F491286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1179 | 467 | 1168 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300034818|Ga0373950_0010349|Ga0373950_0010349_812_1465 |
| Length | 217 |
| Sequence | MKNPKTSKSNKDSGGSKASSTMSSLFDKIRVKPEQDRRPKTGGPVCEWHGCEQKATNKAPKGRGNDKEYWNYCLKHAREYNQSYNFFAGMNDAAVLAFQKDALTGHRPTWKMGTGKRQAKAGIAGMAGGDDPFGLFGAGMKTEQKQQNEQRQVRNAERKALDKLGLDVGATPAQVKVRFKELVKQFHPDVNGGDRSTEDRLVEVIQSYNYLKSAGFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 8 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 9 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 10 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 11 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 12 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 15 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 16 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 17 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 18 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 19 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 20 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 21 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 25 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 28 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 29 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 30 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 31 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 32 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 33 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 34 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 35 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 36 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 37 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 41 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 126 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 134 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 140 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 157 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 158 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 159 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 179 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 274 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 275 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 276 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 277 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 279 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 280 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 282 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 283 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 284 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 285 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 286 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 287 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 289 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 295 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 299 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 314 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 318 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 319 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 320 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 321 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 322 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 323 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 324 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 325 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 326 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 327 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 406 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 407 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 412 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 438 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 439 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 440 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 441 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 456 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 458 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 460 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 461 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 464 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 467 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0.08 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.97 |
| Nodule | 0.85 |
| Rhizoplane | 5.77 |
| Rhizosphere | 89.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214761890 | 2209111006 | Bacteria | 2898 |
| 2 | ARcpr5oldR_c000088 | 3300000041 | Bacteria | 16690 |
| 3 | ARcpr5yngRDRAFT_c000056 | 3300000043 | Bacteria | 18019 |
| 4 | ARSoilOldRDRAFT_c000084 | 3300000044 | Bacteria | 17583 |
| 5 | ARCol0oldRDRAFT_c00490 | 3300000045 | Bacteria | 3665 |
| 6 | ARCol0yngRDRAFT_1000059 | 3300000652 | Bacteria | 19852 |
| 7 | JGI24032J14994_100059 | 3300001430 | Bacteria | 4545 |
| 8 | JGI24741J21665_1002679 | 3300001915 | Bacteria | 4537 |
| 9 | JGI24752J21851_1000628 | 3300001976 | Bacteria | 4716 |
| 10 | JGI24746J21847_1000020 | 3300001977 | Bacteria | 15802 |
| 11 | JGI24747J21853_1000015 | 3300001978 | Bacteria | 6858 |
| 12 | JGI24740J21852_10006056 | 3300001979 | Bacteria | 5055 |
| 13 | JGI24739J22299_10000555 | 3300001989 | Bacteria | 13393 |
| 14 | JGI24737J22298_10000446 | 3300001990 | Bacteria | 14169 |
| 15 | JGI24737J22298_10001295 | 3300001990 | Bacteria | 8861 |
| 16 | JGI24743J22301_10005422 | 3300001991 | Bacteria | 2128 |
| 17 | JGI24735J21928_10097057 | 3300002067 | Bacteria | 846 |
| 18 | JGI24750J21931_1000321 | 3300002070 | Bacteria | 8166 |
| 19 | JGI24748J21848_1006494 | 3300002074 | Bacteria | 1361 |
| 20 | JGI24738J21930_10000478 | 3300002075 | Bacteria | 11322 |
| 21 | JGI24749J21850_1000191 | 3300002076 | Bacteria | 9824 |
| 22 | JGI24744J21845_10000650 | 3300002077 | Bacteria | 6363 |
| 23 | JGI24035J26624_1000088 | 3300002126 | Bacteria | 7690 |
| 24 | JGI24033J26618_1002030 | 3300002155 | Bacteria | 2037 |
| 25 | JGI24034J26672_10000148 | 3300002239 | Bacteria | 10065 |
| 26 | JGI24742J22300_10000055 | 3300002244 | Bacteria | 16895 |
| 27 | JGI24751J29686_10001781 | 3300002459 | Bacteria | 4421 |
| 28 | JGI25405J52794_10016452 | 3300003911 | Bacteria | 1461 |
| 29 | Ga0065716_1001694 | 3300005277 | Bacteria | 4116 |
| 30 | Ga0065704_10081261 | 3300005289 | Bacteria | 3794 |
| 31 | Ga0065712_10004602 | 3300005290 | Bacteria | 4360 |
| 32 | Ga0065712_10014918 | 3300005290 | Bacteria | 2334 |
| 33 | Ga0065712_10069614 | 3300005290 | Bacteria | 6970 |
| 34 | Ga0065715_10094105 | 3300005293 | Bacteria | 4442 |
| 35 | Ga0065715_10351250 | 3300005293 | Bacteria | 950 |
| 36 | Ga0065707_10284269 | 3300005295 | Bacteria | 985 |
| 37 | Ga0070658_10057341 | 3300005327 | Bacteria | 3168 |
| 38 | Ga0070676_10000186 | 3300005328 | Bacteria | 25797 |
| 39 | Ga0070676_10136143 | 3300005328 | Bacteria | 1558 |
| 40 | Ga0070683_100000064 | 3300005329 | Bacteria | 76343 |
| 41 | Ga0070683_100065841 | 3300005329 | Bacteria | 3375 |
| 42 | Ga0070690_100005166 | 3300005330 | Bacteria | 7307 |
| 43 | Ga0070690_100115693 | 3300005330 | Bacteria | 1794 |
| 44 | Ga0070690_100138780 | 3300005330 | Bacteria | 1649 |
| 45 | Ga0070670_100020384 | 3300005331 | Bacteria | 5699 |
| 46 | Ga0070670_100072694 | 3300005331 | Bacteria | 2953 |
| 47 | Ga0070670_100200564 | 3300005331 | Bacteria | 1734 |
| 48 | Ga0070670_100209543 | 3300005331 | Bacteria | 1694 |
| 49 | Ga0070670_100369895 | 3300005331 | Bacteria | 1262 |
| 50 | Ga0070670_100499014 | 3300005331 | Unclassified | 1082 |
| 51 | Ga0070677_10000330 | 3300005333 | Bacteria | 16588 |
| 52 | Ga0068869_100000191 | 3300005334 | Bacteria | 31688 |
| 53 | Ga0068869_100090893 | 3300005334 | Bacteria | 2296 |
| 54 | Ga0068869_101076306 | 3300005334 | Bacteria | 703 |
| 55 | Ga0070666_10020150 | 3300005335 | Bacteria | 4309 |
| 56 | Ga0070666_10341171 | 3300005335 | Bacteria | 1071 |
| 57 | Ga0070666_10378693 | 3300005335 | Bacteria | 1016 |
| 58 | Ga0070680_100008982 | 3300005336 | Bacteria | 7662 |
| 59 | Ga0070680_100009358 | 3300005336 | Bacteria | 7526 |
| 60 | Ga0070680_100027510 | 3300005336 | Bacteria | 4553 |
| 61 | Ga0070680_100196508 | 3300005336 | Bacteria | 1700 |
| 62 | Ga0070680_100199924 | 3300005336 | Bacteria | 1685 |
| 63 | Ga0070682_100001165 | 3300005337 | Bacteria | 15006 |
| 64 | Ga0070682_100032175 | 3300005337 | Bacteria | 3178 |
| 65 | Ga0070682_100047563 | 3300005337 | Bacteria | 2667 |
| 66 | Ga0070682_100050010 | 3300005337 | Bacteria | 2608 |
| 67 | Ga0068868_100000233 | 3300005338 | Bacteria | 37955 |
| 68 | Ga0068868_100015794 | 3300005338 | Bacteria | 5593 |
| 69 | Ga0068868_100631904 | 3300005338 | Bacteria | 952 |
| 70 | Ga0070660_100000523 | 3300005339 | Bacteria | 25559 |
| 71 | Ga0070660_100049478 | 3300005339 | Bacteria | 3232 |
| 72 | Ga0070660_100083409 | 3300005339 | Bacteria | 2511 |
| 73 | Ga0070660_100160965 | 3300005339 | Bacteria | 1809 |
| 74 | Ga0070660_100412565 | 3300005339 | Bacteria | 1117 |
| 75 | Ga0070660_100416381 | 3300005339 | Bacteria | 1112 |
| 76 | Ga0070689_100000764 | 3300005340 | Bacteria | 19669 |
| 77 | Ga0070689_100022766 | 3300005340 | Bacteria | 4682 |
| 78 | Ga0070689_100024145 | 3300005340 | Bacteria | 4558 |
| 79 | Ga0070689_100069466 | 3300005340 | Bacteria | 2748 |
| 80 | Ga0070691_10002775 | 3300005341 | Bacteria | 7813 |
| 81 | Ga0070691_10069908 | 3300005341 | Bacteria | 1702 |
| 82 | Ga0070687_100000911 | 3300005343 | Bacteria | 9967 |
| 83 | Ga0070687_100019895 | 3300005343 | Bacteria | 3130 |
| 84 | Ga0070687_100061266 | 3300005343 | Bacteria | 1988 |
| 85 | Ga0070687_100497940 | 3300005343 | Bacteria | 820 |
| 86 | Ga0070661_100000188 | 3300005344 | Bacteria | 51025 |
| 87 | Ga0070692_10002184 | 3300005345 | Bacteria | 7493 |
| 88 | Ga0070692_10003843 | 3300005345 | Bacteria | 6181 |
| 89 | Ga0070668_100000409 | 3300005347 | Bacteria | 28506 |
| 90 | Ga0070669_100000523 | 3300005353 | Bacteria | 28564 |
| 91 | Ga0070669_100120166 | 3300005353 | Bacteria | 2003 |
| 92 | Ga0070675_100000034 | 3300005354 | Bacteria | 87135 |
| 93 | Ga0070675_100262633 | 3300005354 | Bacteria | 1513 |
| 94 | Ga0070671_100000111 | 3300005355 | Bacteria | 52298 |
| 95 | Ga0070671_100015028 | 3300005355 | Bacteria | 6252 |
| 96 | Ga0070671_100040483 | 3300005355 | Bacteria | 3871 |
| 97 | Ga0070671_100102043 | 3300005355 | Bacteria | 2407 |
| 98 | Ga0070671_100189771 | 3300005355 | Bacteria | 1742 |
| 99 | Ga0070674_100000457 | 3300005356 | Bacteria | 20583 |
| 100 | Ga0070674_100042528 | 3300005356 | Bacteria | 3087 |
| 101 | Ga0070674_100103524 | 3300005356 | Bacteria | 2078 |
| 102 | Ga0070674_100163489 | 3300005356 | Bacteria | 1691 |
| 103 | Ga0070673_100000105 | 3300005364 | Bacteria | 38116 |
| 104 | Ga0070673_100057580 | 3300005364 | Bacteria | 3070 |
| 105 | Ga0070673_100077554 | 3300005364 | Bacteria | 2685 |
| 106 | Ga0070688_100000401 | 3300005365 | Bacteria | 21994 |
| 107 | Ga0070688_100004970 | 3300005365 | Bacteria | 6958 |
| 108 | Ga0070688_100032762 | 3300005365 | Bacteria | 3137 |
| 109 | Ga0070688_100244366 | 3300005365 | Bacteria | 1275 |
| 110 | Ga0070688_100275607 | 3300005365 | Bacteria | 1207 |
| 111 | Ga0070659_100000590 | 3300005366 | Bacteria | 26572 |
| 112 | Ga0070659_100048051 | 3300005366 | Bacteria | 3350 |
| 113 | Ga0070659_100048885 | 3300005366 | Bacteria | 3324 |
| 114 | Ga0070659_100265566 | 3300005366 | Bacteria | 1425 |
| 115 | Ga0070667_100004839 | 3300005367 | Bacteria | 11281 |
| 116 | Ga0070667_100117095 | 3300005367 | Bacteria | 2314 |
| 117 | Ga0070667_100694085 | 3300005367 | Bacteria | 942 |
| 118 | Ga0070703_10020953 | 3300005406 | Bacteria | 1907 |
| 119 | Ga0070709_10003572 | 3300005434 | Bacteria | 8349 |
| 120 | Ga0070709_10009284 | 3300005434 | Bacteria | 5419 |
| 121 | Ga0070709_10024715 | 3300005434 | Bacteria | 3539 |
| 122 | Ga0070709_10058454 | 3300005434 | Bacteria | 2445 |
| 123 | Ga0070714_100017451 | 3300005435 | Bacteria | 5815 |
| 124 | Ga0070714_100222407 | 3300005435 | Bacteria | 1735 |
| 125 | Ga0070713_100000830 | 3300005436 | Bacteria | 19766 |
| 126 | Ga0070713_100014528 | 3300005436 | Bacteria | 5853 |
| 127 | Ga0070713_100345515 | 3300005436 | Bacteria | 1379 |
| 128 | Ga0070710_10002223 | 3300005437 | Bacteria | 9168 |
| 129 | Ga0070710_10008148 | 3300005437 | Bacteria | 5094 |
| 130 | Ga0070710_10224483 | 3300005437 | Bacteria | 1197 |
| 131 | Ga0070701_10001631 | 3300005438 | Bacteria | 8380 |
| 132 | Ga0070701_10073231 | 3300005438 | Bacteria | 1836 |
| 133 | Ga0070711_100025054 | 3300005439 | Bacteria | 3899 |
| 134 | Ga0070711_100031041 | 3300005439 | Bacteria | 3543 |
| 135 | Ga0070711_100032473 | 3300005439 | Bacteria | 3470 |
| 136 | Ga0070711_100049912 | 3300005439 | Bacteria | 2867 |
| 137 | Ga0070711_100157975 | 3300005439 | Bacteria | 1716 |
| 138 | Ga0070711_100438417 | 3300005439 | Bacteria | 1067 |
| 139 | Ga0070705_100000252 | 3300005440 | Bacteria | 31840 |
| 140 | Ga0070705_100884950 | 3300005440 | Bacteria | 717 |
| 141 | Ga0070700_100009718 | 3300005441 | Bacteria | 5286 |
| 142 | Ga0070700_100225394 | 3300005441 | Bacteria | 1331 |
| 143 | Ga0070694_100002271 | 3300005444 | Bacteria | 11362 |
| 144 | Ga0070694_100049276 | 3300005444 | Bacteria | 2836 |
| 145 | Ga0070708_100025000 | 3300005445 | Bacteria | 5103 |
| 146 | Ga0070663_100001002 | 3300005455 | Bacteria | 15401 |
| 147 | Ga0070663_100057226 | 3300005455 | Bacteria | 2796 |
| 148 | Ga0070663_100067388 | 3300005455 | Bacteria | 2596 |
| 149 | Ga0070663_100083501 | 3300005455 | Bacteria | 2352 |
| 150 | Ga0070663_100571252 | 3300005455 | Bacteria | 948 |
| 151 | Ga0070678_100000033 | 3300005456 | Bacteria | 45283 |
| 152 | Ga0070678_100187110 | 3300005456 | Bacteria | 1700 |
| 153 | Ga0070678_100384874 | 3300005456 | Bacteria | 1214 |
| 154 | Ga0070662_100002444 | 3300005457 | Bacteria | 11436 |
| 155 | Ga0070662_100008859 | 3300005457 | Bacteria | 6558 |
| 156 | Ga0070681_10003475 | 3300005458 | Bacteria | 14760 |
| 157 | Ga0070681_10006724 | 3300005458 | Bacteria | 11187 |
| 158 | Ga0070681_10061299 | 3300005458 | Bacteria | 3737 |
| 159 | Ga0070681_10113593 | 3300005458 | Bacteria | 2648 |
| 160 | Ga0070681_10140401 | 3300005458 | Bacteria | 2346 |
| 161 | Ga0070681_10580382 | 3300005458 | Bacteria | 1035 |
| 162 | Ga0068867_100002276 | 3300005459 | Bacteria | 13502 |
| 163 | Ga0068867_100101463 | 3300005459 | Bacteria | 2198 |
| 164 | Ga0070685_10014131 | 3300005466 | Bacteria | 4223 |
| 165 | Ga0070685_10049048 | 3300005466 | Bacteria | 2434 |
| 166 | Ga0070699_100081552 | 3300005518 | Bacteria | 2820 |
| 167 | Ga0070699_100832246 | 3300005518 | Bacteria | 845 |
| 168 | Ga0070679_100010016 | 3300005530 | Bacteria | 8975 |
| 169 | Ga0070679_100022664 | 3300005530 | Bacteria | 6140 |
| 170 | Ga0070679_100092473 | 3300005530 | Bacteria | 3012 |
| 171 | Ga0070679_100609994 | 3300005530 | Bacteria | 1034 |
| 172 | Ga0070684_100000275 | 3300005535 | Bacteria | 35701 |
| 173 | Ga0070684_100153294 | 3300005535 | Bacteria | 2088 |
| 174 | Ga0070684_100666655 | 3300005535 | Bacteria | 969 |
| 175 | Ga0070684_100983172 | 3300005535 | Bacteria | 792 |
| 176 | Ga0068853_100009622 | 3300005539 | Bacteria | 7788 |
| 177 | Ga0068853_100305029 | 3300005539 | Bacteria | 1473 |
| 178 | Ga0068853_100630149 | 3300005539 | Bacteria | 1019 |
| 179 | Ga0070672_100000008 | 3300005543 | Bacteria | 91782 |
| 180 | Ga0070672_100022535 | 3300005543 | Bacteria | 4628 |
| 181 | Ga0070672_100085799 | 3300005543 | Bacteria | 2531 |
| 182 | Ga0070686_100000309 | 3300005544 | Bacteria | 32158 |
| 183 | Ga0070686_100011935 | 3300005544 | Bacteria | 4939 |
| 184 | Ga0070686_100015096 | 3300005544 | Bacteria | 4466 |
| 185 | Ga0070686_100262906 | 3300005544 | Bacteria | 1266 |
| 186 | Ga0070686_100654043 | 3300005544 | Bacteria | 834 |
| 187 | Ga0070695_100000270 | 3300005545 | Bacteria | 26216 |
| 188 | Ga0070695_100008070 | 3300005545 | Bacteria | 6240 |
| 189 | Ga0070696_100001699 | 3300005546 | Bacteria | 14443 |
| 190 | Ga0070696_100087396 | 3300005546 | Bacteria | 2214 |
| 191 | Ga0070696_100136655 | 3300005546 | Bacteria | 1787 |
| 192 | Ga0070696_100331039 | 3300005546 | Bacteria | 1174 |
| 193 | Ga0070693_100000453 | 3300005547 | Bacteria | 18425 |
| 194 | Ga0070693_100006956 | 3300005547 | Bacteria | 5503 |
| 195 | Ga0070693_100138161 | 3300005547 | Bacteria | 1531 |
| 196 | Ga0070665_100071774 | 3300005548 | Bacteria | 3469 |
| 197 | Ga0070704_100001241 | 3300005549 | Bacteria | 13447 |
| 198 | Ga0068855_100011392 | 3300005563 | Bacteria | 10739 |
| 199 | Ga0068855_100063943 | 3300005563 | Bacteria | 4292 |
| 200 | Ga0068855_100122511 | 3300005563 | Bacteria | 2975 |
| 201 | Ga0068855_100149266 | 3300005563 | Bacteria | 2658 |
| 202 | Ga0068855_100192777 | 3300005563 | Bacteria | 2297 |
| 203 | Ga0068855_100393503 | 3300005563 | Bacteria | 1520 |
| 204 | Ga0070664_100000419 | 3300005564 | Bacteria | 31758 |
| 205 | Ga0070664_100083276 | 3300005564 | Bacteria | 2759 |
| 206 | Ga0070664_100225349 | 3300005564 | Bacteria | 1678 |
| 207 | Ga0070664_100417159 | 3300005564 | Bacteria | 1229 |
| 208 | Ga0070664_100626623 | 3300005564 | Bacteria | 999 |
| 209 | Ga0070664_100712422 | 3300005564 | Bacteria | 935 |
| 210 | Ga0068857_100005226 | 3300005577 | Bacteria | 11057 |
| 211 | Ga0068857_100218836 | 3300005577 | Bacteria | 1739 |
| 212 | Ga0068857_100409686 | 3300005577 | Bacteria | 1262 |
| 213 | Ga0068854_100040383 | 3300005578 | Bacteria | 3292 |
| 214 | Ga0068854_100131394 | 3300005578 | Bacteria | 1912 |
| 215 | Ga0068854_100384774 | 3300005578 | Bacteria | 1157 |
| 216 | Ga0068856_100000963 | 3300005614 | Bacteria | 30708 |
| 217 | Ga0068856_100275336 | 3300005614 | Bacteria | 1699 |
| 218 | Ga0068856_100838421 | 3300005614 | Bacteria | 939 |
| 219 | Ga0070702_100068997 | 3300005615 | Bacteria | 2082 |
| 220 | Ga0070702_100075961 | 3300005615 | Bacteria | 1998 |
| 221 | Ga0068852_100024652 | 3300005616 | Bacteria | 4865 |
| 222 | Ga0068852_100198211 | 3300005616 | Bacteria | 1899 |
| 223 | Ga0068852_100327035 | 3300005616 | Bacteria | 1490 |
| 224 | Ga0068859_100010517 | 3300005617 | Bacteria | 9311 |
| 225 | Ga0068859_100038950 | 3300005617 | Bacteria | 4767 |
| 226 | Ga0068859_100041077 | 3300005617 | Bacteria | 4646 |
| 227 | Ga0068859_100158936 | 3300005617 | Bacteria | 2339 |
| 228 | Ga0068864_100013519 | 3300005618 | Bacteria | 6768 |
| 229 | Ga0068864_100041276 | 3300005618 | Bacteria | 3946 |
| 230 | Ga0068864_100344145 | 3300005618 | Bacteria | 1406 |
| 231 | Ga0068864_100819726 | 3300005618 | Bacteria | 915 |
| 232 | Ga0068864_101604943 | 3300005618 | Bacteria | 654 |
| 233 | Ga0068866_10000291 | 3300005718 | Bacteria | 23901 |
| 234 | Ga0068866_10101656 | 3300005718 | Bacteria | 1587 |
| 235 | Ga0068861_100001375 | 3300005719 | Bacteria | 15262 |
| 236 | Ga0068861_100031191 | 3300005719 | Bacteria | 3913 |
| 237 | Ga0068861_100252446 | 3300005719 | Bacteria | 1506 |
| 238 | Ga0068861_100286527 | 3300005719 | Bacteria | 1421 |
| 239 | Ga0068851_10028004 | 3300005834 | Bacteria | 2781 |
| 240 | Ga0068870_10000005 | 3300005840 | Bacteria | 79445 |
| 241 | Ga0068870_10162270 | 3300005840 | Bacteria | 1326 |
| 242 | Ga0068863_100000608 | 3300005841 | Bacteria | 36316 |
| 243 | Ga0068863_100066955 | 3300005841 | Bacteria | 3397 |
| 244 | Ga0068863_100157381 | 3300005841 | Bacteria | 2176 |
| 245 | Ga0068858_100014751 | 3300005842 | Bacteria | 7353 |
| 246 | Ga0068858_100024402 | 3300005842 | Bacteria | 5634 |
| 247 | Ga0068858_100043968 | 3300005842 | Bacteria | 4142 |
| 248 | Ga0068858_100367397 | 3300005842 | Bacteria | 1379 |
| 249 | Ga0068858_100404091 | 3300005842 | Bacteria | 1313 |
| 250 | Ga0068860_100001183 | 3300005843 | Bacteria | 28556 |
| 251 | Ga0068860_100172126 | 3300005843 | Bacteria | 2092 |
| 252 | Ga0068860_100317499 | 3300005843 | Bacteria | 1529 |
| 253 | Ga0068862_100010075 | 3300005844 | Bacteria | 7803 |
| 254 | Ga0068862_100013288 | 3300005844 | Bacteria | 6811 |
