Ga0070659_10000059023 199
315 3300005366 Ga0070659_100048051 Ga0070659_1000480512 199
316 3300005366 Ga0070659_100048885 Ga0070659_1000488853 199
317 3300005366 Ga0070659_100265566 Ga0070659_1002655662 199
318 3300005367 Ga0070667_100004839 Ga0070667_1000048395 199
319 3300005367 Ga0070667_100117095 Ga0070667_1001170952 199
320 3300005367 Ga0070667_100694085 Ga0070667_1006940851 199
321 3300005406 Ga0070703_10020953 Ga0070703_100209532 199
322 3300005434 Ga0070709_10003572 Ga0070709_100035726 199
323 3300005434 Ga0070709_10009284 Ga0070709_100092843 199
324 3300005434 Ga0070709_10024715 Ga0070709_100247153 199
325 3300005435 Ga0070714_100017451 Ga0070714_1000174512 199
326 3300005436 Ga0070713_100000830 Ga0070713_1000008302 199
327 3300005436 Ga0070713_100014528 Ga0070713_1000145283 199
328 3300005436 Ga0070713_100345515 Ga0070713_1003455152 199
329 3300005437 Ga0070710_10002223 Ga0070710_100022233 199
330 3300005437 Ga0070710_10008148 Ga0070710_100081485 199
331 3300005438 Ga0070701_10001631 Ga0070701_100016315 199
332 3300005439 Ga0070711_100025054 Ga0070711_1000250544 199
333 3300005439 Ga0070711_100031041 Ga0070711_1000310414 199
334 3300005439 Ga0070711_100032473 Ga0070711_1000324733 199
335 3300005439 Ga0070711_100049912 Ga0070711_1000499124 199
336 3300005439 Ga0070711_100438417 Ga0070711_1004384171 199
337 3300005440 Ga0070705_100000252 Ga0070705_10000025210 199
338 3300005440 Ga0070705_100884950 Ga0070705_1008849501 199
339 3300005441 Ga0070700_100009718 Ga0070700_1000097185 199
340 3300005441 Ga0070700_100225394 Ga0070700_1002253941 199
341 3300005444 Ga0070694_100002271 Ga0070694_1000022712 199
342 3300005444 Ga0070694_100049276 Ga0070694_1000492762 199
343 3300005445 Ga0070708_100025000 Ga0070708_1000250003 199
344 3300005455 Ga0070663_100001002 Ga0070663_1000010029 199
345 3300005455 Ga0070663_100057226 Ga0070663_1000572264 199
346 3300005455 Ga0070663_100067388 Ga0070663_1000673883 199
347 3300005455 Ga0070663_100083501 Ga0070663_1000835013 199
348 3300005455 Ga0070663_100571252 Ga0070663_1005712523 199
349 3300005456 Ga0070678_100000033 Ga0070678_10000003328 199
350 3300005456 Ga0070678_100384874 Ga0070678_1003848741 199
351 3300005457 Ga0070662_100002444 Ga0070662_1000024446 199
352 3300005457 Ga0070662_100008859 Ga0070662_1000088595 199
353 3300005458 Ga0070681_10003475 Ga0070681_100034756 199
354 3300005458 Ga0070681_10006724 Ga0070681_100067247 199
355 3300005458 Ga0070681_10061299 Ga0070681_100612994 199
356 3300005458 Ga0070681_10113593 Ga0070681_101135932 199
357 3300005458 Ga0070681_10580382 Ga0070681_105803822 199
358 3300005459 Ga0068867_100002276 Ga0068867_1000022767 199
359 3300005466 Ga0070685_10014131 Ga0070685_100141314 199
360 3300005518 Ga0070699_100081552 Ga0070699_1000815523 199
361 3300005518 Ga0070699_100832246 Ga0070699_1008322461 199
362 3300005530 Ga0070679_100010016 Ga0070679_1000100169 199
363 3300005530 Ga0070679_100022664 Ga0070679_1000226646 199
364 3300005530 Ga0070679_100092473 Ga0070679_1000924733 199
365 3300005530 Ga0070679_100609994 Ga0070679_1006099941 199
366 3300005535 Ga0070684_100000275 Ga0070684_10000027527 199
367 3300005535 Ga0070684_100153294 Ga0070684_1001532942 199
368 3300005535 Ga0070684_100666655 Ga0070684_1006666552 199
369 3300005535 Ga0070684_100983172 Ga0070684_1009831721 199
370 3300005539 Ga0068853_100009622 Ga0068853_1000096229 199
371 3300005539 Ga0068853_100305029 Ga0068853_1003050293 199
372 3300005543 Ga0070672_100000008 Ga0070672_10000000828 199
373 3300005543 Ga0070672_100085799 Ga0070672_1000857991 199
374 3300005544 Ga0070686_100000309 Ga0070686_10000030913 199
375 3300005544 Ga0070686_100011935 Ga0070686_1000119355 199
376 3300005544 Ga0070686_100015096 Ga0070686_1000150963 199
377 3300005544 Ga0070686_100262906 Ga0070686_1002629061 199
378 3300005544 Ga0070686_100654043 Ga0070686_1006540431 199
379 3300005545 Ga0070695_100000270 Ga0070695_10000027023 199
380 3300005545 Ga0070695_100008070 Ga0070695_1000080704 199
381 3300005546 Ga0070696_100001699 Ga0070696_1000016999 199
382 3300005546 Ga0070696_100087396 Ga0070696_1000873964 199
383 3300005546 Ga0070696_100136655 Ga0070696_1001366553 199
384 3300005546 Ga0070696_100331039 Ga0070696_1003310392 199
385 3300005547 Ga0070693_100000453 Ga0070693_1000004537 199
386 3300005547 Ga0070693_100006956 Ga0070693_1000069563 199
387 3300005548 Ga0070665_100071774 Ga0070665_1000717743 199
388 3300005549 Ga0070704_100001241 Ga0070704_1000012417 199
389 3300005563 Ga0068855_100011392 Ga0068855_1000113921 199
390 3300005563 Ga0068855_100063943 Ga0068855_1000639435 199
391 3300005563 Ga0068855_100122511 Ga0068855_1001225113 199
392 3300005563 Ga0068855_100149266 Ga0068855_1001492663 199
393 3300005563 Ga0068855_100192777 Ga0068855_1001927772 199
394 3300005564 Ga0070664_100000419 Ga0070664_10000041910 199
395 3300005564 Ga0070664_100083276 Ga0070664_1000832762 199
396 3300005564 Ga0070664_100225349 Ga0070664_1002253491 199
397 3300005564 Ga0070664_100417159 Ga0070664_1004171593 199
398 3300005564 Ga0070664_100626623 Ga0070664_1006266231 199
399 3300005577 Ga0068857_100005226 Ga0068857_1000052262 199
400 3300005577 Ga0068857_100218836 Ga0068857_1002188363 199
401 3300005578 Ga0068854_100040383 Ga0068854_1000403831 199
402 3300005578 Ga0068854_100131394 Ga0068854_1001313942 199
403 3300005578 Ga0068854_100384774 Ga0068854_1003847742 199
404 3300005614 Ga0068856_100000963 Ga0068856_1000009638 199
405 3300005614 Ga0068856_100275336 Ga0068856_1002753361 199
406 3300005614 Ga0068856_100838421 Ga0068856_1008384211 199
407 3300005615 Ga0070702_100068997 Ga0070702_1000689973 199
408 3300005615 Ga0070702_100075961 Ga0070702_1000759613 199
409 3300005616 Ga0068852_100024652 Ga0068852_1000246522 199
410 3300005616 Ga0068852_100198211 Ga0068852_1001982112 199
411 3300005616 Ga0068852_100327035 Ga0068852_1003270353 199
412 3300005617 Ga0068859_100010517 Ga0068859_1000105175 199
413 3300005617 Ga0068859_100038950 Ga0068859_1000389502 199
414 3300005617 Ga0068859_100158936 Ga0068859_1001589363 199
415 3300005618 Ga0068864_100013519 Ga0068864_1000135198 199
416 3300005618 Ga0068864_100041276 Ga0068864_1000412763 199
417 3300005618 Ga0068864_100344145 Ga0068864_1003441453 199
418 3300005718 Ga0068866_10000291 Ga0068866_1000029125 199
419 3300005719 Ga0068861_100001375 Ga0068861_1000013759 199
420 3300005719 Ga0068861_100031191 Ga0068861_1000311912 199
421 3300005719 Ga0068861_100252446 Ga0068861_1002524462 199
422 3300005834 Ga0068851_10028004 Ga0068851_100280042 199
423 3300005840 Ga0068870_10000005 Ga0068870_1000000528 199
424 3300005841 Ga0068863_100000608 Ga0068863_1000006089 199
425 3300005841 Ga0068863_100066955 Ga0068863_1000669552 199