| 255 | Ga0068862_100968330 | 3300005844 | Bacteria | 840 |
| 256 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 257 | Ga0081455_10004074 | 3300005937 | Bacteria | 16551 |
| 258 | Ga0081455_10406209 | 3300005937 | Bacteria | 944 |
| 259 | Ga0070717_10002981 | 3300006028 | Bacteria | 12049 |
| 260 | Ga0075365_10037930 | 3300006038 | Bacteria | 3129 |
| 261 | Ga0075368_10009624 | 3300006042 | Bacteria | 3478 |
| 262 | Ga0075368_10180832 | 3300006042 | Bacteria | 889 |
| 263 | Ga0075363_100021775 | 3300006048 | Bacteria | 3235 |
| 264 | Ga0075363_100483214 | 3300006048 | Bacteria | 734 |
| 265 | Ga0075364_10400130 | 3300006051 | Bacteria | 937 |
| 266 | Ga0075432_10005509 | 3300006058 | Bacteria | 4312 |
| 267 | Ga0075432_10015716 | 3300006058 | Bacteria | 2583 |
| 268 | Ga0070715_10034535 | 3300006163 | Bacteria | 2074 |
| 269 | Ga0070715_10099511 | 3300006163 | Bacteria | 1353 |
| 270 | Ga0070716_100093235 | 3300006173 | Bacteria | 1828 |
| 271 | Ga0070716_100170001 | 3300006173 | Bacteria | 1421 |
| 272 | Ga0070716_100376753 | 3300006173 | Bacteria | 1013 |
| 273 | Ga0070712_100016065 | 3300006175 | Bacteria | 4830 |
| 274 | Ga0070712_100123683 | 3300006175 | Bacteria | 1951 |
| 275 | Ga0070712_100230144 | 3300006175 | Bacteria | 1472 |
| 276 | Ga0075367_10031675 | 3300006178 | Bacteria | 3038 |
| 277 | Ga0075367_10051919 | 3300006178 | Bacteria | 2425 |
| 278 | Ga0075427_10001679 | 3300006194 | Bacteria | 2877 |
| 279 | Ga0075366_10017677 | 3300006195 | Bacteria | 4108 |
| 280 | Ga0075366_10092822 | 3300006195 | Bacteria | 1809 |
| 281 | Ga0097621_100000006 | 3300006237 | Bacteria | 134536 |
| 282 | Ga0097621_100054592 | 3300006237 | Bacteria | 3259 |
| 283 | Ga0097621_100212178 | 3300006237 | Bacteria | 1684 |
| 284 | Ga0075370_10053913 | 3300006353 | Bacteria | 2282 |
| 285 | Ga0075370_10114307 | 3300006353 | Bacteria | 1569 |
| 286 | Ga0075370_10173773 | 3300006353 | Bacteria | 1267 |
| 287 | Ga0068871_100000022 | 3300006358 | Bacteria | 82775 |
| 288 | Ga0068871_100004373 | 3300006358 | Bacteria | 9821 |
| 289 | Ga0068871_100052461 | 3300006358 | Bacteria | 3302 |
| 290 | Ga0068871_100402199 | 3300006358 | Bacteria | 1220 |
| 291 | Ga0075428_100010613 | 3300006844 | Bacteria | 10238 |
| 292 | Ga0075430_100000485 | 3300006846 | Bacteria | 29753 |
| 293 | Ga0075431_100002570 | 3300006847 | Bacteria | 17523 |
| 294 | Ga0075433_10001502 | 3300006852 | Bacteria | 17233 |
| 295 | Ga0075433_10010359 | 3300006852 | Bacteria | 7477 |
| 296 | Ga0075433_10117392 | 3300006852 | Bacteria | 2361 |
| 297 | Ga0075433_10622926 | 3300006852 | Bacteria | 947 |
| 298 | Ga0075434_100000877 | 3300006871 | Bacteria | 24056 |
| 299 | Ga0075434_100001706 | 3300006871 | Bacteria | 18809 |
| 300 | Ga0075434_100159920 | 3300006871 | Bacteria | 2272 |
| 301 | Ga0075434_100296944 | 3300006871 | Bacteria | 1636 |
| 302 | Ga0075429_100000667 | 3300006880 | Bacteria | 26600 |
| 303 | Ga0068865_100000196 | 3300006881 | Bacteria | 33650 |
| 304 | Ga0068865_100017462 | 3300006881 | Bacteria | 4614 |
| 305 | Ga0068865_100024862 | 3300006881 | Bacteria | 3933 |
| 306 | Ga0068865_100088317 | 3300006881 | Bacteria | 2243 |
| 307 | Ga0068865_100471102 | 3300006881 | Bacteria | 1042 |
| 308 | Ga0075436_100207518 | 3300006914 | Bacteria | 1388 |
| 309 | Ga0097620_100010517 | 3300006931 | Bacteria | 9311 |
| 310 | Ga0097620_100038950 | 3300006931 | Bacteria | 4767 |
| 311 | Ga0097620_100041079 | 3300006931 | Bacteria | 4646 |
| 312 | Ga0097620_100158937 | 3300006931 | Bacteria | 2339 |
| 313 | Ga0075435_100007750 | 3300007076 | Bacteria | 7674 |
| 314 | Ga0075435_100220275 | 3300007076 | Bacteria | 1611 |
| 315 | Ga0075435_100735858 | 3300007076 | Bacteria | 858 |
| 316 | Ga0105251_10011249 | 3300009011 | Bacteria | 5122 |
| 317 | Ga0105251_10020989 | 3300009011 | Bacteria | 3419 |
| 318 | Ga0105250_10013540 | 3300009092 | Bacteria | 3360 |
| 319 | Ga0105250_10193910 | 3300009092 | Bacteria | 855 |
| 320 | Ga0105240_10179599 | 3300009093 | Bacteria | 2499 |
| 321 | Ga0105240_10205550 | 3300009093 | Bacteria | 2305 |
| 322 | Ga0105240_10490741 | 3300009093 | Bacteria | 1367 |
| 323 | Ga0105240_10493529 | 3300009093 | Bacteria | 1363 |
| 324 | Ga0105240_10561446 | 3300009093 | Bacteria | 1262 |
| 325 | Ga0105240_10885784 | 3300009093 | Bacteria | 961 |
| 326 | Ga0111539_10000817 | 3300009094 | Bacteria | 40427 |
| 327 | Ga0111539_10001765 | 3300009094 | Bacteria | 28723 |
| 328 | Ga0111539_10001792 | 3300009094 | Bacteria | 28559 |
| 329 | Ga0111539_10047909 | 3300009094 | Bacteria | 5105 |
| 330 | Ga0111539_10371175 | 3300009094 | Bacteria | 1665 |
| 331 | Ga0111539_10417137 | 3300009094 | Bacteria | 1563 |
| 332 | Ga0105245_10001176 | 3300009098 | Bacteria | 23698 |
| 333 | Ga0105245_10056482 | 3300009098 | Bacteria | 3529 |
| 334 | Ga0105245_10065447 | 3300009098 | Bacteria | 3287 |
| 335 | Ga0105245_10577791 | 3300009098 | Bacteria | 1148 |
| 336 | Ga0105247_10001410 | 3300009101 | Bacteria | 17436 |
| 337 | Ga0105247_10037063 | 3300009101 | Bacteria | 2974 |
| 338 | Ga0105247_10078581 | 3300009101 | Bacteria | 2076 |
| 339 | Ga0105247_10096434 | 3300009101 | Bacteria | 1885 |
| 340 | Ga0105247_10384478 | 3300009101 | Bacteria | 996 |
| 341 | Ga0114129_10005250 | 3300009147 | Bacteria | 18260 |
| 342 | Ga0114129_10045189 | 3300009147 | Bacteria | 6192 |
| 343 | Ga0105243_10002512 | 3300009148 | Bacteria | 15312 |
| 344 | Ga0105243_10002946 | 3300009148 | Bacteria | 14068 |
| 345 | Ga0105243_10155191 | 3300009148 | Bacteria | 1968 |
| 346 | Ga0105243_10160393 | 3300009148 | Bacteria | 1938 |
| 347 | Ga0105243_10243132 | 3300009148 | Bacteria | 1603 |
| 348 | Ga0105243_10387998 | 3300009148 | Bacteria | 1294 |
| 349 | Ga0105241_10006541 | 3300009174 | Bacteria | 8588 |
| 350 | Ga0105241_10103578 | 3300009174 | Bacteria | 2266 |
| 351 | Ga0105241_10138834 | 3300009174 | Bacteria | 1977 |
| 352 | Ga0105241_10409578 | 3300009174 | Bacteria | 1191 |
| 353 | Ga0105241_11458188 | 3300009174 | Bacteria | 657 |
| 354 | Ga0105242_10000879 | 3300009176 | Bacteria | 23309 |
| 355 | Ga0105242_10015607 | 3300009176 | Bacteria | 5901 |
| 356 | Ga0105242_10473463 | 3300009176 | Bacteria | 1185 |
| 357 | Ga0105242_10505322 | 3300009176 | Bacteria | 1150 |
| 358 | Ga0105242_10850631 | 3300009176 | Bacteria | 908 |
| 359 | Ga0105248_10012400 | 3300009177 | Bacteria | 9403 |
| 360 | Ga0105248_10034418 | 3300009177 | Bacteria | 5664 |
| 361 | Ga0105248_10174583 | 3300009177 | Bacteria | 2422 |
| 362 | Ga0105248_10233587 | 3300009177 | Bacteria | 2070 |
| 363 | Ga0105248_11205731 | 3300009177 | Bacteria | 856 |
| 364 | Ga0105237_10043805 | 3300009545 | Bacteria | 4507 |
| 365 | Ga0105237_10135140 | 3300009545 | Bacteria | 2461 |
| 366 | Ga0105238_10119323 | 3300009551 | Bacteria | 2618 |
| 367 | Ga0105238_10161226 | 3300009551 | Bacteria | 2218 |
| 368 | Ga0105238_10221644 | 3300009551 | Bacteria | 1867 |
| 369 | Ga0105238_10386325 | 3300009551 | Bacteria | 1392 |
| 370 | Ga0105238_11149496 | 3300009551 | Bacteria | 800 |
| 371 | Ga0105249_10003131 | 3300009553 | Bacteria | 14300 |
| 372 | Ga0105249_10003187 | 3300009553 | Bacteria | 14200 |
| 373 | Ga0105249_10328827 | 3300009553 | Bacteria | 1542 |
| 374 | Ga0105249_10673586 | 3300009553 | Bacteria | 1093 |
| 375 | Ga0105249_11246231 | 3300009553 | Unclassified | 815 |
| 376 | Ga0105239_10001436 | 3300010375 | Bacteria | 31755 |
| 377 | Ga0105239_10010581 | 3300010375 | Bacteria | 10313 |
| 378 | Ga0105239_10607302 | 3300010375 | Bacteria | 1248 |
| 379 | Ga0105246_10000984 | 3300011119 | Bacteria | 16373 |
| 380 | Ga0105246_10141254 | 3300011119 | Bacteria | 1811 |
| 381 | Ga0157341_1014616 | 3300012494 | Bacteria | 714 |
| 382 | Ga0157339_1004819 | 3300012505 | Bacteria | 1040 |
| 383 | Ga0157326_1004464 | 3300012513 | Bacteria | 1469 |
| 384 | Ga0157338_1000604 | 3300012515 | Bacteria | 2209 |
| 385 | Ga0157338_1001184 | 3300012515 | Bacteria | 1803 |
| 386 | Ga0157373_10023028 | 3300013100 | Bacteria | 4518 |
| 387 | Ga0157373_10033867 | 3300013100 | Bacteria | 3671 |
| 388 | Ga0157373_10067713 | 3300013100 | Bacteria | 2524 |
| 389 | Ga0157373_10129589 | 3300013100 | Bacteria | 1774 |
| 390 | Ga0157371_10227785 | 3300013102 | Bacteria | 1339 |
| 391 | Ga0157371_10242990 | 3300013102 | Bacteria | 1295 |
| 392 | Ga0157371_10316006 | 3300013102 | Bacteria | 1133 |
| 393 | Ga0157370_10035810 | 3300013104 | Bacteria | 4821 |
| 394 | Ga0157370_10062601 | 3300013104 | Bacteria | 3528 |
| 395 | Ga0157369_10123103 | 3300013105 | Bacteria | 2751 |
| 396 | Ga0157369_10135939 | 3300013105 | Bacteria | 2603 |
| 397 | Ga0157369_10154077 | 3300013105 | Bacteria | 2428 |
| 398 | Ga0157369_10596731 | 3300013105 | Bacteria | 1140 |
| 399 | Ga0157369_10701506 | 3300013105 | Bacteria | 1042 |
| 400 | Ga0157369_11180794 | 3300013105 | Bacteria | 781 |
| 401 | Ga0157374_10012602 | 3300013296 | Bacteria | 7361 |
| 402 | Ga0157374_10071928 | 3300013296 | Bacteria | 3262 |
| 403 | Ga0157374_10116537 | 3300013296 | Bacteria | 2574 |
| 404 | Ga0157374_10284941 | 3300013296 | Bacteria | 1631 |
| 405 | Ga0157378_10001496 | 3300013297 | Bacteria | 21127 |
| 406 | Ga0157378_10058064 | 3300013297 | Bacteria | 3450 |
| 407 | Ga0157378_10076403 | 3300013297 | Bacteria | 3018 |
| 408 | Ga0157378_10266059 | 3300013297 | Bacteria | 1647 |
| 409 | Ga0157378_10624355 | 3300013297 | Bacteria | 1091 |
| 410 | Ga0163162_10004276 | 3300013306 | Bacteria | 13741 |
| 411 | Ga0163162_10006826 | 3300013306 | Bacteria | 11074 |
| 412 | Ga0163162_10653248 | 3300013306 | Bacteria | 1175 |
| 413 | Ga0157372_10060986 | 3300013307 | Bacteria | 4221 |
| 414 | Ga0157372_10530411 | 3300013307 | Bacteria | 1372 |
| 415 | Ga0157375_10000732 | 3300013308 | Bacteria | 28957 |
| 416 | Ga0157375_10082399 | 3300013308 | Bacteria | 3259 |
| 417 | Ga0157375_10099660 | 3300013308 | Bacteria | 2985 |
| 418 | Ga0157375_10202201 | 3300013308 | Bacteria | 2143 |
| 419 | Ga0157375_10476507 | 3300013308 | Bacteria | 1413 |
| 420 | Ga0157375_11402191 | 3300013308 | Bacteria | 823 |
| 421 | Ga0163163_10005114 | 3300014325 | Bacteria | 11310 |
| 422 | Ga0163163_10111377 | 3300014325 | Bacteria | 2766 |
| 423 | Ga0157380_10000551 | 3300014326 | Bacteria | 23076 |
| 424 | Ga0157380_10140684 | 3300014326 | Bacteria | 2073 |
| 425 | Ga0157380_10490820 | 3300014326 | Bacteria | 1190 |
| 426 | Ga0157380_10796026 | 3300014326 | Bacteria | 962 |
| 427 | Ga0157380_11367712 | 3300014326 | Bacteria | 757 |
| 428 | Ga0182008_10013043 | 3300014497 | Bacteria | 4372 |
| 429 | Ga0157377_10000127 | 3300014745 | Bacteria | 49198 |
| 430 | Ga0157377_10489399 | 3300014745 | Bacteria | 857 |
| 431 | Ga0157379_10016175 | 3300014968 | Bacteria | 6563 |
| 432 | Ga0157379_10017453 | 3300014968 | Bacteria | 6320 |
| 433 | Ga0157379_10203258 | 3300014968 | Bacteria | 1792 |
| 434 | Ga0157379_10537674 | 3300014968 | Bacteria | 1086 |
| 435 | Ga0157376_10000126 | 3300014969 | Bacteria | 52844 |
| 436 | Ga0157376_10106117 | 3300014969 | Bacteria | 2464 |
| 437 | Ga0157376_10237405 | 3300014969 | Bacteria | 1697 |
| 438 | Ga0182007_10044881 | 3300015262 | Bacteria | 1465 |
| 439 | Ga0163161_10000562 | 3300017792 | Bacteria | 29937 |
| 440 | Ga0163161_10061780 | 3300017792 | Bacteria | 2728 |
| 441 | Ga0163161_10192788 | 3300017792 | Bacteria | 1567 |
| 442 | Ga0163161_10209982 | 3300017792 | Bacteria | 1504 |
| 443 | Ga0206356_11340422 | 3300020070 | Bacteria | 1623 |
| 444 | Ga0213876_10017621 | 3300021384 | Bacteria | 3769 |
| 445 | Ga0213876_10082674 | 3300021384 | Bacteria | 1699 |
| 446 | Ga0207666_1000211 | 3300025271 | Bacteria | 8699 |
| 447 | Ga0207666_1000213 | 3300025271 | Bacteria | 8672 |
| 448 | Ga0207673_1000023 | 3300025290 | Bacteria | 11945 |
| 449 | Ga0207697_10000369 | 3300025315 | Bacteria | 25213 |
| 450 | Ga0207696_1042459 | 3300025711 | Bacteria | 1325 |
| 451 | Ga0207713_1040519 | 3300025735 | Bacteria | 1954 |
| 452 | Ga0207653_10004957 | 3300025885 | Bacteria | 4158 |
| 453 | Ga0207682_10000001 | 3300025893 | Bacteria | 152713 |
| 454 | Ga0207682_10002328 | 3300025893 | Bacteria | 8562 |
| 455 | Ga0207692_10043533 | 3300025898 | Bacteria | 2234 |
| 456 | Ga0207692_10090640 | 3300025898 | Bacteria | 1657 |
| 457 | Ga0207692_10312665 | 3300025898 | Bacteria | 959 |
| 458 | Ga0207642_10000346 | 3300025899 | Bacteria | 13892 |
| 459 | Ga0207642_10009174 | 3300025899 | Bacteria | 3430 |
| 460 | Ga0207710_10002668 | 3300025900 | Bacteria | 8215 |
| 461 | Ga0207710_10014949 | 3300025900 | Bacteria | 3278 |
| 462 | Ga0207710_10016601 | 3300025900 | Bacteria | 3116 |
| 463 | Ga0207710_10017400 | 3300025900 | Bacteria | 3049 |
| 464 | Ga0207688_10000694 | 3300025901 | Bacteria | 16633 |
| 465 | Ga0207688_10038648 | 3300025901 | Bacteria | 2650 |
| 466 | Ga0207688_10081821 | 3300025901 | Bacteria | 1845 |
| 467 | Ga0207688_10236699 | 3300025901 | Bacteria | 1103 |
| 468 | Ga0207688_10461644 | 3300025901 | Bacteria | 793 |
| 469 | Ga0207680_10002770 | 3300025903 | Bacteria | 8198 |
| 470 | Ga0207680_10083500 | 3300025903 | Bacteria | 2013 |
| 471 | Ga0207647_10005072 | 3300025904 | Bacteria | 9712 |
| 472 | Ga0207647_10006956 | 3300025904 | Bacteria | 8199 |
| 473 | Ga0207685_10043858 | 3300025905 | Bacteria | 1688 |
| 474 | Ga0207699_10000333 | 3300025906 | Bacteria | 25003 |
| 475 | Ga0207699_10014241 | 3300025906 | Bacteria | 4094 |
| 476 | Ga0207699_10053871 | 3300025906 | Bacteria | 2387 |
| 477 | Ga0207645_10000862 | 3300025907 | Bacteria | 25213 |
| 478 | Ga0207645_10041411 | 3300025907 | Bacteria | 2948 |
| 479 | Ga0207645_10061456 | 3300025907 | Bacteria | 2399 |
| 480 | Ga0207645_10137055 | 3300025907 | Bacteria | 1594 |
| 481 | Ga0207645_10323823 | 3300025907 | Bacteria | 1028 |
| 482 | Ga0207643_10000041 | 3300025908 | Bacteria | 85133 |
| 483 | Ga0207643_10084137 | 3300025908 | Bacteria | 1846 |
| 484 | Ga0207705_10026744 | 3300025909 | Bacteria | 4112 |
| 485 | Ga0207705_10060008 | 3300025909 | Bacteria | 2746 |
| 486 | Ga0207654_10001213 | 3300025911 | Bacteria | 13786 |
| 487 | Ga0207654_10096705 | 3300025911 | Bacteria | 1811 |
| 488 | Ga0207654_10103935 | 3300025911 | Bacteria | 1755 |
| 489 | Ga0207707_10001359 | 3300025912 | Bacteria | 22742 |
| 490 | Ga0207707_10040910 | 3300025912 | Bacteria | 4047 |
| 491 | Ga0207707_10089808 | 3300025912 | Bacteria | 2685 |
| 492 | Ga0207707_10126818 | 3300025912 | Bacteria | 2232 |
| 493 | Ga0207707_10187380 | 3300025912 | Bacteria | 1806 |
| 494 | Ga0207707_10284810 | 3300025912 | Bacteria | 1431 |
| 495 | Ga0207707_10288584 | 3300025912 | Bacteria | 1420 |
| 496 | Ga0207695_10053991 | 3300025913 | Bacteria | 4199 |
| 497 | Ga0207695_10240990 | 3300025913 | Bacteria | 1710 |
| 498 | Ga0207671_10022738 | 3300025914 | Bacteria | 4737 |
| 499 | Ga0207671_10371231 | 3300025914 | Bacteria | 1136 |
| 500 | Ga0207693_10003835 | 3300025915 | Bacteria | 12800 |
| 501 | Ga0207693_10040557 | 3300025915 | Bacteria | 3667 |
| 502 | Ga0207693_10309096 | 3300025915 | Bacteria | 1238 |
| 503 | Ga0207663_10011514 | 3300025916 | Bacteria | 4750 |
| 504 | Ga0207663_10018037 | 3300025916 | Bacteria | 3944 |
| 505 | Ga0207663_10022636 | 3300025916 | Bacteria | 3596 |
| 506 | Ga0207663_10059718 | 3300025916 | Bacteria | 2414 |
| 507 | Ga0207660_10000006 | 3300025917 | Bacteria | 106298 |
| 508 | Ga0207660_10024028 | 3300025917 | Bacteria | 4122 |
| 509 | Ga0207660_10091681 | 3300025917 | Bacteria | 2254 |
| 510 | Ga0207660_10364100 | 3300025917 | Bacteria | 1160 |
| 511 | Ga0207662_10000207 | 3300025918 | Bacteria | 27378 |
| 512 | Ga0207662_10003071 | 3300025918 | Bacteria | 8518 |
| 513 | Ga0207662_10107951 | 3300025918 | Bacteria | 1732 |
| 514 | Ga0207657_10005584 | 3300025919 | Bacteria | 13136 |
| 515 | Ga0207657_10029437 | 3300025919 | Bacteria | 4999 |
| 516 | Ga0207657_10077821 | 3300025919 | Bacteria | 2795 |
| 517 | Ga0207657_10128448 | 3300025919 | Bacteria | 2080 |
| 518 | Ga0207657_10267183 | 3300025919 | Bacteria | 1360 |
| 519 | Ga0207657_10298785 | 3300025919 | Bacteria | 1276 |
| 520 | Ga0207649_10000049 | 3300025920 | Bacteria | 109723 |
| 521 | Ga0207649_10341178 | 3300025920 | Bacteria | 1106 |
| 522 | Ga0207652_10000300 | 3300025921 | Bacteria | 51095 |
| 523 | Ga0207652_10021269 | 3300025921 | Bacteria | 5353 |
| 524 | Ga0207652_10026585 | 3300025921 | Bacteria | 4822 |
| 525 | Ga0207652_10062764 | 3300025921 | Bacteria | 3211 |
| 526 | Ga0207652_10161541 | 3300025921 | Bacteria | 2009 |
| 527 | Ga0207652_10214373 | 3300025921 | Bacteria | 1734 |
| 528 | Ga0207652_10299759 | 3300025921 | Bacteria | 1451 |
| 529 | Ga0207646_10499612 | 3300025922 | Bacteria | 1096 |
| 530 | Ga0207681_10000024 | 3300025923 | Bacteria | 206607 |
| 531 | Ga0207694_10064079 | 3300025924 | Bacteria | 2864 |
| 532 | Ga0207694_10172650 | 3300025924 | Bacteria | 1751 |
| 533 | Ga0207650_10005629 | 3300025925 | Bacteria | 8554 |
| 534 | Ga0207650_10090190 | 3300025925 | Bacteria | 2341 |
| 535 | Ga0207650_10302567 | 3300025925 | Bacteria | 1306 |
| 536 | Ga0207650_10430355 | 3300025925 | Unclassified | 1096 |
| 537 | Ga0207659_10000042 | 3300025926 | Bacteria | 90881 |
| 538 | Ga0207659_10165515 | 3300025926 | Bacteria | 1740 |
| 539 | Ga0207659_10335578 | 3300025926 | Bacteria | 1251 |
| 540 | Ga0207659_10350242 | 3300025926 | Bacteria | 1225 |
| 541 | Ga0207687_10000476 | 3300025927 | Bacteria | 27260 |
| 542 | Ga0207687_10064144 | 3300025927 | Bacteria | 2604 |
| 543 | Ga0207687_10155565 | 3300025927 | Bacteria | 1749 |
| 544 | Ga0207687_10536967 | 3300025927 | Bacteria | 980 |
| 545 | Ga0207700_10003404 | 3300025928 | Bacteria | 9238 |
| 546 | Ga0207700_10086425 | 3300025928 | Bacteria | 2464 |
| 547 | Ga0207664_10072138 | 3300025929 | Bacteria | 2783 |
| 548 | Ga0207664_10159241 | 3300025929 | Bacteria | 1924 |
| 549 | Ga0207644_10000041 | 3300025931 | Bacteria | 114951 |
| 550 | Ga0207644_10018193 | 3300025931 | Bacteria | 4751 |
| 551 | Ga0207644_10062431 | 3300025931 | Bacteria | 2702 |
| 552 | Ga0207644_10320097 | 3300025931 | Bacteria | 1254 |
| 553 | Ga0207690_10000137 | 3300025932 | Bacteria | 59768 |
| 554 | Ga0207690_10020306 | 3300025932 | Bacteria | 4103 |
| 555 | Ga0207706_10010775 | 3300025933 | Bacteria | 8345 |
| 556 | Ga0207706_10056164 | 3300025933 | Bacteria | 3472 |
| 557 | Ga0207706_10113807 | 3300025933 | Bacteria | 2380 |
| 558 | Ga0207706_10123367 | 3300025933 | Bacteria | 2279 |
| 559 | Ga0207686_10001872 | 3300025934 | Bacteria | 11683 |
| 560 | Ga0207686_10364711 | 3300025934 | Bacteria | 1091 |
| 561 | Ga0207709_10000220 | 3300025935 | Bacteria | 72291 |
| 562 | Ga0207709_10008968 | 3300025935 | Bacteria | 5517 |
| 563 | Ga0207709_10080964 | 3300025935 | Bacteria | 2092 |
| 564 | Ga0207709_10361788 | 3300025935 | Bacteria | 1099 |
| 565 | Ga0207709_10658941 | 3300025935 | Bacteria | 834 |
| 566 | Ga0207670_10000323 | 3300025936 | Bacteria | 28564 |
| 567 | Ga0207670_10109615 | 3300025936 | Bacteria | 1987 |
| 568 | Ga0207670_10361414 | 3300025936 | Bacteria | 1152 |
| 569 | Ga0207669_10000005 | 3300025937 | Bacteria | 185218 |
| 570 | Ga0207669_10029133 | 3300025937 | Bacteria | 3048 |
| 571 | Ga0207669_10029285 | 3300025937 | Bacteria | 3043 |
| 572 | Ga0207669_10033772 | 3300025937 | Bacteria | 2891 |
| 573 | Ga0207704_10000060 | 3300025938 | Bacteria | 76535 |
| 574 | Ga0207704_10017052 | 3300025938 | Bacteria | 3753 |
| 575 | Ga0207704_10313975 | 3300025938 | Bacteria | 1206 |
| 576 | Ga0207704_10367216 | 3300025938 | Bacteria | 1125 |
| 577 | Ga0207665_10000210 | 3300025939 | Bacteria | 39483 |
| 578 | Ga0207691_10001272 | 3300025940 | Bacteria | 25213 |
| 579 | Ga0207691_10017131 | 3300025940 | Bacteria | 6873 |
| 580 | Ga0207711_10011312 | 3300025941 | Bacteria | 7414 |
| 581 | Ga0207711_10016725 | 3300025941 | Bacteria | 6091 |
| 582 | Ga0207711_10031220 | 3300025941 | Bacteria | 4496 |
| 583 | Ga0207711_10054949 | 3300025941 | Bacteria | 3418 |
| 584 | Ga0207711_10057776 | 3300025941 | Bacteria | 3335 |
| 585 | Ga0207689_10000053 | 3300025942 | Bacteria | 88245 |
| 586 | Ga0207689_10033493 | 3300025942 | Bacteria | 4269 |
| 587 | Ga0207661_10000036 | 3300025944 | Bacteria | 149720 |
| 588 | Ga0207661_10233033 | 3300025944 | Bacteria | 1631 |
| 589 | Ga0207679_10000060 | 3300025945 | Bacteria | 100711 |
| 590 | Ga0207679_10259210 | 3300025945 | Bacteria | 1482 |
| 591 | Ga0207679_10486478 | 3300025945 | Bacteria | 1099 |
| 592 | Ga0207679_10728592 | 3300025945 | Bacteria | 901 |
| 593 | Ga0207667_10024638 | 3300025949 | Bacteria | 6602 |
| 594 | Ga0207667_10045229 | 3300025949 | Bacteria | 4664 |
| 595 | Ga0207667_10263521 | 3300025949 | Bacteria | 1762 |
| 596 | Ga0207667_10392647 | 3300025949 | Bacteria | 1413 |
| 597 | Ga0207667_10618642 | 3300025949 | Bacteria | 1091 |
| 598 | Ga0207651_10000014 | 3300025960 | Bacteria | 166931 |
| 599 | Ga0207651_10085220 | 3300025960 | Bacteria | 2292 |
| 600 | Ga0207651_10480743 | 3300025960 | Bacteria | 1070 |
| 601 | Ga0207712_10000134 | 3300025961 | Bacteria | 78054 |
| 602 | Ga0207712_10101883 | 3300025961 | Bacteria | 2136 |
| 603 | Ga0207712_10713818 | 3300025961 | Bacteria | 876 |
| 604 | Ga0207668_10000350 | 3300025972 | Bacteria | 29956 |
| 605 | Ga0207668_10058222 | 3300025972 | Bacteria | 2700 |
| 606 | Ga0207640_10000352 | 3300025981 | Bacteria | 30066 |
| 607 | Ga0207640_10164931 | 3300025981 | Bacteria | 1644 |
| 608 | Ga0207640_10308538 | 3300025981 | Bacteria | 1255 |
| 609 | Ga0207658_10004967 | 3300025986 | Bacteria | 9167 |
| 610 | Ga0207658_10097729 | 3300025986 | Bacteria | 2293 |
| 611 | Ga0207658_10646205 | 3300025986 | Bacteria | 953 |
| 612 | Ga0207677_10001126 | 3300026023 | Bacteria | 14572 |
| 613 | Ga0207677_10669024 | 3300026023 | Bacteria | 918 |
| 614 | Ga0207677_10753259 | 3300026023 | Bacteria | 868 |
| 615 | Ga0207703_10001140 | 3300026035 | Bacteria | 25115 |
| 616 | Ga0207703_10005127 | 3300026035 | Bacteria | 10603 |
| 617 | Ga0207703_10015688 | 3300026035 | Bacteria | 5909 |
| 618 | Ga0207703_10060573 | 3300026035 | Bacteria | 3096 |
| 619 | Ga0207703_10488795 | 3300026035 | Bacteria | 1154 |
| 620 | Ga0207639_10000411 | 3300026041 | Bacteria | 29662 |
| 621 | Ga0207639_10090851 | 3300026041 | Bacteria | 2443 |
| 622 | Ga0207639_10218915 | 3300026041 | Bacteria | 1643 |
| 623 | Ga0207639_11053817 | 3300026041 | Bacteria | 762 |
| 624 | Ga0207678_10000892 | 3300026067 | Bacteria | 27377 |
| 625 | Ga0207678_10014646 | 3300026067 | Bacteria | 6902 |
| 626 | Ga0207678_10057977 | 3300026067 | Bacteria | 3333 |
| 627 | Ga0207678_10122419 | 3300026067 | Bacteria | 2219 |
| 628 | Ga0207708_10002664 | 3300026075 | Bacteria | 13116 |
| 629 | Ga0207708_10048230 | 3300026075 | Bacteria | 3242 |
| 630 | Ga0207702_10000228 | 3300026078 | Bacteria | 64998 |
| 631 | Ga0207702_10434257 | 3300026078 | Bacteria | 1271 |
| 632 | Ga0207702_10924324 | 3300026078 | Bacteria | 865 |
| 633 | Ga0207641_10000664 | 3300026088 | Bacteria | 37481 |
| 634 | Ga0207641_10035734 | 3300026088 | Bacteria | 4142 |
| 635 | Ga0207641_10064132 | 3300026088 | Bacteria | 3139 |
| 636 | Ga0207641_10333219 | 3300026088 | Bacteria | 1442 |
| 637 | Ga0207641_10420855 | 3300026088 | Bacteria | 1286 |
| 638 | Ga0207641_11179568 | 3300026088 | Bacteria | 765 |
| 639 | Ga0207648_10001423 | 3300026089 | Bacteria | 26403 |
| 640 | Ga0207648_10203846 | 3300026089 | Bacteria | 1755 |
| 641 | Ga0207648_10231977 | 3300026089 | Bacteria | 1642 |
| 642 | Ga0207676_10000358 | 3300026095 | Bacteria | 38949 |
| 643 | Ga0207676_10004777 | 3300026095 | Bacteria | 9609 |
| 644 | Ga0207674_10000314 | 3300026116 | Bacteria | 61753 |
| 645 | Ga0207674_10016649 | 3300026116 | Bacteria | 8038 |
| 646 | Ga0207674_10037269 | 3300026116 | Bacteria | 5059 |
| 647 | Ga0207674_10159097 | 3300026116 | Bacteria | 2213 |
| 648 | Ga0207674_10351076 | 3300026116 | Bacteria | 1426 |
| 649 | Ga0207674_10405397 | 3300026116 | Bacteria | 1318 |
| 650 | Ga0207674_10969539 | 3300026116 | Unclassified | 819 |
| 651 | Ga0207675_100004673 | 3300026118 | Bacteria | 13186 |
| 652 | Ga0207675_100063045 | 3300026118 | Bacteria | 3463 |
| 653 | Ga0207675_100075170 | 3300026118 | Bacteria | 3162 |
| 654 | Ga0207675_100212039 | 3300026118 | Bacteria | 1863 |
| 655 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 656 | Ga0207683_10003914 | 3300026121 | Bacteria | 12911 |
| 657 | Ga0207683_10005246 | 3300026121 | Bacteria | 11127 |
| 658 | Ga0207683_10005378 | 3300026121 | Bacteria | 10975 |
| 659 | Ga0207698_10000999 | 3300026142 | Bacteria | 16426 |
| 660 | Ga0207698_10065013 | 3300026142 | Bacteria | 2862 |
| 661 | Ga0207698_10923965 | 3300026142 | Bacteria | 881 |
| 662 | Ga0209996_1004434 | 3300027395 | Bacteria | 1780 |
| 663 | Ga0209984_1001890 | 3300027424 | Bacteria | 2309 |
| 664 | Ga0210000_1009970 | 3300027462 | Bacteria | 1403 |
| 665 | Ga0209968_1016232 | 3300027526 | Bacteria | 1182 |
| 666 | Ga0209999_1007612 | 3300027543 | Bacteria | 1949 |
| 667 | Ga0209982_1004169 | 3300027552 | Bacteria | 2067 |
| 668 | Ga0209970_1018978 | 3300027614 | Bacteria | 1157 |
| 669 | Ga0210002_1000546 | 3300027617 | Bacteria | 5074 |
| 670 | Ga0210002_1032379 | 3300027617 | Bacteria | 872 |
| 671 | Ga0209983_1015238 | 3300027665 | Bacteria | 1585 |
| 672 | Ga0209983_1085077 | 3300027665 | Bacteria | 710 |
| 673 | Ga0209966_1001821 | 3300027695 | Bacteria | 3608 |
| 674 | Ga0209998_10001014 | 3300027717 | Bacteria | 7058 |
| 675 | Ga0209998_10001223 | 3300027717 | Bacteria | 6316 |
| 676 | Ga0209998_10002226 | 3300027717 | Bacteria | 4496 |
| 677 | Ga0209813_10090092 | 3300027866 | Bacteria | 1028 |
| 678 | Ga0209974_10003271 | 3300027876 | Bacteria | 5858 |
| 679 | Ga0209974_10106402 | 3300027876 | Bacteria | 984 |
| 680 | Ga0207428_10000316 | 3300027907 | Bacteria | 63363 |
| 681 | Ga0207428_10000897 | 3300027907 | Bacteria | 33272 |
| 682 | Ga0207428_10000923 | 3300027907 | Bacteria | 32854 |
| 683 | Ga0207428_10302598 | 3300027907 | Bacteria | 1183 |
| 684 | Ga0268266_10011674 | 3300028379 | Bacteria | 7625 |
| 685 | Ga0268265_10000146 | 3300028380 | Bacteria | 88615 |
| 686 | Ga0268265_10012031 | 3300028380 | Bacteria | 5857 |
| 687 | Ga0268264_10000976 | 3300028381 | Bacteria | 29278 |
| 688 | Ga0268264_10202635 | 3300028381 | Bacteria | 1816 |
| 689 | Ga0268264_10249514 | 3300028381 | Bacteria | 1648 |
| 690 | Ga0265337_1000979 | 3300028556 | Bacteria | 14962 |
| 691 | Ga0265338_10100432 | 3300028800 | Bacteria | 2360 |
| 692 | Ga0265338_10158624 | 3300028800 | Bacteria | 1750 |
| 693 | Ga0265330_10012738 | 3300031235 | Bacteria | 3926 |
| 694 | Ga0265325_10000097 | 3300031241 | Bacteria | 61606 |
| 695 | Ga0265325_10020634 | 3300031241 | Bacteria | 3630 |
| 696 | Ga0265340_10027609 | 3300031247 | Bacteria | 2860 |
| 697 | Ga0265339_10037773 | 3300031249 | Bacteria | 2697 |
| 698 | Ga0265331_10070035 | 3300031250 | Bacteria | 1642 |
| 699 | Ga0265316_10225647 | 3300031344 | Bacteria | 1381 |
| 700 | Ga0265316_10482761 | 3300031344 | Bacteria | 887 |
| 701 | Ga0307408_100582029 | 3300031548 | Bacteria | 992 |
| 702 | Ga0265313_10009818 | 3300031595 | Bacteria | 6164 |
| 703 | Ga0265313_10036332 | 3300031595 | Bacteria | 2473 |
| 704 | Ga0316575_10005354 | 3300031665 | Bacteria | 4573 |
| 705 | Ga0265314_10000829 | 3300031711 | Bacteria | 36749 |
| 706 | Ga0265314_10036151 | 3300031711 | Bacteria | 3592 |
| 707 | Ga0265314_10154477 | 3300031711 | Bacteria | 1403 |
| 708 | Ga0265314_10366826 | 3300031711 | Bacteria | 788 |
| 709 | Ga0265342_10029877 | 3300031712 | Bacteria | 3381 |
| 710 | Ga0265342_10034349 | 3300031712 | Bacteria | 3111 |
| 711 | Ga0316583_10000713 | 3300032133 | Bacteria | 10304 |
| 712 | Ga0373930_0000210 | 3300034816 | Bacteria | 7212 |
| 713 | Ga0373948_0000429 | 3300034817 | Bacteria | 5186 |
| 714 | Ga0373950_0000149 | 3300034818 | Bacteria | 10950 |
| 715 | Ga0373950_0010349 | 3300034818 | Bacteria | 1505 |
| 716 | Ga0373958_0005446 | 3300034819 | Bacteria | 1935 |
| 717 | Ga0373959_0005882 | 3300034820 | Bacteria | 2019 |
| 718 | Ga0373938_0000214 | 3300034957 | Bacteria | 8820 |
| 719 | Ga0373938_0000487 | 3300034957 | Bacteria | 6433 |
| 720 | Ga0373926_0013860 | 3300035083 | Bacteria | 2737 |
| 721 | Ga0373928_0000527 | 3300035084 | Bacteria | 7464 |
| 722 | Ga0373929_0001507 | 3300035085 | Bacteria | 4429 |
| 723 | Ga0373929_0002034 | 3300035085 | Bacteria | 3763 |
| 724 | Ga0373929_0002354 | 3300035085 | Bacteria | 3475 |
| 725 | Ga0373934_0046367 | 3300035086 | Bacteria | 1719 |
| 726 | Ga0373940_0000101 | 3300035088 | Bacteria | 10405 |
| 727 | Ga0373940_0008665 | 3300035088 | Bacteria | 2343 |
| 728 | Ga0373940_0038487 | 3300035088 | Bacteria | 1306 |
| 729 | Ga0373944_0007027 | 3300035089 | Bacteria | 3007 |
| 730 | Ga0373944_0042024 | 3300035089 | Bacteria | 1416 |
| 731 | Ga0373949_0001142 | 3300035090 | Bacteria | 7975 |
| 732 | Ga0373949_0002647 | 3300035090 | Bacteria | 4518 |
| 733 | Ga0373951_0000243 | 3300035091 | Bacteria | 18417 |
| 734 | Ga0373951_0007521 | 3300035091 | Bacteria | 2472 |
| 735 | Ga0373951_0039492 | 3300035091 | Bacteria | 1134 |
| 736 | Ga0373952_0000399 | 3300035092 | Bacteria | 7434 |
| 737 | Ga0373952_0000485 | 3300035092 | Bacteria | 6919 |
| 738 | Ga0373952_0019099 | 3300035092 | Bacteria | 1424 |
| 739 | Ga0373952_0053797 | 3300035092 | Bacteria | 967 |
| 740 | Ga0373923_0002068 | 3300035111 | Bacteria | 6064 |
| 741 | Ga0373923_0023489 | 3300035111 | Bacteria | 2426 |
| 742 | Ga0373923_0220504 | 3300035111 | Bacteria | 881 |
| 743 | Ga0373932_0000461 | 3300035112 | Bacteria | 12467 |
| 744 | Ga0373936_0022431 | 3300035113 | Bacteria | 2458 |
| 745 | Ga0373936_0026728 | 3300035113 | Bacteria | 2261 |
| 746 | Ga0373936_0231403 | 3300035113 | Bacteria | 822 |
| 747 | Ga0373939_0000710 | 3300035114 | Bacteria | 8245 |
| 748 | Ga0373939_0007703 | 3300035114 | Bacteria | 2621 |
| 749 | Ga0373939_0013941 | 3300035114 | Bacteria | 2077 |
| 750 | Ga0373939_0024392 | 3300035114 | Bacteria | 1684 |
| 751 | Ga0373941_0000067 | 3300035115 | Bacteria | 16393 |
| 752 | Ga0373941_0002487 | 3300035115 | Bacteria | 4065 |
| 753 | Ga0373941_0017762 | 3300035115 | Bacteria | 1954 |
| 754 | Ga0373941_0060405 | 3300035115 | Bacteria | 1232 |
| 755 | Ga0373945_0002631 | 3300035116 | Bacteria | 5623 |
| 756 | Ga0373945_0002786 | 3300035116 | Bacteria | 5485 |
| 757 | Ga0373953_0002762 | 3300035117 | Bacteria | 5333 |
| 758 | Ga0373953_0059206 | 3300035117 | Bacteria | 1563 |
| 759 | Ga0373953_0060854 | 3300035117 | Bacteria | 1543 |
| 760 | Ga0373954_0006315 | 3300035118 | Bacteria | 5166 |
| 761 | Ga0373954_0039933 | 3300035118 | Bacteria | 2185 |
| 762 | Ga0373954_0081640 | 3300035118 | Bacteria | 1545 |
| 763 | Ga0373956_0020187 | 3300035119 | Bacteria | 2832 |
| 764 | Ga0373956_0031722 | 3300035119 | Bacteria | 2317 |
| 765 | Ga0373956_0161385 | 3300035119 | Bacteria | 1056 |
| 766 | Ga0373957_0001485 | 3300035120 | Bacteria | 6357 |
| 767 | Ga0373957_0019662 | 3300035120 | Bacteria | 2379 |
| 768 | Ga0373960_0001028 | 3300035121 | Bacteria | 6016 |
| 769 | Ga0373960_0009902 | 3300035121 | Bacteria | 2318 |
| 770 | Ga0373960_0035083 | 3300035121 | Bacteria | 1422 |
| 771 | Ga0373960_0077211 | 3300035121 | Bacteria | 1041 |
| 772 | Ga0373943_0001307 | 3300035170 | Bacteria | 11185 |
| 773 | Ga0373943_0006960 | 3300035170 | Bacteria | 5073 |
| 774 | Ga0373955_0004746 | 3300035172 | Bacteria | 6046 |
| 775 | Ga0373955_0009093 | 3300035172 | Bacteria | 4639 |
| 776 | Ga0373955_0099589 | 3300035172 | Bacteria | 1666 |
| 777 | Ga0373955_0170572 | 3300035172 | Bacteria | 1287 |
| 778 | Ga0373955_0343054 | 3300035172 | Bacteria | 904 |
| 779 | Ga0373961_0000474 | 3300035241 | Bacteria | 15794 |
| 780 | Ga0373961_0003232 | 3300035241 | Bacteria | 4067 |
| 781 | Ga0373962_0000225 | 3300035242 | Bacteria | 11882 |
| 782 | Ga0373962_0001550 | 3300035242 | Bacteria | 5443 |
| 783 | Ga0373962_0011626 | 3300035242 | Bacteria | 2209 |
| 784 | Ga0373924_0039474 | 3300035410 | Bacteria | 1929 |
| 785 | Ga0373924_0050401 | 3300035410 | Bacteria | 1724 |
| 786 | Ga0373931_0000204 | 3300035691 | Bacteria | 25161 |
| 787 | Ga0373931_0001800 | 3300035691 | Bacteria | 9318 |
| 788 | Ga0373931_0007564 | 3300035691 | Bacteria | 5115 |
| 789 | Ga0373931_0368068 | 3300035691 | Bacteria | 903 |
| 790 | Ga0373931_0476868 | 3300035691 | Bacteria | 801 |
| 791 | Ga0373935_0019987 | 3300035692 | Bacteria | 4087 |
| 792 | Ga0373935_0067496 | 3300035692 | Bacteria | 2299 |
| 793 | Ga0373935_0165611 | 3300035692 | Bacteria | 1509 |
| 794 | Ga0373935_0476239 | 3300035692 | Bacteria | 904 |
| 795 | Ga0373927_0391626 | 3300035695 | Bacteria | 916 |
| 796 | Ga0373933_0002804 | 3300035724 | Bacteria | 9737 |
| 797 | Ga0373933_0004059 | 3300035724 | Bacteria | 8069 |
| 798 | Ga0373933_0008656 | 3300035724 | Bacteria | 5548 |
| 799 | Ga0373933_0009970 | 3300035724 | Bacteria | 5201 |
| 800 | Ga0373933_0181557 | 3300035724 | Bacteria | 1342 |
| 801 | Ga0373937_0013055 | 3300036401 | Bacteria | 7316 |
| 802 | Ga0373937_0029608 | 3300036401 | Bacteria | 4959 |
| 803 | Ga0373937_0045711 | 3300036401 | Bacteria | 4001 |
| 804 | Ga0373937_0089164 | 3300036401 | Bacteria | 2855 |
| 805 | Ga0373937_0091412 | 3300036401 | Bacteria | 2820 |
| 806 | Ga0373937_0285934 | 3300036401 | Bacteria | 1558 |
| 807 | Ga0373925_0012284 | 3300037068 | Bacteria | 6197 |
| 808 | Ga0373925_0027312 | 3300037068 | Bacteria | 4179 |
| 809 | Ga0373925_0028900 | 3300037068 | Bacteria | 4064 |
| 810 | Ga0373925_0345948 | 3300037068 | Bacteria | 1206 |
| 811 | Ga0436365_0784090 | 3300039437 | Bacteria | 26500 |
| 812 | Ga0436365_1113291 | 3300039437 | Bacteria | 1863 |
| 813 | Ga0451839_0363298 | 3300041496 | Bacteria | 728 |
| 814 | Ga0439441_000656 | 3300042001 | Bacteria | 3952 |
| 815 | Ga0439448_0197091 | 3300042005 | Bacteria | 705 |
| 816 | Ga0439455_0020196 | 3300042012 | Bacteria | 1577 |
| 817 | Ga0439456_054694 | 3300042013 | Bacteria | 874 |
| 818 | Ga0439446_0062200 | 3300042156 | Bacteria | 1130 |
| 819 | Ga0439435_0000291 | 3300042436 | Bacteria | 7445 |
| 820 | Ga0439464_0042680 | 3300042439 | Bacteria | 1295 |
| 821 | Ga0439460_0033457 | 3300042461 | Bacteria | 1476 |
| 822 | Ga0439440_0023919 | 3300042993 | Bacteria | 1397 |
| 823 | Ga0466963_0091724 | 3300044694 | Bacteria | 2070 |
| 824 | Ga0451576_0020613 | 3300045051 | Bacteria | 7175 |
| 825 | Ga0466967_0263209 | 3300045976 | Bacteria | 1650 |
| 826 | Ga0495592_0006121 | 3300046454 | Bacteria | 8946 |
| 827 | Ga0495592_0014824 | 3300046454 | Bacteria | 5918 |
| 828 | Ga0495603_0017070 | 3300046455 | Bacteria | 4394 |
| 829 | Ga0495603_0032483 | 3300046455 | Bacteria | 3140 |
| 830 | Ga0495603_0061336 | 3300046455 | Bacteria | 2220 |
| 831 | Ga0495629_0000485 | 3300046459 | Bacteria | 33241 |
| 832 | Ga0495629_0064402 | 3300046459 | Bacteria | 2559 |
| 833 | Ga0495641_0076207 | 3300046461 | Bacteria | 1503 |
| 834 | Ga0495651_0070438 | 3300046462 | Bacteria | 2661 |
| 835 | Ga0495651_0084304 | 3300046462 | Bacteria | 2394 |
| 836 | Ga0495651_0102731 | 3300046462 | Bacteria | 2125 |
| 837 | Ga0495651_0131734 | 3300046462 | Bacteria | 1824 |
| 838 | Ga0495653_0012478 | 3300046463 | Bacteria | 6937 |
| 839 | Ga0495580_0043224 | 3300046472 | Bacteria | 3207 |
| 840 | Ga0495580_0067968 | 3300046472 | Bacteria | 2492 |
| 841 | Ga0495582_0010176 | 3300046473 | Bacteria | 5179 |
| 842 | Ga0495582_0025877 | 3300046473 | Bacteria | 3215 |
| 843 | Ga0495605_0025657 | 3300046474 | Bacteria | 3070 |
| 844 | Ga0495639_0229392 | 3300046475 | Bacteria | 914 |
| 845 | Ga0495662_0004378 | 3300046476 | Bacteria | 7091 |
| 846 | Ga0495662_0061907 | 3300046476 | Bacteria | 1808 |
| 847 | Ga0495662_0260393 | 3300046476 | Bacteria | 854 |
| 848 | Ga0495664_0004210 | 3300046477 | Bacteria | 7855 |
| 849 | Ga0495664_0012302 | 3300046477 | Bacteria | 4845 |
| 850 | Ga0495664_0029424 | 3300046477 | Bacteria | 3212 |
| 851 | Ga0495664_0071505 | 3300046477 | Bacteria | 2072 |
| 852 | Ga0495584_0007346 | 3300046491 | Bacteria | 5745 |
| 853 | Ga0495584_0042546 | 3300046491 | Bacteria | 2293 |
| 854 | Ga0495585_0000734 | 3300046492 | Bacteria | 29222 |
| 855 | Ga0495594_0006008 | 3300046499 | Bacteria | 6231 |
| 856 | Ga0495594_0029074 | 3300046499 | Bacteria | 2985 |
| 857 | Ga0495594_0086067 | 3300046499 | Bacteria | 1758 |
| 858 | Ga0495596_0165411 | 3300046500 | Bacteria | 860 |
| 859 | Ga0495607_0005042 | 3300046501 | Bacteria | 9580 |
| 860 | Ga0495608_0001184 | 3300046511 | Bacteria | 18506 |
| 861 | Ga0495608_0015967 | 3300046511 | Bacteria | 5199 |
| 862 | Ga0495618_0015523 | 3300046514 | Bacteria | 4648 |
| 863 | Ga0495618_0049089 | 3300046514 | Bacteria | 2665 |
| 864 | Ga0495628_0004412 | 3300046516 | Bacteria | 12482 |
| 865 | Ga0495628_0025451 | 3300046516 | Bacteria | 4834 |
| 866 | Ga0495628_0025562 | 3300046516 | Bacteria | 4823 |
| 867 | Ga0495630_0032755 | 3300046517 | Bacteria | 3874 |
| 868 | Ga0495630_0040411 | 3300046517 | Bacteria | 3485 |
| 869 | Ga0495630_0251395 | 3300046517 | Bacteria | 1350 |
| 870 | Ga0495630_0959304 | 3300046517 | Bacteria | 650 |
| 871 | Ga0495643_0206727 | 3300046522 | Bacteria | 939 |
| 872 | Ga0495644_0000828 | 3300046523 | Bacteria | 12770 |
| 873 | Ga0495663_0005863 | 3300046525 | Bacteria | 3402 |
| 874 | Ga0495666_0014716 | 3300046526 | Bacteria | 3893 |
| 875 | Ga0495666_0027794 | 3300046526 | Bacteria | 2784 |
| 876 | Ga0495652_0004969 | 3300046529 | Bacteria | 12597 |
| 877 | Ga0495652_0010574 | 3300046529 | Bacteria | 8363 |
| 878 | Ga0495652_0051717 | 3300046529 | Bacteria | 3506 |
| 879 | Ga0495652_0115826 | 3300046529 | Unclassified | 2147 |
| 880 | Ga0495665_0002225 | 3300046531 | Bacteria | 10511 |
| 881 | Ga0495665_0200322 | 3300046531 | Bacteria | 1035 |
| 882 | Ga0495640_0018787 | 3300046533 | Bacteria | 5115 |
| 883 | Ga0495640_0033111 | 3300046533 | Bacteria | 3674 |
| 884 | Ga0495640_0036221 | 3300046533 | Bacteria | 3486 |
| 885 | Ga0495586_0026174 | 3300046535 | Bacteria | 3121 |
| 886 | Ga0495586_0032495 | 3300046535 | Bacteria | 2797 |
| 887 | Ga0495587_0017832 | 3300046536 | Bacteria | 4404 |
| 888 | Ga0495587_0055108 | 3300046536 | Bacteria | 2342 |
| 889 | Ga0495598_0063893 | 3300046537 | Bacteria | 1142 |
| 890 | Ga0495609_0017622 | 3300046538 | Bacteria | 3316 |
| 891 | Ga0495645_0008947 | 3300046543 | Bacteria | 6995 |
| 892 | Ga0495645_0017944 | 3300046543 | Bacteria | 5077 |
| 893 | Ga0495645_0154406 | 3300046543 | Bacteria | 1592 |
| 894 | Ga0495622_0017962 | 3300046557 | Bacteria | 3294 |
| 895 | Ga0495633_0002950 | 3300046558 | Bacteria | 11631 |
| 896 | Ga0495667_0003221 | 3300046559 | Bacteria | 10945 |
| 897 | Ga0495667_0015894 | 3300046559 | Bacteria | 5088 |
| 898 | Ga0495667_0021566 | 3300046559 | Bacteria | 4347 |
| 899 | Ga0495667_0076919 | 3300046559 | Bacteria | 2171 |
| 900 | Ga0495656_0088924 | 3300046615 | Bacteria | 1409 |
| 901 | Ga0495611_0004234 | 3300046648 | Bacteria | 6246 |
| 902 | Ga0495635_0009913 | 3300046663 | Bacteria | 6659 |
| 903 | Ga0495635_0021211 | 3300046663 | Bacteria | 4528 |
| 904 | Ga0495635_0080227 | 3300046663 | Bacteria | 2233 |
| 905 | Ga0495635_0364505 | 3300046663 | Bacteria | 963 |
| 906 | Ga0495661_0077965 | 3300046665 | Bacteria | 1918 |
| 907 | Ga0495657_0013292 | 3300046675 | Bacteria | 6078 |
| 908 | Ga0495657_0026726 | 3300046675 | Bacteria | 4084 |
| 909 | Ga0495657_0036583 | 3300046675 | Bacteria | 3392 |
| 910 | Ga0495657_0107258 | 3300046675 | Bacteria | 1773 |
| 911 | Ga0495599_0004093 | 3300046678 | Bacteria | 8597 |
| 912 | Ga0495599_0015147 | 3300046678 | Bacteria | 4781 |
| 913 | Ga0495599_0029880 | 3300046678 | Bacteria | 3418 |
| 914 | Ga0495623_0002124 | 3300046679 | Bacteria | 13244 |
| 915 | Ga0495623_0013014 | 3300046679 | Bacteria | 5388 |
| 916 | Ga0495646_0016363 | 3300046680 | Bacteria | 4706 |
| 917 | Ga0495646_0044110 | 3300046680 | Bacteria | 2727 |
| 918 | Ga0495647_0018720 | 3300046681 | Bacteria | 2469 |
| 919 | Ga0495647_0098961 | 3300046681 | Bacteria | 1205 |
| 920 | Ga0495658_0007123 | 3300046683 | Bacteria | 5525 |
| 921 | Ga0495658_0009853 | 3300046683 | Bacteria | 4766 |
| 922 | Ga0495658_0026369 | 3300046683 | Bacteria | 3114 |
| 923 | Ga0495613_0169792 | 3300046689 | Bacteria | 1548 |
| 924 | Ga0495613_0317934 | 3300046689 | Bacteria | 1075 |
| 925 | Ga0495624_0005521 | 3300046690 | Bacteria | 9102 |
| 926 | Ga0495624_0069844 | 3300046690 | Bacteria | 2187 |
| 927 | Ga0495624_0284805 | 3300046690 | Bacteria | 997 |
| 928 | Ga0495670_0001621 | 3300046691 | Bacteria | 11023 |
| 929 | Ga0495671_0220583 | 3300046692 | Bacteria | 918 |