426 3300005841 Ga0068863_100157381 Ga0068863_1001573811 199
427 3300005842 Ga0068858_100014751 Ga0068858_1000147519 199
428 3300005842 Ga0068858_100024402 Ga0068858_1000244022 199
429 3300005842 Ga0068858_100043968 Ga0068858_1000439682 199
430 3300005842 Ga0068858_100367397 Ga0068858_1003673972 199
431 3300005842 Ga0068858_100404091 Ga0068858_1004040912 199
432 3300005843 Ga0068860_100001183 Ga0068860_10000118325 199
433 3300005843 Ga0068860_100172126 Ga0068860_1001721263 199
434 3300005843 Ga0068860_100317499 Ga0068860_1003174993 199
435 3300005844 Ga0068862_100010075 Ga0068862_1000100752 199
436 3300005844 Ga0068862_100013288 Ga0068862_1000132884 199
437 3300005844 Ga0068862_100968330 Ga0068862_1009683301 199
438 3300005937 Ga0081455_10000002 Ga0081455_100000024 199
439 3300005937 Ga0081455_10004074 Ga0081455_100040743 199
440 3300006028 Ga0070717_10002981 Ga0070717_100029819 199
441 3300006042 Ga0075368_10180832 Ga0075368_101808322 199
442 3300006058 Ga0075432_10005509 Ga0075432_100055093 199
443 3300006058 Ga0075432_10015716 Ga0075432_100157163 199
444 3300006163 Ga0070715_10034535 Ga0070715_100345352 199
445 3300006163 Ga0070715_10099511 Ga0070715_100995111 199
446 3300006173 Ga0070716_100170001 Ga0070716_1001700012 199
447 3300006173 Ga0070716_100376753 Ga0070716_1003767531 199
448 3300006175 Ga0070712_100016065 Ga0070712_1000160655 199
449 3300006175 Ga0070712_100230144 Ga0070712_1002301442 199
450 3300006178 Ga0075367_10031675 Ga0075367_100316753 199
451 3300006194 Ga0075427_10001679 Ga0075427_100016792 199
452 3300006237 Ga0097621_100000006 Ga0097621_10000000627 199
453 3300006237 Ga0097621_100054592 Ga0097621_1000545923 199
454 3300006237 Ga0097621_100212178 Ga0097621_1002121782 199
455 3300006353 Ga0075370_10173773 Ga0075370_101737732 199
456 3300006358 Ga0068871_100000022 Ga0068871_10000002253 199
457 3300006358 Ga0068871_100004373 Ga0068871_1000043734 199
458 3300006358 Ga0068871_100052461 Ga0068871_1000524613 199
459 3300006844 Ga0075428_100010613 Ga0075428_1000106134 199
460 3300006846 Ga0075430_100000485 Ga0075430_10000048516 199
461 3300006847 Ga0075431_100002570 Ga0075431_10000257014 199
462 3300006852 Ga0075433_10001502 Ga0075433_100015027 199
463 3300006852 Ga0075433_10010359 Ga0075433_100103596 199
464 3300006852 Ga0075433_10117392 Ga0075433_101173923 199
465 3300006852 Ga0075433_10622926 Ga0075433_106229261 199
466 3300006871 Ga0075434_100000877 Ga0075434_10000087715 199
467 3300006871 Ga0075434_100001706 Ga0075434_1000017067 199
468 3300006871 Ga0075434_100159920 Ga0075434_1001599203 199
469 3300006871 Ga0075434_100296944 Ga0075434_1002969442 199
470 3300006880 Ga0075429_100000667 Ga0075429_10000066719 199
471 3300006881 Ga0068865_100000196 Ga0068865_10000019628 199
472 3300006881 Ga0068865_100017462 Ga0068865_1000174623 199
473 3300006881 Ga0068865_100024862 Ga0068865_1000248622 199
474 3300006881 Ga0068865_100088317 Ga0068865_1000883173 199
475 3300006914 Ga0075436_100207518 Ga0075436_1002075181 199
476 3300006931 Ga0097620_100010517 Ga0097620_1000105175 199
477 3300006931 Ga0097620_100038950 Ga0097620_1000389505 199
478 3300006931 Ga0097620_100158937 Ga0097620_1001589373 199
479 3300007076 Ga0075435_100007750 Ga0075435_1000077503 199
480 3300007076 Ga0075435_100220275 Ga0075435_1002202752 199
481 3300007076 Ga0075435_100735858 Ga0075435_1007358581 199
482 3300009011 Ga0105251_10011249 Ga0105251_100112494 199
483 3300009011 Ga0105251_10020989 Ga0105251_100209893 199
484 3300009092 Ga0105250_10013540 Ga0105250_100135403 199
485 3300009092 Ga0105250_10193910 Ga0105250_101939102 199
486 3300009093 Ga0105240_10179599 Ga0105240_101795993 199
487 3300009093 Ga0105240_10205550 Ga0105240_102055503 199
488 3300009093 Ga0105240_10490741 Ga0105240_104907413 199
489 3300009093 Ga0105240_10493529 Ga0105240_104935292 199
490 3300009093 Ga0105240_10885784 Ga0105240_108857841 199
491 3300009094 Ga0111539_10000817 Ga0111539_100008175 199
492 3300009094 Ga0111539_10001765 Ga0111539_1000176524 199
493 3300009094 Ga0111539_10001792 Ga0111539_100017927 199
494 3300009094 Ga0111539_10047909 Ga0111539_100479092 199
495 3300009094 Ga0111539_10417137 Ga0111539_104171371 199
496 3300009098 Ga0105245_10001176 Ga0105245_1000117618 199
497 3300009098 Ga0105245_10065447 Ga0105245_100654473 199
498 3300009098 Ga0105245_10577791 Ga0105245_105777912 199
499 3300009101 Ga0105247_10001410 Ga0105247_1000141014 199
500 3300009101 Ga0105247_10037063 Ga0105247_100370633 199
501 3300009101 Ga0105247_10096434 Ga0105247_100964343 199
502 3300009101 Ga0105247_10384478 Ga0105247_103844781 199
503 3300009147 Ga0114129_10005250 Ga0114129_100052508 199
504 3300009147 Ga0114129_10045189 Ga0114129_100451894 199
505 3300009148 Ga0105243_10002512 Ga0105243_100025127 199
506 3300009148 Ga0105243_10002946 Ga0105243_100029469 199
507 3300009148 Ga0105243_10155191 Ga0105243_101551911 199
508 3300009148 Ga0105243_10160393 Ga0105243_101603931 199
509 3300009148 Ga0105243_10243132 Ga0105243_102431323 199
510 3300009174 Ga0105241_10006541 Ga0105241_100065419 199
511 3300009174 Ga0105241_10138834 Ga0105241_101388343 199
512 3300009174 Ga0105241_11458188 Ga0105241_114581881 199
513 3300009176 Ga0105242_10000879 Ga0105242_1000087910 199
514 3300009176 Ga0105242_10015607 Ga0105242_100156074 199
515 3300009176 Ga0105242_10473463 Ga0105242_104734632 199
516 3300009176 Ga0105242_10505322 Ga0105242_105053221 199
517 3300009176 Ga0105242_10850631 Ga0105242_108506311 199
518 3300009177 Ga0105248_10012400 Ga0105248_100124006 199
519 3300009177 Ga0105248_10034418 Ga0105248_100344181 199
520 3300009177 Ga0105248_10174583 Ga0105248_101745832 199
521 3300009545 Ga0105237_10043805 Ga0105237_100438052 199
522 3300009545 Ga0105237_10135140 Ga0105237_101351403 199
523 3300009551 Ga0105238_10119323 Ga0105238_101193233 199
524 3300009551 Ga0105238_10221644 Ga0105238_102216443 199
525 3300009551 Ga0105238_11149496 Ga0105238_111494961 199
526 3300009553 Ga0105249_10003131 Ga0105249_100031317 199
527 3300009553 Ga0105249_10003187 Ga0105249_100031877 199
528 3300009553 Ga0105249_10328827 Ga0105249_103288271 199
529 3300009553 Ga0105249_10673586 Ga0105249_106735862 199
530 3300010375 Ga0105239_10001436 Ga0105239_1000143610 199
531 3300010375 Ga0105239_10010581 Ga0105239_100105814 199
532 3300010375 Ga0105239_10607302 Ga0105239_106073021 199
533 3300011119 Ga0105246_10000984 Ga0105246_100009848 199
534 3300012494 Ga0157341_1014616 Ga0157341_10146161 199
535 3300012505 Ga0157339_1004819 Ga0157339_10048191 199
536 3300012513 Ga0157326_1004464 Ga0157326_10044643 199
537 3300012515 Ga0157338_1000604 Ga0157338_10006042 199
538 3300012515 Ga0157338_1001184 Ga0157338_10011842 199
539 3300013100 Ga0157373_10023028 Ga0157373_100230284 199