| 930 | Ga0495600_0016706 | 3300046809 | Bacteria | 4663 |
| 931 | Ga0495600_0075579 | 3300046809 | Bacteria | 2200 |
| 932 | Ga0495600_0094497 | 3300046809 | Bacteria | 1949 |
| 933 | Ga0495581_0002320 | 3300047315 | Bacteria | 10722 |
| 934 | Ga0495581_0023391 | 3300047315 | Bacteria | 3580 |
| 935 | Ga0495604_0005566 | 3300047317 | Bacteria | 9985 |
| 936 | Ga0495604_0007478 | 3300047317 | Bacteria | 8649 |
| 937 | Ga0495604_0019133 | 3300047317 | Bacteria | 5483 |
| 938 | Ga0495604_0111998 | 3300047317 | Bacteria | 1989 |
| 939 | Ga0495636_0054585 | 3300047318 | Bacteria | 1679 |
| 940 | Ga0495674_0009473 | 3300047319 | Bacteria | 9251 |
| 941 | Ga0495674_0024592 | 3300047319 | Bacteria | 5531 |
| 942 | Ga0495674_0105765 | 3300047319 | Bacteria | 2390 |
| 943 | Ga0495676_0071208 | 3300047321 | Bacteria | 2673 |
| 944 | Ga0495680_0002398 | 3300047322 | Bacteria | 19232 |
| 945 | Ga0495680_0007387 | 3300047322 | Bacteria | 10080 |
| 946 | Ga0495680_0040982 | 3300047322 | Bacteria | 3684 |
| 947 | Ga0495680_0050177 | 3300047322 | Bacteria | 3264 |
| 948 | Ga0495675_0036217 | 3300047444 | Bacteria | 3147 |
| 949 | Ga0495675_0113642 | 3300047444 | Unclassified | 1689 |
| 950 | Ga0495675_0211153 | 3300047444 | Bacteria | 1178 |
| 951 | Ga0495679_069851 | 3300047446 | Bacteria | 1014 |
| 952 | Ga0495684_0004228 | 3300047471 | Bacteria | 11209 |
| 953 | Ga0495684_0193084 | 3300047471 | Bacteria | 1504 |
| 954 | Ga0495684_0381774 | 3300047471 | Bacteria | 993 |
| 955 | Ga0495593_0011971 | 3300047673 | Bacteria | 4973 |
| 956 | Ga0495593_0012764 | 3300047673 | Bacteria | 4797 |
| 957 | Ga0495593_0025938 | 3300047673 | Bacteria | 3242 |
| 958 | Ga0495602_0027747 | 3300048088 | Bacteria | 5435 |
| 959 | Ga0495602_0060542 | 3300048088 | Bacteria | 3298 |
| 960 | Ga0495602_0259762 | 3300048088 | Bacteria | 1289 |
| 961 | Ga0495614_0012071 | 3300048089 | Bacteria | 3794 |
| 962 | Ga0495615_0001620 | 3300048090 | Bacteria | 3391 |
| 963 | Ga0496100_0000177 | 3300048903 | Bacteria | 35417 |
| 964 | Ga0496100_0006867 | 3300048903 | Bacteria | 6234 |
| 965 | Ga0496100_0070940 | 3300048903 | Bacteria | 2324 |
| 966 | Ga0496100_0232352 | 3300048903 | Bacteria | 1357 |
| 967 | Ga0496101_0000180 | 3300048904 | Bacteria | 50929 |
| 968 | Ga0496101_0039291 | 3300048904 | Bacteria | 3364 |
| 969 | Ga0496101_0042835 | 3300048904 | Bacteria | 3232 |
| 970 | Ga0496101_0229502 | 3300048904 | Bacteria | 1442 |
| 971 | Ga0496102_0000607 | 3300048905 | Bacteria | 37245 |
| 972 | Ga0496102_0006549 | 3300048905 | Bacteria | 9944 |
| 973 | Ga0496102_0030810 | 3300048905 | Bacteria | 4803 |
| 974 | Ga0496102_0161797 | 3300048905 | Bacteria | 2105 |
| 975 | Ga0496103_0000130 | 3300048906 | Bacteria | 80826 |
| 976 | Ga0496103_0007817 | 3300048906 | Bacteria | 6354 |
| 977 | Ga0496103_0038232 | 3300048906 | Bacteria | 2943 |
| 978 | Ga0496104_0000289 | 3300048907 | Bacteria | 44331 |
| 979 | Ga0496104_0027792 | 3300048907 | Bacteria | 5236 |
| 980 | Ga0496104_0139519 | 3300048907 | Bacteria | 2329 |
| 981 | Ga0496104_0186264 | 3300048907 | Bacteria | 1986 |
| 982 | Ga0496104_0209397 | 3300048907 | Bacteria | 1861 |
| 983 | Ga0496104_0827632 | 3300048907 | Bacteria | 831 |
| 984 | Ga0496105_0000144 | 3300048908 | Bacteria | 46774 |
| 985 | Ga0496105_0025199 | 3300048908 | Bacteria | 4838 |
| 986 | Ga0496105_0049741 | 3300048908 | Bacteria | 3461 |
| 987 | Ga0496106_0000381 | 3300048909 | Bacteria | 31520 |
| 988 | Ga0496106_0007902 | 3300048909 | Bacteria | 7861 |
| 989 | Ga0496106_0027792 | 3300048909 | Bacteria | 4212 |
| 990 | Ga0496106_0086866 | 3300048909 | Bacteria | 2409 |
| 991 | Ga0496106_0446136 | 3300048909 | Bacteria | 1039 |
| 992 | Ga0496107_0001002 | 3300048910 | Bacteria | 16859 |
| 993 | Ga0496107_0005222 | 3300048910 | Bacteria | 8866 |
| 994 | Ga0496107_0015427 | 3300048910 | Bacteria | 5355 |
| 995 | Ga0496107_0161729 | 3300048910 | Bacteria | 1659 |
| 996 | Ga0496108_0001153 | 3300048911 | Bacteria | 20645 |
| 997 | Ga0496108_0003419 | 3300048911 | Bacteria | 12742 |
| 998 | Ga0496108_0013287 | 3300048911 | Bacteria | 6712 |
| 999 | Ga0496108_0019246 | 3300048911 | Bacteria | 5604 |
| 1000 | Ga0496108_0025933 | 3300048911 | Bacteria | 4834 |
| 1001 | Ga0496108_0201008 | 3300048911 | Bacteria | 1729 |
| 1002 | Ga0496109_0000490 | 3300048912 | Bacteria | 33902 |
| 1003 | Ga0496109_0001283 | 3300048912 | Bacteria | 20857 |
| 1004 | Ga0496109_0015162 | 3300048912 | Bacteria | 6709 |
| 1005 | Ga0496109_0054678 | 3300048912 | Bacteria | 3641 |
| 1006 | Ga0496109_0188697 | 3300048912 | Bacteria | 1936 |
| 1007 | Ga0496110_0006458 | 3300048913 | Bacteria | 9291 |
| 1008 | Ga0496110_0089756 | 3300048913 | Bacteria | 2747 |
| 1009 | Ga0496110_0099991 | 3300048913 | Bacteria | 2599 |
| 1010 | Ga0496110_0102603 | 3300048913 | Bacteria | 2565 |
| 1011 | Ga0496111_0017198 | 3300048914 | Bacteria | 4996 |
| 1012 | Ga0496111_0024875 | 3300048914 | Bacteria | 4223 |
| 1013 | Ga0496111_0101084 | 3300048914 | Bacteria | 2118 |
| 1014 | Ga0496111_0533303 | 3300048914 | Bacteria | 862 |
| 1015 | Ga0496112_0015716 | 3300048915 | Bacteria | 7069 |
| 1016 | Ga0496112_0024562 | 3300048915 | Bacteria | 5773 |
| 1017 | Ga0496112_0243128 | 3300048915 | Bacteria | 1752 |
| 1018 | Ga0496112_0674750 | 3300048915 | Bacteria | 962 |
| 1019 | Ga0496113_0003541 | 3300048916 | Bacteria | 9363 |
| 1020 | Ga0496113_0109941 | 3300048916 | Bacteria | 2144 |
| 1021 | Ga0496113_0269158 | 3300048916 | Bacteria | 1361 |
| 1022 | Ga0496113_0443815 | 3300048916 | Bacteria | 1042 |
| 1023 | Ga0496114_0000973 | 3300048917 | Bacteria | 21454 |
| 1024 | Ga0496114_0008867 | 3300048917 | Bacteria | 7972 |
| 1025 | Ga0496114_0093052 | 3300048917 | Bacteria | 2562 |
| 1026 | Ga0496115_0000939 | 3300048918 | Bacteria | 21150 |
| 1027 | Ga0496115_0052739 | 3300048918 | Bacteria | 3263 |
| 1028 | Ga0496115_0082814 | 3300048918 | Bacteria | 2614 |
| 1029 | Ga0496115_0083703 | 3300048918 | Bacteria | 2600 |
| 1030 | Ga0496115_0175217 | 3300048918 | Bacteria | 1773 |
| 1031 | Ga0496119_0372319 | 3300048922 | Bacteria | 687 |
| 1032 | Ga0496125_0155976 | 3300048928 | Bacteria | 1560 |
| 1033 | Ga0501031_0004683 | 3300049568 | Bacteria | 8875 |
| 1034 | Ga0501031_0175551 | 3300049568 | Bacteria | 1400 |
| 1035 | Ga0501032_0180192 | 3300049569 | Bacteria | 1383 |
| 1036 | Ga0501032_0252822 | 3300049569 | Bacteria | 1144 |
| 1037 | Ga0501032_0603138 | 3300049569 | Bacteria | 698 |
| 1038 | Ga0501033_0044841 | 3300049570 | Bacteria | 3291 |
| 1039 | Ga0501034_0174585 | 3300049571 | Bacteria | 2115 |
| 1040 | Ga0501034_0180077 | 3300049571 | Bacteria | 2078 |
| 1041 | Ga0501034_0205325 | 3300049571 | Bacteria | 1927 |
| 1042 | Ga0501034_0230349 | 3300049571 | Bacteria | 1802 |
| 1043 | Ga0501034_0383467 | 3300049571 | Bacteria | 1330 |
| 1044 | Ga0501034_0385524 | 3300049571 | Bacteria | 1326 |
| 1045 | Ga0501036_0152438 | 3300049572 | Bacteria | 1949 |
| 1046 | Ga0501037_0308461 | 3300049573 | Bacteria | 1097 |
| 1047 | Ga0501037_0374012 | 3300049573 | Bacteria | 980 |
| 1048 | Ga0501039_0070373 | 3300049575 | Bacteria | 2718 |
| 1049 | Ga0501043_0072619 | 3300049579 | Bacteria | 2703 |
| 1050 | Ga0501043_0378793 | 3300049579 | Bacteria | 1071 |
| 1051 | Ga0501047_0013763 | 3300049581 | Bacteria | 7682 |
| 1052 | Ga0501047_0082204 | 3300049581 | Bacteria | 3096 |
| 1053 | Ga0501047_0143184 | 3300049581 | Bacteria | 2268 |
| 1054 | Ga0501047_0217227 | 3300049581 | Bacteria | 1769 |
| 1055 | Ga0501047_0253955 | 3300049581 | Bacteria | 1606 |
| 1056 | Ga0501048_0306071 | 3300049582 | Bacteria | 1131 |
| 1057 | Ga0501067_0062076 | 3300049583 | Bacteria | 2069 |
| 1058 | Ga0501067_0247756 | 3300049583 | Bacteria | 992 |
| 1059 | Ga0501069_0010790 | 3300049585 | Bacteria | 4844 |
| 1060 | Ga0501070_0003223 | 3300049586 | Bacteria | 14190 |
| 1061 | Ga0501070_0049525 | 3300049586 | Bacteria | 3489 |
| 1062 | Ga0501070_0069981 | 3300049586 | Bacteria | 2905 |
| 1063 | Ga0501070_0126246 | 3300049586 | Bacteria | 2114 |
| 1064 | Ga0501070_0127313 | 3300049586 | Bacteria | 2104 |
| 1065 | Ga0501070_0142271 | 3300049586 | Bacteria | 1980 |
| 1066 | Ga0501070_0622226 | 3300049586 | Bacteria | 859 |
| 1067 | Ga0501071_0023980 | 3300049587 | Bacteria | 4265 |
| 1068 | Ga0501071_0205289 | 3300049587 | Bacteria | 1481 |
| 1069 | Ga0501073_0035920 | 3300049589 | Bacteria | 3521 |
| 1070 | Ga0501073_0242232 | 3300049589 | Bacteria | 1245 |
| 1071 | Ga0501073_0624266 | 3300049589 | Bacteria | 744 |
| 1072 | Ga0501074_0076829 | 3300049590 | Bacteria | 2396 |
| 1073 | Ga0501074_0126660 | 3300049590 | Bacteria | 1827 |
| 1074 | Ga0501076_0013068 | 3300049592 | Bacteria | 6216 |
| 1075 | Ga0501079_0048358 | 3300049741 | Bacteria | 3282 |
| 1076 | Ga0501079_0355967 | 3300049741 | Bacteria | 1147 |
| 1077 | Ga0501080_0024694 | 3300049742 | Bacteria | 5574 |
| 1078 | Ga0501080_0104149 | 3300049742 | Bacteria | 2631 |
| 1079 | Ga0501080_0118735 | 3300049742 | Bacteria | 2452 |
| 1080 | Ga0501080_0257833 | 3300049742 | Bacteria | 1589 |
| 1081 | Ga0501080_0308707 | 3300049742 | Bacteria | 1434 |
| 1082 | Ga0501080_0363385 | 3300049742 | Bacteria | 1306 |
| 1083 | Ga0501080_0401714 | 3300049742 | Bacteria | 1233 |
| 1084 | Ga0501080_0455271 | 3300049742 | Bacteria | 1147 |
| 1085 | Ga0501083_0005209 | 3300049744 | Bacteria | 9202 |
| 1086 | Ga0501083_0033190 | 3300049744 | Bacteria | 3535 |
| 1087 | Ga0501083_0038727 | 3300049744 | Bacteria | 3240 |
| 1088 | Ga0501035_0000371 | 3300049822 | Bacteria | 51668 |
| 1089 | Ga0501035_0047743 | 3300049822 | Bacteria | 3842 |
| 1090 | Ga0501035_0159651 | 3300049822 | Bacteria | 1952 |
| 1091 | Ga0501035_0889255 | 3300049822 | Bacteria | 706 |
| 1092 | Ga0501044_0022389 | 3300049823 | Bacteria | 6735 |
| 1093 | Ga0501044_0092944 | 3300049823 | Bacteria | 3042 |
| 1094 | Ga0501044_0108177 | 3300049823 | Bacteria | 2791 |
| 1095 | Ga0501044_0402588 | 3300049823 | Bacteria | 1281 |
| 1096 | Ga0501044_0565159 | 3300049823 | Bacteria | 1033 |
| 1097 | Ga0501044_1025764 | 3300049823 | Bacteria | 696 |
| 1098 | nmdc:mga00v17_366232_c1 | 3300050491 | Bacteria | 937 |
| 1099 | nmdc:mga0yw44_228834_c1 | 3300050492 | Bacteria | 1234 |
| 1100 | nmdc:mga0yw44_448866_c1 | 3300050492 | Bacteria | 874 |
| 1101 | nmdc:mga0k408_147555_c1 | 3300050493 | Bacteria | 1400 |
| 1102 | nmdc:mga06z11_373772_c1 | 3300050494 | Bacteria | 856 |
| 1103 | nmdc:mga06z11_7327_c1 | 3300050494 | Bacteria | 4533 |
| 1104 | nmdc:mga04h51_92901_c1 | 3300050495 | Bacteria | 1088 |
| 1105 | nmdc:mga07m45_168571_c1 | 3300050496 | Bacteria | 1272 |
| 1106 | nmdc:mga07m45_97397_c1 | 3300050496 | Bacteria | 1688 |
| 1107 | nmdc:mga05p37_222_c1 | 3300050507 | Bacteria | 57449 |
| 1108 | nmdc:mga05p37_5864_c1 | 3300050507 | Bacteria | 14447 |
| 1109 | nmdc:mga09592_2841_c1 | 3300050508 | Bacteria | 14047 |
| 1110 | nmdc:mga0qj67_418_c1 | 3300050509 | Bacteria | 29088 |
| 1111 | nmdc:mga06r32_1436_c1 | 3300050510 | Bacteria | 21509 |
| 1112 | nmdc:mga08y16_1566_c1 | 3300050511 | Bacteria | 23071 |
| 1113 | nmdc:mga08y16_41995_c1 | 3300050511 | Bacteria | 4789 |
| 1114 | nmdc:mga08y16_4988_c1 | 3300050511 | Bacteria | 13877 |
| 1115 | nmdc:mga08y16_587_c1 | 3300050511 | Bacteria | 33873 |
| 1116 | nmdc:mga08y16_799686_c1 | 3300050511 | Bacteria | 936 |
| 1117 | nmdc:mga0n895_14048_c1 | 3300050512 | Bacteria | 7257 |
| 1118 | nmdc:mga0n895_1683_c1 | 3300050512 | Bacteria | 16689 |
| 1119 | nmdc:mga0n895_34469_c1 | 3300050512 | Bacteria | 4873 |
| 1120 | nmdc:mga0n895_437_c1 | 3300050512 | Bacteria | 28072 |
| 1121 | nmdc:mga0n895_471926_c1 | 3300050512 | Bacteria | 1266 |
| 1122 | nmdc:mga0rr50_93865_c1 | 3300050513 | Bacteria | 2342 |
| 1123 | nmdc:mga08x19_218446_c1 | 3300050514 | Bacteria | 1309 |
| 1124 | nmdc:mga0a205_3971_c1 | 3300050515 | Bacteria | 13224 |
| 1125 | nmdc:mga0a205_440909_c1 | 3300050515 | Bacteria | 1163 |
| 1126 | nmdc:mga0a205_4474_c1 | 3300050515 | Bacteria | 12544 |
| 1127 | nmdc:mga0a205_721199_c1 | 3300050515 | Bacteria | 846 |
| 1128 | nmdc:mga0sz30_184845_c1 | 3300050516 | Bacteria | 925 |
| 1129 | Ga0495601_0000279 | 3300053077 | Bacteria | 27517 |
| 1130 | Ga0495601_0000558 | 3300053077 | Bacteria | 19769 |
| 1131 | Ga0495601_0002117 | 3300053077 | Bacteria | 11172 |
| 1132 | Ga0495601_0002312 | 3300053077 | Bacteria | 10768 |
| 1133 | Ga0495601_0033559 | 3300053077 | Bacteria | 3198 |
| 1134 | Ga0495601_0207955 | 3300053077 | Bacteria | 1278 |
| 1135 | Ga0495612_0001484 | 3300053078 | Bacteria | 9659 |
| 1136 | Ga0495612_0003350 | 3300053078 | Bacteria | 6640 |
| 1137 | Ga0495612_0012895 | 3300053078 | Bacteria | 3367 |
| 1138 | Ga0495612_0017559 | 3300053078 | Bacteria | 2864 |
| 1139 | Ga0495612_0058377 | 3300053078 | Bacteria | 1594 |
| 1140 | Ga0495595_0002455 | 3300053084 | Bacteria | 7248 |
| 1141 | Ga0495595_0003977 | 3300053084 | Bacteria | 5908 |
| 1142 | Ga0495595_0005137 | 3300053084 | Bacteria | 5293 |
| 1143 | Ga0495595_0031107 | 3300053084 | Bacteria | 2397 |
| 1144 | Ga0495619_0000170 | 3300053085 | Bacteria | 47706 |
| 1145 | Ga0495619_0000175 | 3300053085 | Bacteria | 47129 |
| 1146 | Ga0495619_0003531 | 3300053085 | Bacteria | 10085 |
| 1147 | Ga0495619_0013000 | 3300053085 | Bacteria | 5244 |
| 1148 | Ga0495619_0019630 | 3300053085 | Bacteria | 4298 |
| 1149 | Ga0495619_0023515 | 3300053085 | Bacteria | 3951 |
| 1150 | Ga0495619_0042668 | 3300053085 | Bacteria | 2971 |
| 1151 | Ga0495619_0203927 | 3300053085 | Bacteria | 1369 |
| 1152 | Ga0500643_004624 | 3300053087 | Bacteria | 6150 |
| 1153 | Ga0500644_0001616 | 3300053088 | Bacteria | 5881 |
| 1154 | Ga0500651_0010263 | 3300053093 | Bacteria | 5608 |
| 1155 | Ga0500566_0110663 | 3300053094 | Bacteria | 1493 |
| 1156 | Ga0500566_0137171 | 3300053094 | Bacteria | 1302 |
| 1157 | Ga0500650_0020033 | 3300053098 | Bacteria | 2929 |
| 1158 | Ga0500595_000085 | 3300053119 | Bacteria | 65800 |
| 1159 | Ga0500618_017763 | 3300053125 | Bacteria | 1767 |
| 1160 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1161 | Ga0500616_0174395 | 3300053153 | Bacteria | 973 |
| 1162 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 1163 | Ga0501084_0077816 | 3300054114 | Bacteria | 2780 |
| 1164 | Ga0501084_0291964 | 3300054114 | Bacteria | 1377 |
| 1165 | Ga0501082_0000010 | 3300060353 | Bacteria | 122899 |
| 1166 | Ga0501082_0018641 | 3300060353 | Bacteria | 5981 |
| 1167 | Ga0501082_0702057 | 3300060353 | Bacteria | 885 |
| 1168 | Ga0530510_0452400 | 3300061734 | Bacteria | 971 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_0363298 | Ga0451839_0363298_36_560 | 172 |
| 2 | 3300060353 | Ga0501082_0000010 | Ga0501082_0000010_112587_113186 | 174 |
| 3 | 3300049582 | Ga0501048_0306071 | Ga0501048_0306071_449_1063 | 178 |
| 4 | 3300049583 | Ga0501067_0247756 | Ga0501067_0247756_361_966 | 183 |
| 5 | 3300039437 | Ga0436365_1113291 | Ga0436365_1113291_1145_1765 | 184 |
| 6 | 3300046663 | Ga0495635_0080227 | Ga0495635_0080227_736_1308 | 190 |
| 7 | 3300005937 | Ga0081455_10406209 | Ga0081455_104062091 | 192 |
| 8 | 3300006048 | Ga0075363_100483214 | Ga0075363_1004832141 | 192 |
| 9 | 3300013297 | Ga0157378_10076403 | Ga0157378_100764034 | 192 |
| 10 | 3300049744 | Ga0501083_0033190 | Ga0501083_0033190_1477_2076 | 192 |
| 11 | 3300054114 | Ga0501084_0077816 | Ga0501084_0077816_967_1566 | 192 |
| 12 | 3300060353 | Ga0501082_0018641 | Ga0501082_0018641_2648_3247 | 192 |
| 13 | 3300005331 | Ga0070670_100369895 | Ga0070670_1003698952 | 193 |
| 14 | 3300005338 | Ga0068868_100631904 | Ga0068868_1006319042 | 193 |
| 15 | 3300005343 | Ga0070687_100061266 | Ga0070687_1000612663 | 193 |
| 16 | 3300005577 | Ga0068857_100409686 | Ga0068857_1004096862 | 193 |
| 17 | 3300005617 | Ga0068859_100041077 | Ga0068859_1000410774 | 193 |
| 18 | 3300005618 | Ga0068864_100819726 | Ga0068864_1008197261 | 193 |
| 19 | 3300005618 | Ga0068864_101604943 | Ga0068864_1016049431 | 193 |
| 20 | 3300005719 | Ga0068861_100286527 | Ga0068861_1002865272 | 193 |
| 21 | 3300006931 | Ga0097620_100041079 | Ga0097620_1000410793 | 193 |
| 22 | 3300009101 | Ga0105247_10078581 | Ga0105247_100785813 | 193 |
| 23 | 3300009148 | Ga0105243_10387998 | Ga0105243_103879982 | 193 |
| 24 | 3300009174 | Ga0105241_10103578 | Ga0105241_101035782 | 193 |
| 25 | 3300009177 | Ga0105248_10233587 | Ga0105248_102335873 | 193 |
| 26 | 3300009551 | Ga0105238_10386325 | Ga0105238_103863251 | 193 |
| 27 | 3300025900 | Ga0207710_10017400 | Ga0207710_100174004 | 193 |
| 28 | 3300025901 | Ga0207688_10236699 | Ga0207688_102366992 | 193 |
| 29 | 3300025911 | Ga0207654_10103935 | Ga0207654_101039353 | 193 |
| 30 | 3300025918 | Ga0207662_10107951 | Ga0207662_101079512 | 193 |
| 31 | 3300025926 | Ga0207659_10335578 | Ga0207659_103355781 | 193 |
| 32 | 3300025941 | Ga0207711_10054949 | Ga0207711_100549494 | 193 |
| 33 | 3300026035 | Ga0207703_10488795 | Ga0207703_104887951 | 193 |
| 34 | 3300026041 | Ga0207639_10090851 | Ga0207639_100908512 | 193 |
| 35 | 3300026088 | Ga0207641_10035734 | Ga0207641_100357343 | 193 |
| 36 | 3300026116 | Ga0207674_10037269 | Ga0207674_100372696 | 193 |
| 37 | 3300026118 | Ga0207675_100212039 | Ga0207675_1002120393 | 193 |
| 38 | 3300042156 | Ga0439446_0062200 | Ga0439446_0062200_12_611 | 193 |
| 39 | 3300046474 | Ga0495605_0025657 | Ga0495605_0025657_2026_2625 | 193 |
| 40 | 3300048915 | Ga0496112_0674750 | Ga0496112_0674750_107_706 | 193 |
| 41 | iso_pu_bacteria | 2513237095 | 2513653036 | 193 |
| 42 | iso_pu_bacteria | 2513237102 | 2513706718 | 193 |
| 43 | iso_pu_bacteria | 2513237139 | 2513879620 | 193 |
| 44 | iso_pu_bacteria | 2517093001 | 2517107362 | 193 |
| 45 | iso_pu_bacteria | 2528768022 | 2528857749 | 193 |
| 46 | iso_pu_bacteria | 2816332527 | 2818244043 | 193 |
| 47 | iso_pu_bacteria | 2847939898 | 2847940745 | 193 |
| 48 | iso_pu_bacteria | 2929615660 | 2929623990 | 193 |
| 49 | iso_pu_bacteria | 2929624759 | 2929633376 | 193 |
| 50 | iso_pu_bacteria | 2933577622 | 2933585892 | 193 |
| 51 | iso_pu_bacteria | 8055742211 | 8055743969 | 193 |
| 52 | 3300021384 | Ga0213876_10017621 | Ga0213876_100176214 | 194 |
| 53 | 3300031250 | Ga0265331_10070035 | Ga0265331_100700353 | 194 |
| 54 | 3300031548 | Ga0307408_100582029 | Ga0307408_1005820291 | 194 |
| 55 | 3300039437 | Ga0436365_0784090 | Ga0436365_0784090_11412_12014 | 194 |
| 56 | 3300049571 | Ga0501034_0385524 | Ga0501034_0385524_23_625 | 194 |
| 57 | 3300049589 | Ga0501073_0035920 | Ga0501073_0035920_1790_2392 | 194 |
| 58 | 3300049741 | Ga0501079_0048358 | Ga0501079_0048358_325_927 | 194 |
| 59 | 3300049742 | Ga0501080_0024694 | Ga0501080_0024694_2605_3207 | 194 |
| 60 | 3300050492 | nmdc:mga0yw44_448866_c1 | nmdc:mga0yw44_448866_c1_15_617 | 194 |
| 61 | 3300005293 | Ga0065715_10351250 | Ga0065715_103512502 | 195 |
| 62 | 3300005295 | Ga0065707_10284269 | Ga0065707_102842691 | 195 |
| 63 | 3300005328 | Ga0070676_10136143 | Ga0070676_101361432 | 195 |
| 64 | 3300005331 | Ga0070670_100072694 | Ga0070670_1000726943 | 195 |
| 65 | 3300005331 | Ga0070670_100499014 | Ga0070670_1004990142 | 195 |
| 66 | 3300005334 | Ga0068869_101076306 | Ga0068869_1010763061 | 195 |
| 67 | 3300005335 | Ga0070666_10341171 | Ga0070666_103411711 | 195 |
| 68 | 3300005339 | Ga0070660_100416381 | Ga0070660_1004163811 | 195 |
| 69 | 3300005340 | Ga0070689_100024145 | Ga0070689_1000241453 | 195 |
| 70 | 3300005343 | Ga0070687_100497940 | Ga0070687_1004979401 | 195 |
| 71 | 3300005353 | Ga0070669_100120166 | Ga0070669_1001201662 | 195 |
| 72 | 3300005355 | Ga0070671_100102043 | Ga0070671_1001020431 | 195 |
| 73 | 3300005356 | Ga0070674_100103524 | Ga0070674_1001035242 | 195 |
| 74 | 3300005364 | Ga0070673_100077554 | Ga0070673_1000775542 | 195 |
| 75 | 3300005365 | Ga0070688_100244366 | Ga0070688_1002443662 | 195 |
| 76 | 3300005438 | Ga0070701_10073231 | Ga0070701_100732312 | 195 |
| 77 | 3300005456 | Ga0070678_100187110 | Ga0070678_1001871102 | 195 |
| 78 | 3300005459 | Ga0068867_100101463 | Ga0068867_1001014632 | 195 |
| 79 | 3300005466 | Ga0070685_10049048 | Ga0070685_100490484 | 195 |
| 80 | 3300005543 | Ga0070672_100022535 | Ga0070672_1000225355 | 195 |
| 81 | 3300005564 | Ga0070664_100712422 | Ga0070664_1007124221 | 195 |
| 82 | 3300005718 | Ga0068866_10101656 | Ga0068866_101016563 | 195 |
| 83 | 3300005840 | Ga0068870_10162270 | Ga0068870_101622702 | 195 |
| 84 | 3300006051 | Ga0075364_10400130 | Ga0075364_104001302 | 195 |
| 85 | 3300006353 | Ga0075370_10114307 | Ga0075370_101143072 | 195 |
| 86 | 3300006358 | Ga0068871_100402199 | Ga0068871_1004021991 | 195 |
| 87 | 3300006881 | Ga0068865_100471102 | Ga0068865_1004711021 | 195 |
| 88 | 3300009094 | Ga0111539_10371175 | Ga0111539_103711752 | 195 |
| 89 | 3300009098 | Ga0105245_10056482 | Ga0105245_100564821 | 195 |
| 90 | 3300009553 | Ga0105249_11246231 | Ga0105249_112462311 | 195 |
| 91 | 3300011119 | Ga0105246_10141254 | Ga0105246_101412542 | 195 |
| 92 | 3300013296 | Ga0157374_10284941 | Ga0157374_102849412 | 195 |
| 93 | 3300013297 | Ga0157378_10624355 | Ga0157378_106243552 | 195 |
| 94 | 3300013306 | Ga0163162_10653248 | Ga0163162_106532482 | 195 |
| 95 | 3300013308 | Ga0157375_10476507 | Ga0157375_104765072 | 195 |
| 96 | 3300014326 | Ga0157380_10140684 | Ga0157380_101406841 | 195 |
| 97 | 3300014745 | Ga0157377_10489399 | Ga0157377_104893992 | 195 |
| 98 | 3300014969 | Ga0157376_10237405 | Ga0157376_102374052 | 195 |
| 99 | 3300017792 | Ga0163161_10192788 | Ga0163161_101927882 | 195 |
| 100 | 3300025893 | Ga0207682_10002328 | Ga0207682_100023288 | 195 |
| 101 | 3300025901 | Ga0207688_10461644 | Ga0207688_104616441 | 195 |
| 102 | 3300025903 | Ga0207680_10083500 | Ga0207680_100835004 | 195 |
| 103 | 3300025907 | Ga0207645_10041411 | Ga0207645_100414111 | 195 |
| 104 | 3300025908 | Ga0207643_10084137 | Ga0207643_100841372 | 195 |
| 105 | 3300025919 | Ga0207657_10298785 | Ga0207657_102987852 | 195 |
| 106 | 3300025925 | Ga0207650_10430355 | Ga0207650_104303552 | 195 |
| 107 | 3300025926 | Ga0207659_10165515 | Ga0207659_101655152 | 195 |
| 108 | 3300025933 | Ga0207706_10123367 | Ga0207706_101233673 | 195 |
| 109 | 3300025935 | Ga0207709_10080964 | Ga0207709_100809643 | 195 |
| 110 | 3300025936 | Ga0207670_10361414 | Ga0207670_103614141 | 195 |
| 111 | 3300025937 | Ga0207669_10029133 | Ga0207669_100291332 | 195 |
| 112 | 3300025938 | Ga0207704_10367216 | Ga0207704_103672161 | 195 |
| 113 | 3300025940 | Ga0207691_10017131 | Ga0207691_100171316 | 195 |
| 114 | 3300025960 | Ga0207651_10480743 | Ga0207651_104807432 | 195 |
| 115 | 3300026023 | Ga0207677_10753259 | Ga0207677_107532592 | 195 |
| 116 | 3300026089 | Ga0207648_10203846 | Ga0207648_102038462 | 195 |
| 117 | 3300026116 | Ga0207674_10969539 | Ga0207674_109695392 | 195 |
| 118 | 3300026121 | Ga0207683_10003914 | Ga0207683_100039146 | 195 |
| 119 | 3300026142 | Ga0207698_10923965 | Ga0207698_109239652 | 195 |
| 120 | 3300046500 | Ga0495596_0165411 | Ga0495596_0165411_75_680 | 195 |
| 121 | 3300046537 | Ga0495598_0063893 | Ga0495598_0063893_156_761 | 195 |
| 122 | 3300046615 | Ga0495656_0088924 | Ga0495656_0088924_463_1068 | 195 |
| 123 | 3300047318 | Ga0495636_0054585 | Ga0495636_0054585_1030_1635 | 195 |
| 124 | 3300048090 | Ga0495615_0001620 | Ga0495615_0001620_2004_2609 | 195 |
| 125 | 3300049568 | Ga0501031_0004683 | Ga0501031_0004683_6087_6692 | 195 |
| 126 | 3300049569 | Ga0501032_0180192 | Ga0501032_0180192_193_798 | 195 |
| 127 | 3300049570 | Ga0501033_0044841 | Ga0501033_0044841_96_701 | 195 |
| 128 | 3300049571 | Ga0501034_0180077 | Ga0501034_0180077_711_1316 | 195 |
| 129 | 3300049573 | Ga0501037_0308461 | Ga0501037_0308461_433_1038 | 195 |
| 130 | 3300049575 | Ga0501039_0070373 | Ga0501039_0070373_1245_1850 | 195 |
| 131 | 3300049579 | Ga0501043_0378793 | Ga0501043_0378793_359_964 | 195 |
| 132 | 3300049581 | Ga0501047_0013763 | Ga0501047_0013763_6030_6635 | 195 |
| 133 | 3300049586 | Ga0501070_0069981 | Ga0501070_0069981_1075_1680 | 195 |
| 134 | 3300049822 | Ga0501035_0159651 | Ga0501035_0159651_440_1045 | 195 |
| 135 | 3300049823 | Ga0501044_0022389 | Ga0501044_0022389_5091_5696 | 195 |
| 136 | 3300050491 | nmdc:mga00v17_366232_c1 | nmdc:mga00v17_366232_c1_34_636 | 195 |
| 137 | 3300050496 | nmdc:mga07m45_97397_c1 | nmdc:mga07m45_97397_c1_807_1409 | 195 |
| 138 | 3300005329 | Ga0070683_100065841 | Ga0070683_1000658414 | 196 |
| 139 | 3300005337 | Ga0070682_100047563 | Ga0070682_1000475632 | 196 |
| 140 | 3300005434 | Ga0070709_10058454 | Ga0070709_100584543 | 196 |
| 141 | 3300005435 | Ga0070714_100222407 | Ga0070714_1002224071 | 196 |
| 142 | 3300005437 | Ga0070710_10224483 | Ga0070710_102244832 | 196 |
| 143 | 3300005439 | Ga0070711_100157975 | Ga0070711_1001579753 | 196 |
| 144 | 3300005458 | Ga0070681_10140401 | Ga0070681_101404012 | 196 |
| 145 | 3300005539 | Ga0068853_100630149 | Ga0068853_1006301491 | 196 |
| 146 | 3300005547 | Ga0070693_100138161 | Ga0070693_1001381612 | 196 |
| 147 | 3300005563 | Ga0068855_100393503 | Ga0068855_1003935032 | 196 |
| 148 | 3300006173 | Ga0070716_100093235 | Ga0070716_1000932353 | 196 |
| 149 | 3300006175 | Ga0070712_100123683 | Ga0070712_1001236833 | 196 |
| 150 | 3300009093 | Ga0105240_10561446 | Ga0105240_105614461 | 196 |
| 151 | 3300009174 | Ga0105241_10409578 | Ga0105241_104095782 | 196 |
| 152 | 3300009551 | Ga0105238_10161226 | Ga0105238_101612263 | 196 |
| 153 | 3300013100 | Ga0157373_10129589 | Ga0157373_101295893 | 196 |
| 154 | 3300013105 | Ga0157369_10135939 | Ga0157369_101359392 | 196 |
| 155 | 3300013307 | Ga0157372_10530411 | Ga0157372_105304113 | 196 |
| 156 | 3300021384 | Ga0213876_10082674 | Ga0213876_100826742 | 196 |
| 157 | 3300025898 | Ga0207692_10043533 | Ga0207692_100435332 | 196 |
| 158 | 3300025906 | Ga0207699_10053871 | Ga0207699_100538713 | 196 |
| 159 | 3300025915 | Ga0207693_10040557 | Ga0207693_100405574 | 196 |
| 160 | 3300025921 | Ga0207652_10026585 | Ga0207652_100265856 | 196 |
| 161 | 3300025929 | Ga0207664_10072138 | Ga0207664_100721382 | 196 |
| 162 | 3300025944 | Ga0207661_10233033 | Ga0207661_102330332 | 196 |
| 163 | 3300026116 | Ga0207674_10351076 | Ga0207674_103510763 | 196 |
| 164 | 3300031711 | Ga0265314_10154477 | Ga0265314_101544773 | 196 |
| 165 | 3300049569 | Ga0501032_0603138 | Ga0501032_0603138_48_656 | 196 |
| 166 | 3300049571 | Ga0501034_0205325 | Ga0501034_0205325_928_1536 | 196 |
| 167 | 3300049572 | Ga0501036_0152438 | Ga0501036_0152438_1203_1811 | 196 |
| 168 | 3300049579 | Ga0501043_0072619 | Ga0501043_0072619_999_1607 | 196 |
| 169 | 3300049581 | Ga0501047_0143184 | Ga0501047_0143184_863_1471 | 196 |
| 170 | 3300049583 | Ga0501067_0062076 | Ga0501067_0062076_194_802 | 196 |
| 171 | 3300049585 | Ga0501069_0010790 | Ga0501069_0010790_4155_4763 | 196 |
| 172 | 3300049586 | Ga0501070_0003223 | Ga0501070_0003223_13256_13864 | 196 |
| 173 | 3300049586 | Ga0501070_0126246 | Ga0501070_0126246_675_1283 | 196 |
| 174 | 3300049586 | Ga0501070_0127313 | Ga0501070_0127313_979_1587 | 196 |
| 175 | 3300049586 | Ga0501070_0142271 | Ga0501070_0142271_1299_1907 | 196 |
| 176 | 3300049586 | Ga0501070_0622226 | Ga0501070_0622226_11_619 | 196 |
| 177 | 3300049587 | Ga0501071_0023980 | Ga0501071_0023980_3532_4140 | 196 |
| 178 | 3300049590 | Ga0501074_0076829 | Ga0501074_0076829_1643_2251 | 196 |
| 179 | 3300049742 | Ga0501080_0104149 | Ga0501080_0104149_1078_1686 | 196 |
| 180 | 3300049742 | Ga0501080_0118735 | Ga0501080_0118735_498_1106 | 196 |
| 181 | 3300049742 | Ga0501080_0455271 | Ga0501080_0455271_230_838 | 196 |
| 182 | 3300049744 | Ga0501083_0005209 | Ga0501083_0005209_8168_8776 | 196 |
| 183 | 3300049822 | Ga0501035_0000371 | Ga0501035_0000371_50001_50609 | 196 |
| 184 | 3300049823 | Ga0501044_0565159 | Ga0501044_0565159_225_833 | 196 |
| 185 | 3300050514 | nmdc:mga08x19_218446_c1 | nmdc:mga08x19_218446_c1_27_617 | 196 |
| 186 | 3300006038 | Ga0075365_10037930 | Ga0075365_100379304 | 197 |
| 187 | 3300006042 | Ga0075368_10009624 | Ga0075368_100096242 | 197 |
| 188 | 3300006048 | Ga0075363_100021775 | Ga0075363_1000217755 | 197 |
| 189 | 3300006178 | Ga0075367_10051919 | Ga0075367_100519193 | 197 |
| 190 | 3300006195 | Ga0075366_10017677 | Ga0075366_100176774 | 197 |
| 191 | 3300006195 | Ga0075366_10092822 | Ga0075366_100928223 | 197 |
| 192 | 3300006353 | Ga0075370_10053913 | Ga0075370_100539132 | 197 |
| 193 | 3300014326 | Ga0157380_10490820 | Ga0157380_104908201 | 197 |
| 194 | 3300014497 | Ga0182008_10013043 | Ga0182008_100130433 | 197 |
| 195 | 3300015262 | Ga0182007_10044881 | Ga0182007_100448811 | 197 |
| 196 | 3300027866 | Ga0209813_10090092 | Ga0209813_100900921 | 197 |
| 197 | 3300035114 | Ga0373939_0013941 | Ga0373939_0013941_1426_2019 | 197 |
| 198 | 3300042005 | Ga0439448_0197091 | Ga0439448_0197091_69_683 | 197 |
| 199 | 3300042013 | Ga0439456_054694 | Ga0439456_054694_119_730 | 197 |
| 200 | 3300042436 | Ga0439435_0000291 | Ga0439435_0000291_2462_3073 | 197 |
| 201 | 3300046522 | Ga0495643_0206727 | Ga0495643_0206727_236_847 | 197 |
| 202 | 3300049568 | Ga0501031_0175551 | Ga0501031_0175551_764_1360 | 197 |
| 203 | 3300049569 | Ga0501032_0252822 | Ga0501032_0252822_198_794 | 197 |
| 204 | 3300049581 | Ga0501047_0253955 | Ga0501047_0253955_156_752 | 197 |
| 205 | 3300049744 | Ga0501083_0038727 | Ga0501083_0038727_2412_3008 | 197 |
| 206 | 3300049823 | Ga0501044_0108177 | Ga0501044_0108177_1937_2533 | 197 |
| 207 | 3300050492 | nmdc:mga0yw44_228834_c1 | nmdc:mga0yw44_228834_c1_295_912 | 197 |
| 208 | 3300050493 | nmdc:mga0k408_147555_c1 | nmdc:mga0k408_147555_c1_264_875 | 197 |
| 209 | 3300050494 | nmdc:mga06z11_373772_c1 | nmdc:mga06z11_373772_c1_79_696 | 197 |
| 210 | 3300050516 | nmdc:mga0sz30_184845_c1 | nmdc:mga0sz30_184845_c1_51_668 | 197 |
| 211 | 3300053087 | Ga0500643_004624 | Ga0500643_004624_3152_3808 | 197 |
| 212 | 3300053094 | Ga0500566_0110663 | Ga0500566_0110663_697_1353 | 197 |
| 213 | 3300053098 | Ga0500650_0020033 | Ga0500650_0020033_319_930 | 197 |
| 214 | 3300053119 | Ga0500595_000085 | Ga0500595_000085_45067_45723 | 197 |
| 215 | 3300053153 | Ga0500616_0174395 | Ga0500616_0174395_156_767 | 197 |
| 216 | 3300009177 | Ga0105248_11205731 | Ga0105248_112057311 | 198 |
| 217 | 3300028800 | Ga0265338_10158624 | Ga0265338_101586242 | 198 |
| 218 | 3300031344 | Ga0265316_10225647 | Ga0265316_102256471 | 198 |
| 219 | 3300031344 | Ga0265316_10482761 | Ga0265316_104827612 | 198 |
| 220 | 3300031711 | Ga0265314_10036151 | Ga0265314_100361512 | 198 |
| 221 | 3300036401 | Ga0373937_0091412 | Ga0373937_0091412_89_688 | 198 |
| 222 | 3300047444 | Ga0495675_0211153 | Ga0495675_0211153_172_771 | 198 |
| 223 | 3300053085 | Ga0495619_0203927 | Ga0495619_0203927_282_881 | 198 |
| 224 | 2209111006 | 2214761890 | 2213777783 | 199 |
| 225 | 3300000041 | ARcpr5oldR_c000088 | ARcpr5oldR_00008811 | 199 |
| 226 | 3300000043 | ARcpr5yngRDRAFT_c000056 | ARcpr5yngRDRAFT_0000567 | 199 |
| 227 | 3300000044 | ARSoilOldRDRAFT_c000084 | ARSoilOldRDRAFT_0000847 | 199 |
| 228 | 3300000045 | ARCol0oldRDRAFT_c00490 | ARCol0oldRDRAFT_004903 | 199 |
| 229 | 3300000652 | ARCol0yngRDRAFT_1000059 | ARCol0yngRDRAFT_100005911 | 199 |
| 230 | 3300001430 | JGI24032J14994_100059 | JGI24032J14994_1000595 | 199 |
| 231 | 3300001915 | JGI24741J21665_1002679 | JGI24741J21665_10026793 | 199 |
| 232 | 3300001976 | JGI24752J21851_1000628 | JGI24752J21851_10006282 | 199 |
| 233 | 3300001977 | JGI24746J21847_1000020 | JGI24746J21847_10000205 | 199 |
| 234 | 3300001978 | JGI24747J21853_1000015 | JGI24747J21853_10000152 | 199 |
| 235 | 3300001979 | JGI24740J21852_10006056 | JGI24740J21852_100060565 | 199 |
| 236 | 3300001989 | JGI24739J22299_10000555 | JGI24739J22299_100005559 | 199 |
| 237 | 3300001990 | JGI24737J22298_10000446 | JGI24737J22298_100004467 | 199 |
| 238 | 3300001990 | JGI24737J22298_10001295 | JGI24737J22298_100012959 | 199 |
| 239 | 3300001991 | JGI24743J22301_10005422 | JGI24743J22301_100054222 | 199 |
| 240 | 3300002067 | JGI24735J21928_10097057 | JGI24735J21928_100970572 | 199 |
| 241 | 3300002070 | JGI24750J21931_1000321 | JGI24750J21931_10003215 | 199 |
| 242 | 3300002074 | JGI24748J21848_1006494 | JGI24748J21848_10064941 | 199 |
| 243 | 3300002075 | JGI24738J21930_10000478 | JGI24738J21930_100004787 | 199 |
| 244 | 3300002076 | JGI24749J21850_1000191 | JGI24749J21850_10001913 | 199 |
| 245 | 3300002077 | JGI24744J21845_10000650 | JGI24744J21845_100006506 | 199 |
| 246 | 3300002126 | JGI24035J26624_1000088 | JGI24035J26624_10000883 | 199 |
| 247 | 3300002155 | JGI24033J26618_1002030 | JGI24033J26618_10020302 | 199 |
| 248 | 3300002239 | JGI24034J26672_10000148 | JGI24034J26672_100001485 | 199 |
| 249 | 3300002244 | JGI24742J22300_10000055 | JGI24742J22300_100000558 | 199 |
| 250 | 3300002459 | JGI24751J29686_10001781 | JGI24751J29686_100017812 | 199 |
| 251 | 3300003911 | JGI25405J52794_10016452 | JGI25405J52794_100164523 | 199 |
| 252 | 3300005277 | Ga0065716_1001694 | Ga0065716_10016944 | 199 |
| 253 | 3300005289 | Ga0065704_10081261 | Ga0065704_100812613 | 199 |
| 254 | 3300005290 | Ga0065712_10004602 | Ga0065712_100046022 | 199 |
| 255 | 3300005290 | Ga0065712_10014918 | Ga0065712_100149182 | 199 |
| 256 | 3300005290 | Ga0065712_10069614 | Ga0065712_100696147 | 199 |
| 257 | 3300005293 | Ga0065715_10094105 | Ga0065715_100941055 | 199 |
| 258 | 3300005327 | Ga0070658_10057341 | Ga0070658_100573413 | 199 |
| 259 | 3300005328 | Ga0070676_10000186 | Ga0070676_1000018625 | 199 |
| 260 | 3300005329 | Ga0070683_100000064 | Ga0070683_10000006447 | 199 |
| 261 | 3300005330 | Ga0070690_100005166 | Ga0070690_1000051662 | 199 |
| 262 | 3300005330 | Ga0070690_100115693 | Ga0070690_1001156932 | 199 |
| 263 | 3300005330 | Ga0070690_100138780 | Ga0070690_1001387802 | 199 |
| 264 | 3300005331 | Ga0070670_100020384 | Ga0070670_1000203841 | 199 |
| 265 | 3300005331 | Ga0070670_100200564 | Ga0070670_1002005641 | 199 |
| 266 | 3300005331 | Ga0070670_100209543 | Ga0070670_1002095432 | 199 |
| 267 | 3300005333 | Ga0070677_10000330 | Ga0070677_100003302 | 199 |
| 268 | 3300005334 | Ga0068869_100000191 | Ga0068869_10000019125 | 199 |
| 269 | 3300005334 | Ga0068869_100090893 | Ga0068869_1000908933 | 199 |
| 270 | 3300005335 | Ga0070666_10020150 | Ga0070666_100201503 | 199 |
| 271 | 3300005335 | Ga0070666_10378693 | Ga0070666_103786931 | 199 |
| 272 | 3300005336 | Ga0070680_100008982 | Ga0070680_1000089826 | 199 |
| 273 | 3300005336 | Ga0070680_100009358 | Ga0070680_1000093588 | 199 |
| 274 | 3300005336 | Ga0070680_100027510 | Ga0070680_1000275103 | 199 |
| 275 | 3300005336 | Ga0070680_100196508 | Ga0070680_1001965082 | 199 |
| 276 | 3300005336 | Ga0070680_100199924 | Ga0070680_1001999242 | 199 |
| 277 | 3300005337 | Ga0070682_100001165 | Ga0070682_1000011657 | 199 |
| 278 | 3300005337 | Ga0070682_100032175 | Ga0070682_1000321753 | 199 |
| 279 | 3300005337 | Ga0070682_100050010 | Ga0070682_1000500103 | 199 |
| 280 | 3300005338 | Ga0068868_100000233 | Ga0068868_10000023311 | 199 |
| 281 | 3300005338 | Ga0068868_100015794 | Ga0068868_1000157943 | 199 |
| 282 | 3300005339 | Ga0070660_100000523 | Ga0070660_10000052323 | 199 |
| 283 | 3300005339 | Ga0070660_100049478 | Ga0070660_1000494783 | 199 |
| 284 | 3300005339 | Ga0070660_100083409 | Ga0070660_1000834092 | 199 |
| 285 | 3300005339 | Ga0070660_100160965 | Ga0070660_1001609652 | 199 |
| 286 | 3300005339 | Ga0070660_100412565 | Ga0070660_1004125652 | 199 |
| 287 | 3300005340 | Ga0070689_100000764 | Ga0070689_10000076414 | 199 |
| 288 | 3300005340 | Ga0070689_100022766 | Ga0070689_1000227665 | 199 |
| 289 | 3300005340 | Ga0070689_100069466 | Ga0070689_1000694663 | 199 |
| 290 | 3300005341 | Ga0070691_10002775 | Ga0070691_100027751 | 199 |
| 291 | 3300005341 | Ga0070691_10069908 | Ga0070691_100699082 | 199 |
| 292 | 3300005343 | Ga0070687_100000911 | Ga0070687_1000009113 | 199 |
| 293 | 3300005343 | Ga0070687_100019895 | Ga0070687_1000198954 | 199 |
| 294 | 3300005344 | Ga0070661_100000188 | Ga0070661_10000018824 | 199 |
| 295 | 3300005345 | Ga0070692_10002184 | Ga0070692_100021844 | 199 |
| 296 | 3300005345 | Ga0070692_10003843 | Ga0070692_100038437 | 199 |
| 297 | 3300005347 | Ga0070668_100000409 | Ga0070668_10000040925 | 199 |
| 298 | 3300005353 | Ga0070669_100000523 | Ga0070669_1000005237 | 199 |
| 299 | 3300005354 | Ga0070675_100000034 | Ga0070675_10000003460 | 199 |
| 300 | 3300005354 | Ga0070675_100262633 | Ga0070675_1002626332 | 199 |
| 301 | 3300005355 | Ga0070671_100000111 | Ga0070671_10000011128 | 199 |
| 302 | 3300005355 | Ga0070671_100015028 | Ga0070671_1000150283 | 199 |
| 303 | 3300005355 | Ga0070671_100040483 | Ga0070671_1000404833 | 199 |
| 304 | 3300005355 | Ga0070671_100189771 | Ga0070671_1001897711 | 199 |
| 305 | 3300005356 | Ga0070674_100000457 | Ga0070674_1000004577 | 199 |
| 306 | 3300005356 | Ga0070674_100042528 | Ga0070674_1000425284 | 199 |
| 307 | 3300005356 | Ga0070674_100163489 | Ga0070674_1001634892 | 199 |
| 308 | 3300005364 | Ga0070673_100000105 | Ga0070673_1000001059 | 199 |
| 309 | 3300005364 | Ga0070673_100057580 | Ga0070673_1000575803 | 199 |
| 310 | 3300005365 | Ga0070688_100000401 | Ga0070688_1000004012 | 199 |
| 311 | 3300005365 | Ga0070688_100004970 | Ga0070688_1000049705 | 199 |
| 312 | 3300005365 | Ga0070688_100032762 | Ga0070688_1000327623 | 199 |
| 313 | 3300005365 | Ga0070688_100275607 | Ga0070688_1002756072 | 199 |
| 314 | 3300005366 | Ga0070659_100000590 | Ga0070659_10000059023 | 199 |
| 315 | 3300005366 | Ga0070659_100048051 | Ga0070659_1000480512 | 199 |
| 316 | 3300005366 | Ga0070659_100048885 | Ga0070659_1000488853 | 199 |
| 317 | 3300005366 | Ga0070659_100265566 | Ga0070659_1002655662 | 199 |
| 318 | 3300005367 | Ga0070667_100004839 | Ga0070667_1000048395 | 199 |
| 319 | 3300005367 | Ga0070667_100117095 | Ga0070667_1001170952 | 199 |
| 320 | 3300005367 | Ga0070667_100694085 | Ga0070667_1006940851 | 199 |
| 321 | 3300005406 | Ga0070703_10020953 | Ga0070703_100209532 | 199 |
| 322 | 3300005434 | Ga0070709_10003572 | Ga0070709_100035726 | 199 |
| 323 | 3300005434 | Ga0070709_10009284 | Ga0070709_100092843 | 199 |
| 324 | 3300005434 | Ga0070709_10024715 | Ga0070709_100247153 | 199 |
| 325 | 3300005435 | Ga0070714_100017451 | Ga0070714_1000174512 | 199 |
| 326 | 3300005436 | Ga0070713_100000830 | Ga0070713_1000008302 | 199 |
| 327 | 3300005436 | Ga0070713_100014528 | Ga0070713_1000145283 | 199 |
| 328 | 3300005436 | Ga0070713_100345515 | Ga0070713_1003455152 | 199 |
| 329 | 3300005437 | Ga0070710_10002223 | Ga0070710_100022233 | 199 |
| 330 | 3300005437 | Ga0070710_10008148 | Ga0070710_100081485 | 199 |
| 331 | 3300005438 | Ga0070701_10001631 | Ga0070701_100016315 | 199 |
| 332 | 3300005439 | Ga0070711_100025054 | Ga0070711_1000250544 | 199 |
| 333 | 3300005439 | Ga0070711_100031041 | Ga0070711_1000310414 | 199 |
| 334 | 3300005439 | Ga0070711_100032473 | Ga0070711_1000324733 | 199 |
| 335 | 3300005439 | Ga0070711_100049912 | Ga0070711_1000499124 | 199 |
| 336 | 3300005439 | Ga0070711_100438417 | Ga0070711_1004384171 | 199 |
| 337 | 3300005440 | Ga0070705_100000252 | Ga0070705_10000025210 | 199 |
| 338 | 3300005440 | Ga0070705_100884950 | Ga0070705_1008849501 | 199 |
| 339 | 3300005441 | Ga0070700_100009718 | Ga0070700_1000097185 | 199 |
| 340 | 3300005441 | Ga0070700_100225394 | Ga0070700_1002253941 | 199 |
| 341 | 3300005444 | Ga0070694_100002271 | Ga0070694_1000022712 | 199 |
| 342 | 3300005444 | Ga0070694_100049276 | Ga0070694_1000492762 | 199 |
| 343 | 3300005445 | Ga0070708_100025000 | Ga0070708_1000250003 | 199 |
| 344 | 3300005455 | Ga0070663_100001002 | Ga0070663_1000010029 | 199 |
| 345 | 3300005455 | Ga0070663_100057226 | Ga0070663_1000572264 | 199 |
| 346 | 3300005455 | Ga0070663_100067388 | Ga0070663_1000673883 | 199 |
| 347 | 3300005455 | Ga0070663_100083501 | Ga0070663_1000835013 | 199 |
| 348 | 3300005455 | Ga0070663_100571252 | Ga0070663_1005712523 | 199 |
| 349 | 3300005456 | Ga0070678_100000033 | Ga0070678_10000003328 | 199 |
| 350 | 3300005456 | Ga0070678_100384874 | Ga0070678_1003848741 | 199 |
| 351 | 3300005457 | Ga0070662_100002444 | Ga0070662_1000024446 | 199 |
| 352 | 3300005457 | Ga0070662_100008859 | Ga0070662_1000088595 | 199 |
| 353 | 3300005458 | Ga0070681_10003475 | Ga0070681_100034756 | 199 |
| 354 | 3300005458 | Ga0070681_10006724 | Ga0070681_100067247 | 199 |
| 355 | 3300005458 | Ga0070681_10061299 | Ga0070681_100612994 | 199 |
| 356 | 3300005458 | Ga0070681_10113593 | Ga0070681_101135932 | 199 |
| 357 | 3300005458 | Ga0070681_10580382 | Ga0070681_105803822 | 199 |
| 358 | 3300005459 | Ga0068867_100002276 | Ga0068867_1000022767 | 199 |