540 3300013100 Ga0157373_10033867 Ga0157373_100338674 199
541 3300013100 Ga0157373_10067713 Ga0157373_100677131 199
542 3300013102 Ga0157371_10227785 Ga0157371_102277853 199
543 3300013102 Ga0157371_10242990 Ga0157371_102429901 199
544 3300013102 Ga0157371_10316006 Ga0157371_103160061 199
545 3300013104 Ga0157370_10035810 Ga0157370_100358106 199
546 3300013104 Ga0157370_10062601 Ga0157370_100626014 199
547 3300013105 Ga0157369_10123103 Ga0157369_101231034 199
548 3300013105 Ga0157369_10154077 Ga0157369_101540773 199
549 3300013105 Ga0157369_10596731 Ga0157369_105967312 199
550 3300013105 Ga0157369_10701506 Ga0157369_107015062 199
551 3300013105 Ga0157369_11180794 Ga0157369_111807941 199
552 3300013296 Ga0157374_10012602 Ga0157374_100126028 199
553 3300013296 Ga0157374_10071928 Ga0157374_100719283 199
554 3300013296 Ga0157374_10116537 Ga0157374_101165373 199
555 3300013297 Ga0157378_10001496 Ga0157378_1000149613 199
556 3300013297 Ga0157378_10058064 Ga0157378_100580642 199
557 3300013297 Ga0157378_10266059 Ga0157378_102660592 199
558 3300013306 Ga0163162_10004276 Ga0163162_100042768 199
559 3300013306 Ga0163162_10006826 Ga0163162_100068265 199
560 3300013307 Ga0157372_10060986 Ga0157372_100609864 199
561 3300013308 Ga0157375_10000732 Ga0157375_100007329 199
562 3300013308 Ga0157375_10082399 Ga0157375_100823994 199
563 3300013308 Ga0157375_10099660 Ga0157375_100996603 199
564 3300013308 Ga0157375_10202201 Ga0157375_102022011 199
565 3300013308 Ga0157375_11402191 Ga0157375_114021911 199
566 3300014325 Ga0163163_10005114 Ga0163163_100051145 199
567 3300014325 Ga0163163_10111377 Ga0163163_101113772 199
568 3300014326 Ga0157380_10000551 Ga0157380_100005515 199
569 3300014326 Ga0157380_10796026 Ga0157380_107960261 199
570 3300014326 Ga0157380_11367712 Ga0157380_113677121 199
571 3300014745 Ga0157377_10000127 Ga0157377_1000012726 199
572 3300014968 Ga0157379_10016175 Ga0157379_100161758 199
573 3300014968 Ga0157379_10017453 Ga0157379_100174538 199
574 3300014968 Ga0157379_10203258 Ga0157379_102032582 199
575 3300014968 Ga0157379_10537674 Ga0157379_105376742 199
576 3300014969 Ga0157376_10000126 Ga0157376_1000012624 199
577 3300014969 Ga0157376_10106117 Ga0157376_101061172 199
578 3300017792 Ga0163161_10000562 Ga0163161_100005625 199
579 3300017792 Ga0163161_10061780 Ga0163161_100617801 199
580 3300017792 Ga0163161_10209982 Ga0163161_102099823 199
581 3300020070 Ga0206356_11340422 Ga0206356_113404222 199
582 3300025271 Ga0207666_1000211 Ga0207666_10002112 199
583 3300025271 Ga0207666_1000213 Ga0207666_10002134 199
584 3300025290 Ga0207673_1000023 Ga0207673_10000236 199
585 3300025315 Ga0207697_10000369 Ga0207697_100003697 199
586 3300025711 Ga0207696_1042459 Ga0207696_10424592 199
587 3300025735 Ga0207713_1040519 Ga0207713_10405192 199
588 3300025885 Ga0207653_10004957 Ga0207653_100049575 199
589 3300025893 Ga0207682_10000001 Ga0207682_1000000142 199
590 3300025898 Ga0207692_10090640 Ga0207692_100906403 199
591 3300025898 Ga0207692_10312665 Ga0207692_103126651 199
592 3300025899 Ga0207642_10000346 Ga0207642_100003462 199
593 3300025899 Ga0207642_10009174 Ga0207642_100091743 199
594 3300025900 Ga0207710_10002668 Ga0207710_100026683 199
595 3300025900 Ga0207710_10014949 Ga0207710_100149491 199
596 3300025900 Ga0207710_10016601 Ga0207710_100166012 199
597 3300025901 Ga0207688_10000694 Ga0207688_100006949 199
598 3300025901 Ga0207688_10038648 Ga0207688_100386483 199
599 3300025901 Ga0207688_10081821 Ga0207688_100818213 199
600 3300025903 Ga0207680_10002770 Ga0207680_100027703 199
601 3300025904 Ga0207647_10005072 Ga0207647_100050723 199
602 3300025904 Ga0207647_10006956 Ga0207647_100069565 199
603 3300025905 Ga0207685_10043858 Ga0207685_100438582 199
604 3300025906 Ga0207699_10000333 Ga0207699_1000033319 199
605 3300025906 Ga0207699_10014241 Ga0207699_100142413 199
606 3300025907 Ga0207645_10000862 Ga0207645_100008627 199
607 3300025907 Ga0207645_10061456 Ga0207645_100614563 199
608 3300025907 Ga0207645_10137055 Ga0207645_101370552 199
609 3300025907 Ga0207645_10323823 Ga0207645_103238232 199
610 3300025908 Ga0207643_10000041 Ga0207643_1000004181 199
611 3300025909 Ga0207705_10026744 Ga0207705_100267443 199
612 3300025909 Ga0207705_10060008 Ga0207705_100600082 199
613 3300025911 Ga0207654_10001213 Ga0207654_1000121313 199
614 3300025911 Ga0207654_10096705 Ga0207654_100967052 199
615 3300025912 Ga0207707_10001359 Ga0207707_1000135916 199
616 3300025912 Ga0207707_10040910 Ga0207707_100409104 199
617 3300025912 Ga0207707_10089808 Ga0207707_100898083 199
618 3300025912 Ga0207707_10126818 Ga0207707_101268181 199
619 3300025912 Ga0207707_10187380 Ga0207707_101873802 199
620 3300025912 Ga0207707_10284810 Ga0207707_102848102 199
621 3300025912 Ga0207707_10288584 Ga0207707_102885843 199
622 3300025913 Ga0207695_10053991 Ga0207695_100539913 199
623 3300025913 Ga0207695_10240990 Ga0207695_102409903 199
624 3300025914 Ga0207671_10022738 Ga0207671_100227385 199
625 3300025914 Ga0207671_10371231 Ga0207671_103712311 199
626 3300025915 Ga0207693_10003835 Ga0207693_1000383511 199
627 3300025915 Ga0207693_10309096 Ga0207693_103090962 199
628 3300025916 Ga0207663_10011514 Ga0207663_100115141 199
629 3300025916 Ga0207663_10018037 Ga0207663_100180374 199
630 3300025916 Ga0207663_10022636 Ga0207663_100226365 199
631 3300025916 Ga0207663_10059718 Ga0207663_100597183 199
632 3300025917 Ga0207660_10000006 Ga0207660_1000000671 199
633 3300025917 Ga0207660_10024028 Ga0207660_100240283 199
634 3300025917 Ga0207660_10091681 Ga0207660_100916813 199
635 3300025917 Ga0207660_10364100 Ga0207660_103641001 199
636 3300025918 Ga0207662_10000207 Ga0207662_100002077 199
637 3300025918 Ga0207662_10003071 Ga0207662_100030718 199
638 3300025919 Ga0207657_10005584 Ga0207657_100055847 199
639 3300025919 Ga0207657_10029437 Ga0207657_100294372 199
640 3300025919 Ga0207657_10077821 Ga0207657_100778213 199
641 3300025919 Ga0207657_10128448 Ga0207657_101284481 199
642 3300025919 Ga0207657_10267183 Ga0207657_102671833 199
643 3300025920 Ga0207649_10000049 Ga0207649_1000004935 199
644 3300025920 Ga0207649_10341178 Ga0207649_103411782 199
645 3300025921 Ga0207652_10000300 Ga0207652_1000030013 199
646 3300025921 Ga0207652_10021269 Ga0207652_100212694 199
647 3300025921 Ga0207652_10062764 Ga0207652_100627643 199
648 3300025921 Ga0207652_10161541 Ga0207652_101615412 199
649 3300025921 Ga0207652_10214373 Ga0207652_102143732 199
650 3300025921 Ga0207652_10299759 Ga0207652_102997591 199
651 3300025922 Ga0207646_10499612 Ga0207646_104996122 199
652 3300025923 Ga0207681_10000024 Ga0207681_10000024149 199
653 3300025924 Ga0207694_10064079 Ga0207694_100640793 199
654 3300025924 Ga0207694_10172650 Ga0207694_101726503 199