| 359 | 3300005466 | Ga0070685_10014131 | Ga0070685_100141314 | 199 |
| 360 | 3300005518 | Ga0070699_100081552 | Ga0070699_1000815523 | 199 |
| 361 | 3300005518 | Ga0070699_100832246 | Ga0070699_1008322461 | 199 |
| 362 | 3300005530 | Ga0070679_100010016 | Ga0070679_1000100169 | 199 |
| 363 | 3300005530 | Ga0070679_100022664 | Ga0070679_1000226646 | 199 |
| 364 | 3300005530 | Ga0070679_100092473 | Ga0070679_1000924733 | 199 |
| 365 | 3300005530 | Ga0070679_100609994 | Ga0070679_1006099941 | 199 |
| 366 | 3300005535 | Ga0070684_100000275 | Ga0070684_10000027527 | 199 |
| 367 | 3300005535 | Ga0070684_100153294 | Ga0070684_1001532942 | 199 |
| 368 | 3300005535 | Ga0070684_100666655 | Ga0070684_1006666552 | 199 |
| 369 | 3300005535 | Ga0070684_100983172 | Ga0070684_1009831721 | 199 |
| 370 | 3300005539 | Ga0068853_100009622 | Ga0068853_1000096229 | 199 |
| 371 | 3300005539 | Ga0068853_100305029 | Ga0068853_1003050293 | 199 |
| 372 | 3300005543 | Ga0070672_100000008 | Ga0070672_10000000828 | 199 |
| 373 | 3300005543 | Ga0070672_100085799 | Ga0070672_1000857991 | 199 |
| 374 | 3300005544 | Ga0070686_100000309 | Ga0070686_10000030913 | 199 |
| 375 | 3300005544 | Ga0070686_100011935 | Ga0070686_1000119355 | 199 |
| 376 | 3300005544 | Ga0070686_100015096 | Ga0070686_1000150963 | 199 |
| 377 | 3300005544 | Ga0070686_100262906 | Ga0070686_1002629061 | 199 |
| 378 | 3300005544 | Ga0070686_100654043 | Ga0070686_1006540431 | 199 |
| 379 | 3300005545 | Ga0070695_100000270 | Ga0070695_10000027023 | 199 |
| 380 | 3300005545 | Ga0070695_100008070 | Ga0070695_1000080704 | 199 |
| 381 | 3300005546 | Ga0070696_100001699 | Ga0070696_1000016999 | 199 |
| 382 | 3300005546 | Ga0070696_100087396 | Ga0070696_1000873964 | 199 |
| 383 | 3300005546 | Ga0070696_100136655 | Ga0070696_1001366553 | 199 |
| 384 | 3300005546 | Ga0070696_100331039 | Ga0070696_1003310392 | 199 |
| 385 | 3300005547 | Ga0070693_100000453 | Ga0070693_1000004537 | 199 |
| 386 | 3300005547 | Ga0070693_100006956 | Ga0070693_1000069563 | 199 |
| 387 | 3300005548 | Ga0070665_100071774 | Ga0070665_1000717743 | 199 |
| 388 | 3300005549 | Ga0070704_100001241 | Ga0070704_1000012417 | 199 |
| 389 | 3300005563 | Ga0068855_100011392 | Ga0068855_1000113921 | 199 |
| 390 | 3300005563 | Ga0068855_100063943 | Ga0068855_1000639435 | 199 |
| 391 | 3300005563 | Ga0068855_100122511 | Ga0068855_1001225113 | 199 |
| 392 | 3300005563 | Ga0068855_100149266 | Ga0068855_1001492663 | 199 |
| 393 | 3300005563 | Ga0068855_100192777 | Ga0068855_1001927772 | 199 |
| 394 | 3300005564 | Ga0070664_100000419 | Ga0070664_10000041910 | 199 |
| 395 | 3300005564 | Ga0070664_100083276 | Ga0070664_1000832762 | 199 |
| 396 | 3300005564 | Ga0070664_100225349 | Ga0070664_1002253491 | 199 |
| 397 | 3300005564 | Ga0070664_100417159 | Ga0070664_1004171593 | 199 |
| 398 | 3300005564 | Ga0070664_100626623 | Ga0070664_1006266231 | 199 |
| 399 | 3300005577 | Ga0068857_100005226 | Ga0068857_1000052262 | 199 |
| 400 | 3300005577 | Ga0068857_100218836 | Ga0068857_1002188363 | 199 |
| 401 | 3300005578 | Ga0068854_100040383 | Ga0068854_1000403831 | 199 |
| 402 | 3300005578 | Ga0068854_100131394 | Ga0068854_1001313942 | 199 |
| 403 | 3300005578 | Ga0068854_100384774 | Ga0068854_1003847742 | 199 |
| 404 | 3300005614 | Ga0068856_100000963 | Ga0068856_1000009638 | 199 |
| 405 | 3300005614 | Ga0068856_100275336 | Ga0068856_1002753361 | 199 |
| 406 | 3300005614 | Ga0068856_100838421 | Ga0068856_1008384211 | 199 |
| 407 | 3300005615 | Ga0070702_100068997 | Ga0070702_1000689973 | 199 |
| 408 | 3300005615 | Ga0070702_100075961 | Ga0070702_1000759613 | 199 |
| 409 | 3300005616 | Ga0068852_100024652 | Ga0068852_1000246522 | 199 |
| 410 | 3300005616 | Ga0068852_100198211 | Ga0068852_1001982112 | 199 |
| 411 | 3300005616 | Ga0068852_100327035 | Ga0068852_1003270353 | 199 |
| 412 | 3300005617 | Ga0068859_100010517 | Ga0068859_1000105175 | 199 |
| 413 | 3300005617 | Ga0068859_100038950 | Ga0068859_1000389502 | 199 |
| 414 | 3300005617 | Ga0068859_100158936 | Ga0068859_1001589363 | 199 |
| 415 | 3300005618 | Ga0068864_100013519 | Ga0068864_1000135198 | 199 |
| 416 | 3300005618 | Ga0068864_100041276 | Ga0068864_1000412763 | 199 |
| 417 | 3300005618 | Ga0068864_100344145 | Ga0068864_1003441453 | 199 |
| 418 | 3300005718 | Ga0068866_10000291 | Ga0068866_1000029125 | 199 |
| 419 | 3300005719 | Ga0068861_100001375 | Ga0068861_1000013759 | 199 |
| 420 | 3300005719 | Ga0068861_100031191 | Ga0068861_1000311912 | 199 |
| 421 | 3300005719 | Ga0068861_100252446 | Ga0068861_1002524462 | 199 |
| 422 | 3300005834 | Ga0068851_10028004 | Ga0068851_100280042 | 199 |
| 423 | 3300005840 | Ga0068870_10000005 | Ga0068870_1000000528 | 199 |
| 424 | 3300005841 | Ga0068863_100000608 | Ga0068863_1000006089 | 199 |
| 425 | 3300005841 | Ga0068863_100066955 | Ga0068863_1000669552 | 199 |
| 426 | 3300005841 | Ga0068863_100157381 | Ga0068863_1001573811 | 199 |
| 427 | 3300005842 | Ga0068858_100014751 | Ga0068858_1000147519 | 199 |
| 428 | 3300005842 | Ga0068858_100024402 | Ga0068858_1000244022 | 199 |
| 429 | 3300005842 | Ga0068858_100043968 | Ga0068858_1000439682 | 199 |
| 430 | 3300005842 | Ga0068858_100367397 | Ga0068858_1003673972 | 199 |
| 431 | 3300005842 | Ga0068858_100404091 | Ga0068858_1004040912 | 199 |
| 432 | 3300005843 | Ga0068860_100001183 | Ga0068860_10000118325 | 199 |
| 433 | 3300005843 | Ga0068860_100172126 | Ga0068860_1001721263 | 199 |
| 434 | 3300005843 | Ga0068860_100317499 | Ga0068860_1003174993 | 199 |
| 435 | 3300005844 | Ga0068862_100010075 | Ga0068862_1000100752 | 199 |
| 436 | 3300005844 | Ga0068862_100013288 | Ga0068862_1000132884 | 199 |
| 437 | 3300005844 | Ga0068862_100968330 | Ga0068862_1009683301 | 199 |
| 438 | 3300005937 | Ga0081455_10000002 | Ga0081455_100000024 | 199 |
| 439 | 3300005937 | Ga0081455_10004074 | Ga0081455_100040743 | 199 |
| 440 | 3300006028 | Ga0070717_10002981 | Ga0070717_100029819 | 199 |
| 441 | 3300006042 | Ga0075368_10180832 | Ga0075368_101808322 | 199 |
| 442 | 3300006058 | Ga0075432_10005509 | Ga0075432_100055093 | 199 |
| 443 | 3300006058 | Ga0075432_10015716 | Ga0075432_100157163 | 199 |
| 444 | 3300006163 | Ga0070715_10034535 | Ga0070715_100345352 | 199 |
| 445 | 3300006163 | Ga0070715_10099511 | Ga0070715_100995111 | 199 |
| 446 | 3300006173 | Ga0070716_100170001 | Ga0070716_1001700012 | 199 |
| 447 | 3300006173 | Ga0070716_100376753 | Ga0070716_1003767531 | 199 |
| 448 | 3300006175 | Ga0070712_100016065 | Ga0070712_1000160655 | 199 |
| 449 | 3300006175 | Ga0070712_100230144 | Ga0070712_1002301442 | 199 |
| 450 | 3300006178 | Ga0075367_10031675 | Ga0075367_100316753 | 199 |
| 451 | 3300006194 | Ga0075427_10001679 | Ga0075427_100016792 | 199 |
| 452 | 3300006237 | Ga0097621_100000006 | Ga0097621_10000000627 | 199 |
| 453 | 3300006237 | Ga0097621_100054592 | Ga0097621_1000545923 | 199 |
| 454 | 3300006237 | Ga0097621_100212178 | Ga0097621_1002121782 | 199 |
| 455 | 3300006353 | Ga0075370_10173773 | Ga0075370_101737732 | 199 |
| 456 | 3300006358 | Ga0068871_100000022 | Ga0068871_10000002253 | 199 |
| 457 | 3300006358 | Ga0068871_100004373 | Ga0068871_1000043734 | 199 |
| 458 | 3300006358 | Ga0068871_100052461 | Ga0068871_1000524613 | 199 |
| 459 | 3300006844 | Ga0075428_100010613 | Ga0075428_1000106134 | 199 |
| 460 | 3300006846 | Ga0075430_100000485 | Ga0075430_10000048516 | 199 |
| 461 | 3300006847 | Ga0075431_100002570 | Ga0075431_10000257014 | 199 |
| 462 | 3300006852 | Ga0075433_10001502 | Ga0075433_100015027 | 199 |
| 463 | 3300006852 | Ga0075433_10010359 | Ga0075433_100103596 | 199 |
| 464 | 3300006852 | Ga0075433_10117392 | Ga0075433_101173923 | 199 |
| 465 | 3300006852 | Ga0075433_10622926 | Ga0075433_106229261 | 199 |
| 466 | 3300006871 | Ga0075434_100000877 | Ga0075434_10000087715 | 199 |
| 467 | 3300006871 | Ga0075434_100001706 | Ga0075434_1000017067 | 199 |
| 468 | 3300006871 | Ga0075434_100159920 | Ga0075434_1001599203 | 199 |
| 469 | 3300006871 | Ga0075434_100296944 | Ga0075434_1002969442 | 199 |
| 470 | 3300006880 | Ga0075429_100000667 | Ga0075429_10000066719 | 199 |
| 471 | 3300006881 | Ga0068865_100000196 | Ga0068865_10000019628 | 199 |
| 472 | 3300006881 | Ga0068865_100017462 | Ga0068865_1000174623 | 199 |
| 473 | 3300006881 | Ga0068865_100024862 | Ga0068865_1000248622 | 199 |
| 474 | 3300006881 | Ga0068865_100088317 | Ga0068865_1000883173 | 199 |
| 475 | 3300006914 | Ga0075436_100207518 | Ga0075436_1002075181 | 199 |
| 476 | 3300006931 | Ga0097620_100010517 | Ga0097620_1000105175 | 199 |
| 477 | 3300006931 | Ga0097620_100038950 | Ga0097620_1000389505 | 199 |
| 478 | 3300006931 | Ga0097620_100158937 | Ga0097620_1001589373 | 199 |
| 479 | 3300007076 | Ga0075435_100007750 | Ga0075435_1000077503 | 199 |
| 480 | 3300007076 | Ga0075435_100220275 | Ga0075435_1002202752 | 199 |
| 481 | 3300007076 | Ga0075435_100735858 | Ga0075435_1007358581 | 199 |
| 482 | 3300009011 | Ga0105251_10011249 | Ga0105251_100112494 | 199 |
| 483 | 3300009011 | Ga0105251_10020989 | Ga0105251_100209893 | 199 |
| 484 | 3300009092 | Ga0105250_10013540 | Ga0105250_100135403 | 199 |
| 485 | 3300009092 | Ga0105250_10193910 | Ga0105250_101939102 | 199 |
| 486 | 3300009093 | Ga0105240_10179599 | Ga0105240_101795993 | 199 |
| 487 | 3300009093 | Ga0105240_10205550 | Ga0105240_102055503 | 199 |
| 488 | 3300009093 | Ga0105240_10490741 | Ga0105240_104907413 | 199 |
| 489 | 3300009093 | Ga0105240_10493529 | Ga0105240_104935292 | 199 |
| 490 | 3300009093 | Ga0105240_10885784 | Ga0105240_108857841 | 199 |
| 491 | 3300009094 | Ga0111539_10000817 | Ga0111539_100008175 | 199 |
| 492 | 3300009094 | Ga0111539_10001765 | Ga0111539_1000176524 | 199 |
| 493 | 3300009094 | Ga0111539_10001792 | Ga0111539_100017927 | 199 |
| 494 | 3300009094 | Ga0111539_10047909 | Ga0111539_100479092 | 199 |
| 495 | 3300009094 | Ga0111539_10417137 | Ga0111539_104171371 | 199 |
| 496 | 3300009098 | Ga0105245_10001176 | Ga0105245_1000117618 | 199 |
| 497 | 3300009098 | Ga0105245_10065447 | Ga0105245_100654473 | 199 |
| 498 | 3300009098 | Ga0105245_10577791 | Ga0105245_105777912 | 199 |
| 499 | 3300009101 | Ga0105247_10001410 | Ga0105247_1000141014 | 199 |
| 500 | 3300009101 | Ga0105247_10037063 | Ga0105247_100370633 | 199 |
| 501 | 3300009101 | Ga0105247_10096434 | Ga0105247_100964343 | 199 |
| 502 | 3300009101 | Ga0105247_10384478 | Ga0105247_103844781 | 199 |
| 503 | 3300009147 | Ga0114129_10005250 | Ga0114129_100052508 | 199 |
| 504 | 3300009147 | Ga0114129_10045189 | Ga0114129_100451894 | 199 |
| 505 | 3300009148 | Ga0105243_10002512 | Ga0105243_100025127 | 199 |
| 506 | 3300009148 | Ga0105243_10002946 | Ga0105243_100029469 | 199 |
| 507 | 3300009148 | Ga0105243_10155191 | Ga0105243_101551911 | 199 |
| 508 | 3300009148 | Ga0105243_10160393 | Ga0105243_101603931 | 199 |
| 509 | 3300009148 | Ga0105243_10243132 | Ga0105243_102431323 | 199 |
| 510 | 3300009174 | Ga0105241_10006541 | Ga0105241_100065419 | 199 |
| 511 | 3300009174 | Ga0105241_10138834 | Ga0105241_101388343 | 199 |
| 512 | 3300009174 | Ga0105241_11458188 | Ga0105241_114581881 | 199 |
| 513 | 3300009176 | Ga0105242_10000879 | Ga0105242_1000087910 | 199 |
| 514 | 3300009176 | Ga0105242_10015607 | Ga0105242_100156074 | 199 |
| 515 | 3300009176 | Ga0105242_10473463 | Ga0105242_104734632 | 199 |
| 516 | 3300009176 | Ga0105242_10505322 | Ga0105242_105053221 | 199 |
| 517 | 3300009176 | Ga0105242_10850631 | Ga0105242_108506311 | 199 |
| 518 | 3300009177 | Ga0105248_10012400 | Ga0105248_100124006 | 199 |
| 519 | 3300009177 | Ga0105248_10034418 | Ga0105248_100344181 | 199 |
| 520 | 3300009177 | Ga0105248_10174583 | Ga0105248_101745832 | 199 |
| 521 | 3300009545 | Ga0105237_10043805 | Ga0105237_100438052 | 199 |
| 522 | 3300009545 | Ga0105237_10135140 | Ga0105237_101351403 | 199 |
| 523 | 3300009551 | Ga0105238_10119323 | Ga0105238_101193233 | 199 |
| 524 | 3300009551 | Ga0105238_10221644 | Ga0105238_102216443 | 199 |
| 525 | 3300009551 | Ga0105238_11149496 | Ga0105238_111494961 | 199 |
| 526 | 3300009553 | Ga0105249_10003131 | Ga0105249_100031317 | 199 |
| 527 | 3300009553 | Ga0105249_10003187 | Ga0105249_100031877 | 199 |
| 528 | 3300009553 | Ga0105249_10328827 | Ga0105249_103288271 | 199 |
| 529 | 3300009553 | Ga0105249_10673586 | Ga0105249_106735862 | 199 |
| 530 | 3300010375 | Ga0105239_10001436 | Ga0105239_1000143610 | 199 |
| 531 | 3300010375 | Ga0105239_10010581 | Ga0105239_100105814 | 199 |
| 532 | 3300010375 | Ga0105239_10607302 | Ga0105239_106073021 | 199 |
| 533 | 3300011119 | Ga0105246_10000984 | Ga0105246_100009848 | 199 |
| 534 | 3300012494 | Ga0157341_1014616 | Ga0157341_10146161 | 199 |
| 535 | 3300012505 | Ga0157339_1004819 | Ga0157339_10048191 | 199 |
| 536 | 3300012513 | Ga0157326_1004464 | Ga0157326_10044643 | 199 |
| 537 | 3300012515 | Ga0157338_1000604 | Ga0157338_10006042 | 199 |
| 538 | 3300012515 | Ga0157338_1001184 | Ga0157338_10011842 | 199 |
| 539 | 3300013100 | Ga0157373_10023028 | Ga0157373_100230284 | 199 |
| 540 | 3300013100 | Ga0157373_10033867 | Ga0157373_100338674 | 199 |
| 541 | 3300013100 | Ga0157373_10067713 | Ga0157373_100677131 | 199 |
| 542 | 3300013102 | Ga0157371_10227785 | Ga0157371_102277853 | 199 |
| 543 | 3300013102 | Ga0157371_10242990 | Ga0157371_102429901 | 199 |
| 544 | 3300013102 | Ga0157371_10316006 | Ga0157371_103160061 | 199 |
| 545 | 3300013104 | Ga0157370_10035810 | Ga0157370_100358106 | 199 |
| 546 | 3300013104 | Ga0157370_10062601 | Ga0157370_100626014 | 199 |
| 547 | 3300013105 | Ga0157369_10123103 | Ga0157369_101231034 | 199 |
| 548 | 3300013105 | Ga0157369_10154077 | Ga0157369_101540773 | 199 |
| 549 | 3300013105 | Ga0157369_10596731 | Ga0157369_105967312 | 199 |
| 550 | 3300013105 | Ga0157369_10701506 | Ga0157369_107015062 | 199 |
| 551 | 3300013105 | Ga0157369_11180794 | Ga0157369_111807941 | 199 |
| 552 | 3300013296 | Ga0157374_10012602 | Ga0157374_100126028 | 199 |
| 553 | 3300013296 | Ga0157374_10071928 | Ga0157374_100719283 | 199 |
| 554 | 3300013296 | Ga0157374_10116537 | Ga0157374_101165373 | 199 |
| 555 | 3300013297 | Ga0157378_10001496 | Ga0157378_1000149613 | 199 |
| 556 | 3300013297 | Ga0157378_10058064 | Ga0157378_100580642 | 199 |
| 557 | 3300013297 | Ga0157378_10266059 | Ga0157378_102660592 | 199 |
| 558 | 3300013306 | Ga0163162_10004276 | Ga0163162_100042768 | 199 |
| 559 | 3300013306 | Ga0163162_10006826 | Ga0163162_100068265 | 199 |
| 560 | 3300013307 | Ga0157372_10060986 | Ga0157372_100609864 | 199 |
| 561 | 3300013308 | Ga0157375_10000732 | Ga0157375_100007329 | 199 |
| 562 | 3300013308 | Ga0157375_10082399 | Ga0157375_100823994 | 199 |
| 563 | 3300013308 | Ga0157375_10099660 | Ga0157375_100996603 | 199 |
| 564 | 3300013308 | Ga0157375_10202201 | Ga0157375_102022011 | 199 |
| 565 | 3300013308 | Ga0157375_11402191 | Ga0157375_114021911 | 199 |
| 566 | 3300014325 | Ga0163163_10005114 | Ga0163163_100051145 | 199 |
| 567 | 3300014325 | Ga0163163_10111377 | Ga0163163_101113772 | 199 |
| 568 | 3300014326 | Ga0157380_10000551 | Ga0157380_100005515 | 199 |
| 569 | 3300014326 | Ga0157380_10796026 | Ga0157380_107960261 | 199 |
| 570 | 3300014326 | Ga0157380_11367712 | Ga0157380_113677121 | 199 |
| 571 | 3300014745 | Ga0157377_10000127 | Ga0157377_1000012726 | 199 |
| 572 | 3300014968 | Ga0157379_10016175 | Ga0157379_100161758 | 199 |
| 573 | 3300014968 | Ga0157379_10017453 | Ga0157379_100174538 | 199 |
| 574 | 3300014968 | Ga0157379_10203258 | Ga0157379_102032582 | 199 |
| 575 | 3300014968 | Ga0157379_10537674 | Ga0157379_105376742 | 199 |
| 576 | 3300014969 | Ga0157376_10000126 | Ga0157376_1000012624 | 199 |
| 577 | 3300014969 | Ga0157376_10106117 | Ga0157376_101061172 | 199 |
| 578 | 3300017792 | Ga0163161_10000562 | Ga0163161_100005625 | 199 |
| 579 | 3300017792 | Ga0163161_10061780 | Ga0163161_100617801 | 199 |
| 580 | 3300017792 | Ga0163161_10209982 | Ga0163161_102099823 | 199 |
| 581 | 3300020070 | Ga0206356_11340422 | Ga0206356_113404222 | 199 |
| 582 | 3300025271 | Ga0207666_1000211 | Ga0207666_10002112 | 199 |
| 583 | 3300025271 | Ga0207666_1000213 | Ga0207666_10002134 | 199 |
| 584 | 3300025290 | Ga0207673_1000023 | Ga0207673_10000236 | 199 |
| 585 | 3300025315 | Ga0207697_10000369 | Ga0207697_100003697 | 199 |
| 586 | 3300025711 | Ga0207696_1042459 | Ga0207696_10424592 | 199 |
| 587 | 3300025735 | Ga0207713_1040519 | Ga0207713_10405192 | 199 |
| 588 | 3300025885 | Ga0207653_10004957 | Ga0207653_100049575 | 199 |
| 589 | 3300025893 | Ga0207682_10000001 | Ga0207682_1000000142 | 199 |
| 590 | 3300025898 | Ga0207692_10090640 | Ga0207692_100906403 | 199 |
| 591 | 3300025898 | Ga0207692_10312665 | Ga0207692_103126651 | 199 |
| 592 | 3300025899 | Ga0207642_10000346 | Ga0207642_100003462 | 199 |
| 593 | 3300025899 | Ga0207642_10009174 | Ga0207642_100091743 | 199 |
| 594 | 3300025900 | Ga0207710_10002668 | Ga0207710_100026683 | 199 |
| 595 | 3300025900 | Ga0207710_10014949 | Ga0207710_100149491 | 199 |
| 596 | 3300025900 | Ga0207710_10016601 | Ga0207710_100166012 | 199 |
| 597 | 3300025901 | Ga0207688_10000694 | Ga0207688_100006949 | 199 |
| 598 | 3300025901 | Ga0207688_10038648 | Ga0207688_100386483 | 199 |
| 599 | 3300025901 | Ga0207688_10081821 | Ga0207688_100818213 | 199 |
| 600 | 3300025903 | Ga0207680_10002770 | Ga0207680_100027703 | 199 |
| 601 | 3300025904 | Ga0207647_10005072 | Ga0207647_100050723 | 199 |
| 602 | 3300025904 | Ga0207647_10006956 | Ga0207647_100069565 | 199 |
| 603 | 3300025905 | Ga0207685_10043858 | Ga0207685_100438582 | 199 |
| 604 | 3300025906 | Ga0207699_10000333 | Ga0207699_1000033319 | 199 |
| 605 | 3300025906 | Ga0207699_10014241 | Ga0207699_100142413 | 199 |
| 606 | 3300025907 | Ga0207645_10000862 | Ga0207645_100008627 | 199 |
| 607 | 3300025907 | Ga0207645_10061456 | Ga0207645_100614563 | 199 |
| 608 | 3300025907 | Ga0207645_10137055 | Ga0207645_101370552 | 199 |
| 609 | 3300025907 | Ga0207645_10323823 | Ga0207645_103238232 | 199 |
| 610 | 3300025908 | Ga0207643_10000041 | Ga0207643_1000004181 | 199 |
| 611 | 3300025909 | Ga0207705_10026744 | Ga0207705_100267443 | 199 |
| 612 | 3300025909 | Ga0207705_10060008 | Ga0207705_100600082 | 199 |
| 613 | 3300025911 | Ga0207654_10001213 | Ga0207654_1000121313 | 199 |
| 614 | 3300025911 | Ga0207654_10096705 | Ga0207654_100967052 | 199 |
| 615 | 3300025912 | Ga0207707_10001359 | Ga0207707_1000135916 | 199 |
| 616 | 3300025912 | Ga0207707_10040910 | Ga0207707_100409104 | 199 |
| 617 | 3300025912 | Ga0207707_10089808 | Ga0207707_100898083 | 199 |
| 618 | 3300025912 | Ga0207707_10126818 | Ga0207707_101268181 | 199 |
| 619 | 3300025912 | Ga0207707_10187380 | Ga0207707_101873802 | 199 |
| 620 | 3300025912 | Ga0207707_10284810 | Ga0207707_102848102 | 199 |
| 621 | 3300025912 | Ga0207707_10288584 | Ga0207707_102885843 | 199 |
| 622 | 3300025913 | Ga0207695_10053991 | Ga0207695_100539913 | 199 |
| 623 | 3300025913 | Ga0207695_10240990 | Ga0207695_102409903 | 199 |
| 624 | 3300025914 | Ga0207671_10022738 | Ga0207671_100227385 | 199 |
| 625 | 3300025914 | Ga0207671_10371231 | Ga0207671_103712311 | 199 |
| 626 | 3300025915 | Ga0207693_10003835 | Ga0207693_1000383511 | 199 |
| 627 | 3300025915 | Ga0207693_10309096 | Ga0207693_103090962 | 199 |
| 628 | 3300025916 | Ga0207663_10011514 | Ga0207663_100115141 | 199 |
| 629 | 3300025916 | Ga0207663_10018037 | Ga0207663_100180374 | 199 |
| 630 | 3300025916 | Ga0207663_10022636 | Ga0207663_100226365 | 199 |
| 631 | 3300025916 | Ga0207663_10059718 | Ga0207663_100597183 | 199 |
| 632 | 3300025917 | Ga0207660_10000006 | Ga0207660_1000000671 | 199 |
| 633 | 3300025917 | Ga0207660_10024028 | Ga0207660_100240283 | 199 |
| 634 | 3300025917 | Ga0207660_10091681 | Ga0207660_100916813 | 199 |
| 635 | 3300025917 | Ga0207660_10364100 | Ga0207660_103641001 | 199 |
| 636 | 3300025918 | Ga0207662_10000207 | Ga0207662_100002077 | 199 |
| 637 | 3300025918 | Ga0207662_10003071 | Ga0207662_100030718 | 199 |
| 638 | 3300025919 | Ga0207657_10005584 | Ga0207657_100055847 | 199 |
| 639 | 3300025919 | Ga0207657_10029437 | Ga0207657_100294372 | 199 |
| 640 | 3300025919 | Ga0207657_10077821 | Ga0207657_100778213 | 199 |
| 641 | 3300025919 | Ga0207657_10128448 | Ga0207657_101284481 | 199 |
| 642 | 3300025919 | Ga0207657_10267183 | Ga0207657_102671833 | 199 |
| 643 | 3300025920 | Ga0207649_10000049 | Ga0207649_1000004935 | 199 |
| 644 | 3300025920 | Ga0207649_10341178 | Ga0207649_103411782 | 199 |
| 645 | 3300025921 | Ga0207652_10000300 | Ga0207652_1000030013 | 199 |
| 646 | 3300025921 | Ga0207652_10021269 | Ga0207652_100212694 | 199 |
| 647 | 3300025921 | Ga0207652_10062764 | Ga0207652_100627643 | 199 |
| 648 | 3300025921 | Ga0207652_10161541 | Ga0207652_101615412 | 199 |
| 649 | 3300025921 | Ga0207652_10214373 | Ga0207652_102143732 | 199 |
| 650 | 3300025921 | Ga0207652_10299759 | Ga0207652_102997591 | 199 |
| 651 | 3300025922 | Ga0207646_10499612 | Ga0207646_104996122 | 199 |
| 652 | 3300025923 | Ga0207681_10000024 | Ga0207681_10000024149 | 199 |
| 653 | 3300025924 | Ga0207694_10064079 | Ga0207694_100640793 | 199 |
| 654 | 3300025924 | Ga0207694_10172650 | Ga0207694_101726503 | 199 |
| 655 | 3300025925 | Ga0207650_10005629 | Ga0207650_100056293 | 199 |
| 656 | 3300025925 | Ga0207650_10090190 | Ga0207650_100901902 | 199 |
| 657 | 3300025925 | Ga0207650_10302567 | Ga0207650_103025671 | 199 |
| 658 | 3300025926 | Ga0207659_10000042 | Ga0207659_1000004260 | 199 |
| 659 | 3300025926 | Ga0207659_10350242 | Ga0207659_103502422 | 199 |
| 660 | 3300025927 | Ga0207687_10000476 | Ga0207687_1000047616 | 199 |
| 661 | 3300025927 | Ga0207687_10064144 | Ga0207687_100641442 | 199 |
| 662 | 3300025927 | Ga0207687_10155565 | Ga0207687_101555653 | 199 |
| 663 | 3300025927 | Ga0207687_10536967 | Ga0207687_105369671 | 199 |
| 664 | 3300025928 | Ga0207700_10003404 | Ga0207700_100034044 | 199 |
| 665 | 3300025928 | Ga0207700_10086425 | Ga0207700_100864252 | 199 |
| 666 | 3300025929 | Ga0207664_10159241 | Ga0207664_101592413 | 199 |
| 667 | 3300025931 | Ga0207644_10000041 | Ga0207644_1000004157 | 199 |
| 668 | 3300025931 | Ga0207644_10018193 | Ga0207644_100181933 | 199 |
| 669 | 3300025931 | Ga0207644_10062431 | Ga0207644_100624312 | 199 |
| 670 | 3300025931 | Ga0207644_10320097 | Ga0207644_103200973 | 199 |
| 671 | 3300025932 | Ga0207690_10000137 | Ga0207690_1000013724 | 199 |
| 672 | 3300025932 | Ga0207690_10020306 | Ga0207690_100203064 | 199 |
| 673 | 3300025933 | Ga0207706_10010775 | Ga0207706_100107752 | 199 |
| 674 | 3300025933 | Ga0207706_10056164 | Ga0207706_100561644 | 199 |
| 675 | 3300025933 | Ga0207706_10113807 | Ga0207706_101138073 | 199 |
| 676 | 3300025934 | Ga0207686_10001872 | Ga0207686_100018727 | 199 |
| 677 | 3300025934 | Ga0207686_10364711 | Ga0207686_103647111 | 199 |
| 678 | 3300025935 | Ga0207709_10000220 | Ga0207709_1000022042 | 199 |
| 679 | 3300025935 | Ga0207709_10008968 | Ga0207709_100089683 | 199 |
| 680 | 3300025935 | Ga0207709_10361788 | Ga0207709_103617882 | 199 |
| 681 | 3300025935 | Ga0207709_10658941 | Ga0207709_106589411 | 199 |
| 682 | 3300025936 | Ga0207670_10000323 | Ga0207670_100003237 | 199 |
| 683 | 3300025936 | Ga0207670_10109615 | Ga0207670_101096152 | 199 |
| 684 | 3300025937 | Ga0207669_10000005 | Ga0207669_10000005126 | 199 |
| 685 | 3300025937 | Ga0207669_10029285 | Ga0207669_100292853 | 199 |
| 686 | 3300025937 | Ga0207669_10033772 | Ga0207669_100337723 | 199 |
| 687 | 3300025938 | Ga0207704_10000060 | Ga0207704_1000006027 | 199 |
| 688 | 3300025938 | Ga0207704_10017052 | Ga0207704_100170522 | 199 |
| 689 | 3300025938 | Ga0207704_10313975 | Ga0207704_103139752 | 199 |
| 690 | 3300025939 | Ga0207665_10000210 | Ga0207665_1000021043 | 199 |
| 691 | 3300025940 | Ga0207691_10001272 | Ga0207691_100012727 | 199 |
| 692 | 3300025941 | Ga0207711_10011312 | Ga0207711_100113122 | 199 |
| 693 | 3300025941 | Ga0207711_10016725 | Ga0207711_100167252 | 199 |
| 694 | 3300025941 | Ga0207711_10031220 | Ga0207711_100312203 | 199 |
| 695 | 3300025941 | Ga0207711_10057776 | Ga0207711_100577763 | 199 |
| 696 | 3300025942 | Ga0207689_10000053 | Ga0207689_1000005324 | 199 |
| 697 | 3300025942 | Ga0207689_10033493 | Ga0207689_100334933 | 199 |
| 698 | 3300025944 | Ga0207661_10000036 | Ga0207661_10000036139 | 199 |
| 699 | 3300025945 | Ga0207679_10000060 | Ga0207679_1000006050 | 199 |
| 700 | 3300025945 | Ga0207679_10259210 | Ga0207679_102592102 | 199 |
| 701 | 3300025945 | Ga0207679_10486478 | Ga0207679_104864782 | 199 |
| 702 | 3300025945 | Ga0207679_10728592 | Ga0207679_107285921 | 199 |
| 703 | 3300025949 | Ga0207667_10024638 | Ga0207667_100246388 | 199 |
| 704 | 3300025949 | Ga0207667_10045229 | Ga0207667_100452292 | 199 |
| 705 | 3300025949 | Ga0207667_10263521 | Ga0207667_102635213 | 199 |
| 706 | 3300025949 | Ga0207667_10392647 | Ga0207667_103926471 | 199 |
| 707 | 3300025949 | Ga0207667_10618642 | Ga0207667_106186421 | 199 |
| 708 | 3300025960 | Ga0207651_10000014 | Ga0207651_1000001452 | 199 |
| 709 | 3300025960 | Ga0207651_10085220 | Ga0207651_100852201 | 199 |
| 710 | 3300025961 | Ga0207712_10000134 | Ga0207712_1000013471 | 199 |
| 711 | 3300025961 | Ga0207712_10101883 | Ga0207712_101018833 | 199 |
| 712 | 3300025961 | Ga0207712_10713818 | Ga0207712_107138181 | 199 |
| 713 | 3300025972 | Ga0207668_10000350 | Ga0207668_1000035026 | 199 |
| 714 | 3300025972 | Ga0207668_10058222 | Ga0207668_100582222 | 199 |
| 715 | 3300025981 | Ga0207640_10000352 | Ga0207640_1000035214 | 199 |
| 716 | 3300025981 | Ga0207640_10164931 | Ga0207640_101649312 | 199 |
| 717 | 3300025981 | Ga0207640_10308538 | Ga0207640_103085382 | 199 |
| 718 | 3300025986 | Ga0207658_10004967 | Ga0207658_100049676 | 199 |
| 719 | 3300025986 | Ga0207658_10097729 | Ga0207658_100977291 | 199 |
| 720 | 3300025986 | Ga0207658_10646205 | Ga0207658_106462052 | 199 |
| 721 | 3300026023 | Ga0207677_10001126 | Ga0207677_100011267 | 199 |
| 722 | 3300026023 | Ga0207677_10669024 | Ga0207677_106690241 | 199 |
| 723 | 3300026035 | Ga0207703_10001140 | Ga0207703_1000114017 | 199 |
| 724 | 3300026035 | Ga0207703_10005127 | Ga0207703_100051279 | 199 |
| 725 | 3300026035 | Ga0207703_10015688 | Ga0207703_100156885 | 199 |
| 726 | 3300026035 | Ga0207703_10060573 | Ga0207703_100605733 | 199 |
| 727 | 3300026041 | Ga0207639_10000411 | Ga0207639_100004117 | 199 |
| 728 | 3300026041 | Ga0207639_10218915 | Ga0207639_102189152 | 199 |
| 729 | 3300026041 | Ga0207639_11053817 | Ga0207639_110538171 | 199 |
| 730 | 3300026067 | Ga0207678_10000892 | Ga0207678_1000089224 | 199 |
| 731 | 3300026067 | Ga0207678_10014646 | Ga0207678_100146462 | 199 |
| 732 | 3300026067 | Ga0207678_10057977 | Ga0207678_100579772 | 199 |
| 733 | 3300026067 | Ga0207678_10122419 | Ga0207678_101224193 | 199 |
| 734 | 3300026075 | Ga0207708_10002664 | Ga0207708_100026647 | 199 |
| 735 | 3300026075 | Ga0207708_10048230 | Ga0207708_100482304 | 199 |
| 736 | 3300026078 | Ga0207702_10000228 | Ga0207702_1000022844 | 199 |
| 737 | 3300026078 | Ga0207702_10434257 | Ga0207702_104342572 | 199 |
| 738 | 3300026078 | Ga0207702_10924324 | Ga0207702_109243242 | 199 |
| 739 | 3300026088 | Ga0207641_10000664 | Ga0207641_100006647 | 199 |
| 740 | 3300026088 | Ga0207641_10064132 | Ga0207641_100641324 | 199 |
| 741 | 3300026088 | Ga0207641_10333219 | Ga0207641_103332192 | 199 |
| 742 | 3300026088 | Ga0207641_10420855 | Ga0207641_104208552 | 199 |
| 743 | 3300026088 | Ga0207641_11179568 | Ga0207641_111795681 | 199 |
| 744 | 3300026089 | Ga0207648_10001423 | Ga0207648_100014237 | 199 |
| 745 | 3300026089 | Ga0207648_10231977 | Ga0207648_102319772 | 199 |
| 746 | 3300026095 | Ga0207676_10000358 | Ga0207676_100003582 | 199 |
| 747 | 3300026095 | Ga0207676_10004777 | Ga0207676_100047777 | 199 |
| 748 | 3300026116 | Ga0207674_10000314 | Ga0207674_100003142 | 199 |
| 749 | 3300026116 | Ga0207674_10016649 | Ga0207674_100166497 | 199 |
| 750 | 3300026116 | Ga0207674_10159097 | Ga0207674_101590972 | 199 |
| 751 | 3300026116 | Ga0207674_10405397 | Ga0207674_104053972 | 199 |
| 752 | 3300026118 | Ga0207675_100004673 | Ga0207675_1000046739 | 199 |
| 753 | 3300026118 | Ga0207675_100063045 | Ga0207675_1000630452 | 199 |
| 754 | 3300026118 | Ga0207675_100075170 | Ga0207675_1000751704 | 199 |
| 755 | 3300026121 | Ga0207683_10000001 | Ga0207683_10000001251 | 199 |
| 756 | 3300026121 | Ga0207683_10005246 | Ga0207683_100052469 | 199 |
| 757 | 3300026121 | Ga0207683_10005378 | Ga0207683_100053783 | 199 |
| 758 | 3300026142 | Ga0207698_10000999 | Ga0207698_100009999 | 199 |
| 759 | 3300026142 | Ga0207698_10065013 | Ga0207698_100650133 | 199 |
| 760 | 3300027395 | Ga0209996_1004434 | Ga0209996_10044342 | 199 |
| 761 | 3300027424 | Ga0209984_1001890 | Ga0209984_10018903 | 199 |
| 762 | 3300027462 | Ga0210000_1009970 | Ga0210000_10099703 | 199 |
| 763 | 3300027526 | Ga0209968_1016232 | Ga0209968_10162322 | 199 |
| 764 | 3300027543 | Ga0209999_1007612 | Ga0209999_10076123 | 199 |
| 765 | 3300027552 | Ga0209982_1004169 | Ga0209982_10041692 | 199 |
| 766 | 3300027614 | Ga0209970_1018978 | Ga0209970_10189782 | 199 |
| 767 | 3300027617 | Ga0210002_1000546 | Ga0210002_10005462 | 199 |
| 768 | 3300027617 | Ga0210002_1032379 | Ga0210002_10323792 | 199 |
| 769 | 3300027665 | Ga0209983_1015238 | Ga0209983_10152383 | 199 |
| 770 | 3300027665 | Ga0209983_1085077 | Ga0209983_10850771 | 199 |
| 771 | 3300027695 | Ga0209966_1001821 | Ga0209966_10018212 | 199 |
| 772 | 3300027717 | Ga0209998_10001014 | Ga0209998_100010142 | 199 |
| 773 | 3300027717 | Ga0209998_10001223 | Ga0209998_100012236 | 199 |
| 774 | 3300027717 | Ga0209998_10002226 | Ga0209998_100022265 | 199 |
| 775 | 3300027876 | Ga0209974_10003271 | Ga0209974_100032715 | 199 |
| 776 | 3300027876 | Ga0209974_10106402 | Ga0209974_101064021 | 199 |
| 777 | 3300027907 | Ga0207428_10000316 | Ga0207428_1000031647 | 199 |
| 778 | 3300027907 | Ga0207428_10000897 | Ga0207428_1000089727 | 199 |
| 779 | 3300027907 | Ga0207428_10000923 | Ga0207428_1000092326 | 199 |
| 780 | 3300027907 | Ga0207428_10302598 | Ga0207428_103025982 | 199 |
| 781 | 3300028379 | Ga0268266_10011674 | Ga0268266_100116744 | 199 |
| 782 | 3300028380 | Ga0268265_10000146 | Ga0268265_1000014662 | 199 |
| 783 | 3300028380 | Ga0268265_10012031 | Ga0268265_100120315 | 199 |
| 784 | 3300028381 | Ga0268264_10000976 | Ga0268264_100009766 | 199 |
| 785 | 3300028381 | Ga0268264_10202635 | Ga0268264_102026352 | 199 |
| 786 | 3300028381 | Ga0268264_10249514 | Ga0268264_102495142 | 199 |
| 787 | 3300028556 | Ga0265337_1000979 | Ga0265337_10009793 | 199 |
| 788 | 3300028800 | Ga0265338_10100432 | Ga0265338_101004322 | 199 |
| 789 | 3300031235 | Ga0265330_10012738 | Ga0265330_100127382 | 199 |
| 790 | 3300031241 | Ga0265325_10000097 | Ga0265325_1000009737 | 199 |
| 791 | 3300031241 | Ga0265325_10020634 | Ga0265325_100206342 | 199 |
| 792 | 3300031247 | Ga0265340_10027609 | Ga0265340_100276092 | 199 |
| 793 | 3300031249 | Ga0265339_10037773 | Ga0265339_100377731 | 199 |
| 794 | 3300031595 | Ga0265313_10009818 | Ga0265313_100098182 | 199 |
| 795 | 3300031595 | Ga0265313_10036332 | Ga0265313_100363324 | 199 |
| 796 | 3300031665 | Ga0316575_10005354 | Ga0316575_100053544 | 199 |
| 797 | 3300031711 | Ga0265314_10000829 | Ga0265314_1000082932 | 199 |
| 798 | 3300031711 | Ga0265314_10366826 | Ga0265314_103668261 | 199 |
| 799 | 3300031712 | Ga0265342_10029877 | Ga0265342_100298773 | 199 |
| 800 | 3300031712 | Ga0265342_10034349 | Ga0265342_100343491 | 199 |
| 801 | 3300032133 | Ga0316583_10000713 | Ga0316583_100007135 | 199 |
| 802 | 3300034816 | Ga0373930_0000210 | Ga0373930_0000210_2973_3572 | 199 |
| 803 | 3300034817 | Ga0373948_0000429 | Ga0373948_0000429_3096_3695 | 199 |
| 804 | 3300034818 | Ga0373950_0000149 | Ga0373950_0000149_8865_9464 | 199 |
| 805 | 3300034818 | Ga0373950_0010349 | Ga0373950_0010349_812_1465 | 199 |
| 806 | 3300034819 | Ga0373958_0005446 | Ga0373958_0005446_977_1576 | 199 |
| 807 | 3300034820 | Ga0373959_0005882 | Ga0373959_0005882_362_961 | 199 |
| 808 | 3300034957 | Ga0373938_0000214 | Ga0373938_0000214_2411_3010 | 199 |
| 809 | 3300034957 | Ga0373938_0000487 | Ga0373938_0000487_672_1271 | 199 |
| 810 | 3300035083 | Ga0373926_0013860 | Ga0373926_0013860_2092_2691 | 199 |
| 811 | 3300035084 | Ga0373928_0000527 | Ga0373928_0000527_2530_3129 | 199 |
| 812 | 3300035085 | Ga0373929_0001507 | Ga0373929_0001507_2773_3372 | 199 |
| 813 | 3300035085 | Ga0373929_0002034 | Ga0373929_0002034_2897_3496 | 199 |
| 814 | 3300035085 | Ga0373929_0002354 | Ga0373929_0002354_1957_2556 | 199 |
| 815 | 3300035086 | Ga0373934_0046367 | Ga0373934_0046367_771_1370 | 199 |
| 816 | 3300035088 | Ga0373940_0000101 | Ga0373940_0000101_9096_9695 | 199 |
| 817 | 3300035088 | Ga0373940_0008665 | Ga0373940_0008665_1025_1624 | 199 |
| 818 | 3300035088 | Ga0373940_0038487 | Ga0373940_0038487_162_761 | 199 |
| 819 | 3300035089 | Ga0373944_0007027 | Ga0373944_0007027_347_946 | 199 |
| 820 | 3300035089 | Ga0373944_0042024 | Ga0373944_0042024_25_624 | 199 |
| 821 | 3300035090 | Ga0373949_0001142 | Ga0373949_0001142_6559_7158 | 199 |
| 822 | 3300035090 | Ga0373949_0002647 | Ga0373949_0002647_3589_4188 | 199 |
| 823 | 3300035091 | Ga0373951_0000243 | Ga0373951_0000243_7477_8076 | 199 |
| 824 | 3300035091 | Ga0373951_0007521 | Ga0373951_0007521_1311_1910 | 199 |
| 825 | 3300035091 | Ga0373951_0039492 | Ga0373951_0039492_246_845 | 199 |
| 826 | 3300035092 | Ga0373952_0000399 | Ga0373952_0000399_1048_1647 | 199 |
| 827 | 3300035092 | Ga0373952_0000485 | Ga0373952_0000485_2963_3562 | 199 |
| 828 | 3300035092 | Ga0373952_0019099 | Ga0373952_0019099_757_1356 | 199 |
| 829 | 3300035092 | Ga0373952_0053797 | Ga0373952_0053797_25_624 | 199 |
| 830 | 3300035111 | Ga0373923_0002068 | Ga0373923_0002068_121_720 | 199 |
| 831 | 3300035111 | Ga0373923_0023489 | Ga0373923_0023489_874_1473 | 199 |
| 832 | 3300035111 | Ga0373923_0220504 | Ga0373923_0220504_195_794 | 199 |
| 833 | 3300035112 | Ga0373932_0000461 | Ga0373932_0000461_10381_10980 | 199 |
| 834 | 3300035113 | Ga0373936_0022431 | Ga0373936_0022431_625_1224 | 199 |
| 835 | 3300035113 | Ga0373936_0026728 | Ga0373936_0026728_626_1225 | 199 |
| 836 | 3300035113 | Ga0373936_0231403 | Ga0373936_0231403_158_757 | 199 |
| 837 | 3300035114 | Ga0373939_0000710 | Ga0373939_0000710_308_907 | 199 |
| 838 | 3300035114 | Ga0373939_0007703 | Ga0373939_0007703_999_1598 | 199 |
| 839 | 3300035114 | Ga0373939_0024392 | Ga0373939_0024392_579_1178 | 199 |
| 840 | 3300035115 | Ga0373941_0000067 | Ga0373941_0000067_7206_7805 | 199 |
| 841 | 3300035115 | Ga0373941_0002487 | Ga0373941_0002487_555_1154 | 199 |
| 842 | 3300035115 | Ga0373941_0017762 | Ga0373941_0017762_486_1085 | 199 |
| 843 | 3300035115 | Ga0373941_0060405 | Ga0373941_0060405_401_1003 | 199 |
| 844 | 3300035116 | Ga0373945_0002631 | Ga0373945_0002631_3606_4205 | 199 |
| 845 | 3300035116 | Ga0373945_0002786 | Ga0373945_0002786_1351_1950 | 199 |
| 846 | 3300035117 | Ga0373953_0002762 | Ga0373953_0002762_74_673 | 199 |
| 847 | 3300035117 | Ga0373953_0059206 | Ga0373953_0059206_583_1182 | 199 |
| 848 | 3300035117 | Ga0373953_0060854 | Ga0373953_0060854_565_1164 | 199 |
| 849 | 3300035118 | Ga0373954_0006315 | Ga0373954_0006315_4208_4810 | 199 |
| 850 | 3300035118 | Ga0373954_0039933 | Ga0373954_0039933_858_1457 | 199 |
| 851 | 3300035118 | Ga0373954_0081640 | Ga0373954_0081640_934_1533 | 199 |
| 852 | 3300035119 | Ga0373956_0020187 | Ga0373956_0020187_1492_2091 | 199 |
| 853 | 3300035119 | Ga0373956_0031722 | Ga0373956_0031722_1174_1776 | 199 |
| 854 | 3300035119 | Ga0373956_0161385 | Ga0373956_0161385_78_677 | 199 |
| 855 | 3300035120 | Ga0373957_0001485 | Ga0373957_0001485_1518_2120 | 199 |
| 856 | 3300035120 | Ga0373957_0019662 | Ga0373957_0019662_1498_2097 | 199 |
| 857 | 3300035121 | Ga0373960_0001028 | Ga0373960_0001028_3224_3823 | 199 |
| 858 | 3300035121 | Ga0373960_0009902 | Ga0373960_0009902_884_1483 | 199 |
| 859 | 3300035121 | Ga0373960_0035083 | Ga0373960_0035083_760_1359 | 199 |
| 860 | 3300035121 | Ga0373960_0077211 | Ga0373960_0077211_182_781 | 199 |
| 861 | 3300035170 | Ga0373943_0001307 | Ga0373943_0001307_1072_1671 | 199 |
| 862 | 3300035170 | Ga0373943_0006960 | Ga0373943_0006960_2383_2982 | 199 |
| 863 | 3300035172 | Ga0373955_0004746 | Ga0373955_0004746_4342_4944 | 199 |
| 864 | 3300035172 | Ga0373955_0009093 | Ga0373955_0009093_1348_1947 | 199 |
| 865 | 3300035172 | Ga0373955_0099589 | Ga0373955_0099589_876_1475 | 199 |
| 866 | 3300035172 | Ga0373955_0170572 | Ga0373955_0170572_71_670 | 199 |
| 867 | 3300035172 | Ga0373955_0343054 | Ga0373955_0343054_224_826 | 199 |
| 868 | 3300035241 | Ga0373961_0000474 | Ga0373961_0000474_9418_10017 | 199 |
| 869 | 3300035241 | Ga0373961_0003232 | Ga0373961_0003232_767_1366 | 199 |
| 870 | 3300035242 | Ga0373962_0000225 | Ga0373962_0000225_7316_7915 | 199 |
| 871 | 3300035242 | Ga0373962_0001550 | Ga0373962_0001550_1022_1621 | 199 |
| 872 | 3300035242 | Ga0373962_0011626 | Ga0373962_0011626_661_1260 | 199 |
| 873 | 3300035410 | Ga0373924_0039474 | Ga0373924_0039474_1067_1666 | 199 |
| 874 | 3300035410 | Ga0373924_0050401 | Ga0373924_0050401_746_1345 | 199 |
| 875 | 3300035691 | Ga0373931_0000204 | Ga0373931_0000204_17205_17804 | 199 |
| 876 | 3300035691 | Ga0373931_0001800 | Ga0373931_0001800_3227_3826 | 199 |
| 877 | 3300035691 | Ga0373931_0007564 | Ga0373931_0007564_678_1277 | 199 |
| 878 | 3300035691 | Ga0373931_0368068 | Ga0373931_0368068_58_657 | 199 |
| 879 | 3300035691 | Ga0373931_0476868 | Ga0373931_0476868_180_779 | 199 |
| 880 | 3300035692 | Ga0373935_0019987 | Ga0373935_0019987_2033_2632 | 199 |
| 881 | 3300035692 | Ga0373935_0067496 | Ga0373935_0067496_1474_2073 | 199 |
| 882 | 3300035692 | Ga0373935_0165611 | Ga0373935_0165611_365_964 | 199 |
| 883 | 3300035692 | Ga0373935_0476239 | Ga0373935_0476239_285_884 | 199 |
| 884 | 3300035695 | Ga0373927_0391626 | Ga0373927_0391626_47_646 | 199 |
| 885 | 3300035724 | Ga0373933_0002804 | Ga0373933_0002804_80_679 | 199 |
| 886 | 3300035724 | Ga0373933_0004059 | Ga0373933_0004059_5356_5955 | 199 |
| 887 | 3300035724 | Ga0373933_0008656 | Ga0373933_0008656_4927_5526 | 199 |
| 888 | 3300035724 | Ga0373933_0009970 | Ga0373933_0009970_3805_4407 | 199 |
| 889 | 3300035724 | Ga0373933_0181557 | Ga0373933_0181557_533_1135 | 199 |
| 890 | 3300036401 | Ga0373937_0013055 | Ga0373937_0013055_624_1223 | 199 |
| 891 | 3300036401 | Ga0373937_0029608 | Ga0373937_0029608_681_1283 | 199 |
| 892 | 3300036401 | Ga0373937_0045711 | Ga0373937_0045711_226_825 | 199 |
| 893 | 3300036401 | Ga0373937_0089164 | Ga0373937_0089164_319_918 | 199 |
| 894 | 3300036401 | Ga0373937_0285934 | Ga0373937_0285934_510_1109 | 199 |
| 895 | 3300037068 | Ga0373925_0012284 | Ga0373925_0012284_3793_4392 | 199 |
| 896 | 3300037068 | Ga0373925_0027312 | Ga0373925_0027312_2924_3523 | 199 |
| 897 | 3300037068 | Ga0373925_0028900 | Ga0373925_0028900_102_701 | 199 |
| 898 | 3300037068 | Ga0373925_0345948 | Ga0373925_0345948_227_826 | 199 |
| 899 | 3300042001 | Ga0439441_000656 | Ga0439441_000656_1237_1836 | 199 |
| 900 | 3300042012 | Ga0439455_0020196 | Ga0439455_0020196_728_1327 | 199 |
| 901 | 3300042439 | Ga0439464_0042680 | Ga0439464_0042680_447_1046 | 199 |
| 902 | 3300042461 | Ga0439460_0033457 | Ga0439460_0033457_499_1098 | 199 |
| 903 | 3300042993 | Ga0439440_0023919 | Ga0439440_0023919_686_1285 | 199 |
| 904 | 3300044694 | Ga0466963_0091724 | Ga0466963_0091724_29_631 | 199 |
| 905 | 3300045051 | Ga0451576_0020613 | Ga0451576_0020613_4567_5166 | 199 |
| 906 | 3300045976 | Ga0466967_0263209 | Ga0466967_0263209_527_1129 | 199 |
| 907 | 3300046454 | Ga0495592_0006121 | Ga0495592_0006121_2522_3121 | 199 |
| 908 | 3300046454 | Ga0495592_0014824 | Ga0495592_0014824_2315_2914 | 199 |
| 909 | 3300046455 | Ga0495603_0017070 | Ga0495603_0017070_1551_2150 | 199 |
| 910 | 3300046455 | Ga0495603_0032483 | Ga0495603_0032483_1648_2247 | 199 |
| 911 | 3300046455 | Ga0495603_0061336 | Ga0495603_0061336_80_679 | 199 |
| 912 | 3300046459 | Ga0495629_0000485 | Ga0495629_0000485_22942_23541 | 199 |
| 913 | 3300046459 | Ga0495629_0064402 | Ga0495629_0064402_353_952 | 199 |
| 914 | 3300046461 | Ga0495641_0076207 | Ga0495641_0076207_226_825 | 199 |
| 915 | 3300046462 | Ga0495651_0070438 | Ga0495651_0070438_383_982 | 199 |
| 916 | 3300046462 | Ga0495651_0084304 | Ga0495651_0084304_1110_1709 | 199 |
| 917 | 3300046462 | Ga0495651_0102731 | Ga0495651_0102731_433_1032 | 199 |
| 918 | 3300046462 | Ga0495651_0131734 | Ga0495651_0131734_204_803 | 199 |
| 919 | 3300046463 | Ga0495653_0012478 | Ga0495653_0012478_4927_5526 | 199 |
| 920 | 3300046472 | Ga0495580_0043224 | Ga0495580_0043224_2415_3014 | 199 |
| 921 | 3300046472 | Ga0495580_0067968 | Ga0495580_0067968_1842_2441 | 199 |