655 3300025925 Ga0207650_10005629 Ga0207650_100056293 199
656 3300025925 Ga0207650_10090190 Ga0207650_100901902 199
657 3300025925 Ga0207650_10302567 Ga0207650_103025671 199
658 3300025926 Ga0207659_10000042 Ga0207659_1000004260 199
659 3300025926 Ga0207659_10350242 Ga0207659_103502422 199
660 3300025927 Ga0207687_10000476 Ga0207687_1000047616 199
661 3300025927 Ga0207687_10064144 Ga0207687_100641442 199
662 3300025927 Ga0207687_10155565 Ga0207687_101555653 199
663 3300025927 Ga0207687_10536967 Ga0207687_105369671 199
664 3300025928 Ga0207700_10003404 Ga0207700_100034044 199
665 3300025928 Ga0207700_10086425 Ga0207700_100864252 199
666 3300025929 Ga0207664_10159241 Ga0207664_101592413 199
667 3300025931 Ga0207644_10000041 Ga0207644_1000004157 199
668 3300025931 Ga0207644_10018193 Ga0207644_100181933 199
669 3300025931 Ga0207644_10062431 Ga0207644_100624312 199
670 3300025931 Ga0207644_10320097 Ga0207644_103200973 199
671 3300025932 Ga0207690_10000137 Ga0207690_1000013724 199
672 3300025932 Ga0207690_10020306 Ga0207690_100203064 199
673 3300025933 Ga0207706_10010775 Ga0207706_100107752 199
674 3300025933 Ga0207706_10056164 Ga0207706_100561644 199
675 3300025933 Ga0207706_10113807 Ga0207706_101138073 199
676 3300025934 Ga0207686_10001872 Ga0207686_100018727 199
677 3300025934 Ga0207686_10364711 Ga0207686_103647111 199
678 3300025935 Ga0207709_10000220 Ga0207709_1000022042 199
679 3300025935 Ga0207709_10008968 Ga0207709_100089683 199
680 3300025935 Ga0207709_10361788 Ga0207709_103617882 199
681 3300025935 Ga0207709_10658941 Ga0207709_106589411 199
682 3300025936 Ga0207670_10000323 Ga0207670_100003237 199
683 3300025936 Ga0207670_10109615 Ga0207670_101096152 199
684 3300025937 Ga0207669_10000005 Ga0207669_10000005126 199
685 3300025937 Ga0207669_10029285 Ga0207669_100292853 199
686 3300025937 Ga0207669_10033772 Ga0207669_100337723 199
687 3300025938 Ga0207704_10000060 Ga0207704_1000006027 199
688 3300025938 Ga0207704_10017052 Ga0207704_100170522 199
689 3300025938 Ga0207704_10313975 Ga0207704_103139752 199
690 3300025939 Ga0207665_10000210 Ga0207665_1000021043 199
691 3300025940 Ga0207691_10001272 Ga0207691_100012727 199
692 3300025941 Ga0207711_10011312 Ga0207711_100113122 199
693 3300025941 Ga0207711_10016725 Ga0207711_100167252 199
694 3300025941 Ga0207711_10031220 Ga0207711_100312203 199
695 3300025941 Ga0207711_10057776 Ga0207711_100577763 199
696 3300025942 Ga0207689_10000053 Ga0207689_1000005324 199
697 3300025942 Ga0207689_10033493 Ga0207689_100334933 199
698 3300025944 Ga0207661_10000036 Ga0207661_10000036139 199
699 3300025945 Ga0207679_10000060 Ga0207679_1000006050 199
700 3300025945 Ga0207679_10259210 Ga0207679_102592102 199
701 3300025945 Ga0207679_10486478 Ga0207679_104864782 199
702 3300025945 Ga0207679_10728592 Ga0207679_107285921 199
703 3300025949 Ga0207667_10024638 Ga0207667_100246388 199
704 3300025949 Ga0207667_10045229 Ga0207667_100452292 199
705 3300025949 Ga0207667_10263521 Ga0207667_102635213 199
706 3300025949 Ga0207667_10392647 Ga0207667_103926471 199
707 3300025949 Ga0207667_10618642 Ga0207667_106186421 199
708 3300025960 Ga0207651_10000014 Ga0207651_1000001452 199
709 3300025960 Ga0207651_10085220 Ga0207651_100852201 199
710 3300025961 Ga0207712_10000134 Ga0207712_1000013471 199
711 3300025961 Ga0207712_10101883 Ga0207712_101018833 199
712 3300025961 Ga0207712_10713818 Ga0207712_107138181 199
713 3300025972 Ga0207668_10000350 Ga0207668_1000035026 199
714 3300025972 Ga0207668_10058222 Ga0207668_100582222 199
715 3300025981 Ga0207640_10000352 Ga0207640_1000035214 199
716 3300025981 Ga0207640_10164931 Ga0207640_101649312 199
717 3300025981 Ga0207640_10308538 Ga0207640_103085382 199
718 3300025986 Ga0207658_10004967 Ga0207658_100049676 199
719 3300025986 Ga0207658_10097729 Ga0207658_100977291 199
720 3300025986 Ga0207658_10646205 Ga0207658_106462052 199
721 3300026023 Ga0207677_10001126 Ga0207677_100011267 199
722 3300026023 Ga0207677_10669024 Ga0207677_106690241 199
723 3300026035 Ga0207703_10001140 Ga0207703_1000114017 199
724 3300026035 Ga0207703_10005127 Ga0207703_100051279 199
725 3300026035 Ga0207703_10015688 Ga0207703_100156885 199
726 3300026035 Ga0207703_10060573 Ga0207703_100605733 199
727 3300026041 Ga0207639_10000411 Ga0207639_100004117 199
728 3300026041 Ga0207639_10218915 Ga0207639_102189152 199
729 3300026041 Ga0207639_11053817 Ga0207639_110538171 199
730 3300026067 Ga0207678_10000892 Ga0207678_1000089224 199
731 3300026067 Ga0207678_10014646 Ga0207678_100146462 199
732 3300026067 Ga0207678_10057977 Ga0207678_100579772 199
733 3300026067 Ga0207678_10122419 Ga0207678_101224193 199
734 3300026075 Ga0207708_10002664 Ga0207708_100026647 199
735 3300026075 Ga0207708_10048230 Ga0207708_100482304 199
736 3300026078 Ga0207702_10000228 Ga0207702_1000022844 199
737 3300026078 Ga0207702_10434257 Ga0207702_104342572 199
738 3300026078 Ga0207702_10924324 Ga0207702_109243242 199
739 3300026088 Ga0207641_10000664 Ga0207641_100006647 199
740 3300026088 Ga0207641_10064132 Ga0207641_100641324 199
741 3300026088 Ga0207641_10333219 Ga0207641_103332192 199
742 3300026088 Ga0207641_10420855 Ga0207641_104208552 199
743 3300026088 Ga0207641_11179568 Ga0207641_111795681 199
744 3300026089 Ga0207648_10001423 Ga0207648_100014237 199
745 3300026089 Ga0207648_10231977 Ga0207648_102319772 199
746 3300026095 Ga0207676_10000358 Ga0207676_100003582 199
747 3300026095 Ga0207676_10004777 Ga0207676_100047777 199
748 3300026116 Ga0207674_10000314 Ga0207674_100003142 199
749 3300026116 Ga0207674_10016649 Ga0207674_100166497 199
750 3300026116 Ga0207674_10159097 Ga0207674_101590972 199
751 3300026116 Ga0207674_10405397 Ga0207674_104053972 199
752 3300026118 Ga0207675_100004673 Ga0207675_1000046739 199
753 3300026118 Ga0207675_100063045 Ga0207675_1000630452 199
754 3300026118 Ga0207675_100075170 Ga0207675_1000751704 199
755 3300026121 Ga0207683_10000001 Ga0207683_10000001251 199
756 3300026121 Ga0207683_10005246 Ga0207683_100052469 199
757 3300026121 Ga0207683_10005378 Ga0207683_100053783 199
758 3300026142 Ga0207698_10000999 Ga0207698_100009999 199
759 3300026142 Ga0207698_10065013 Ga0207698_100650133 199
760 3300027395 Ga0209996_1004434 Ga0209996_10044342 199
761 3300027424 Ga0209984_1001890 Ga0209984_10018903 199
762 3300027462 Ga0210000_1009970 Ga0210000_10099703 199
763 3300027526 Ga0209968_1016232 Ga0209968_10162322 199
764 3300027543 Ga0209999_1007612 Ga0209999_10076123 199
765 3300027552 Ga0209982_1004169 Ga0209982_10041692 199
766 3300027614 Ga0209970_1018978 Ga0209970_10189782 199
767 3300027617 Ga0210002_1000546 Ga0210002_10005462 199
768 3300027617 Ga0210002_1032379 Ga0210002_10323792 199
769 3300027665 Ga0209983_1015238 Ga0209983_10152383 199
770 3300027665 Ga0209983_1085077 Ga0209983_10850771 199
771 3300027695 Ga0209966_1001821 Ga0209966_10018212 199
772 3300027717 Ga0209998_10001014 Ga0209998_100010142 199
773 3300027717 Ga0209998_10001223 Ga0209998_100012236 199
774 3300027717 Ga0209998_10002226 Ga0209998_100022265 199
775 3300027876 Ga0209974_10003271 Ga0209974_100032715 199
776 3300027876 Ga0209974_10106402 Ga0209974_101064021 199
777 3300027907 Ga0207428_10000316 Ga0207428_1000031647 199
778 3300027907 Ga0207428_10000897 Ga0207428_1000089727 199
779 3300027907 Ga0207428_10000923 Ga0207428_1000092326 199
780 3300027907 Ga0207428_10302598 Ga0207428_103025982 199
781 3300028379 Ga0268266_10011674 Ga0268266_100116744 199
782 3300028380 Ga0268265_10000146 Ga0268265_1000014662 199
783 3300028380 Ga0268265_10012031 Ga0268265_100120315 199
784 3300028381 Ga0268264_10000976 Ga0268264_100009766 199
785 3300028381 Ga0268264_10202635 Ga0268264_102026352 199
786 3300028381 Ga0268264_10249514 Ga0268264_102495142 199
787 3300028556 Ga0265337_1000979 Ga0265337_10009793 199
788 3300028800 Ga0265338_10100432 Ga0265338_101004322 199
789 3300031235 Ga0265330_10012738 Ga0265330_100127382 199
790 3300031241 Ga0265325_10000097 Ga0265325_1000009737 199
791 3300031241 Ga0265325_10020634 Ga0265325_100206342 199
792 3300031247 Ga0265340_10027609 Ga0265340_100276092 199
793 3300031249 Ga0265339_10037773 Ga0265339_100377731 199
794 3300031595 Ga0265313_10009818 Ga0265313_100098182 199
795 3300031595 Ga0265313_10036332 Ga0265313_100363324 199
796 3300031665 Ga0316575_10005354 Ga0316575_100053544 199
797 3300031711 Ga0265314_10000829 Ga0265314_1000082932 199
798 3300031711 Ga0265314_10366826 Ga0265314_103668261 199
799 3300031712 Ga0265342_10029877 Ga0265342_100298773 199
800 3300031712 Ga0265342_10034349 Ga0265342_100343491 199
801 3300032133 Ga0316583_10000713 Ga0316583_100007135 199
802 3300034816 Ga0373930_0000210 Ga0373930_0000210_2973_3572 199
803 3300034817 Ga0373948_0000429 Ga0373948_0000429_3096_3695 199
804 3300034818 Ga0373950_0000149 Ga0373950_0000149_8865_9464 199
805 3300034818 Ga0373950_0010349 Ga0373950_0010349_812_1465 199
806 3300034819 Ga0373958_0005446 Ga0373958_0005446_977_1576 199
807 3300034820 Ga0373959_0005882 Ga0373959_0005882_362_961 199
808 3300034957 Ga0373938_0000214 Ga0373938_0000214_2411_3010 199
809 3300034957 Ga0373938_0000487 Ga0373938_0000487_672_1271 199
810 3300035083 Ga0373926_0013860 Ga0373926_0013860_2092_2691 199
811 3300035084 Ga0373928_0000527 Ga0373928_0000527_2530_3129 199
812 3300035085 Ga0373929_0001507 Ga0373929_0001507_2773_3372 199
813 3300035085 Ga0373929_0002034 Ga0373929_0002034_2897_3496 199
814 3300035085 Ga0373929_0002354 Ga0373929_0002354_1957_2556 199
815 3300035086 Ga0373934_0046367 Ga0373934_0046367_771_1370 199
816 3300035088 Ga0373940_0000101 Ga0373940_0000101_9096_9695 199
817 3300035088 Ga0373940_0008665 Ga0373940_0008665_1025_1624 199
818 3300035088 Ga0373940_0038487 Ga0373940_0038487_162_761 199
819 3300035089 Ga0373944_0007027 Ga0373944_0007027_347_946 199
820 3300035089 Ga0373944_0042024 Ga0373944_0042024_25_624 199
821 3300035090 Ga0373949_0001142 Ga0373949_0001142_6559_7158 199
822 3300035090 Ga0373949_0002647 Ga0373949_0002647_3589_4188 199
823 3300035091 Ga0373951_0000243 Ga0373951_0000243_7477_8076 199
824 3300035091 Ga0373951_0007521 Ga0373951_0007521_1311_1910 199
825 3300035091 Ga0373951_0039492 Ga0373951_0039492_246_845 199
826 3300035092 Ga0373952_0000399 Ga0373952_0000399_1048_1647 199
827 3300035092 Ga0373952_0000485 Ga0373952_0000485_2963_3562 199
828 3300035092 Ga0373952_0019099 Ga0373952_0019099_757_1356 199
829 3300035092 Ga0373952_0053797 Ga0373952_0053797_25_624 199
830 3300035111 Ga0373923_0002068 Ga0373923_0002068_121_720 199
831 3300035111 Ga0373923_0023489 Ga0373923_0023489_874_1473 199
832 3300035111 Ga0373923_0220504 Ga0373923_0220504_195_794 199
833 3300035112 Ga0373932_0000461 Ga0373932_0000461_10381_10980 199
834 3300035113 Ga0373936_0022431 Ga0373936_0022431_625_1224 199
835 3300035113 Ga0373936_0026728 Ga0373936_0026728_626_1225 199
836 3300035113 Ga0373936_0231403 Ga0373936_0231403_158_757 199
837 3300035114 Ga0373939_0000710 Ga0373939_0000710_308_907 199
838 3300035114 Ga0373939_0007703 Ga0373939_0007703_999_1598 199
839 3300035114 Ga0373939_0024392 Ga0373939_0024392_579_1178 199
840 3300035115 Ga0373941_0000067 Ga0373941_0000067_7206_7805 199
841 3300035115 Ga0373941_0002487 Ga0373941_0002487_555_1154 199
842 3300035115 Ga0373941_0017762 Ga0373941_0017762_486_1085 199
843 3300035115 Ga0373941_0060405 Ga0373941_0060405_401_1003 199
844 3300035116 Ga0373945_0002631 Ga0373945_0002631_3606_4205 199
845 3300035116 Ga0373945_0002786 Ga0373945_0002786_1351_1950 199
846 3300035117 Ga0373953_0002762 Ga0373953_0002762_74_673 199
847 3300035117 Ga0373953_0059206 Ga0373953_0059206_583_1182 199
848 3300035117 Ga0373953_0060854 Ga0373953_0060854_565_1164 199
849 3300035118 Ga0373954_0006315 Ga0373954_0006315_4208_4810 199
850 3300035118 Ga0373954_0039933 Ga0373954_0039933_858_1457 199
851 3300035118 Ga0373954_0081640 Ga0373954_0081640_934_1533 199
852 3300035119 Ga0373956_0020187 Ga0373956_0020187_1492_2091 199
853 3300035119 Ga0373956_0031722 Ga0373956_0031722_1174_1776 199
854 3300035119 Ga0373956_0161385 Ga0373956_0161385_78_677 199
855 3300035120 Ga0373957_0001485 Ga0373957_0001485_1518_2120 199
856 3300035120 Ga0373957_0019662 Ga0373957_0019662_1498_2097 199
857 3300035121 Ga0373960_0001028 Ga0373960_0001028_3224_3823 199
858 3300035121 Ga0373960_0009902 Ga0373960_0009902_884_1483 199
859 3300035121 Ga0373960_0035083 Ga0373960_0035083_760_1359 199
860 3300035121 Ga0373960_0077211 Ga0373960_0077211_182_781 199
861 3300035170 Ga0373943_0001307 Ga0373943_0001307_1072_1671 199
862 3300035170 Ga0373943_0006960 Ga0373943_0006960_2383_2982 199
863 3300035172 Ga0373955_0004746 Ga0373955_0004746_4342_4944 199
864 3300035172 Ga0373955_0009093 Ga0373955_0009093_1348_1947 199
865 3300035172 Ga0373955_0099589 Ga0373955_0099589_876_1475 199
866 3300035172 Ga0373955_0170572 Ga0373955_0170572_71_670 199
867 3300035172 Ga0373955_0343054 Ga0373955_0343054_224_826 199
868 3300035241 Ga0373961_0000474 Ga0373961_0000474_9418_10017 199
869 3300035241 Ga0373961_0003232 Ga0373961_0003232_767_1366 199
870 3300035242 Ga0373962_0000225 Ga0373962_0000225_7316_7915 199
871 3300035242 Ga0373962_0001550 Ga0373962_0001550_1022_1621 199
872 3300035242 Ga0373962_0011626 Ga0373962_0011626_661_1260 199
873 3300035410 Ga0373924_0039474 Ga0373924_0039474_1067_1666 199
874 3300035410 Ga0373924_0050401 Ga0373924_0050401_746_1345 199
875 3300035691 Ga0373931_0000204 Ga0373931_0000204_17205_17804 199
876 3300035691 Ga0373931_0001800 Ga0373931_0001800_3227_3826 199
877 3300035691 Ga0373931_0007564 Ga0373931_0007564_678_1277 199
878 3300035691 Ga0373931_0368068 Ga0373931_0368068_58_657 199
879 3300035691 Ga0373931_0476868 Ga0373931_0476868_180_779 199
880 3300035692 Ga0373935_0019987 Ga0373935_0019987_2033_2632 199
881 3300035692 Ga0373935_0067496 Ga0373935_0067496_1474_2073 199
882 3300035692 Ga0373935_0165611 Ga0373935_0165611_365_964 199
883 3300035692 Ga0373935_0476239 Ga0373935_0476239_285_884 199
884 3300035695 Ga0373927_0391626 Ga0373927_0391626_47_646 199
885 3300035724 Ga0373933_0002804 Ga0373933_0002804_80_679 199
886 3300035724 Ga0373933_0004059 Ga0373933_0004059_5356_5955 199
887 3300035724 Ga0373933_0008656 Ga0373933_0008656_4927_5526 199
888 3300035724 Ga0373933_0009970 Ga0373933_0009970_3805_4407 199
889 3300035724 Ga0373933_0181557 Ga0373933_0181557_533_1135 199
890 3300036401 Ga0373937_0013055 Ga0373937_0013055_624_1223 199
891 3300036401 Ga0373937_0029608 Ga0373937_0029608_681_1283 199
892 3300036401 Ga0373937_0045711 Ga0373937_0045711_226_825 199
893 3300036401 Ga0373937_0089164 Ga0373937_0089164_319_918 199
894 3300036401 Ga0373937_0285934 Ga0373937_0285934_510_1109 199
895 3300037068 Ga0373925_0012284 Ga0373925_0012284_3793_4392 199
896 3300037068 Ga0373925_0027312 Ga0373925_0027312_2924_3523 199
897 3300037068 Ga0373925_0028900 Ga0373925_0028900_102_701 199
898 3300037068 Ga0373925_0345948 Ga0373925_0345948_227_826 199
899 3300042001 Ga0439441_000656 Ga0439441_000656_1237_1836 199
900 3300042012 Ga0439455_0020196 Ga0439455_0020196_728_1327 199
901 3300042439 Ga0439464_0042680 Ga0439464_0042680_447_1046 199
902 3300042461 Ga0439460_0033457 Ga0439460_0033457_499_1098 199
903 3300042993 Ga0439440_0023919 Ga0439440_0023919_686_1285 199
904 3300044694 Ga0466963_0091724 Ga0466963_0091724_29_631 199
905 3300045051 Ga0451576_0020613 Ga0451576_0020613_4567_5166 199
906 3300045976 Ga0466967_0263209 Ga0466967_0263209_527_1129 199
907 3300046454 Ga0495592_0006121 Ga0495592_0006121_2522_3121 199
908 3300046454 Ga0495592_0014824 Ga0495592_0014824_2315_2914 199
909 3300046455 Ga0495603_0017070 Ga0495603_0017070_1551_2150 199
910 3300046455 Ga0495603_0032483 Ga0495603_0032483_1648_2247 199
911 3300046455 Ga0495603_0061336 Ga0495603_0061336_80_679 199
912 3300046459 Ga0495629_0000485 Ga0495629_0000485_22942_23541 199
913 3300046459 Ga0495629_0064402 Ga0495629_0064402_353_952 199
914 3300046461 Ga0495641_0076207 Ga0495641_0076207_226_825 199
915 3300046462 Ga0495651_0070438 Ga0495651_0070438_383_982 199
916 3300046462 Ga0495651_0084304 Ga0495651_0084304_1110_1709 199
917 3300046462 Ga0495651_0102731 Ga0495651_0102731_433_1032 199
918 3300046462 Ga0495651_0131734 Ga0495651_0131734_204_803 199
919 3300046463 Ga0495653_0012478 Ga0495653_0012478_4927_5526 199
920 3300046472 Ga0495580_0043224 Ga0495580_0043224_2415_3014 199
921 3300046472 Ga0495580_0067968 Ga0495580_0067968_1842_2441 199
922 3300046473 Ga0495582_0010176 Ga0495582_0010176_2521_3120 199
923 3300046473 Ga0495582_0025877 Ga0495582_0025877_744_1343 199
924 3300046475 Ga0495639_0229392 Ga0495639_0229392_90_689 199
925 3300046476 Ga0495662_0004378 Ga0495662_0004378_2297_2896 199
926 3300046476 Ga0495662_0061907 Ga0495662_0061907_575_1174 199
927 3300046476 Ga0495662_0260393 Ga0495662_0260393_155_754 199
928 3300046477 Ga0495664_0004210 Ga0495664_0004210_4025_4624 199
929 3300046477 Ga0495664_0012302 Ga0495664_0012302_2312_2911 199
930 3300046477 Ga0495664_0029424 Ga0495664_0029424_487_1086 199
931 3300046477 Ga0495664_0071505 Ga0495664_0071505_296_895 199
932 3300046491 Ga0495584_0007346 Ga0495584_0007346_5032_5631 199
933 3300046491 Ga0495584_0042546 Ga0495584_0042546_1464_2063 199
934 3300046492 Ga0495585_0000734 Ga0495585_0000734_6871_7470 199
935 3300046499 Ga0495594_0006008 Ga0495594_0006008_4091_4690 199
936 3300046499 Ga0495594_0029074 Ga0495594_0029074_707_1306 199
937 3300046499 Ga0495594_0086067 Ga0495594_0086067_774_1373 199
938 3300046501 Ga0495607_0005042 Ga0495607_0005042_3590_4189 199
939 3300046511 Ga0495608_0001184 Ga0495608_0001184_6009_6608 199
940 3300046511 Ga0495608_0015967 Ga0495608_0015967_4441_5040 199
941 3300046514 Ga0495618_0015523 Ga0495618_0015523_2384_2983 199
942 3300046514 Ga0495618_0049089 Ga0495618_0049089_1459_2058 199
943 3300046516 Ga0495628_0004412 Ga0495628_0004412_3008_3607 199
944 3300046516 Ga0495628_0025451 Ga0495628_0025451_2569_3168 199
945 3300046516 Ga0495628_0025562 Ga0495628_0025562_2362_2961 199
946 3300046517 Ga0495630_0032755 Ga0495630_0032755_1670_2269 199
947 3300046517 Ga0495630_0040411 Ga0495630_0040411_2285_2884 199
948 3300046517 Ga0495630_0251395 Ga0495630_0251395_397_996 199
949 3300046517 Ga0495630_0959304 Ga0495630_0959304_23_622 199
950 3300046523 Ga0495644_0000828 Ga0495644_0000828_4583_5182 199
951 3300046525 Ga0495663_0005863 Ga0495663_0005863_1527_2126 199
952 3300046526 Ga0495666_0014716 Ga0495666_0014716_2527_3126 199
953 3300046526 Ga0495666_0027794 Ga0495666_0027794_160_759 199
954 3300046529 Ga0495652_0004969 Ga0495652_0004969_1419_2018 199
955 3300046529 Ga0495652_0010574 Ga0495652_0010574_2250_2849 199
956 3300046529 Ga0495652_0051717 Ga0495652_0051717_381_980 199
957 3300046529 Ga0495652_0115826 Ga0495652_0115826_644_1246 199
958 3300046531 Ga0495665_0002225 Ga0495665_0002225_8187_8786 199
959 3300046531 Ga0495665_0200322 Ga0495665_0200322_270_869 199
960 3300046533 Ga0495640_0018787 Ga0495640_0018787_1667_2266 199
961 3300046533 Ga0495640_0033111 Ga0495640_0033111_2695_3294 199
962 3300046533 Ga0495640_0036221 Ga0495640_0036221_1662_2261 199
963 3300046535 Ga0495586_0026174 Ga0495586_0026174_586_1185 199
964 3300046535 Ga0495586_0032495 Ga0495586_0032495_34_633 199
965 3300046536 Ga0495587_0017832 Ga0495587_0017832_3689_4288 199
966 3300046536 Ga0495587_0055108 Ga0495587_0055108_1639_2238 199
967 3300046538 Ga0495609_0017622 Ga0495609_0017622_929_1528 199
968 3300046543 Ga0495645_0008947 Ga0495645_0008947_1685_2284 199
969 3300046543 Ga0495645_0017944 Ga0495645_0017944_635_1234 199
970 3300046543 Ga0495645_0154406 Ga0495645_0154406_729_1328 199
971 3300046557 Ga0495622_0017962 Ga0495622_0017962_1026_1625 199
972 3300046558 Ga0495633_0002950 Ga0495633_0002950_8463_9062 199
973 3300046559 Ga0495667_0003221 Ga0495667_0003221_8871_9470 199
974 3300046559 Ga0495667_0015894 Ga0495667_0015894_1463_2062 199
975 3300046559 Ga0495667_0021566 Ga0495667_0021566_3715_4314 199
976 3300046559 Ga0495667_0076919 Ga0495667_0076919_883_1482 199
977 3300046648 Ga0495611_0004234 Ga0495611_0004234_1065_1664 199
978 3300046663 Ga0495635_0009913 Ga0495635_0009913_1329_1928 199
979 3300046663 Ga0495635_0021211 Ga0495635_0021211_1657_2256 199
980 3300046663 Ga0495635_0364505 Ga0495635_0364505_194_793 199
981 3300046665 Ga0495661_0077965 Ga0495661_0077965_15_614 199
982 3300046675 Ga0495657_0013292 Ga0495657_0013292_1746_2345 199
983 3300046675 Ga0495657_0026726 Ga0495657_0026726_2861_3460 199
984 3300046675 Ga0495657_0036583 Ga0495657_0036583_349_951 199
985 3300046675 Ga0495657_0107258 Ga0495657_0107258_1155_1757 199
986 3300046678 Ga0495599_0004093 Ga0495599_0004093_5773_6372 199
987 3300046678 Ga0495599_0015147 Ga0495599_0015147_1281_1880 199
988 3300046678 Ga0495599_0029880 Ga0495599_0029880_1370_1969 199
989 3300046679 Ga0495623_0002124 Ga0495623_0002124_5466_6065 199
990 3300046679 Ga0495623_0013014 Ga0495623_0013014_3972_4571 199
991 3300046680 Ga0495646_0016363 Ga0495646_0016363_2788_3387 199
992 3300046680 Ga0495646_0044110 Ga0495646_0044110_1810_2409 199
993 3300046681 Ga0495647_0018720 Ga0495647_0018720_184_783 199
994 3300046681 Ga0495647_0098961 Ga0495647_0098961_381_980 199
995 3300046683 Ga0495658_0007123 Ga0495658_0007123_1587_2186 199
996 3300046683 Ga0495658_0009853 Ga0495658_0009853_1134_1733 199
997 3300046683 Ga0495658_0026369 Ga0495658_0026369_873_1472 199
998 3300046689 Ga0495613_0169792 Ga0495613_0169792_771_1370 199
999 3300046689 Ga0495613_0317934 Ga0495613_0317934_435_1034 199
1000 3300046690 Ga0495624_0005521 Ga0495624_0005521_1466_2065 199
1001 3300046690 Ga0495624_0069844 Ga0495624_0069844_527_1126 199
1002 3300046690 Ga0495624_0284805 Ga0495624_0284805_68_667 199
1003 3300046691 Ga0495670_0001621 Ga0495670_0001621_650_1249 199
1004 3300046692 Ga0495671_0220583 Ga0495671_0220583_43_642 199
1005 3300046809 Ga0495600_0016706 Ga0495600_0016706_2653_3252 199
1006 3300046809 Ga0495600_0075579 Ga0495600_0075579_1360_1962 199
1007 3300046809 Ga0495600_0094497 Ga0495600_0094497_475_1074 199
1008 3300047315 Ga0495581_0002320 Ga0495581_0002320_8201_8800 199
1009 3300047315 Ga0495581_0023391 Ga0495581_0023391_1514_2113 199
1010 3300047317 Ga0495604_0005566 Ga0495604_0005566_1826_2425 199
1011 3300047317 Ga0495604_0007478 Ga0495604_0007478_1244_1843 199
1012 3300047317 Ga0495604_0019133 Ga0495604_0019133_786_1385 199
1013 3300047317 Ga0495604_0111998 Ga0495604_0111998_683_1285 199
1014 3300047319 Ga0495674_0009473 Ga0495674_0009473_1713_2312 199
1015 3300047319 Ga0495674_0024592 Ga0495674_0024592_3477_4076 199
1016 3300047319 Ga0495674_0105765 Ga0495674_0105765_1411_2010 199
1017 3300047321 Ga0495676_0071208 Ga0495676_0071208_127_726 199
1018 3300047322 Ga0495680_0002398 Ga0495680_0002398_2488_3087 199
1019 3300047322 Ga0495680_0007387 Ga0495680_0007387_6171_6770 199
1020 3300047322 Ga0495680_0040982 Ga0495680_0040982_1612_2211 199
1021 3300047322 Ga0495680_0050177 Ga0495680_0050177_1084_1683 199
1022 3300047444 Ga0495675_0036217 Ga0495675_0036217_1085_1684 199
1023 3300047444 Ga0495675_0113642 Ga0495675_0113642_1042_1644 199
1024 3300047446 Ga0495679_069851 Ga0495679_069851_47_646 199
1025 3300047471 Ga0495684_0004228 Ga0495684_0004228_10384_10983 199
1026 3300047471 Ga0495684_0193084 Ga0495684_0193084_30_629 199
1027 3300047471 Ga0495684_0381774 Ga0495684_0381774_383_982 199
1028 3300047673 Ga0495593_0011971 Ga0495593_0011971_2918_3517 199
1029 3300047673 Ga0495593_0012764 Ga0495593_0012764_735_1334 199
1030 3300047673 Ga0495593_0025938 Ga0495593_0025938_692_1291 199
1031 3300048088 Ga0495602_0027747 Ga0495602_0027747_3255_3854 199
1032 3300048088 Ga0495602_0060542 Ga0495602_0060542_1704_2303 199
1033 3300048088 Ga0495602_0259762 Ga0495602_0259762_239_841 199
1034 3300048089 Ga0495614_0012071 Ga0495614_0012071_2522_3121 199
1035 3300048903 Ga0496100_0000177 Ga0496100_0000177_20354_20953 199
1036 3300048903 Ga0496100_0006867 Ga0496100_0006867_4099_4698 199
1037 3300048903 Ga0496100_0070940 Ga0496100_0070940_1493_2092 199
1038 3300048903 Ga0496100_0232352 Ga0496100_0232352_52_651 199
1039 3300048904 Ga0496101_0000180 Ga0496101_0000180_15380_15979 199
1040 3300048904 Ga0496101_0039291 Ga0496101_0039291_1077_1676 199
1041 3300048904 Ga0496101_0042835 Ga0496101_0042835_935_1534 199
1042 3300048904 Ga0496101_0229502 Ga0496101_0229502_55_654 199
1043 3300048905 Ga0496102_0000607 Ga0496102_0000607_21899_22498 199
1044 3300048905 Ga0496102_0006549 Ga0496102_0006549_4464_5063 199
1045 3300048905 Ga0496102_0030810 Ga0496102_0030810_2277_2876 199
1046 3300048905 Ga0496102_0161797 Ga0496102_0161797_136_735 199
1047 3300048906 Ga0496103_0000130 Ga0496103_0000130_21899_22498 199
1048 3300048906 Ga0496103_0007817 Ga0496103_0007817_4145_4744 199
1049 3300048906 Ga0496103_0038232 Ga0496103_0038232_806_1405 199
1050 3300048907 Ga0496104_0000289 Ga0496104_0000289_37663_38262 199
1051 3300048907 Ga0496104_0027792 Ga0496104_0027792_2751_3350 199
1052 3300048907 Ga0496104_0139519 Ga0496104_0139519_1349_1948 199
1053 3300048907 Ga0496104_0186264 Ga0496104_0186264_497_1096 199
1054 3300048907 Ga0496104_0209397 Ga0496104_0209397_747_1346 199
1055 3300048907 Ga0496104_0827632 Ga0496104_0827632_131_730 199
1056 3300048908 Ga0496105_0000144 Ga0496105_0000144_16219_16818 199
1057 3300048908 Ga0496105_0025199 Ga0496105_0025199_1878_2477 199
1058 3300048908 Ga0496105_0049741 Ga0496105_0049741_2262_2861 199
1059 3300048909 Ga0496106_0000381 Ga0496106_0000381_26931_27530 199
1060 3300048909 Ga0496106_0007902 Ga0496106_0007902_6617_7216 199
1061 3300048909 Ga0496106_0027792 Ga0496106_0027792_2425_3024 199
1062 3300048909 Ga0496106_0086866 Ga0496106_0086866_144_743 199
1063 3300048909 Ga0496106_0446136 Ga0496106_0446136_368_967 199
1064 3300048910 Ga0496107_0001002 Ga0496107_0001002_15801_16400 199
1065 3300048910 Ga0496107_0005222 Ga0496107_0005222_4719_5318 199
1066 3300048910 Ga0496107_0015427 Ga0496107_0015427_3150_3749 199
1067 3300048910 Ga0496107_0161729 Ga0496107_0161729_916_1515 199
1068 3300048911 Ga0496108_0001153 Ga0496108_0001153_17796_18395 199
1069 3300048911 Ga0496108_0003419 Ga0496108_0003419_11767_12366 199
1070 3300048911 Ga0496108_0013287 Ga0496108_0013287_4017_4616 199
1071 3300048911 Ga0496108_0019246 Ga0496108_0019246_4328_4927 199
1072 3300048911 Ga0496108_0025933 Ga0496108_0025933_1781_2380 199
1073 3300048911 Ga0496108_0201008 Ga0496108_0201008_996_1595 199
1074 3300048912 Ga0496109_0000490 Ga0496109_0000490_23487_24086 199
1075 3300048912 Ga0496109_0001283 Ga0496109_0001283_19542_20141 199
1076 3300048912 Ga0496109_0015162 Ga0496109_0015162_1781_2380 199
1077 3300048912 Ga0496109_0054678 Ga0496109_0054678_2446_3045 199
1078 3300048912 Ga0496109_0188697 Ga0496109_0188697_261_860 199
1079 3300048913 Ga0496110_0006458 Ga0496110_0006458_5840_6439 199
1080 3300048913 Ga0496110_0089756 Ga0496110_0089756_684_1283 199
1081 3300048913 Ga0496110_0099991 Ga0496110_0099991_312_911 199
1082 3300048913 Ga0496110_0102603 Ga0496110_0102603_368_967 199
1083 3300048914 Ga0496111_0017198 Ga0496111_0017198_4330_4929 199
1084 3300048914 Ga0496111_0024875 Ga0496111_0024875_462_1061 199
1085 3300048914 Ga0496111_0101084 Ga0496111_0101084_1290_1889 199
1086 3300048914 Ga0496111_0533303 Ga0496111_0533303_15_614 199
1087 3300048915 Ga0496112_0015716 Ga0496112_0015716_1911_2510 199
1088 3300048915 Ga0496112_0024562 Ga0496112_0024562_3208_3807 199
1089 3300048915 Ga0496112_0243128 Ga0496112_0243128_602_1201 199
1090 3300048916 Ga0496113_0003541 Ga0496113_0003541_6161_6760 199
1091 3300048916 Ga0496113_0109941 Ga0496113_0109941_155_754 199
1092 3300048916 Ga0496113_0269158 Ga0496113_0269158_368_967 199
1093 3300048916 Ga0496113_0443815 Ga0496113_0443815_44_643 199
1094 3300048917 Ga0496114_0000973 Ga0496114_0000973_3613_4212 199
1095 3300048917 Ga0496114_0008867 Ga0496114_0008867_5557_6156 199
1096 3300048917 Ga0496114_0093052 Ga0496114_0093052_333_932 199
1097 3300048918 Ga0496115_0000939 Ga0496115_0000939_11133_11732 199
1098 3300048918 Ga0496115_0052739 Ga0496115_0052739_970_1569 199
1099 3300048918 Ga0496115_0082814 Ga0496115_0082814_235_834 199
1100 3300048918 Ga0496115_0083703 Ga0496115_0083703_1189_1788 199
1101 3300048918 Ga0496115_0175217 Ga0496115_0175217_1052_1651 199
1102 3300048922 Ga0496119_0372319 Ga0496119_0372319_32_631 199
1103 3300048928 Ga0496125_0155976 Ga0496125_0155976_104_703 199
1104 3300049571 Ga0501034_0174585 Ga0501034_0174585_745_1344 199
1105 3300049571 Ga0501034_0230349 Ga0501034_0230349_759_1361 199
1106 3300049571 Ga0501034_0383467 Ga0501034_0383467_265_867 199
1107 3300049573 Ga0501037_0374012 Ga0501037_0374012_141_740 199
1108 3300049581 Ga0501047_0082204 Ga0501047_0082204_1600_2202 199
1109 3300049581 Ga0501047_0217227 Ga0501047_0217227_1029_1628 199
1110 3300049586 Ga0501070_0049525 Ga0501070_0049525_783_1382 199
1111 3300049587 Ga0501071_0205289 Ga0501071_0205289_441_1040 199
1112 3300049589 Ga0501073_0242232 Ga0501073_0242232_368_967 199
1113 3300049589 Ga0501073_0624266 Ga0501073_0624266_85_684 199
1114 3300049590 Ga0501074_0126660 Ga0501074_0126660_364_966 199
1115 3300049592 Ga0501076_0013068 Ga0501076_0013068_1054_1653 199
1116 3300049741 Ga0501079_0355967 Ga0501079_0355967_426_1025 199
1117 3300049742 Ga0501080_0257833 Ga0501080_0257833_782_1384 199
1118 3300049742 Ga0501080_0308707 Ga0501080_0308707_643_1242 199
1119 3300049742 Ga0501080_0363385 Ga0501080_0363385_505_1107 199
1120 3300049742 Ga0501080_0401714 Ga0501080_0401714_574_1176 199
1121 3300049822 Ga0501035_0047743 Ga0501035_0047743_1003_1602 199
1122 3300049822 Ga0501035_0889255 Ga0501035_0889255_35_637 199
1123 3300049823 Ga0501044_0092944 Ga0501044_0092944_1632_2231 199
1124 3300049823 Ga0501044_0402588 Ga0501044_0402588_394_996 199
1125 3300049823 Ga0501044_1025764 Ga0501044_1025764_25_624 199
1126 3300050494 nmdc:mga06z11_7327_c1 nmdc:mga06z11_7327_c1_1477_2076 199
1127 3300050495 nmdc:mga04h51_92901_c1 nmdc:mga04h51_92901_c1_414_1013 199
1128 3300050496 nmdc:mga07m45_168571_c1 nmdc:mga07m45_168571_c1_322_921 199
1129 3300050507 nmdc:mga05p37_222_c1 nmdc:mga05p37_222_c1_15853_16452 199
1130 3300050507 nmdc:mga05p37_5864_c1 nmdc:mga05p37_5864_c1_6749_7348 199
1131 3300050508 nmdc:mga09592_2841_c1 nmdc:mga09592_2841_c1_5677_6276 199
1132 3300050509 nmdc:mga0qj67_418_c1 nmdc:mga0qj67_418_c1_14690_15289 199
1133 3300050510 nmdc:mga06r32_1436_c1 nmdc:mga06r32_1436_c1_10696_11295 199
1134 3300050511 nmdc:mga08y16_1566_c1 nmdc:mga08y16_1566_c1_8439_9038 199
1135 3300050511 nmdc:mga08y16_41995_c1 nmdc:mga08y16_41995_c1_577_1176 199
1136 3300050511 nmdc:mga08y16_4988_c1 nmdc:mga08y16_4988_c1_7702_8301 199
1137 3300050511 nmdc:mga08y16_587_c1 nmdc:mga08y16_587_c1_10617_11216 199
1138 3300050511 nmdc:mga08y16_799686_c1 nmdc:mga08y16_799686_c1_218_817 199
1139 3300050512 nmdc:mga0n895_14048_c1 nmdc:mga0n895_14048_c1_4321_4920 199
1140 3300050512 nmdc:mga0n895_1683_c1 nmdc:mga0n895_1683_c1_223_822 199
1141 3300050512 nmdc:mga0n895_34469_c1 nmdc:mga0n895_34469_c1_3294_3893 199
1142 3300050512 nmdc:mga0n895_437_c1 nmdc:mga0n895_437_c1_6362_6961 199
1143 3300050512 nmdc:mga0n895_471926_c1 nmdc:mga0n895_471926_c1_580_1179 199
1144 3300050513 nmdc:mga0rr50_93865_c1 nmdc:mga0rr50_93865_c1_1510_2109 199
1145 3300050515 nmdc:mga0a205_3971_c1 nmdc:mga0a205_3971_c1_3208_3807 199
1146 3300050515 nmdc:mga0a205_440909_c1 nmdc:mga0a205_440909_c1_332_931 199
1147 3300050515 nmdc:mga0a205_4474_c1 nmdc:mga0a205_4474_c1_7101_7700 199
1148 3300050515 nmdc:mga0a205_721199_c1 nmdc:mga0a205_721199_c1_142_741 199
1149 3300053077 Ga0495601_0000279 Ga0495601_0000279_24813_25412 199
1150 3300053077 Ga0495601_0000558 Ga0495601_0000558_9906_10505 199
1151 3300053077 Ga0495601_0002117 Ga0495601_0002117_7131_7730 199
1152 3300053077 Ga0495601_0002312 Ga0495601_0002312_799_1401 199
1153 3300053077 Ga0495601_0033559 Ga0495601_0033559_933_1532 199
1154 3300053077 Ga0495601_0207955 Ga0495601_0207955_625_1224 199
1155 3300053078 Ga0495612_0001484 Ga0495612_0001484_5916_6515 199
1156 3300053078 Ga0495612_0003350 Ga0495612_0003350_1119_1718 199
1157 3300053078 Ga0495612_0012895 Ga0495612_0012895_1582_2181 199
1158 3300053078 Ga0495612_0017559 Ga0495612_0017559_992_1594 199
1159 3300053078 Ga0495612_0058377 Ga0495612_0058377_187_786 199
1160 3300053084 Ga0495595_0002455 Ga0495595_0002455_2552_3151 199
1161 3300053084 Ga0495595_0003977 Ga0495595_0003977_46_645 199
1162 3300053084 Ga0495595_0005137 Ga0495595_0005137_2006_2608 199
1163 3300053084 Ga0495595_0031107 Ga0495595_0031107_1782_2381 199
1164 3300053085 Ga0495619_0000170 Ga0495619_0000170_16306_16905 199
1165 3300053085 Ga0495619_0000175 Ga0495619_0000175_29026_29625 199
1166 3300053085 Ga0495619_0003531 Ga0495619_0003531_6962_7561 199
1167 3300053085 Ga0495619_0013000 Ga0495619_0013000_3962_4564 199
1168 3300053085 Ga0495619_0019630 Ga0495619_0019630_1551_2150 199
1169 3300053085 Ga0495619_0023515 Ga0495619_0023515_294_893 199
1170 3300053085 Ga0495619_0042668 Ga0495619_0042668_954_1553 199
1171 3300053088 Ga0500644_0001616 Ga0500644_0001616_3097_3747 199
1172 3300053093 Ga0500651_0010263 Ga0500651_0010263_980_1630 199
1173 3300053094 Ga0500566_0137171 Ga0500566_0137171_650_1249 199
1174 3300053125 Ga0500618_017763 Ga0500618_017763_230_829 199
1175 3300053153 Ga0500616_0000001 Ga0500616_0000001_859433_860083 199
1176 3300053730 Ga0500645_000015 Ga0500645_000015_28259_28909 199
1177 3300054114 Ga0501084_0291964 Ga0501084_0291964_743_1342 199
1178 3300060353 Ga0501082_0702057 Ga0501082_0702057_169_768 199
1179 3300061734 Ga0530510_0452400 Ga0530510_0452400_28_627 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

160

214

0.95

Feature Viewer

pLDDT pTM Quality
67.75 0.32 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map