| 922 | 3300046473 | Ga0495582_0010176 | Ga0495582_0010176_2521_3120 | 199 |
| 923 | 3300046473 | Ga0495582_0025877 | Ga0495582_0025877_744_1343 | 199 |
| 924 | 3300046475 | Ga0495639_0229392 | Ga0495639_0229392_90_689 | 199 |
| 925 | 3300046476 | Ga0495662_0004378 | Ga0495662_0004378_2297_2896 | 199 |
| 926 | 3300046476 | Ga0495662_0061907 | Ga0495662_0061907_575_1174 | 199 |
| 927 | 3300046476 | Ga0495662_0260393 | Ga0495662_0260393_155_754 | 199 |
| 928 | 3300046477 | Ga0495664_0004210 | Ga0495664_0004210_4025_4624 | 199 |
| 929 | 3300046477 | Ga0495664_0012302 | Ga0495664_0012302_2312_2911 | 199 |
| 930 | 3300046477 | Ga0495664_0029424 | Ga0495664_0029424_487_1086 | 199 |
| 931 | 3300046477 | Ga0495664_0071505 | Ga0495664_0071505_296_895 | 199 |
| 932 | 3300046491 | Ga0495584_0007346 | Ga0495584_0007346_5032_5631 | 199 |
| 933 | 3300046491 | Ga0495584_0042546 | Ga0495584_0042546_1464_2063 | 199 |
| 934 | 3300046492 | Ga0495585_0000734 | Ga0495585_0000734_6871_7470 | 199 |
| 935 | 3300046499 | Ga0495594_0006008 | Ga0495594_0006008_4091_4690 | 199 |
| 936 | 3300046499 | Ga0495594_0029074 | Ga0495594_0029074_707_1306 | 199 |
| 937 | 3300046499 | Ga0495594_0086067 | Ga0495594_0086067_774_1373 | 199 |
| 938 | 3300046501 | Ga0495607_0005042 | Ga0495607_0005042_3590_4189 | 199 |
| 939 | 3300046511 | Ga0495608_0001184 | Ga0495608_0001184_6009_6608 | 199 |
| 940 | 3300046511 | Ga0495608_0015967 | Ga0495608_0015967_4441_5040 | 199 |
| 941 | 3300046514 | Ga0495618_0015523 | Ga0495618_0015523_2384_2983 | 199 |
| 942 | 3300046514 | Ga0495618_0049089 | Ga0495618_0049089_1459_2058 | 199 |
| 943 | 3300046516 | Ga0495628_0004412 | Ga0495628_0004412_3008_3607 | 199 |
| 944 | 3300046516 | Ga0495628_0025451 | Ga0495628_0025451_2569_3168 | 199 |
| 945 | 3300046516 | Ga0495628_0025562 | Ga0495628_0025562_2362_2961 | 199 |
| 946 | 3300046517 | Ga0495630_0032755 | Ga0495630_0032755_1670_2269 | 199 |
| 947 | 3300046517 | Ga0495630_0040411 | Ga0495630_0040411_2285_2884 | 199 |
| 948 | 3300046517 | Ga0495630_0251395 | Ga0495630_0251395_397_996 | 199 |
| 949 | 3300046517 | Ga0495630_0959304 | Ga0495630_0959304_23_622 | 199 |
| 950 | 3300046523 | Ga0495644_0000828 | Ga0495644_0000828_4583_5182 | 199 |
| 951 | 3300046525 | Ga0495663_0005863 | Ga0495663_0005863_1527_2126 | 199 |
| 952 | 3300046526 | Ga0495666_0014716 | Ga0495666_0014716_2527_3126 | 199 |
| 953 | 3300046526 | Ga0495666_0027794 | Ga0495666_0027794_160_759 | 199 |
| 954 | 3300046529 | Ga0495652_0004969 | Ga0495652_0004969_1419_2018 | 199 |
| 955 | 3300046529 | Ga0495652_0010574 | Ga0495652_0010574_2250_2849 | 199 |
| 956 | 3300046529 | Ga0495652_0051717 | Ga0495652_0051717_381_980 | 199 |
| 957 | 3300046529 | Ga0495652_0115826 | Ga0495652_0115826_644_1246 | 199 |
| 958 | 3300046531 | Ga0495665_0002225 | Ga0495665_0002225_8187_8786 | 199 |
| 959 | 3300046531 | Ga0495665_0200322 | Ga0495665_0200322_270_869 | 199 |
| 960 | 3300046533 | Ga0495640_0018787 | Ga0495640_0018787_1667_2266 | 199 |
| 961 | 3300046533 | Ga0495640_0033111 | Ga0495640_0033111_2695_3294 | 199 |
| 962 | 3300046533 | Ga0495640_0036221 | Ga0495640_0036221_1662_2261 | 199 |
| 963 | 3300046535 | Ga0495586_0026174 | Ga0495586_0026174_586_1185 | 199 |
| 964 | 3300046535 | Ga0495586_0032495 | Ga0495586_0032495_34_633 | 199 |
| 965 | 3300046536 | Ga0495587_0017832 | Ga0495587_0017832_3689_4288 | 199 |
| 966 | 3300046536 | Ga0495587_0055108 | Ga0495587_0055108_1639_2238 | 199 |
| 967 | 3300046538 | Ga0495609_0017622 | Ga0495609_0017622_929_1528 | 199 |
| 968 | 3300046543 | Ga0495645_0008947 | Ga0495645_0008947_1685_2284 | 199 |
| 969 | 3300046543 | Ga0495645_0017944 | Ga0495645_0017944_635_1234 | 199 |
| 970 | 3300046543 | Ga0495645_0154406 | Ga0495645_0154406_729_1328 | 199 |
| 971 | 3300046557 | Ga0495622_0017962 | Ga0495622_0017962_1026_1625 | 199 |
| 972 | 3300046558 | Ga0495633_0002950 | Ga0495633_0002950_8463_9062 | 199 |
| 973 | 3300046559 | Ga0495667_0003221 | Ga0495667_0003221_8871_9470 | 199 |
| 974 | 3300046559 | Ga0495667_0015894 | Ga0495667_0015894_1463_2062 | 199 |
| 975 | 3300046559 | Ga0495667_0021566 | Ga0495667_0021566_3715_4314 | 199 |
| 976 | 3300046559 | Ga0495667_0076919 | Ga0495667_0076919_883_1482 | 199 |
| 977 | 3300046648 | Ga0495611_0004234 | Ga0495611_0004234_1065_1664 | 199 |
| 978 | 3300046663 | Ga0495635_0009913 | Ga0495635_0009913_1329_1928 | 199 |
| 979 | 3300046663 | Ga0495635_0021211 | Ga0495635_0021211_1657_2256 | 199 |
| 980 | 3300046663 | Ga0495635_0364505 | Ga0495635_0364505_194_793 | 199 |
| 981 | 3300046665 | Ga0495661_0077965 | Ga0495661_0077965_15_614 | 199 |
| 982 | 3300046675 | Ga0495657_0013292 | Ga0495657_0013292_1746_2345 | 199 |
| 983 | 3300046675 | Ga0495657_0026726 | Ga0495657_0026726_2861_3460 | 199 |
| 984 | 3300046675 | Ga0495657_0036583 | Ga0495657_0036583_349_951 | 199 |
| 985 | 3300046675 | Ga0495657_0107258 | Ga0495657_0107258_1155_1757 | 199 |
| 986 | 3300046678 | Ga0495599_0004093 | Ga0495599_0004093_5773_6372 | 199 |
| 987 | 3300046678 | Ga0495599_0015147 | Ga0495599_0015147_1281_1880 | 199 |
| 988 | 3300046678 | Ga0495599_0029880 | Ga0495599_0029880_1370_1969 | 199 |
| 989 | 3300046679 | Ga0495623_0002124 | Ga0495623_0002124_5466_6065 | 199 |
| 990 | 3300046679 | Ga0495623_0013014 | Ga0495623_0013014_3972_4571 | 199 |
| 991 | 3300046680 | Ga0495646_0016363 | Ga0495646_0016363_2788_3387 | 199 |
| 992 | 3300046680 | Ga0495646_0044110 | Ga0495646_0044110_1810_2409 | 199 |
| 993 | 3300046681 | Ga0495647_0018720 | Ga0495647_0018720_184_783 | 199 |
| 994 | 3300046681 | Ga0495647_0098961 | Ga0495647_0098961_381_980 | 199 |
| 995 | 3300046683 | Ga0495658_0007123 | Ga0495658_0007123_1587_2186 | 199 |
| 996 | 3300046683 | Ga0495658_0009853 | Ga0495658_0009853_1134_1733 | 199 |
| 997 | 3300046683 | Ga0495658_0026369 | Ga0495658_0026369_873_1472 | 199 |
| 998 | 3300046689 | Ga0495613_0169792 | Ga0495613_0169792_771_1370 | 199 |
| 999 | 3300046689 | Ga0495613_0317934 | Ga0495613_0317934_435_1034 | 199 |
| 1000 | 3300046690 | Ga0495624_0005521 | Ga0495624_0005521_1466_2065 | 199 |
| 1001 | 3300046690 | Ga0495624_0069844 | Ga0495624_0069844_527_1126 | 199 |
| 1002 | 3300046690 | Ga0495624_0284805 | Ga0495624_0284805_68_667 | 199 |
| 1003 | 3300046691 | Ga0495670_0001621 | Ga0495670_0001621_650_1249 | 199 |
| 1004 | 3300046692 | Ga0495671_0220583 | Ga0495671_0220583_43_642 | 199 |
| 1005 | 3300046809 | Ga0495600_0016706 | Ga0495600_0016706_2653_3252 | 199 |
| 1006 | 3300046809 | Ga0495600_0075579 | Ga0495600_0075579_1360_1962 | 199 |
| 1007 | 3300046809 | Ga0495600_0094497 | Ga0495600_0094497_475_1074 | 199 |
| 1008 | 3300047315 | Ga0495581_0002320 | Ga0495581_0002320_8201_8800 | 199 |
| 1009 | 3300047315 | Ga0495581_0023391 | Ga0495581_0023391_1514_2113 | 199 |
| 1010 | 3300047317 | Ga0495604_0005566 | Ga0495604_0005566_1826_2425 | 199 |
| 1011 | 3300047317 | Ga0495604_0007478 | Ga0495604_0007478_1244_1843 | 199 |
| 1012 | 3300047317 | Ga0495604_0019133 | Ga0495604_0019133_786_1385 | 199 |
| 1013 | 3300047317 | Ga0495604_0111998 | Ga0495604_0111998_683_1285 | 199 |
| 1014 | 3300047319 | Ga0495674_0009473 | Ga0495674_0009473_1713_2312 | 199 |
| 1015 | 3300047319 | Ga0495674_0024592 | Ga0495674_0024592_3477_4076 | 199 |
| 1016 | 3300047319 | Ga0495674_0105765 | Ga0495674_0105765_1411_2010 | 199 |
| 1017 | 3300047321 | Ga0495676_0071208 | Ga0495676_0071208_127_726 | 199 |
| 1018 | 3300047322 | Ga0495680_0002398 | Ga0495680_0002398_2488_3087 | 199 |
| 1019 | 3300047322 | Ga0495680_0007387 | Ga0495680_0007387_6171_6770 | 199 |
| 1020 | 3300047322 | Ga0495680_0040982 | Ga0495680_0040982_1612_2211 | 199 |
| 1021 | 3300047322 | Ga0495680_0050177 | Ga0495680_0050177_1084_1683 | 199 |
| 1022 | 3300047444 | Ga0495675_0036217 | Ga0495675_0036217_1085_1684 | 199 |
| 1023 | 3300047444 | Ga0495675_0113642 | Ga0495675_0113642_1042_1644 | 199 |
| 1024 | 3300047446 | Ga0495679_069851 | Ga0495679_069851_47_646 | 199 |
| 1025 | 3300047471 | Ga0495684_0004228 | Ga0495684_0004228_10384_10983 | 199 |
| 1026 | 3300047471 | Ga0495684_0193084 | Ga0495684_0193084_30_629 | 199 |
| 1027 | 3300047471 | Ga0495684_0381774 | Ga0495684_0381774_383_982 | 199 |
| 1028 | 3300047673 | Ga0495593_0011971 | Ga0495593_0011971_2918_3517 | 199 |
| 1029 | 3300047673 | Ga0495593_0012764 | Ga0495593_0012764_735_1334 | 199 |
| 1030 | 3300047673 | Ga0495593_0025938 | Ga0495593_0025938_692_1291 | 199 |
| 1031 | 3300048088 | Ga0495602_0027747 | Ga0495602_0027747_3255_3854 | 199 |
| 1032 | 3300048088 | Ga0495602_0060542 | Ga0495602_0060542_1704_2303 | 199 |
| 1033 | 3300048088 | Ga0495602_0259762 | Ga0495602_0259762_239_841 | 199 |
| 1034 | 3300048089 | Ga0495614_0012071 | Ga0495614_0012071_2522_3121 | 199 |
| 1035 | 3300048903 | Ga0496100_0000177 | Ga0496100_0000177_20354_20953 | 199 |
| 1036 | 3300048903 | Ga0496100_0006867 | Ga0496100_0006867_4099_4698 | 199 |
| 1037 | 3300048903 | Ga0496100_0070940 | Ga0496100_0070940_1493_2092 | 199 |
| 1038 | 3300048903 | Ga0496100_0232352 | Ga0496100_0232352_52_651 | 199 |
| 1039 | 3300048904 | Ga0496101_0000180 | Ga0496101_0000180_15380_15979 | 199 |
| 1040 | 3300048904 | Ga0496101_0039291 | Ga0496101_0039291_1077_1676 | 199 |
| 1041 | 3300048904 | Ga0496101_0042835 | Ga0496101_0042835_935_1534 | 199 |
| 1042 | 3300048904 | Ga0496101_0229502 | Ga0496101_0229502_55_654 | 199 |
| 1043 | 3300048905 | Ga0496102_0000607 | Ga0496102_0000607_21899_22498 | 199 |
| 1044 | 3300048905 | Ga0496102_0006549 | Ga0496102_0006549_4464_5063 | 199 |
| 1045 | 3300048905 | Ga0496102_0030810 | Ga0496102_0030810_2277_2876 | 199 |
| 1046 | 3300048905 | Ga0496102_0161797 | Ga0496102_0161797_136_735 | 199 |
| 1047 | 3300048906 | Ga0496103_0000130 | Ga0496103_0000130_21899_22498 | 199 |
| 1048 | 3300048906 | Ga0496103_0007817 | Ga0496103_0007817_4145_4744 | 199 |
| 1049 | 3300048906 | Ga0496103_0038232 | Ga0496103_0038232_806_1405 | 199 |
| 1050 | 3300048907 | Ga0496104_0000289 | Ga0496104_0000289_37663_38262 | 199 |
| 1051 | 3300048907 | Ga0496104_0027792 | Ga0496104_0027792_2751_3350 | 199 |
| 1052 | 3300048907 | Ga0496104_0139519 | Ga0496104_0139519_1349_1948 | 199 |
| 1053 | 3300048907 | Ga0496104_0186264 | Ga0496104_0186264_497_1096 | 199 |
| 1054 | 3300048907 | Ga0496104_0209397 | Ga0496104_0209397_747_1346 | 199 |
| 1055 | 3300048907 | Ga0496104_0827632 | Ga0496104_0827632_131_730 | 199 |
| 1056 | 3300048908 | Ga0496105_0000144 | Ga0496105_0000144_16219_16818 | 199 |
| 1057 | 3300048908 | Ga0496105_0025199 | Ga0496105_0025199_1878_2477 | 199 |
| 1058 | 3300048908 | Ga0496105_0049741 | Ga0496105_0049741_2262_2861 | 199 |
| 1059 | 3300048909 | Ga0496106_0000381 | Ga0496106_0000381_26931_27530 | 199 |
| 1060 | 3300048909 | Ga0496106_0007902 | Ga0496106_0007902_6617_7216 | 199 |
| 1061 | 3300048909 | Ga0496106_0027792 | Ga0496106_0027792_2425_3024 | 199 |
| 1062 | 3300048909 | Ga0496106_0086866 | Ga0496106_0086866_144_743 | 199 |
| 1063 | 3300048909 | Ga0496106_0446136 | Ga0496106_0446136_368_967 | 199 |
| 1064 | 3300048910 | Ga0496107_0001002 | Ga0496107_0001002_15801_16400 | 199 |
| 1065 | 3300048910 | Ga0496107_0005222 | Ga0496107_0005222_4719_5318 | 199 |
| 1066 | 3300048910 | Ga0496107_0015427 | Ga0496107_0015427_3150_3749 | 199 |
| 1067 | 3300048910 | Ga0496107_0161729 | Ga0496107_0161729_916_1515 | 199 |
| 1068 | 3300048911 | Ga0496108_0001153 | Ga0496108_0001153_17796_18395 | 199 |
| 1069 | 3300048911 | Ga0496108_0003419 | Ga0496108_0003419_11767_12366 | 199 |
| 1070 | 3300048911 | Ga0496108_0013287 | Ga0496108_0013287_4017_4616 | 199 |
| 1071 | 3300048911 | Ga0496108_0019246 | Ga0496108_0019246_4328_4927 | 199 |
| 1072 | 3300048911 | Ga0496108_0025933 | Ga0496108_0025933_1781_2380 | 199 |
| 1073 | 3300048911 | Ga0496108_0201008 | Ga0496108_0201008_996_1595 | 199 |
| 1074 | 3300048912 | Ga0496109_0000490 | Ga0496109_0000490_23487_24086 | 199 |
| 1075 | 3300048912 | Ga0496109_0001283 | Ga0496109_0001283_19542_20141 | 199 |
| 1076 | 3300048912 | Ga0496109_0015162 | Ga0496109_0015162_1781_2380 | 199 |
| 1077 | 3300048912 | Ga0496109_0054678 | Ga0496109_0054678_2446_3045 | 199 |
| 1078 | 3300048912 | Ga0496109_0188697 | Ga0496109_0188697_261_860 | 199 |
| 1079 | 3300048913 | Ga0496110_0006458 | Ga0496110_0006458_5840_6439 | 199 |
| 1080 | 3300048913 | Ga0496110_0089756 | Ga0496110_0089756_684_1283 | 199 |
| 1081 | 3300048913 | Ga0496110_0099991 | Ga0496110_0099991_312_911 | 199 |
| 1082 | 3300048913 | Ga0496110_0102603 | Ga0496110_0102603_368_967 | 199 |
| 1083 | 3300048914 | Ga0496111_0017198 | Ga0496111_0017198_4330_4929 | 199 |
| 1084 | 3300048914 | Ga0496111_0024875 | Ga0496111_0024875_462_1061 | 199 |
| 1085 | 3300048914 | Ga0496111_0101084 | Ga0496111_0101084_1290_1889 | 199 |
| 1086 | 3300048914 | Ga0496111_0533303 | Ga0496111_0533303_15_614 | 199 |
| 1087 | 3300048915 | Ga0496112_0015716 | Ga0496112_0015716_1911_2510 | 199 |
| 1088 | 3300048915 | Ga0496112_0024562 | Ga0496112_0024562_3208_3807 | 199 |
| 1089 | 3300048915 | Ga0496112_0243128 | Ga0496112_0243128_602_1201 | 199 |
| 1090 | 3300048916 | Ga0496113_0003541 | Ga0496113_0003541_6161_6760 | 199 |
| 1091 | 3300048916 | Ga0496113_0109941 | Ga0496113_0109941_155_754 | 199 |
| 1092 | 3300048916 | Ga0496113_0269158 | Ga0496113_0269158_368_967 | 199 |
| 1093 | 3300048916 | Ga0496113_0443815 | Ga0496113_0443815_44_643 | 199 |
| 1094 | 3300048917 | Ga0496114_0000973 | Ga0496114_0000973_3613_4212 | 199 |
| 1095 | 3300048917 | Ga0496114_0008867 | Ga0496114_0008867_5557_6156 | 199 |
| 1096 | 3300048917 | Ga0496114_0093052 | Ga0496114_0093052_333_932 | 199 |
| 1097 | 3300048918 | Ga0496115_0000939 | Ga0496115_0000939_11133_11732 | 199 |
| 1098 | 3300048918 | Ga0496115_0052739 | Ga0496115_0052739_970_1569 | 199 |
| 1099 | 3300048918 | Ga0496115_0082814 | Ga0496115_0082814_235_834 | 199 |
| 1100 | 3300048918 | Ga0496115_0083703 | Ga0496115_0083703_1189_1788 | 199 |
| 1101 | 3300048918 | Ga0496115_0175217 | Ga0496115_0175217_1052_1651 | 199 |
| 1102 | 3300048922 | Ga0496119_0372319 | Ga0496119_0372319_32_631 | 199 |
| 1103 | 3300048928 | Ga0496125_0155976 | Ga0496125_0155976_104_703 | 199 |
| 1104 | 3300049571 | Ga0501034_0174585 | Ga0501034_0174585_745_1344 | 199 |
| 1105 | 3300049571 | Ga0501034_0230349 | Ga0501034_0230349_759_1361 | 199 |
| 1106 | 3300049571 | Ga0501034_0383467 | Ga0501034_0383467_265_867 | 199 |
| 1107 | 3300049573 | Ga0501037_0374012 | Ga0501037_0374012_141_740 | 199 |
| 1108 | 3300049581 | Ga0501047_0082204 | Ga0501047_0082204_1600_2202 | 199 |
| 1109 | 3300049581 | Ga0501047_0217227 | Ga0501047_0217227_1029_1628 | 199 |
| 1110 | 3300049586 | Ga0501070_0049525 | Ga0501070_0049525_783_1382 | 199 |
| 1111 | 3300049587 | Ga0501071_0205289 | Ga0501071_0205289_441_1040 | 199 |
| 1112 | 3300049589 | Ga0501073_0242232 | Ga0501073_0242232_368_967 | 199 |
| 1113 | 3300049589 | Ga0501073_0624266 | Ga0501073_0624266_85_684 | 199 |
| 1114 | 3300049590 | Ga0501074_0126660 | Ga0501074_0126660_364_966 | 199 |
| 1115 | 3300049592 | Ga0501076_0013068 | Ga0501076_0013068_1054_1653 | 199 |
| 1116 | 3300049741 | Ga0501079_0355967 | Ga0501079_0355967_426_1025 | 199 |
| 1117 | 3300049742 | Ga0501080_0257833 | Ga0501080_0257833_782_1384 | 199 |
| 1118 | 3300049742 | Ga0501080_0308707 | Ga0501080_0308707_643_1242 | 199 |
| 1119 | 3300049742 | Ga0501080_0363385 | Ga0501080_0363385_505_1107 | 199 |
| 1120 | 3300049742 | Ga0501080_0401714 | Ga0501080_0401714_574_1176 | 199 |
| 1121 | 3300049822 | Ga0501035_0047743 | Ga0501035_0047743_1003_1602 | 199 |
| 1122 | 3300049822 | Ga0501035_0889255 | Ga0501035_0889255_35_637 | 199 |
| 1123 | 3300049823 | Ga0501044_0092944 | Ga0501044_0092944_1632_2231 | 199 |
| 1124 | 3300049823 | Ga0501044_0402588 | Ga0501044_0402588_394_996 | 199 |
| 1125 | 3300049823 | Ga0501044_1025764 | Ga0501044_1025764_25_624 | 199 |
| 1126 | 3300050494 | nmdc:mga06z11_7327_c1 | nmdc:mga06z11_7327_c1_1477_2076 | 199 |
| 1127 | 3300050495 | nmdc:mga04h51_92901_c1 | nmdc:mga04h51_92901_c1_414_1013 | 199 |
| 1128 | 3300050496 | nmdc:mga07m45_168571_c1 | nmdc:mga07m45_168571_c1_322_921 | 199 |
| 1129 | 3300050507 | nmdc:mga05p37_222_c1 | nmdc:mga05p37_222_c1_15853_16452 | 199 |
| 1130 | 3300050507 | nmdc:mga05p37_5864_c1 | nmdc:mga05p37_5864_c1_6749_7348 | 199 |
| 1131 | 3300050508 | nmdc:mga09592_2841_c1 | nmdc:mga09592_2841_c1_5677_6276 | 199 |
| 1132 | 3300050509 | nmdc:mga0qj67_418_c1 | nmdc:mga0qj67_418_c1_14690_15289 | 199 |
| 1133 | 3300050510 | nmdc:mga06r32_1436_c1 | nmdc:mga06r32_1436_c1_10696_11295 | 199 |
| 1134 | 3300050511 | nmdc:mga08y16_1566_c1 | nmdc:mga08y16_1566_c1_8439_9038 | 199 |
| 1135 | 3300050511 | nmdc:mga08y16_41995_c1 | nmdc:mga08y16_41995_c1_577_1176 | 199 |
| 1136 | 3300050511 | nmdc:mga08y16_4988_c1 | nmdc:mga08y16_4988_c1_7702_8301 | 199 |
| 1137 | 3300050511 | nmdc:mga08y16_587_c1 | nmdc:mga08y16_587_c1_10617_11216 | 199 |
| 1138 | 3300050511 | nmdc:mga08y16_799686_c1 | nmdc:mga08y16_799686_c1_218_817 | 199 |
| 1139 | 3300050512 | nmdc:mga0n895_14048_c1 | nmdc:mga0n895_14048_c1_4321_4920 | 199 |
| 1140 | 3300050512 | nmdc:mga0n895_1683_c1 | nmdc:mga0n895_1683_c1_223_822 | 199 |
| 1141 | 3300050512 | nmdc:mga0n895_34469_c1 | nmdc:mga0n895_34469_c1_3294_3893 | 199 |
| 1142 | 3300050512 | nmdc:mga0n895_437_c1 | nmdc:mga0n895_437_c1_6362_6961 | 199 |
| 1143 | 3300050512 | nmdc:mga0n895_471926_c1 | nmdc:mga0n895_471926_c1_580_1179 | 199 |
| 1144 | 3300050513 | nmdc:mga0rr50_93865_c1 | nmdc:mga0rr50_93865_c1_1510_2109 | 199 |
| 1145 | 3300050515 | nmdc:mga0a205_3971_c1 | nmdc:mga0a205_3971_c1_3208_3807 | 199 |
| 1146 | 3300050515 | nmdc:mga0a205_440909_c1 | nmdc:mga0a205_440909_c1_332_931 | 199 |
| 1147 | 3300050515 | nmdc:mga0a205_4474_c1 | nmdc:mga0a205_4474_c1_7101_7700 | 199 |
| 1148 | 3300050515 | nmdc:mga0a205_721199_c1 | nmdc:mga0a205_721199_c1_142_741 | 199 |
| 1149 | 3300053077 | Ga0495601_0000279 | Ga0495601_0000279_24813_25412 | 199 |
| 1150 | 3300053077 | Ga0495601_0000558 | Ga0495601_0000558_9906_10505 | 199 |
| 1151 | 3300053077 | Ga0495601_0002117 | Ga0495601_0002117_7131_7730 | 199 |
| 1152 | 3300053077 | Ga0495601_0002312 | Ga0495601_0002312_799_1401 | 199 |
| 1153 | 3300053077 | Ga0495601_0033559 | Ga0495601_0033559_933_1532 | 199 |
| 1154 | 3300053077 | Ga0495601_0207955 | Ga0495601_0207955_625_1224 | 199 |
| 1155 | 3300053078 | Ga0495612_0001484 | Ga0495612_0001484_5916_6515 | 199 |
| 1156 | 3300053078 | Ga0495612_0003350 | Ga0495612_0003350_1119_1718 | 199 |
| 1157 | 3300053078 | Ga0495612_0012895 | Ga0495612_0012895_1582_2181 | 199 |
| 1158 | 3300053078 | Ga0495612_0017559 | Ga0495612_0017559_992_1594 | 199 |
| 1159 | 3300053078 | Ga0495612_0058377 | Ga0495612_0058377_187_786 | 199 |
| 1160 | 3300053084 | Ga0495595_0002455 | Ga0495595_0002455_2552_3151 | 199 |
| 1161 | 3300053084 | Ga0495595_0003977 | Ga0495595_0003977_46_645 | 199 |
| 1162 | 3300053084 | Ga0495595_0005137 | Ga0495595_0005137_2006_2608 | 199 |
| 1163 | 3300053084 | Ga0495595_0031107 | Ga0495595_0031107_1782_2381 | 199 |
| 1164 | 3300053085 | Ga0495619_0000170 | Ga0495619_0000170_16306_16905 | 199 |
| 1165 | 3300053085 | Ga0495619_0000175 | Ga0495619_0000175_29026_29625 | 199 |
| 1166 | 3300053085 | Ga0495619_0003531 | Ga0495619_0003531_6962_7561 | 199 |
| 1167 | 3300053085 | Ga0495619_0013000 | Ga0495619_0013000_3962_4564 | 199 |
| 1168 | 3300053085 | Ga0495619_0019630 | Ga0495619_0019630_1551_2150 | 199 |
| 1169 | 3300053085 | Ga0495619_0023515 | Ga0495619_0023515_294_893 | 199 |
| 1170 | 3300053085 | Ga0495619_0042668 | Ga0495619_0042668_954_1553 | 199 |
| 1171 | 3300053088 | Ga0500644_0001616 | Ga0500644_0001616_3097_3747 | 199 |
| 1172 | 3300053093 | Ga0500651_0010263 | Ga0500651_0010263_980_1630 | 199 |
| 1173 | 3300053094 | Ga0500566_0137171 | Ga0500566_0137171_650_1249 | 199 |
| 1174 | 3300053125 | Ga0500618_017763 | Ga0500618_017763_230_829 | 199 |
| 1175 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_859433_860083 | 199 |
| 1176 | 3300053730 | Ga0500645_000015 | Ga0500645_000015_28259_28909 | 199 |
| 1177 | 3300054114 | Ga0501084_0291964 | Ga0501084_0291964_743_1342 | 199 |
| 1178 | 3300060353 | Ga0501082_0702057 | Ga0501082_0702057_169_768 | 199 |
| 1179 | 3300061734 | Ga0530510_0452400 | Ga0530510_0452400_28_627 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar