F491199

General Info

Members Datasets Scaffolds Average Seq Length
1173 385 1154 240

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10294576|Ga0070709_102945761
Length 273
Sequence MPARGRAGGPAPAVGAGRCGLTFWRDAREGRIENVLSDSEVQRVLVIAAHPDDVDFSAAGTIAGWTDAGIEVVYCIVTDGDAGGHDDAVPRSEIAPLRRKEQTAAAACVGVSDLRFLGYRDGQVEATLGLRKDLARVIRQVRPDRLVCPSPERNYARIGVSHPDHRAVGSAALDAVYPDARNPYAFGELRTEEGLEPWSVREVWLPGGPVPNRYVDVTGTFDRKVAALRAHESQTGQMDKLEEFLRTRLAAAAATGGLPEGSLAETFQILDTA

Samples

Sample ID Description Type Environment
1 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
2 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
3 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
4 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
5 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
6 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
9 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
10 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
11 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
12 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
13 2891562705 Microbispora tritici MT50 Isolate Unclassified
14 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
15 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
16 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
217 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
227 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
384 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
385 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0.6
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 7.33
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10056762 3300003203 Bacteria 1283
2 rootH2_10041817 3300003320 Bacteria 1818
3 JGI25404J52841_10000650 3300003659 Bacteria 5283
4 Ga0070658_10000873 3300005327 Bacteria 25791
5 Ga0070658_10375750 3300005327 Bacteria 1219
6 Ga0070658_10403280 3300005327 Bacteria 1175
7 Ga0070658_10411448 3300005327 Bacteria 1162
8 Ga0070658_10427271 3300005327 Bacteria 1140
9 Ga0070676_10115376 3300005328 Bacteria 1678
10 Ga0070676_10164378 3300005328 Bacteria 1431
11 Ga0070690_100078306 3300005330 Bacteria 2159
12 Ga0070690_100255004 3300005330 Bacteria 1242
13 Ga0068869_100028764 3300005334 Bacteria 3887
14 Ga0070680_100000250 3300005336 Bacteria 35510
15 Ga0070682_100057475 3300005337 Bacteria 2450
16 Ga0068868_100861606 3300005338 Bacteria 821
17 Ga0070660_100126413 3300005339 Bacteria 2043
18 Ga0070660_100213840 3300005339 Bacteria 1565
19 Ga0070660_100261049 3300005339 Bacteria 1414
20 Ga0070689_100261111 3300005340 Bacteria 1432
21 Ga0070691_10082196 3300005341 Bacteria 1579
22 Ga0070661_100152856 3300005344 Bacteria 1745
23 Ga0070661_100254299 3300005344 Bacteria 1357
24 Ga0070692_10076543 3300005345 Bacteria 1794
25 Ga0070668_100438224 3300005347 Bacteria 1121
26 Ga0070669_100144723 3300005353 Bacteria 1836
27 Ga0070675_100102255 3300005354 Bacteria 2414
28 Ga0070671_100001891 3300005355 Bacteria 16005
29 Ga0070674_100339251 3300005356 Bacteria 1210
30 Ga0070673_100176926 3300005364 Bacteria 1824
31 Ga0070688_100437853 3300005365 Bacteria 975
32 Ga0070659_100041701 3300005366 Bacteria 3588
33 Ga0070667_100074881 3300005367 Bacteria 2889
34 Ga0070667_100130496 3300005367 Bacteria 2193
35 Ga0070709_10058198 3300005434 Bacteria 2450
36 Ga0070709_10059134 3300005434 Bacteria 2433
37 Ga0070709_10067195 3300005434 Bacteria 2301
38 Ga0070709_10087873 3300005434 Bacteria 2043
39 Ga0070709_10102706 3300005434 Bacteria 1907
40 Ga0070709_10294576 3300005434 Bacteria 1183
41 Ga0070714_100001479 3300005435 Bacteria 17130
42 Ga0070714_100009096 3300005435 Bacteria 7791
43 Ga0070714_100017500 3300005435 Bacteria 5807
44 Ga0070714_100059883 3300005435 Bacteria 3266
45 Ga0070714_100101602 3300005435 Bacteria 2534
46 Ga0070714_100206918 3300005435 Bacteria 1797
47 Ga0070713_100006079 3300005436 Bacteria 8323
48 Ga0070713_100106597 3300005436 Bacteria 2436
49 Ga0070713_100143189 3300005436 Bacteria 2119
50 Ga0070713_100161620 3300005436 Bacteria 2000
51 Ga0070713_100228004 3300005436 Bacteria 1692
52 Ga0070713_100246457 3300005436 Bacteria 1628
53 Ga0070713_100538628 3300005436 Bacteria 1105
54 Ga0070710_10000020 3300005437 Bacteria 85562
55 Ga0070710_10019048 3300005437 Bacteria 3542
56 Ga0070710_10048460 3300005437 Bacteria 2373
57 Ga0070710_10055647 3300005437 Bacteria 2236
58 Ga0070710_10090241 3300005437 Bacteria 1806
59 Ga0070711_100007900 3300005439 Bacteria 6486
60 Ga0070711_100098649 3300005439 Bacteria 2121
61 Ga0070711_100108259 3300005439 Bacteria 2036
62 Ga0070711_100151211 3300005439 Bacteria 1750
63 Ga0070711_100181286 3300005439 Bacteria 1612
64 Ga0070711_100194005 3300005439 Bacteria 1563
65 Ga0070711_100204756 3300005439 Unclassified 1525
66 Ga0070705_100137903 3300005440 Bacteria 1601
67 Ga0070705_100216908 3300005440 Bacteria 1322
68 Ga0070705_100319160 3300005440 Bacteria 1121
69 Ga0070700_100100330 3300005441 Bacteria 1906
70 Ga0070700_100352502 3300005441 Bacteria 1091
71 Ga0070708_100017408 3300005445 Bacteria 5993
72 Ga0070708_100050975 3300005445 Bacteria 3667
73 Ga0070708_100192134 3300005445 Bacteria 1909
74 Ga0070708_100210724 3300005445 Bacteria 1820
75 Ga0070663_100122690 3300005455 Bacteria 1964
76 Ga0070663_100226813 3300005455 Bacteria 1469
77 Ga0070663_100406058 3300005455 Bacteria 1115
78 Ga0070663_100413294 3300005455 Bacteria 1105
79 Ga0070678_100092962 3300005456 Bacteria 2318
80 Ga0070678_100442171 3300005456 Bacteria 1137
81 Ga0070678_100485092 3300005456 Bacteria 1088
82 Ga0070678_100508086 3300005456 Bacteria 1064
83 Ga0070662_100052156 3300005457 Bacteria 2956
84 Ga0070706_100003833 3300005467 Bacteria 14699
85 Ga0070706_100007075 3300005467 Bacteria 10563
86 Ga0070706_100008175 3300005467 Bacteria 9761
87 Ga0070706_100052075 3300005467 Bacteria 3779
88 Ga0070706_100097316 3300005467 Bacteria 2733
89 Ga0070706_100101304 3300005467 Bacteria 2677
90 Ga0070706_100206478 3300005467 Bacteria 1834
91 Ga0070706_100243135 3300005467 Bacteria 1680
92 Ga0070706_100270858 3300005467 Bacteria 1585
93 Ga0070706_100299309 3300005467 Bacteria 1501
94 Ga0070706_100307336 3300005467 Unclassified 1479
95 Ga0070707_100000256 3300005468 Bacteria 53538
96 Ga0070707_100003915 3300005468 Bacteria 14013
97 Ga0070707_100012607 3300005468 Bacteria 7896
98 Ga0070707_100020625 3300005468 Bacteria 6219
99 Ga0070707_100132249 3300005468 Bacteria 2426
100 Ga0070707_100168451 3300005468 Bacteria 2134
101 Ga0070707_100214458 3300005468 Bacteria 1876
102 Ga0070707_100311621 3300005468 Bacteria 1530
103 Ga0070707_100725596 3300005468 Bacteria 957
104 Ga0070698_100000292 3300005471 Bacteria 50989
105 Ga0070698_100000333 3300005471 Bacteria 48484
106 Ga0070698_100001168 3300005471 Bacteria 29125
107 Ga0070698_100003058 3300005471 Bacteria 18441
108 Ga0070698_100037912 3300005471 Bacteria 4968
109 Ga0070698_100039511 3300005471 Bacteria 4856
110 Ga0070698_100083329 3300005471 Bacteria 3187
111 Ga0070698_100159215 3300005471 Bacteria 2202
112 Ga0070698_100315991 3300005471 Bacteria 1492
113 Ga0070698_100530810 3300005471 Bacteria 1115
114 Ga0070698_100691201 3300005471 Bacteria 962
115 Ga0070699_100005166 3300005518 Bacteria 11481
116 Ga0070699_100027648 3300005518 Bacteria 4892
117 Ga0070699_100082594 3300005518 Bacteria 2801
118 Ga0070699_100128863 3300005518 Bacteria 2230
119 Ga0070699_100140942 3300005518 Bacteria 2129
120 Ga0070679_100226125 3300005530 Bacteria 1831
121 Ga0070679_100279321 3300005530 Bacteria 1623
122 Ga0070684_100111329 3300005535 Bacteria 2455
123 Ga0070684_100266519 3300005535 Bacteria 1568
124 Ga0070684_100279392 3300005535 Bacteria 1530
125 Ga0070684_100285765 3300005535 Bacteria 1512
126 Ga0070684_100330337 3300005535 Bacteria 1401
127 Ga0070697_100135556 3300005536 Bacteria 2067
128 Ga0068853_100074513 3300005539 Bacteria 2961
129 Ga0070686_100148851 3300005544 Bacteria 1637
130 Ga0070696_100121381 3300005546 Bacteria 1892
131 Ga0070693_100092428 3300005547 Bacteria 1827
132 Ga0070693_100190487 3300005547 Bacteria 1326
133 Ga0070665_100294631 3300005548 Unclassified 1625
134 Ga0070665_100466201 3300005548 Bacteria 1273
135 Ga0070665_100746182 3300005548 Bacteria 992
136 Ga0068855_100010590 3300005563 Bacteria 11116
137 Ga0068855_100011828 3300005563 Bacteria 10551
138 Ga0068855_100163774 3300005563 Bacteria 2522
139 Ga0068855_100188899 3300005563 Bacteria 2325
140 Ga0068855_100240344 3300005563 Bacteria 2024
141 Ga0070664_100111903 3300005564 Bacteria 2383
142 Ga0070664_100503452 3300005564 Bacteria 1116
143 Ga0070664_100541855 3300005564 Bacteria 1075
144 Ga0068854_100003602 3300005578 Bacteria 9690
145 Ga0068854_100021085 3300005578 Bacteria 4418
146 Ga0068854_100110153 3300005578 Bacteria 2076
147 Ga0068856_100019202 3300005614 Bacteria 6635
148 Ga0068856_100028186 3300005614 Bacteria 5482
149 Ga0068856_100081628 3300005614 Bacteria 3208
150 Ga0068856_100180970 3300005614 Bacteria 2121
151 Ga0068856_100944262 3300005614 Bacteria 881
152 Ga0070702_100065314 3300005615 Bacteria 2131
153 Ga0070702_100445884 3300005615 Bacteria 938
154 Ga0068852_100081138 3300005616 Bacteria 2878
155 Ga0068852_100155928 3300005616 Bacteria 2127
156 Ga0068852_100278223 3300005616 Bacteria 1612
157 Ga0068852_100281208 3300005616 Bacteria 1604
158 Ga0068852_100670007 3300005616 Bacteria 1046
159 Ga0068859_100071345 3300005617 Bacteria 3509
160 Ga0068864_100078054 3300005618 Bacteria 2897
161 Ga0068864_100229081 3300005618 Bacteria 1718
162 Ga0068864_100301129 3300005618 Bacteria 1501
163 Ga0068864_100596394 3300005618 Bacteria 1071
164 Ga0068866_10201750 3300005718 Bacteria 1189
165 Ga0068861_100102389 3300005719 Bacteria 2280
166 Ga0068861_100670025 3300005719 Bacteria 960
167 Ga0068861_100958797 3300005719 Bacteria 814
168 Ga0068870_10106007 3300005840 Bacteria 1597
169 Ga0068863_100092480 3300005841 Bacteria 2869
170 Ga0068863_100208426 3300005841 Bacteria 1882
171 Ga0068858_100127173 3300005842 Bacteria 2387
172 Ga0068858_100157406 3300005842 Bacteria 2138
173 Ga0068858_100480948 3300005842 Bacteria 1198
174 Ga0068860_100060801 3300005843 Bacteria 3590
175 Ga0068862_100213252 3300005844 Bacteria 1745
176 Ga0081455_10000986 3300005937 Bacteria 36239
177 Ga0081455_10058026 3300005937 Bacteria 3278
178 Ga0081455_10087175 3300005937 Bacteria 2540
179 Ga0081455_10151247 3300005937 Bacteria 1789
180 Ga0081540_1000347 3300005983 Bacteria 46724
181 Ga0081540_1001397 3300005983 Bacteria 20920
182 Ga0081539_10000124 3300005985 Bacteria 180973
183 Ga0081539_10005050 3300005985 Bacteria 13864
184 Ga0070717_10003811 3300006028 Bacteria 10846
185 Ga0070717_10012249 3300006028 Bacteria 6540
186 Ga0070717_10032502 3300006028 Bacteria 4205
187 Ga0070717_10035438 3300006028 Bacteria 4039
188 Ga0070717_10036952 3300006028 Bacteria 3964
189 Ga0070717_10041719 3300006028 Bacteria 3741
190 Ga0070717_10045906 3300006028 Bacteria 3573
191 Ga0070717_10108166 3300006028 Bacteria 2369
192 Ga0070717_10141585 3300006028 Bacteria 2075
193 Ga0070717_10174251 3300006028 Bacteria 1872
194 Ga0070717_10177790 3300006028 Bacteria 1853
195 Ga0070717_10286661 3300006028 Bacteria 1461
196 Ga0070717_10380304 3300006028 Bacteria 1266
197 Ga0070717_10434754 3300006028 Bacteria 1181
198 Ga0070717_10592651 3300006028 Bacteria 1005
199 Ga0070717_10720377 3300006028 Bacteria 907
200 Ga0075365_10057927 3300006038 Unclassified 2578
201 Ga0070715_10007893 3300006163 Bacteria 3683
202 Ga0070715_10015951 3300006163 Bacteria 2811
203 Ga0070715_10017375 3300006163 Bacteria 2723
204 Ga0070715_10027155 3300006163 Bacteria 2284
205 Ga0070715_10085555 3300006163 Bacteria 1440
206 Ga0070715_10087639 3300006163 Bacteria 1426
207 Ga0070716_100001346 3300006173 Bacteria 10874
208 Ga0070716_100066296 3300006173 Bacteria 2105
209 Ga0070716_100068831 3300006173 Bacteria 2072
210 Ga0070716_100070590 3300006173 Bacteria 2051
211 Ga0070716_100125569 3300006173 Bacteria 1613
212 Ga0070716_100354744 3300006173 Bacteria 1039
213 Ga0070712_100004001 3300006175 Bacteria 9059
214 Ga0070712_100036738 3300006175 Bacteria 3335
215 Ga0070712_100182458 3300006175 Bacteria 1636
216 Ga0070712_100203933 3300006175 Bacteria 1555
217 Ga0070712_100233680 3300006175 Bacteria 1461
218 Ga0070712_100583432 3300006175 Bacteria 945
219 Ga0097621_100049061 3300006237 Bacteria 3428
220 Ga0097621_100364605 3300006237 Bacteria 1288
221 Ga0068871_100084391 3300006358 Bacteria 2636
222 Ga0068871_100346781 3300006358 Bacteria 1312
223 Ga0075428_100076521 3300006844 Bacteria 3654
224 Ga0075428_100112994 3300006844 Bacteria 2959
225 Ga0075428_100246994 3300006844 Unclassified 1924
226 Ga0075430_100019365 3300006846 Bacteria 5787
227 Ga0075431_100106479 3300006847 Bacteria 2893
228 Ga0075433_10099722 3300006852 Bacteria 2571
229 Ga0075433_10411052 3300006852 Bacteria 1194
230 Ga0075434_100015888 3300006871 Bacteria 7228
231 Ga0075434_100227337 3300006871 Bacteria 1885
232 Ga0075434_100236314 3300006871 Bacteria 1847
233 Ga0075429_100026490 3300006880 Bacteria 5035
234 Ga0075429_100070830 3300006880 Bacteria 3036
235 Ga0068865_100035766 3300006881 Bacteria 3344
236 Ga0068865_100368315 3300006881 Bacteria 1168
237 Ga0068865_100464962 3300006881 Bacteria 1048
238 Ga0075436_100023153 3300006914 Bacteria 4267
239 Ga0075436_100077556 3300006914 Bacteria 2301
240 Ga0075436_100149263 3300006914 Bacteria 1644
241 Ga0075436_100162479 3300006914 Bacteria 1575
242 Ga0075436_100164945 3300006914 Bacteria 1563
243 Ga0075436_100244799 3300006914 Bacteria 1276
244 Ga0097620_100071349 3300006931 Bacteria 3509
245 Ga0075435_100025231 3300007076 Bacteria 4625
246 Ga0075435_100230238 3300007076 Bacteria 1574
247 Ga0075435_100245189 3300007076 Bacteria 1524
248 Ga0075435_100472037 3300007076 Bacteria 1083
249 Ga0075435_100579412 3300007076 Bacteria 972
250 Ga0099795_10037345 3300007788 Bacteria 1709
251 Ga0105251_10032047 3300009011 Bacteria 2623
252 Ga0105250_10053587 3300009092 Bacteria 1618
253 Ga0105240_10018361 3300009093 Bacteria 9394
254 Ga0105240_10069191 3300009093 Bacteria 4370
255 Ga0105240_10098724 3300009093 Bacteria 3555
256 Ga0111539_10030655 3300009094 Bacteria 6538
257 Ga0111539_10102409 3300009094 Bacteria 3361
258 Ga0105245_10013600 3300009098 Bacteria 7090
259 Ga0105245_10021074 3300009098 Bacteria 5717
260 Ga0105245_10138453 3300009098 Bacteria 2290
261 Ga0105245_10335338 3300009098 Bacteria 1494
262 Ga0105245_10856641 3300009098 Bacteria 949
263 Ga0105247_10057469 3300009101 Bacteria 2405
264 Ga0105247_10077209 3300009101 Bacteria 2093
265 Ga0114129_10019257 3300009147 Bacteria 9722
266 Ga0114129_10203291 3300009147 Bacteria 2681
267 Ga0114129_10366700 3300009147 Bacteria 1905
268 Ga0105243_10124866 3300009148 Bacteria 2175
269 Ga0105243_10200438 3300009148 Bacteria 1750
270 Ga0105243_10264051 3300009148 Bacteria 1543
271 Ga0105243_10531517 3300009148 Bacteria 1120
272 Ga0105241_10003252 3300009174 Bacteria 12087
273 Ga0105241_10810061 3300009174 Bacteria 863
274 Ga0105242_10039533 3300009176 Bacteria 3797
275 Ga0105242_10254012 3300009176 Bacteria 1585
276 Ga0105248_10364293 3300009177 Bacteria 1627
277 Ga0105248_10939263 3300009177 Bacteria 977
278 Ga0105237_10237987 3300009545 Bacteria 1822
279 Ga0105238_10023373 3300009551 Bacteria 6300
280 Ga0105238_10297312 3300009551 Bacteria 1598
281 Ga0105249_10011734 3300009553 Bacteria 7703
282 Ga0105249_10054023 3300009553 Bacteria 3672
283 Ga0105029_101993 3300009984 Bacteria 1305
284 Ga0105239_10169841 3300010375 Bacteria 2438
285 Ga0105239_10298816 3300010375 Bacteria 1813
286 Ga0105239_10321144 3300010375 Bacteria 1746
287 Ga0105246_10071452 3300011119 Bacteria 2444
288 Ga0105246_10100691 3300011119 Bacteria 2103
289 Ga0105246_10253651 3300011119 Bacteria 1398
290 Ga0157320_1006499 3300012481 Bacteria 811
291 Ga0157338_1003066 3300012515 Bacteria 1358
292 Ga0157371_10039265 3300013102 Bacteria 3384
293 Ga0157371_10623275 3300013102 Bacteria 803
294 Ga0157370_10002163 3300013104 Bacteria 23996
295 Ga0157370_10336482 3300013104 Bacteria 1391
296 Ga0157369_10002312 3300013105 Bacteria 22937
297 Ga0157369_10935719 3300013105 Bacteria 888
298 Ga0157374_10232293 3300013296 Bacteria 1812
299 Ga0157374_10498788 3300013296 Bacteria 1222
300 Ga0157378_10269351 3300013297 Bacteria 1637
301 Ga0163162_10843403 3300013306 Bacteria 1032
302 Ga0163162_11235580 3300013306 Bacteria 848
303 Ga0157372_10353996 3300013307 Bacteria 1711
304 Ga0157375_10021555 3300013308 Bacteria 5911
305 Ga0157375_10022472 3300013308 Bacteria 5804
306 Ga0157375_10036370 3300013308 Bacteria 4710
307 Ga0157375_10119685 3300013308 Bacteria 2741
308 Ga0157375_10249144 3300013308 Bacteria 1937
309 Ga0163163_10013229 3300014325 Bacteria 7546
310 Ga0163163_10054650 3300014325 Bacteria 3945
311 Ga0163163_10080825 3300014325 Bacteria 3251
312 Ga0163163_10323645 3300014325 Bacteria 1595
313 Ga0157380_10366883 3300014326 Bacteria 1353
314 Ga0157380_10583369 3300014326 Bacteria 1103
315 Ga0157380_10785431 3300014326 Bacteria 967
316 Ga0157379_10018900 3300014968 Bacteria 6080
317 Ga0157379_10194533 3300014968 Bacteria 1833
318 Ga0157379_10328405 3300014968 Bacteria 1397
319 Ga0157376_10009414 3300014969 Bacteria 7093
320 Ga0157376_10160513 3300014969 Bacteria 2037
321 Ga0157376_10382239 3300014969 Bacteria 1357
322 Ga0157376_10696784 3300014969 Bacteria 1020
323 Ga0163161_10034035 3300017792 Bacteria 3643
324 Ga0197907_10524558 3300020069 Bacteria 949
325 Ga0206356_11448904 3300020070 Bacteria 1727
326 Ga0206350_11111617 3300020080 Bacteria 1003
327 Ga0206354_11026499 3300020081 Bacteria 1039
328 Ga0206353_11912876 3300020082 Bacteria 960
329 Ga0213876_10017417 3300021384 Bacteria 3794
330 Ga0213875_10000593 3300021388 Bacteria 29253
331 Ga0213875_10012651 3300021388 Bacteria 4158
332 Ga0213875_10028541 3300021388 Bacteria 2649
333 Ga0213875_10046922 3300021388 Bacteria 2027
334 Ga0213875_10224812 3300021388 Bacteria 884
335 Ga0224712_10004193 3300022467 Bacteria 3859
336 Ga0224572_1001665 3300024225 Bacteria 3363
337 Ga0224572_1008184 3300024225 Bacteria 1930
338 Ga0207656_10119271 3300025321 Bacteria 1227
339 Ga0207692_10002126 3300025898 Bacteria 7564
340 Ga0207692_10016925 3300025898 Bacteria 3240
341 Ga0207692_10278843 3300025898 Bacteria 1011
342 Ga0207688_10014603 3300025901 Bacteria 4266
343 Ga0207688_10043740 3300025901 Bacteria 2494
344 Ga0207688_10091287 3300025901 Bacteria 1749
345 Ga0207680_10050470 3300025903 Bacteria 2482
346 Ga0207647_10011354 3300025904 Bacteria 6251
347 Ga0207647_10216053 3300025904 Bacteria 1106
348 Ga0207685_10010139 3300025905 Bacteria 2768
349 Ga0207685_10026050 3300025905 Bacteria 2028
350 Ga0207685_10043009 3300025905 Bacteria 1700
351 Ga0207699_10001820 3300025906 Bacteria 10029
352 Ga0207699_10012515 3300025906 Bacteria 4318
353 Ga0207699_10057587 3300025906 Bacteria 2321
354 Ga0207699_10071298 3300025906 Bacteria 2124
355 Ga0207699_10074012 3300025906 Bacteria 2091
356 Ga0207699_10085093 3300025906 Bacteria 1971
357 Ga0207699_10120297 3300025906 Bacteria 1697
358 Ga0207643_10007439 3300025908 Bacteria 5876
359 Ga0207643_10065429 3300025908 Bacteria 2082
360 Ga0207705_10003827 3300025909 Bacteria 11446
361 Ga0207705_10103219 3300025909 Bacteria 2100
362 Ga0207705_10121347 3300025909 Bacteria 1940
363 Ga0207705_10312685 3300025909 Bacteria 1206
364 Ga0207684_10001419 3300025910 Bacteria 25953
365 Ga0207684_10011757 3300025910 Bacteria 7634
366 Ga0207684_10353653 3300025910 Bacteria 1264
367 Ga0207684_10390624 3300025910 Bacteria 1196
368 Ga0207684_10624394 3300025910 Bacteria 919
369 Ga0207654_10009462 3300025911 Bacteria 4948
370 Ga0207654_10158008 3300025911 Bacteria 1462
371 Ga0207707_10262995 3300025912 Bacteria 1497
372 Ga0207695_10003245 3300025913 Bacteria 23143
373 Ga0207695_10007764 3300025913 Bacteria 13582
374 Ga0207671_10000084 3300025914 Bacteria 143562
375 Ga0207693_10006708 3300025915 Bacteria 9504
376 Ga0207693_10024565 3300025915 Bacteria 4780
377 Ga0207693_10028558 3300025915 Bacteria 4408
378 Ga0207693_10049527 3300025915 Bacteria 3299
379 Ga0207693_10049719 3300025915 Bacteria 3293
380 Ga0207693_10083802 3300025915 Bacteria 2498
381 Ga0207693_10110958 3300025915 Bacteria 2151
382 Ga0207693_10141649 3300025915 Bacteria 1890
383 Ga0207693_10210924 3300025915 Bacteria 1527
384 Ga0207693_10316673 3300025915 Bacteria 1221
385 Ga0207663_10004402 3300025916 Bacteria 6992
386 Ga0207663_10052859 3300025916 Bacteria 2535
387 Ga0207663_10114102 3300025916 Bacteria 1838
388 Ga0207663_10138638 3300025916 Bacteria 1691
389 Ga0207663_10273736 3300025916 Bacteria 1251
390 Ga0207663_10293890 3300025916 Bacteria 1211
391 Ga0207663_10308349 3300025916 Bacteria 1185
392 Ga0207660_10217108 3300025917 Bacteria 1499
393 Ga0207662_10016343 3300025918 Bacteria 4188
394 Ga0207657_10014199 3300025919 Bacteria 7788
395 Ga0207657_10066075 3300025919 Bacteria 3080
396 Ga0207657_10111971 3300025919 Bacteria 2253
397 Ga0207652_10041753 3300025921 Bacteria 3901
398 Ga0207652_10045698 3300025921 Bacteria 3733
399 Ga0207652_10714537 3300025921 Bacteria 893
400 Ga0207646_10018804 3300025922 Bacteria 6436
401 Ga0207646_10023902 3300025922 Bacteria 5607
402 Ga0207646_10032929 3300025922 Bacteria 4688
403 Ga0207646_10043043 3300025922 Bacteria 4056
404 Ga0207646_10083847 3300025922 Bacteria 2851
405 Ga0207646_10088253 3300025922 Bacteria 2775
406 Ga0207646_10252090 3300025922 Bacteria 1595
407 Ga0207646_10344410 3300025922 Bacteria 1347
408 Ga0207646_10459428 3300025922 Bacteria 1148
409 Ga0207694_10000838 3300025924 Bacteria 27340
410 Ga0207694_10380683 3300025924 Bacteria 1171
411 Ga0207650_10203611 3300025925 Bacteria 1586
412 Ga0207659_10673889 3300025926 Bacteria 885
413 Ga0207687_10007838 3300025927 Bacteria 7002
414 Ga0207687_10057736 3300025927 Bacteria 2728
415 Ga0207687_10104496 3300025927 Bacteria 2091
416 Ga0207700_10000310 3300025928 Bacteria 28632
417 Ga0207700_10017584 3300025928 Bacteria 4781
418 Ga0207700_10043317 3300025928 Bacteria 3305
419 Ga0207700_10075550 3300025928 Bacteria 2611
420 Ga0207700_10098953 3300025928 Bacteria 2321
421 Ga0207700_10196595 3300025928 Bacteria 1697
422 Ga0207700_10261065 3300025928 Bacteria 1483
423 Ga0207700_10278050 3300025928 Bacteria 1439
424 Ga0207700_10320897 3300025928 Bacteria 1342
425 Ga0207700_10353926 3300025928 Bacteria 1279
426 Ga0207700_10354781 3300025928 Bacteria 1278
427 Ga0207700_10423869 3300025928 Bacteria 1169
428 Ga0207700_10434246 3300025928 Bacteria 1155
429 Ga0207700_10545213 3300025928 Bacteria 1029
430 Ga0207700_10629900 3300025928 Bacteria 955
431 Ga0207664_10000526 3300025929 Bacteria 27229
432 Ga0207664_10012144 3300025929 Bacteria 6154
433 Ga0207664_10020860 3300025929 Bacteria 4862
434 Ga0207664_10041475 3300025929 Bacteria 3585
435 Ga0207664_10106881 3300025929 Bacteria 2321
436 Ga0207664_10172575 3300025929 Bacteria 1851
437 Ga0207664_10205258 3300025929 Bacteria 1703
438 Ga0207664_10206660 3300025929 Bacteria 1697
439 Ga0207664_10222742 3300025929 Bacteria 1637
440 Ga0207664_10547264 3300025929 Bacteria 1038
441 Ga0207664_10661220 3300025929 Bacteria 939
442 Ga0207644_10319838 3300025931 Bacteria 1254
443 Ga0207690_10087612 3300025932 Bacteria 2191
444 Ga0207706_10051852 3300025933 Bacteria 3622
445 Ga0207706_10066405 3300025933 Bacteria 3174
446 Ga0207686_10060887 3300025934 Bacteria 2391
447 Ga0207709_10091442 3300025935 Bacteria 1990
448 Ga0207709_10129769 3300025935 Bacteria 1716
449 Ga0207709_10159879 3300025935 Bacteria 1570
450 Ga0207709_10699263 3300025935 Bacteria 811
451 Ga0207669_10100060 3300025937 Bacteria 1914
452 Ga0207669_10306870 3300025937 Bacteria 1209
453 Ga0207704_10467081 3300025938 Bacteria 1010
454 Ga0207665_10000491 3300025939 Bacteria 26745
455 Ga0207665_10002136 3300025939 Bacteria 13368
456 Ga0207665_10040618 3300025939 Bacteria 3105
457 Ga0207665_10053930 3300025939 Bacteria 2710
458 Ga0207665_10068949 3300025939 Bacteria 2410
459 Ga0207665_10086767 3300025939 Bacteria 2162
460 Ga0207665_10087674 3300025939 Bacteria 2151
461 Ga0207665_10099093 3300025939 Bacteria 2032
462 Ga0207665_10331572 3300025939 Bacteria 1144
463 Ga0207665_10366208 3300025939 Bacteria 1091
464 Ga0207691_10081824 3300025940 Bacteria 2901
465 Ga0207691_10648928 3300025940 Bacteria 892
466 Ga0207711_10210385 3300025941 Bacteria 1776
467 Ga0207689_10025258 3300025942 Bacteria 4979
468 Ga0207689_10053010 3300025942 Bacteria 3342
469 Ga0207661_10094137 3300025944 Bacteria 2502
470 Ga0207661_10278577 3300025944 Bacteria 1494
471 Ga0207679_10059797 3300025945 Bacteria 2829
472 Ga0207679_10543108 3300025945 Bacteria 1042
473 Ga0207667_10024640 3300025949 Bacteria 6602
474 Ga0207667_10033783 3300025949 Bacteria 5496
475 Ga0207667_10159752 3300025949 Bacteria 2319
476 Ga0207667_10265136 3300025949 Bacteria 1757
477 Ga0207712_10182424 3300025961 Bacteria 1650
478 Ga0207640_10240676 3300025981 Bacteria 1398
479 Ga0207640_10347760 3300025981 Bacteria 1190
480 Ga0207658_10013270 3300025986 Bacteria 5627
481 Ga0207658_10073734 3300025986 Bacteria 2592
482 Ga0207658_10228659 3300025986 Bacteria 1569
483 Ga0207703_10687306 3300026035 Bacteria 972
484 Ga0207703_10793421 3300026035 Bacteria 904
485 Ga0207678_10021933 3300026067 Bacteria 5598
486 Ga0207678_10117908 3300026067 Bacteria 2265
487 Ga0207678_10186271 3300026067 Bacteria 1773
488 Ga0207678_10851683 3300026067 Bacteria 805
489 Ga0207708_10017313 3300026075 Bacteria 5425
490 Ga0207708_10115664 3300026075 Bacteria 2086
491 Ga0207702_10033693 3300026078 Bacteria 4279
492 Ga0207702_10051457 3300026078 Bacteria 3481
493 Ga0207702_10160192 3300026078 Bacteria 2055
494 Ga0207702_10230756 3300026078 Bacteria 1730
495 Ga0207702_10251113 3300026078 Bacteria 1661
496 Ga0207702_10275931 3300026078 Bacteria 1587
497 Ga0207702_10686648 3300026078 Bacteria 1008
498 Ga0207702_10776131 3300026078 Bacteria 947
499 Ga0207641_10005170 3300026088 Bacteria 11154
500 Ga0207641_10019140 3300026088 Bacteria 5616
501 Ga0207641_10077411 3300026088 Bacteria 2878
502 Ga0207648_10251537 3300026089 Bacteria 1575
503 Ga0207676_10418352 3300026095 Bacteria 1256
504 Ga0207676_10781177 3300026095 Bacteria 930
505 Ga0207674_10007070 3300026116 Bacteria 13118
506 Ga0207674_10100426 3300026116 Bacteria 2875
507 Ga0207674_10441832 3300026116 Bacteria 1257
508 Ga0207674_10459450 3300026116 Bacteria 1231
509 Ga0207675_100017685 3300026118 Bacteria 6651
510 Ga0207675_100074166 3300026118 Bacteria 3184
511 Ga0207675_100140095 3300026118 Bacteria 2297
512 Ga0207683_10027857 3300026121 Bacteria 4883
513 Ga0207683_10137439 3300026121 Bacteria 2200
514 Ga0207683_10281864 3300026121 Bacteria 1519
515 Ga0207698_10106602 3300026142 Bacteria 2337
516 Ga0207698_10114975 3300026142 Bacteria 2265
517 Ga0207698_10136929 3300026142 Bacteria 2102
518 Ga0207698_10247085 3300026142 Bacteria 1630
519 Ga0207428_10107503 3300027907 Bacteria 2149
520 Ga0268266_10109991 3300028379 Bacteria 2441
521 Ga0268266_10312168 3300028379 Bacteria 1469
522 Ga0268265_10090268 3300028380 Bacteria 2447
523 Ga0268264_10153417 3300028381 Bacteria 2068
524 Ga0265336_10005985 3300028666 Bacteria 4433
525 Ga0307515_10065533 3300028794 Bacteria 5052
526 Ga0265338_10002247 3300028800 Bacteria 29390
527 Ga0265338_10082821 3300028800 Bacteria 2685
528 Ga0265325_10013195 3300031241 Bacteria 4708
529 Ga0265340_10002018 3300031247 Bacteria 11621
530 Ga0265340_10009380 3300031247 Bacteria 5256
531 Ga0265339_10096053 3300031249 Bacteria 1547
532 Ga0265327_10002519 3300031251 Bacteria 19092
533 Ga0265327_10056214 3300031251 Bacteria 2029
534 Ga0265327_10125587 3300031251 Bacteria 1212
535 Ga0307513_10097849 3300031456 Bacteria 2968
536 Ga0316575_10017224 3300031665 Bacteria 2742
537 Ga0316575_10158561 3300031665 Bacteria 935
538 Ga0316579_10125553 3300031691 Bacteria 1234
539 Ga0316576_10003072 3300031727 Bacteria 9720
540 Ga0316576_10009447 3300031727 Bacteria 6294
541 Ga0316576_10046655 3300031727 Bacteria 3137
542 Ga0316576_10048738 3300031727 Bacteria 3074
543 Ga0316576_10160548 3300031727 Bacteria 1695
544 Ga0316576_10169726 3300031727 Bacteria 1646
545 Ga0316576_10533570 3300031727 Bacteria 861
546 Ga0316578_10005943 3300031728 Bacteria 5976
547 Ga0316578_10009892 3300031728 Bacteria 4925
548 Ga0316578_10020680 3300031728 Bacteria 3640
549 Ga0316578_10020922 3300031728 Bacteria 3624
550 Ga0316578_10024813 3300031728 Bacteria 3366
551 Ga0316578_10061302 3300031728 Bacteria 2216
552 Ga0316578_10075009 3300031728 Bacteria 2006
553 Ga0307413_10000380 3300031824 Bacteria 14252
554 Ga0307410_10098675 3300031852 Bacteria 2090
555 Ga0307415_100250388 3300032126 Bacteria 1439
556 Ga0307415_100347123 3300032126 Bacteria 1248
557 Ga0316583_10007536 3300032133 Bacteria 3919
558 Ga0316585_10031261 3300032137 Bacteria 1673
559 Ga0316585_10116608 3300032137 Bacteria 878
560 Ga0316580_10005050 3300032139 Bacteria 3838
561 Ga0316580_10043200 3300032139 Bacteria 1390
562 Ga0373930_0075364 3300034816 Bacteria 773
563 Ga0373948_0004868 3300034817 Bacteria 2146
564 Ga0373926_0000706 3300035083 Bacteria 9224
565 Ga0373926_0002263 3300035083 Bacteria 6082
566 Ga0373926_0009305 3300035083 Bacteria 3280
567 Ga0373926_0185800 3300035083 Unclassified 798
568 Ga0373928_0012131 3300035084 Bacteria 1715
569 Ga0373929_0007096 3300035085 Bacteria 2039
570 Ga0373929_0022838 3300035085 Bacteria 1280
571 Ga0373934_0000178 3300035086 Bacteria 23259
572 Ga0373934_0024467 3300035086 Bacteria 2334
573 Ga0373934_0027208 3300035086 Bacteria 2221
574 Ga0373934_0053597 3300035086 Bacteria 1600
575 Ga0373934_0173773 3300035086 Bacteria 884
576 Ga0373940_0000334 3300035088 Bacteria 6958
577 Ga0373944_0001105 3300035089 Bacteria 6707
578 Ga0373944_0002206 3300035089 Bacteria 4950
579 Ga0373951_0100470 3300035091 Bacteria 769
580 Ga0373952_0009007 3300035092 Bacteria 1903
581 Ga0373923_0010792 3300035111 Bacteria 3334
582 Ga0373923_0031550 3300035111 Bacteria 2137
583 Ga0373923_0056984 3300035111 Bacteria 1651
584 Ga0373923_0213472 3300035111 Bacteria 895
585 Ga0373936_0004300 3300035113 Bacteria 5382
586 Ga0373936_0004395 3300035113 Bacteria 5329
587 Ga0373936_0016310 3300035113 Bacteria 2856
588 Ga0373936_0028332 3300035113 Bacteria 2201
589 Ga0373945_0001773 3300035116 Bacteria 6667
590 Ga0373945_0003885 3300035116 Bacteria 4722
591 Ga0373945_0030731 3300035116 Bacteria 1894
592 Ga0373953_0000696 3300035117 Bacteria 9288
593 Ga0373953_0081552 3300035117 Bacteria 1345
594 Ga0373953_0083099 3300035117 Bacteria 1333
595 Ga0373953_0115992 3300035117 Bacteria 1135
596 Ga0373953_0217476 3300035117 Bacteria 827
597 Ga0373954_0009781 3300035118 Bacteria 4220
598 Ga0373954_0016521 3300035118 Bacteria 3304
599 Ga0373956_0000007 3300035119 Bacteria 63448
600 Ga0373956_0013689 3300035119 Bacteria 3376
601 Ga0373956_0013750 3300035119 Bacteria 3370
602 Ga0373956_0044151 3300035119 Bacteria 1986
603 Ga0373957_0000024 3300035120 Bacteria 39141
604 Ga0373957_0000648 3300035120 Bacteria 8927
605 Ga0373957_0011153 3300035120 Bacteria 2992
606 Ga0373957_0039868 3300035120 Bacteria 1763
607 Ga0373960_0021841 3300035121 Bacteria 1707
608 Ga0373943_0006873 3300035170 Bacteria 5102
609 Ga0373943_0013679 3300035170 Bacteria 3667
610 Ga0373943_0033209 3300035170 Bacteria 2456
611 Ga0373946_0000327 3300035171 Bacteria 15404
612 Ga0373946_0002911 3300035171 Bacteria 6077
613 Ga0373955_0000007 3300035172 Bacteria 87917
614 Ga0373955_0002791 3300035172 Bacteria 7672
615 Ga0373955_0005022 3300035172 Bacteria 5914
616 Ga0373955_0010689 3300035172 Bacteria 4345
617 Ga0373955_0014264 3300035172 Bacteria 3861
618 Ga0373955_0183118 3300035172 Bacteria 1243
619 Ga0373942_0018861 3300035207 Bacteria 1716
620 Ga0373942_0024404 3300035207 Bacteria 1550
621 Ga0373961_0017989 3300035241 Bacteria 1841
622 Ga0373961_0030034 3300035241 Bacteria 1509
623 Ga0316574_0000415 3300035398 Bacteria 16875
624 Ga0316574_0009422 3300035398 Bacteria 5470
625 Ga0316574_0025746 3300035398 Bacteria 3533
626 Ga0316574_0050755 3300035398 Bacteria 2583
627 Ga0316574_0053621 3300035398 Unclassified 2518
628 Ga0316574_0098849 3300035398 Bacteria 1867
629 Ga0316574_0174122 3300035398 Bacteria 1385
630 Ga0316574_0304769 3300035398 Bacteria 1012
631 Ga0316574_0414037 3300035398 Bacteria 847
632 Ga0373924_0001299 3300035410 Bacteria 8024
633 Ga0373924_0005508 3300035410 Bacteria 4488
634 Ga0373924_0010699 3300035410 Bacteria 3393
635 Ga0373924_0113902 3300035410 Bacteria 1170
636 Ga0373924_0268401 3300035410 Bacteria 756
637 Ga0373931_0030267 3300035691 Bacteria 2785
638 Ga0373931_0042816 3300035691 Bacteria 2382
639 Ga0373931_0174482 3300035691 Bacteria 1269
640 Ga0373931_0194989 3300035691 Bacteria 1207
641 Ga0373931_0363681 3300035691 Bacteria 908
642 Ga0373931_0380633 3300035691 Bacteria 890
643 Ga0373935_0000834 3300035692 Bacteria 16581
644 Ga0373935_0006552 3300035692 Bacteria 6954
645 Ga0373935_0027546 3300035692 Bacteria 3513
646 Ga0373935_0038058 3300035692 Bacteria 3010
647 Ga0373935_0060602 3300035692 Bacteria 2421
648 Ga0373935_0158069 3300035692 Bacteria 1543
649 Ga0373935_0184846 3300035692 Bacteria 1433
650 Ga0373935_0473924 3300035692 Bacteria 906
651 Ga0373927_0013530 3300035695 Bacteria 5420
652 Ga0373927_0060456 3300035695 Bacteria 2451
653 Ga0373933_0000002 3300035724 Bacteria 151785
654 Ga0373933_0002549 3300035724 Bacteria 10218
655 Ga0373933_0013620 3300035724 Bacteria 4509
656 Ga0373933_0027940 3300035724 Bacteria 3252
657 Ga0373933_0029337 3300035724 Bacteria 3180
658 Ga0373933_0080777 3300035724 Bacteria 1993
659 Ga0373933_0081322 3300035724 Bacteria 1987
660 Ga0373933_0279046 3300035724 Bacteria 1079
661 Ga0373933_0428221 3300035724 Bacteria 864
662 Ga0373947_0000007 3300035725 Bacteria 192259
663 Ga0373947_0005412 3300035725 Bacteria 7453
664 Ga0373947_0063435 3300035725 Bacteria 2251
665 Ga0373947_0400845 3300035725 Bacteria 925
666 Ga0373947_0486175 3300035725 Bacteria 838
667 Ga0373937_0000014 3300036401 Bacteria 151785
668 Ga0373937_0005563 3300036401 Bacteria 10809
669 Ga0373937_0020358 3300036401 Bacteria 5948
670 Ga0373937_0060449 3300036401 Bacteria 3482
671 Ga0373937_0064687 3300036401 Bacteria 3364
672 Ga0373937_0135505 3300036401 Bacteria 2302
673 Ga0373937_0142160 3300036401 Bacteria 2245
674 Ga0373937_0156739 3300036401 Bacteria 2134
675 Ga0373937_0338579 3300036401 Bacteria 1424
676 Ga0373937_0639025 3300036401 Bacteria 1009
677 Ga0373937_0694201 3300036401 Bacteria 964
678 Ga0372808_000497 3300036459 Bacteria 3148
679 Ga0316582_0009720 3300036647 Bacteria 5230
680 Ga0316584_0001023 3300036712 Bacteria 16179
681 Ga0316584_0002391 3300036712 Bacteria 11856
682 Ga0316584_0007712 3300036712 Bacteria 7385
683 Ga0316584_0013593 3300036712 Bacteria 5767
684 Ga0316584_0079084 3300036712 Bacteria 2463
685 Ga0316584_0253120 3300036712 Bacteria 1286
686 Ga0316584_0393239 3300036712 Bacteria 989
687 Ga0373925_0000386 3300037068 Bacteria 45430
688 Ga0373925_0008493 3300037068 Bacteria 7485
689 Ga0373925_0010386 3300037068 Bacteria 6757
690 Ga0373925_0025652 3300037068 Bacteria 4308
691 Ga0373925_0054033 3300037068 Bacteria 3003
692 Ga0373925_0072768 3300037068 Bacteria 2600
693 Ga0373925_0128358 3300037068 Bacteria 1975
694 Ga0373925_0411770 3300037068 Bacteria 1103
695 Ga0395899_0031959 3300037312 Bacteria 3954
696 Ga0395900_0220774 3300037418 Bacteria 1910
697 Ga0436364_0473707 3300037853 Bacteria 2695
698 Ga0436364_0614856 3300037853 Bacteria 15986
699 Ga0436364_0929327 3300037853 Bacteria 2152
700 Ga0436364_1121015 3300037853 Bacteria 839
701 Ga0436364_1224579 3300037853 Bacteria 29151
702 Ga0436364_1419794 3300037853 Bacteria 2420
703 Ga0436364_1557633 3300037853 Bacteria 3598
704 Ga0395901_0049909 3300038443 Bacteria 4348
705 Ga0395901_0447419 3300038443 Bacteria 1322
706 Ga0395901_0468220 3300038443 Bacteria 1287
707 Ga0400483_062449 3300039062 Bacteria 34296
708 Ga0436365_0284137 3300039437 Bacteria 904
709 Ga0436365_1479890 3300039437 Bacteria 3986
710 Ga0436360_0195882 3300039438 Bacteria 1239
711 Ga0436360_1064513 3300039438 Bacteria 2779
712 Ga0436361_0590157 3300039447 Bacteria 2557
713 Ga0436363_0459504 3300039450 Bacteria 1217
714 Ga0451791_0375960 3300041451 Bacteria 1559
715 Ga0451807_0098985 3300041486 Bacteria 1025
716 Ga0451853_1187230 3300041512 Bacteria 1215
717 Ga0451577_0005184 3300042876 Bacteria 13407
718 Ga0466969_0009648 3300044656 Bacteria 5117
719 Ga0466966_0022589 3300044684 Bacteria 4127
720 Ga0466966_0298613 3300044684 Bacteria 968
721 Ga0466961_0122089 3300044693 Bacteria 1635
722 Ga0466961_0160555 3300044693 Bacteria 1401
723 Ga0466961_0212492 3300044693 Bacteria 1194
724 Ga0466961_0217610 3300044693 Bacteria 1178
725 Ga0466961_0231279 3300044693 Bacteria 1137
726 Ga0466963_0053105 3300044694 Bacteria 2690
727 Ga0453684_0046076 3300044712 Bacteria 5806
728 Ga0466970_0007159 3300044765 Bacteria 5584
729 Ga0466959_0125910 3300045049 Bacteria 1819
730 Ga0466958_0004717 3300045836 Bacteria 7241
731 Ga0466958_0038210 3300045836 Bacteria 2880
732 Ga0466967_0083203 3300045976 Bacteria 2894
733 Ga0466967_0157834 3300045976 Bacteria 2127
734 Ga0466967_0209557 3300045976 Bacteria 1848
735 Ga0466967_0300560 3300045976 Bacteria 1544
736 Ga0466967_0308254 3300045976 Bacteria 1524
737 Ga0466967_0948864 3300045976 Bacteria 856
738 Ga0495592_0000077 3300046454 Bacteria 85837
739 Ga0495592_0016114 3300046454 Bacteria 5670
740 Ga0495592_0081060 3300046454 Bacteria 2346
741 Ga0495592_0158292 3300046454 Bacteria 1561
742 Ga0495592_0302894 3300046454 Bacteria 1038
743 Ga0495603_0002146 3300046455 Bacteria 11606
744 Ga0495603_0083631 3300046455 Bacteria 1869
745 Ga0495629_0014897 3300046459 Bacteria 5590
746 Ga0495629_0017639 3300046459 Bacteria 5117
747 Ga0495629_0199859 3300046459 Bacteria 1382
748 Ga0495629_0207285 3300046459 Bacteria 1354
749 Ga0495641_0020237 3300046461 Bacteria 3380
750 Ga0495641_0024989 3300046461 Bacteria 2937
751 Ga0495641_0123042 3300046461 Bacteria 1157
752 Ga0495651_0000019 3300046462 Bacteria 120970
753 Ga0495651_0015418 3300046462 Bacteria 5910
754 Ga0495651_0016634 3300046462 Bacteria 5695
755 Ga0495651_0021996 3300046462 Bacteria 4959
756 Ga0495651_0028479 3300046462 Bacteria 4352
757 Ga0495651_0085790 3300046462 Bacteria 2370
758 Ga0495651_0130927 3300046462 Bacteria 1831
759 Ga0495651_0159964 3300046462 Bacteria 1614
760 Ga0495653_0029955 3300046463 Bacteria 4337
761 Ga0495653_0034240 3300046463 Bacteria 4019
762 Ga0495653_0041955 3300046463 Bacteria 3568
763 Ga0495653_0064840 3300046463 Bacteria 2751
764 Ga0495653_0074947 3300046463 Bacteria 2519
765 Ga0495653_0079650 3300046463 Bacteria 2425
766 Ga0495653_0086682 3300046463 Bacteria 2301
767 Ga0495653_0168347 3300046463 Bacteria 1515
768 Ga0495653_0184688 3300046463 Bacteria 1427
769 Ga0495653_0238815 3300046463 Bacteria 1212
770 Ga0495653_0368868 3300046463 Bacteria 919
771 Ga0495650_0113233 3300046471 Bacteria 1005
772 Ga0495580_0005000 3300046472 Bacteria 11062
773 Ga0495582_0032621 3300046473 Bacteria 2863
774 Ga0495582_0038542 3300046473 Bacteria 2630
775 Ga0495582_0206452 3300046473 Bacteria 1122
776 Ga0495639_0001825 3300046475 Bacteria 9434
777 Ga0495639_0069091 3300046475 Bacteria 1629
778 Ga0495639_0069621 3300046475 Bacteria 1623
779 Ga0495662_0002061 3300046476 Bacteria 10075
780 Ga0495662_0055381 3300046476 Bacteria 1916
781 Ga0495664_0002274 3300046477 Bacteria 10293
782 Ga0495664_0036255 3300046477 Bacteria 2906
783 Ga0495664_0112003 3300046477 Bacteria 1647
784 Ga0495594_0036555 3300046499 Bacteria 2678
785 Ga0495594_0117303 3300046499 Bacteria 1504
786 Ga0495594_0120319 3300046499 Bacteria 1484
787 Ga0495608_0000028 3300046511 Bacteria 151829
788 Ga0495608_0007762 3300046511 Bacteria 7556
789 Ga0495608_0011341 3300046511 Bacteria 6204
790 Ga0495608_0034561 3300046511 Bacteria 3411
791 Ga0495608_0043346 3300046511 Bacteria 3006
792 Ga0495608_0073174 3300046511 Bacteria 2235
793 Ga0495608_0140185 3300046511 Bacteria 1544
794 Ga0495608_0226423 3300046511 Bacteria 1171
795 Ga0495608_0403640 3300046511 Bacteria 835
796 Ga0495618_0020924 3300046514 Bacteria 4028
797 Ga0495618_0027798 3300046514 Bacteria 3522
798 Ga0495618_0039948 3300046514 Bacteria 2951
799 Ga0495618_0041522 3300046514 Bacteria 2897
800 Ga0495618_0054126 3300046514 Bacteria 2538
801 Ga0495618_0310421 3300046514 Bacteria 978
802 Ga0495628_0000337 3300046516 Bacteria 42541
803 Ga0495628_0042422 3300046516 Bacteria 3628
804 Ga0495628_0055160 3300046516 Bacteria 3130
805 Ga0495628_0087344 3300046516 Bacteria 2417
806 Ga0495628_0095685 3300046516 Bacteria 2294
807 Ga0495628_0100556 3300046516 Bacteria 2232
808 Ga0495628_0193003 3300046516 Bacteria 1537
809 Ga0495628_0207250 3300046516 Bacteria 1475
810 Ga0495630_0019317 3300046517 Bacteria 5008
811 Ga0495630_0020707 3300046517 Bacteria 4852
812 Ga0495630_0084355 3300046517 Bacteria 2398
813 Ga0495630_0154028 3300046517 Bacteria 1749
814 Ga0495630_0178799 3300046517 Bacteria 1617
815 Ga0495666_0001318 3300046526 Bacteria 12002
816 Ga0495652_0000031 3300046529 Bacteria 151765
817 Ga0495652_0009083 3300046529 Bacteria 9044
818 Ga0495652_0085890 3300046529 Bacteria 2584
819 Ga0495652_0087437 3300046529 Bacteria 2556
820 Ga0495652_0099435 3300046529 Bacteria 2362
821 Ga0495652_0109846 3300046529 Bacteria 2219
822 Ga0495652_0128119 3300046529 Bacteria 2013
823 Ga0495665_0001806 3300046531 Bacteria 11529
824 Ga0495665_0009930 3300046531 Bacteria 5154
825 Ga0495665_0016348 3300046531 Bacteria 3998
826 Ga0495640_0006719 3300046533 Bacteria 9077
827 Ga0495640_0022291 3300046533 Bacteria 4630
828 Ga0495640_0027147 3300046533 Bacteria 4132
829 Ga0495640_0035192 3300046533 Bacteria 3545
830 Ga0495640_0060915 3300046533 Bacteria 2566
831 Ga0495640_0079302 3300046533 Bacteria 2186
832 Ga0495640_0202859 3300046533 Bacteria 1256
833 Ga0495640_0228459 3300046533 Bacteria 1171
834 Ga0495586_0016075 3300046535 Bacteria 3981
835 Ga0495586_0039162 3300046535 Bacteria 2548
836 Ga0495586_0066457 3300046535 Bacteria 1966
837 Ga0495586_0075096 3300046535 Bacteria 1850
838 Ga0495587_0000023 3300046536 Bacteria 151763
839 Ga0495587_0010360 3300046536 Bacteria 5938
840 Ga0495587_0015544 3300046536 Bacteria 4750
841 Ga0495587_0057581 3300046536 Bacteria 2284
842 Ga0495587_0066315 3300046536 Bacteria 2106
843 Ga0495587_0069693 3300046536 Bacteria 2047
844 Ga0495645_0009718 3300046543 Bacteria 6728
845 Ga0495645_0037752 3300046543 Bacteria 3522
846 Ga0495645_0040802 3300046543 Bacteria 3384
847 Ga0495645_0046431 3300046543 Bacteria 3165
848 Ga0495645_0057048 3300046543 Bacteria 2835
849 Ga0495645_0060000 3300046543 Bacteria 2757
850 Ga0495645_0098946 3300046543 Bacteria 2075
851 Ga0495667_0000054 3300046559 Bacteria 105009
852 Ga0495667_0003678 3300046559 Bacteria 10322
853 Ga0495667_0005611 3300046559 Bacteria 8478
854 Ga0495667_0016694 3300046559 Bacteria 4956
855 Ga0495667_0025078 3300046559 Bacteria 4019
856 Ga0495667_0049312 3300046559 Bacteria 2779
857 Ga0495667_0049945 3300046559 Bacteria 2761
858 Ga0495667_0327836 3300046559 Bacteria 968
859 Ga0495634_0015195 3300046642 Bacteria 5534
860 Ga0495634_0015203 3300046642 Bacteria 5533
861 Ga0495634_0052627 3300046642 Bacteria 2728
862 Ga0495634_0172169 3300046642 Bacteria 1360
863 Ga0495635_0003379 3300046663 Bacteria 11024
864 Ga0495635_0009152 3300046663 Bacteria 6913
865 Ga0495635_0023322 3300046663 Bacteria 4313
866 Ga0495635_0063598 3300046663 Bacteria 2533
867 Ga0495635_0064048 3300046663 Bacteria 2524
868 Ga0495635_0088812 3300046663 Bacteria 2115
869 Ga0495588_0033638 3300046674 Bacteria 2590
870 Ga0495588_0103668 3300046674 Bacteria 1496
871 Ga0495657_0000022 3300046675 Bacteria 151837
872 Ga0495657_0011867 3300046675 Bacteria 6493
873 Ga0495657_0018129 3300046675 Bacteria 5100
874 Ga0495657_0023212 3300046675 Bacteria 4434
875 Ga0495657_0024268 3300046675 Bacteria 4321
876 Ga0495657_0044914 3300046675 Bacteria 3000
877 Ga0495657_0068295 3300046675 Bacteria 2330
878 Ga0495657_0090107 3300046675 Bacteria 1969
879 Ga0495657_0090770 3300046675 Bacteria 1960
880 Ga0495657_0095173 3300046675 Bacteria 1904
881 Ga0495657_0128882 3300046675 Bacteria 1586
882 Ga0495599_0000125 3300046678 Bacteria 50781
883 Ga0495599_0009774 3300046678 Bacteria 5872
884 Ga0495599_0015168 3300046678 Bacteria 4778
885 Ga0495599_0031267 3300046678 Bacteria 3341
886 Ga0495599_0081111 3300046678 Bacteria 2026
887 Ga0495599_0105055 3300046678 Bacteria 1759
888 Ga0495599_0310631 3300046678 Bacteria 950
889 Ga0495623_0000797 3300046679 Bacteria 21197
890 Ga0495623_0015589 3300046679 Bacteria 4914
891 Ga0495623_0067815 3300046679 Bacteria 2226
892 Ga0495623_0079290 3300046679 Bacteria 2034
893 Ga0495623_0114069 3300046679 Bacteria 1634
894 Ga0495623_0153471 3300046679 Bacteria 1359
895 Ga0495623_0274611 3300046679 Bacteria 940
896 Ga0495646_0008062 3300046680 Bacteria 6694
897 Ga0495646_0010047 3300046680 Bacteria 6019
898 Ga0495646_0019837 3300046680 Bacteria 4251
899 Ga0495646_0024184 3300046680 Bacteria 3825
900 Ga0495646_0026611 3300046680 Bacteria 3631
901 Ga0495646_0047563 3300046680 Bacteria 2610
902 Ga0495646_0104435 3300046680 Bacteria 1620
903 Ga0495646_0289224 3300046680 Bacteria 869
904 Ga0495647_0079380 3300046681 Bacteria 1328
905 Ga0495647_0165702 3300046681 Bacteria 955
906 Ga0495658_0002496 3300046683 Bacteria 9252
907 Ga0495658_0008261 3300046683 Bacteria 5156
908 Ga0495658_0052202 3300046683 Bacteria 2318
909 Ga0495613_0001385 3300046689 Bacteria 18425
910 Ga0495613_0033969 3300046689 Bacteria 3788
911 Ga0495613_0035450 3300046689 Bacteria 3702
912 Ga0495613_0143885 3300046689 Bacteria 1702
913 Ga0495624_0021852 3300046690 Bacteria 4239
914 Ga0495624_0094544 3300046690 Bacteria 1842
915 Ga0495624_0205833 3300046690 Bacteria 1194
916 Ga0495600_0004170 3300046809 Bacteria 8618
917 Ga0495600_0004827 3300046809 Bacteria 8095
918 Ga0495600_0009896 3300046809 Bacteria 5904
919 Ga0495600_0112200 3300046809 Bacteria 1775
920 Ga0495600_0164646 3300046809 Bacteria 1432
921 Ga0495600_0325868 3300046809 Bacteria 965
922 Ga0495581_0002443 3300047315 Bacteria 10503
923 Ga0495581_0053632 3300047315 Bacteria 2328
924 Ga0495581_0061380 3300047315 Bacteria 2172
925 Ga0495581_0090165 3300047315 Bacteria 1778
926 Ga0495581_0214482 3300047315 Bacteria 1125
927 Ga0495604_0000022 3300047317 Bacteria 151744
928 Ga0495604_0001765 3300047317 Bacteria 17659
929 Ga0495604_0031910 3300047317 Bacteria 4176
930 Ga0495604_0047725 3300047317 Bacteria 3334
931 Ga0495604_0080450 3300047317 Bacteria 2441
932 Ga0495604_0085425 3300047317 Bacteria 2355
933 Ga0495674_0000494 3300047319 Bacteria 35995
934 Ga0495674_0004554 3300047319 Bacteria 13337
935 Ga0495674_0010807 3300047319 Bacteria 8637
936 Ga0495674_0029470 3300047319 Bacteria 4997
937 Ga0495674_0038833 3300047319 Bacteria 4270
938 Ga0495674_0150371 3300047319 Bacteria 1952
939 Ga0495672_0008693 3300047320 Bacteria 7452
940 Ga0495676_0013531 3300047321 Bacteria 7333
941 Ga0495676_0020535 3300047321 Bacteria 5792
942 Ga0495676_0488897 3300047321 Bacteria 809
943 Ga0495680_0000154 3300047322 Bacteria 69567
944 Ga0495680_0002272 3300047322 Bacteria 19776
945 Ga0495680_0003207 3300047322 Bacteria 16272
946 Ga0495680_0021868 3300047322 Bacteria 5344
947 Ga0495680_0075393 3300047322 Bacteria 2559
948 Ga0495680_0082276 3300047322 Bacteria 2429
949 Ga0495680_0082341 3300047322 Bacteria 2428
950 Ga0495680_0262846 3300047322 Bacteria 1220
951 Ga0495680_0389736 3300047322 Bacteria 963
952 Ga0495680_0415797 3300047322 Bacteria 926
953 Ga0495675_0000235 3300047444 Bacteria 39995
954 Ga0495675_0029913 3300047444 Bacteria 3474
955 Ga0495675_0057165 3300047444 Bacteria 2473
956 Ga0495675_0123536 3300047444 Bacteria 1611
957 Ga0495684_0002869 3300047471 Bacteria 13571
958 Ga0495684_0012510 3300047471 Bacteria 6539
959 Ga0495684_0015089 3300047471 Bacteria 5949
960 Ga0495684_0016613 3300047471 Bacteria 5669
961 Ga0495684_0025760 3300047471 Bacteria 4519
962 Ga0495684_0034261 3300047471 Bacteria 3896
963 Ga0495684_0091242 3300047471 Bacteria 2307
964 Ga0495593_0040534 3300047673 Bacteria 2507
965 Ga0495593_0159731 3300047673 Bacteria 1138
966 Ga0495602_0000251 3300048088 Bacteria 50166
967 Ga0495602_0031755 3300048088 Bacteria 4986
968 Ga0495602_0047899 3300048088 Bacteria 3846
969 Ga0495602_0098103 3300048088 Bacteria 2412
970 Ga0495602_0129271 3300048088 Bacteria 2017
971 Ga0495602_0134951 3300048088 Bacteria 1962
972 Ga0495602_0216176 3300048088 Bacteria 1450
973 Ga0495602_0305968 3300048088 Bacteria 1161
974 Ga0495614_0011860 3300048089 Bacteria 3831
975 Ga0495614_0111824 3300048089 Bacteria 1200
976 Ga0495614_0200634 3300048089 Bacteria 902
977 Ga0496100_0022256 3300048903 Bacteria 3834
978 Ga0496100_0062597 3300048903 Bacteria 2456
979 Ga0496100_0249927 3300048903 Bacteria 1311
980 Ga0496100_0321595 3300048903 Bacteria 1162
981 Ga0496101_0033097 3300048904 Bacteria 3644
982 Ga0496101_0077013 3300048904 Bacteria 2457
983 Ga0496102_0021652 3300048905 Bacteria 5687
984 Ga0496102_0033453 3300048905 Bacteria 4621
985 Ga0496102_0049769 3300048905 Bacteria 3813
986 Ga0496102_0076608 3300048905 Bacteria 3077
987 Ga0496102_0080804 3300048905 Bacteria 2995
988 Ga0496102_0204436 3300048905 Bacteria 1862
989 Ga0496103_0105046 3300048906 Bacteria 1790
990 Ga0496104_0000798 3300048907 Bacteria 27060
991 Ga0496104_0020944 3300048907 Bacteria 5998
992 Ga0496104_0052301 3300048907 Bacteria 3857
993 Ga0496104_0087856 3300048907 Bacteria 2969
994 Ga0496104_0109492 3300048907 Bacteria 2647
995 Ga0496104_0219756 3300048907 Bacteria 1812
996 Ga0496104_0220641 3300048907 Bacteria 1808
997 Ga0496104_0262661 3300048907 Unclassified 1639
998 Ga0496104_0473714 3300048907 Bacteria 1164
999 Ga0496105_0001126 3300048908 Bacteria 18623
1000 Ga0496105_0004860 3300048908 Bacteria 10144
1001 Ga0496105_0009994 3300048908 Bacteria 7444
1002 Ga0496105_0020647 3300048908 Bacteria 5323
1003 Ga0496105_0041023 3300048908 Bacteria 3815
1004 Ga0496105_0087943 3300048908 Bacteria 2567
1005 Ga0496105_0263643 3300048908 Bacteria 1393
1006 Ga0496106_0110294 3300048909 Bacteria 2142
1007 Ga0496106_0197015 3300048909 Bacteria 1602
1008 Ga0496106_0369870 3300048909 Bacteria 1152
1009 Ga0496106_0686605 3300048909 Bacteria 817
1010 Ga0496107_0169151 3300048910 Bacteria 1621
1011 Ga0496107_0660902 3300048910 Bacteria 770
1012 Ga0496108_0010116 3300048911 Bacteria 7653
1013 Ga0496108_0015234 3300048911 Bacteria 6274
1014 Ga0496108_0017530 3300048911 Bacteria 5860
1015 Ga0496108_0058645 3300048911 Bacteria 3236
1016 Ga0496108_0171082 3300048911 Bacteria 1879
1017 Ga0496109_0010754 3300048912 Bacteria 7833
1018 Ga0496109_0021605 3300048912 Bacteria 5694
1019 Ga0496109_0043294 3300048912 Bacteria 4081
1020 Ga0496109_0069469 3300048912 Bacteria 3230
1021 Ga0496109_0087165 3300048912 Bacteria 2883
1022 Ga0496109_0088948 3300048912 Bacteria 2855
1023 Ga0496109_0153563 3300048912 Bacteria 2156
1024 Ga0496109_0561291 3300048912 Bacteria 1077
1025 Ga0496109_0664365 3300048912 Unclassified 979
1026 Ga0496110_0002119 3300048913 Bacteria 14818
1027 Ga0496110_0036811 3300048913 Bacteria 4251
1028 Ga0496110_0051330 3300048913 Bacteria 3623
1029 Ga0496110_0059226 3300048913 Bacteria 3375
1030 Ga0496110_0066320 3300048913 Bacteria 3192
1031 Ga0496110_0081208 3300048913 Bacteria 2890
1032 Ga0496110_0451264 3300048913 Bacteria 1172
1033 Ga0496110_0503852 3300048913 Bacteria 1102
1034 Ga0496111_0015650 3300048914 Bacteria 5212
1035 Ga0496111_0059732 3300048914 Bacteria 2763
1036 Ga0496111_0065831 3300048914 Bacteria 2631
1037 Ga0496111_0126246 3300048914 Bacteria 1891
1038 Ga0496111_0464479 3300048914 Unclassified 933
1039 Ga0496112_0000937 3300048915 Bacteria 21151
1040 Ga0496112_0064145 3300048915 Bacteria 3624
1041 Ga0496112_0176345 3300048915 Bacteria 2102
1042 Ga0496112_0328289 3300048915 Bacteria 1474
1043 Ga0496112_0425477 3300048915 Bacteria 1266
1044 Ga0496113_0048136 3300048916 Bacteria 3171
1045 Ga0496113_0094461 3300048916 Bacteria 2310
1046 Ga0496113_0108558 3300048916 Bacteria 2157
1047 Ga0496113_0132206 3300048916 Bacteria 1959
1048 Ga0496113_0654438 3300048916 Bacteria 840
1049 Ga0496114_0007913 3300048917 Bacteria 8413
1050 Ga0496114_0022774 3300048917 Bacteria 5106
1051 Ga0496114_0026592 3300048917 Bacteria 4738
1052 Ga0496114_0051258 3300048917 Bacteria 3436
1053 Ga0496114_0214418 3300048917 Bacteria 1689
1054 Ga0496114_0240459 3300048917 Bacteria 1592
1055 Ga0496115_0002788 3300048918 Bacteria 12565
1056 Ga0496115_0017876 3300048918 Bacteria 5431
1057 Ga0496115_0037786 3300048918 Bacteria 3827
1058 Ga0496115_0068363 3300048918 Bacteria 2876
1059 Ga0496115_0127063 3300048918 Bacteria 2100
1060 Ga0496115_0216587 3300048918 Bacteria 1581
1061 Ga0496126_0000246 3300048929 Bacteria 116854
1062 Ga0496126_0457827 3300048929 Bacteria 1026
1063 Ga0501031_0343747 3300049568 Bacteria 966
1064 Ga0501032_0131420 3300049569 Bacteria 1652
1065 Ga0501037_0390454 3300049573 Bacteria 955
1066 Ga0501038_0060613 3300049574 Bacteria 3238
1067 Ga0501039_0021168 3300049575 Bacteria 4989
1068 Ga0501040_0008399 3300049576 Bacteria 6711
1069 Ga0501040_0080288 3300049576 Bacteria 2259
1070 Ga0501040_0438936 3300049576 Bacteria 939
1071 Ga0501041_0021802 3300049577 Bacteria 3837
1072 Ga0501041_0164436 3300049577 Bacteria 1388
1073 Ga0501042_0002888 3300049578 Bacteria 10666
1074 Ga0501042_0083950 3300049578 Bacteria 2283
1075 Ga0501042_0307208 3300049578 Bacteria 1146
1076 Ga0501046_0010722 3300049580 Bacteria 7861
1077 Ga0501047_0171447 3300049581 Bacteria 2038
1078 Ga0501047_0716450 3300049581 Bacteria 818
1079 Ga0501048_0019722 3300049582 Bacteria 4945
1080 Ga0501048_0358636 3300049582 Bacteria 1040
1081 Ga0501070_0026719 3300049586 Bacteria 4842
1082 Ga0501070_0108029 3300049586 Bacteria 2299
1083 Ga0501070_0152991 3300049586 Bacteria 1903
1084 Ga0501070_0227360 3300049586 Bacteria 1529
1085 Ga0501071_0011060 3300049587 Bacteria 6064
1086 Ga0501072_0016014 3300049588 Bacteria 5750
1087 Ga0501072_0088402 3300049588 Bacteria 2459
1088 Ga0501072_0109901 3300049588 Bacteria 2194
1089 Ga0501074_0160877 3300049590 Bacteria 1604
1090 Ga0501075_0185946 3300049591 Bacteria 1585
1091 Ga0501075_0251633 3300049591 Bacteria 1347
1092 Ga0501076_0027580 3300049592 Bacteria 4404
1093 Ga0501076_0262124 3300049592 Bacteria 1415
1094 Ga0501077_0083268 3300049593 Bacteria 2027
1095 Ga0501079_0104256 3300049741 Bacteria 2200
1096 Ga0501081_0116935 3300049743 Bacteria 1896
1097 Ga0501083_0204432 3300049744 Bacteria 1288
1098 Ga0501035_0191888 3300049822 Bacteria 1756
1099 Ga0501044_0066117 3300049823 Bacteria 3687
1100 Ga0501044_0641213 3300049823 Bacteria 952
1101 Ga0501045_0353908 3300049824 Bacteria 1093
1102 nmdc:mga05p37_19744_c1 3300050507 Bacteria 8153
1103 nmdc:mga05p37_40546_c1 3300050507 Bacteria 5718
1104 nmdc:mga05p37_541648_c1 3300050507 Bacteria 1327
1105 nmdc:mga09592_155159_c1 3300050508 Bacteria 1976
1106 nmdc:mga09592_65810_c1 3300050508 Bacteria 3071
1107 nmdc:mga06r32_202_c1 3300050510 Bacteria 8912
1108 nmdc:mga08y16_61137_c1 3300050511 Bacteria 3933
1109 nmdc:mga0n895_285428_c1 3300050512 Bacteria 1674
1110 nmdc:mga0n895_32660_c1 3300050512 Bacteria 4997
1111 nmdc:mga0n895_466952_c1 3300050512 Bacteria 1273
1112 nmdc:mga0n895_91500_c1 3300050512 Bacteria 3045
1113 nmdc:mga0rr50_157904_c1 3300050513 Unclassified 1838
1114 nmdc:mga0rr50_17671_c1 3300050513 Bacteria 4768
1115 nmdc:mga0rr50_202178_c1 3300050513 Bacteria 1633
1116 nmdc:mga0rr50_701450_c1 3300050513 Bacteria 864
1117 nmdc:mga08x19_107954_c1 3300050514 Bacteria 1854
1118 nmdc:mga08x19_180089_c1 3300050514 Bacteria 1442
1119 nmdc:mga08x19_192126_c1 3300050514 Bacteria 1397
1120 nmdc:mga08x19_26338_c1 3300050514 Bacteria 3628
1121 nmdc:mga08x19_508315_c1 3300050514 Bacteria 851
1122 nmdc:mga08x19_629170_c1 3300050514 Bacteria 761
1123 nmdc:mga0a205_208320_c1 3300050515 Bacteria 1844
1124 Ga0495601_0006711 3300053077 Bacteria 6735
1125 Ga0495601_0007677 3300053077 Bacteria 6340
1126 Ga0495601_0018237 3300053077 Bacteria 4268
1127 Ga0495601_0036442 3300053077 Bacteria 3071
1128 Ga0495601_0106249 3300053077 Bacteria 1816
1129 Ga0495601_0136800 3300053077 Unclassified 1597
1130 Ga0495601_0208939 3300053077 Bacteria 1275
1131 Ga0495601_0448109 3300053077 Bacteria 835
1132 Ga0495612_0001584 3300053078 Bacteria 9390
1133 Ga0495612_0014365 3300053078 Bacteria 3184
1134 Ga0495612_0033386 3300053078 Bacteria 2082
1135 Ga0495595_0002186 3300053084 Bacteria 7601
1136 Ga0495595_0009141 3300053084 Bacteria 4094
1137 Ga0495595_0009413 3300053084 Bacteria 4042
1138 Ga0495595_0046501 3300053084 Bacteria 2000
1139 Ga0495595_0069903 3300053084 Bacteria 1658
1140 Ga0495595_0107788 3300053084 Bacteria 1349
1141 Ga0495619_0000588 3300053085 Bacteria 24150
1142 Ga0495619_0013237 3300053085 Bacteria 5199
1143 Ga0495619_0089057 3300053085 Bacteria 2088
1144 Ga0495619_0101555 3300053085 Bacteria 1958
1145 Ga0495619_0292950 3300053085 Bacteria 1127
1146 Ga0500566_0000478 3300053094 Bacteria 22275
1147 Ga0500568_0113430 3300053139 Bacteria 1012
1148 Ga0500573_0038146 3300053140 Bacteria 2776
1149 Ga0501084_0000010 3300054114 Bacteria 187712
1150 Ga0501082_0019912 3300060353 Bacteria 5783
1151 Ga0466962_0051291 3300061719 Bacteria 1972
1152 Ga0530510_0002594 3300061734 Bacteria 12416
1153 Ga0530510_0090218 3300061734 Bacteria 2235
1154 Ga0530510_0508770 3300061734 Bacteria 913

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0488897 Ga0495676_0488897_22_597 188
2 3300046463 Ga0495653_0368868 Ga0495653_0368868_14_610 196
3 3300026116 Ga0207674_10441832 Ga0207674_104418322 203
4 3300026035 Ga0207703_10793421 Ga0207703_107934211 218
5 3300035398 Ga0316574_0000415 Ga0316574_0000415_6570_7283 219
6 3300036712 Ga0316584_0013593 Ga0316584_0013593_3351_4064 219
7 3300046809 Ga0495600_0325868 Ga0495600_0325868_288_950 219
8 3300031727 Ga0316576_10003072 Ga0316576_100030728 220
9 3300031728 Ga0316578_10005943 Ga0316578_100059433 220
10 3300005985 Ga0081539_10000124 Ga0081539_1000012489 223
11 3300009984 Ga0105029_101993 Ga0105029_1019932 223
12 3300028794 Ga0307515_10065533 Ga0307515_100655334 223
13 3300006847 Ga0075431_100106479 Ga0075431_1001064791 225
14 3300009147 Ga0114129_10366700 Ga0114129_103667002 225
15 3300050507 nmdc:mga05p37_541648_c1 nmdc:mga05p37_541648_c1_216_938 225
16 3300050510 nmdc:mga06r32_202_c1 nmdc:mga06r32_202_c1_8118_8831 225
17 3300005937 Ga0081455_10000986 Ga0081455_1000098614 226
18 3300025922 Ga0207646_10252090 Ga0207646_102520902 226
19 3300048912 Ga0496109_0561291 Ga0496109_0561291_335_1021 226
20 3300050512 nmdc:mga0n895_91500_c1 nmdc:mga0n895_91500_c1_1472_2155 226
21 3300050513 nmdc:mga0rr50_17671_c1 nmdc:mga0rr50_17671_c1_3395_4078 226
22 3300050514 nmdc:mga08x19_26338_c1 nmdc:mga08x19_26338_c1_662_1345 226
23 3300050515 nmdc:mga0a205_208320_c1 nmdc:mga0a205_208320_c1_810_1493 226
24 3300005436 Ga0070713_100106597 Ga0070713_1001065971 227
25 3300006028 Ga0070717_10041719 Ga0070717_100417192 227
26 3300025898 Ga0207692_10002126 Ga0207692_100021264 227
27 3300025915 Ga0207693_10049719 Ga0207693_100497192 227
28 3300025916 Ga0207663_10273736 Ga0207663_102737362 227
29 3300025929 Ga0207664_10020860 Ga0207664_100208602 227
30 3300031251 Ga0265327_10125587 Ga0265327_101255872 227
31 3300031727 Ga0316576_10046655 Ga0316576_100466552 227
32 3300044693 Ga0466961_0217610 Ga0466961_0217610_367_1056 227
33 3300005471 Ga0070698_100159215 Ga0070698_1001592152 228
34 3300006173 Ga0070716_100070590 Ga0070716_1000705902 228
35 3300006175 Ga0070712_100182458 Ga0070712_1001824582 228
36 3300025939 Ga0207665_10099093 Ga0207665_100990931 228
37 3300050514 nmdc:mga08x19_180089_c1 nmdc:mga08x19_180089_c1_428_1117 228
38 3300044694 Ga0466963_0053105 Ga0466963_0053105_738_1439 230
39 3300045836 Ga0466958_0038210 Ga0466958_0038210_665_1366 230
40 3300045976 Ga0466967_0083203 Ga0466967_0083203_1060_1761 230
41 3300049592 Ga0501076_0262124 Ga0501076_0262124_705_1403 230
42 3300048089 Ga0495614_0111824 Ga0495614_0111824_382_1134 231
43 3300048903 Ga0496100_0321595 Ga0496100_0321595_14_766 231
44 3300048909 Ga0496106_0110294 Ga0496106_0110294_640_1392 231
45 3300048917 Ga0496114_0214418 Ga0496114_0214418_903_1655 231
46 3300048918 Ga0496115_0216587 Ga0496115_0216587_529_1281 231
47 3300049578 Ga0501042_0307208 Ga0501042_0307208_298_996 231
48 3300025929 Ga0207664_10205258 Ga0207664_102052582 232
49 3300031727 Ga0316576_10009447 Ga0316576_100094473 232
50 3300031728 Ga0316578_10020922 Ga0316578_100209223 232
51 3300035083 Ga0373926_0000706 Ga0373926_0000706_2895_3596 232
52 3300035086 Ga0373934_0173773 Ga0373934_0173773_91_792 232
53 3300035692 Ga0373935_0000834 Ga0373935_0000834_13022_13723 232
54 3300035725 Ga0373947_0000007 Ga0373947_0000007_158419_159120 232
55 3300035725 Ga0373947_0063435 Ga0373947_0063435_717_1418 232
56 3300046475 Ga0495639_0069091 Ga0495639_0069091_315_1016 232
57 3300046514 Ga0495618_0041522 Ga0495618_0041522_1766_2467 232
58 3300046516 Ga0495628_0042422 Ga0495628_0042422_1766_2467 232
59 3300046529 Ga0495652_0085890 Ga0495652_0085890_165_866 232
60 3300046535 Ga0495586_0016075 Ga0495586_0016075_327_1028 232
61 3300046543 Ga0495645_0046431 Ga0495645_0046431_1079_1780 232
62 3300046683 Ga0495658_0052202 Ga0495658_0052202_1208_1909 232
63 3300046809 Ga0495600_0164646 Ga0495600_0164646_231_932 232
64 3300053077 Ga0495601_0036442 Ga0495601_0036442_1513_2214 232
65 iso_pu_bacteria 2775506925 2776373985 232
66 iso_pu_bacteria 2863067949 2863070397 232
67 iso_pu_bacteria 8056207758 8056208477 232
68 3300005330 Ga0070690_100255004 Ga0070690_1002550042 233
69 3300005341 Ga0070691_10082196 Ga0070691_100821962 233
70 3300005434 Ga0070709_10067195 Ga0070709_100671952 233
71 3300005436 Ga0070713_100246457 Ga0070713_1002464572 233
72 3300005439 Ga0070711_100108259 Ga0070711_1001082592 233
73 3300005440 Ga0070705_100137903 Ga0070705_1001379032 233
74 3300005468 Ga0070707_100168451 Ga0070707_1001684512 233
75 3300005535 Ga0070684_100279392 Ga0070684_1002793922 233
76 3300005535 Ga0070684_100285765 Ga0070684_1002857651 233
77 3300005536 Ga0070697_100135556 Ga0070697_1001355562 233
78 3300005547 Ga0070693_100190487 Ga0070693_1001904872 233
79 3300005548 Ga0070665_100746182 Ga0070665_1007461821 233
80 3300005564 Ga0070664_100541855 Ga0070664_1005418552 233
81 3300005614 Ga0068856_100081628 Ga0068856_1000816283 233
82 3300005616 Ga0068852_100670007 Ga0068852_1006700071 233
83 3300005618 Ga0068864_100229081 Ga0068864_1002290812 233
84 3300005841 Ga0068863_100208426 Ga0068863_1002084262 233
85 3300005842 Ga0068858_100157406 Ga0068858_1001574062 233
86 3300006163 Ga0070715_10027155 Ga0070715_100271552 233
87 3300006173 Ga0070716_100066296 Ga0070716_1000662962 233
88 3300006358 Ga0068871_100084391 Ga0068871_1000843913 233
89 3300006914 Ga0075436_100162479 Ga0075436_1001624792 233
90 3300009098 Ga0105245_10021074 Ga0105245_100210744 233
91 3300009174 Ga0105241_10810061 Ga0105241_108100611 233
92 3300010375 Ga0105239_10298816 Ga0105239_102988163 233
93 3300013102 Ga0157371_10623275 Ga0157371_106232751 233
94 3300013307 Ga0157372_10353996 Ga0157372_103539962 233
95 3300013308 Ga0157375_10022472 Ga0157375_100224725 233
96 3300014325 Ga0163163_10013229 Ga0163163_100132295 233
97 3300014968 Ga0157379_10018900 Ga0157379_100189003 233
98 3300014969 Ga0157376_10009414 Ga0157376_100094144 233
99 3300025898 Ga0207692_10278843 Ga0207692_102788431 233
100 3300025912 Ga0207707_10262995 Ga0207707_102629952 233
101 3300025915 Ga0207693_10316673 Ga0207693_103166732 233
102 3300025916 Ga0207663_10308349 Ga0207663_103083491 233
103 3300025922 Ga0207646_10083847 Ga0207646_100838473 233
104 3300025928 Ga0207700_10261065 Ga0207700_102610652 233
105 3300025928 Ga0207700_10320897 Ga0207700_103208972 233
106 3300025929 Ga0207664_10547264 Ga0207664_105472641 233
107 3300025939 Ga0207665_10053930 Ga0207665_100539302 233
108 3300025945 Ga0207679_10543108 Ga0207679_105431081 233
109 3300026035 Ga0207703_10687306 Ga0207703_106873061 233
110 3300026078 Ga0207702_10033693 Ga0207702_100336933 233
111 3300026088 Ga0207641_10077411 Ga0207641_100774112 233
112 3300026116 Ga0207674_10459450 Ga0207674_104594501 233
113 3300028379 Ga0268266_10109991 Ga0268266_101099911 233
114 3300035117 Ga0373953_0115992 Ga0373953_0115992_308_1012 233
115 3300035170 Ga0373943_0033209 Ga0373943_0033209_516_1217 233
116 3300035172 Ga0373955_0014264 Ga0373955_0014264_2652_3353 233
117 3300035410 Ga0373924_0113902 Ga0373924_0113902_331_1035 233
118 3300039450 Ga0436363_0459504 Ga0436363_0459504_21_740 233
119 3300046511 Ga0495608_0140185 Ga0495608_0140185_569_1321 233
120 3300046533 Ga0495640_0060915 Ga0495640_0060915_1622_2374 233
121 3300046543 Ga0495645_0060000 Ga0495645_0060000_1554_2258 233
122 3300046675 Ga0495657_0095173 Ga0495657_0095173_152_883 233
123 3300046679 Ga0495623_0274611 Ga0495623_0274611_55_807 233
124 3300047444 Ga0495675_0029913 Ga0495675_0029913_1373_2077 233
125 3300048907 Ga0496104_0052301 Ga0496104_0052301_1385_2089 233
126 3300048908 Ga0496105_0020647 Ga0496105_0020647_3855_4559 233
127 3300048911 Ga0496108_0015234 Ga0496108_0015234_4576_5280 233
128 3300048912 Ga0496109_0087165 Ga0496109_0087165_882_1586 233
129 3300048913 Ga0496110_0036811 Ga0496110_0036811_1666_2370 233
130 3300048914 Ga0496111_0059732 Ga0496111_0059732_1328_2032 233
131 3300048915 Ga0496112_0176345 Ga0496112_0176345_802_1506 233
132 3300048916 Ga0496113_0132206 Ga0496113_0132206_492_1196 233
133 3300050512 nmdc:mga0n895_466952_c1 nmdc:mga0n895_466952_c1_385_1089 233
134 3300053084 Ga0495595_0107788 Ga0495595_0107788_98_829 233
135 iso_pu_bacteria 2795385472 2795795235 233
136 3300005338 Ga0068868_100861606 Ga0068868_1008616061 234
137 3300005355 Ga0070671_100001891 Ga0070671_10000189111 234
138 3300005436 Ga0070713_100161620 Ga0070713_1001616202 234
139 3300005937 Ga0081455_10058026 Ga0081455_100580263 234
140 3300005937 Ga0081455_10151247 Ga0081455_101512471 234
141 3300009098 Ga0105245_10856641 Ga0105245_108566411 234
142 3300031824 Ga0307413_10000380 Ga0307413_100003805 234
143 3300035398 Ga0316574_0053621 Ga0316574_0053621_498_1223 234
144 3300035398 Ga0316574_0304769 Ga0316574_0304769_211_936 234
145 3300044693 Ga0466961_0122089 Ga0466961_0122089_712_1431 234
146 3300044765 Ga0466970_0007159 Ga0466970_0007159_4845_5564 234
147 3300049588 Ga0501072_0109901 Ga0501072_0109901_1201_1938 234
148 3300049824 Ga0501045_0353908 Ga0501045_0353908_159_896 234
149 3300061734 Ga0530510_0002594 Ga0530510_0002594_3161_3898 234
150 iso_pu_bacteria 2675903060 2676494583 234
151 iso_pu_bacteria 2884693830 2884694955 234
152 iso_pu_bacteria 2895427314 2895438467 234
153 iso_pu_bacteria 2895442618 2895446357 234
154 3300005467 Ga0070706_100307336 Ga0070706_1003073362 235
155 3300006028 Ga0070717_10380304 Ga0070717_103803042 235
156 3300006038 Ga0075365_10057927 Ga0075365_100579272 235
157 3300006914 Ga0075436_100244799 Ga0075436_1002447991 235
158 3300009092 Ga0105250_10053587 Ga0105250_100535872 235
159 3300021384 Ga0213876_10017417 Ga0213876_100174172 235
160 3300028800 Ga0265338_10082821 Ga0265338_100828212 235
161 3300031241 Ga0265325_10013195 Ga0265325_100131952 235
162 3300031247 Ga0265340_10002018 Ga0265340_100020184 235
163 3300031247 Ga0265340_10009380 Ga0265340_100093805 235
164 3300031249 Ga0265339_10096053 Ga0265339_100960532 235
165 3300031456 Ga0307513_10097849 Ga0307513_100978492 235
166 3300032126 Ga0307415_100250388 Ga0307415_1002503882 235
167 3300036401 Ga0373937_0694201 Ga0373937_0694201_63_782 235
168 3300038443 Ga0395901_0468220 Ga0395901_0468220_463_1182 235
169 3300039062 Ga0400483_062449 Ga0400483_062449_33064_33774 235
170 3300039437 Ga0436365_1479890 Ga0436365_1479890_321_1043 235
171 3300044693 Ga0466961_0160555 Ga0466961_0160555_76_786 235
172 3300045976 Ga0466967_0209557 Ga0466967_0209557_362_1105 235
173 3300045976 Ga0466967_0308254 Ga0466967_0308254_291_1007 235
174 3300046471 Ga0495650_0113233 Ga0495650_0113233_99_824 235
175 3300048929 Ga0496126_0000246 Ga0496126_0000246_51702_52418 235
176 3300049588 Ga0501072_0088402 Ga0501072_0088402_712_1437 235
177 3300049591 Ga0501075_0251633 Ga0501075_0251633_154_879 235
178 3300049823 Ga0501044_0066117 Ga0501044_0066117_1962_2681 235
179 3300050514 nmdc:mga08x19_192126_c1 nmdc:mga08x19_192126_c1_443_1186 235
180 3300061734 Ga0530510_0508770 Ga0530510_0508770_136_888 235
181 3300005336 Ga0070680_100000250 Ga0070680_10000025019 236
182 3300005455 Ga0070663_100226813 Ga0070663_1002268132 236
183 3300005456 Ga0070678_100442171 Ga0070678_1004421712 236
184 3300005547 Ga0070693_100092428 Ga0070693_1000924282 236
185 3300005548 Ga0070665_100466201 Ga0070665_1004662011 236
186 3300005563 Ga0068855_100010590 Ga0068855_1000105902 236
187 3300005578 Ga0068854_100003602 Ga0068854_1000036027 236
188 3300005614 Ga0068856_100944262 Ga0068856_1009442621 236
189 3300005615 Ga0070702_100065314 Ga0070702_1000653142 236
190 3300005616 Ga0068852_100081138 Ga0068852_1000811382 236
191 3300006844 Ga0075428_100112994 Ga0075428_1001129944 236
192 3300006844 Ga0075428_100246994 Ga0075428_1002469942 236
193 3300006846 Ga0075430_100019365 Ga0075430_1000193653 236
194 3300006880 Ga0075429_100026490 Ga0075429_1000264905 236
195 3300006880 Ga0075429_100070830 Ga0075429_1000708302 236
196 3300006881 Ga0068865_100035766 Ga0068865_1000357664 236
197 3300009093 Ga0105240_10098724 Ga0105240_100987242 236
198 3300009147 Ga0114129_10203291 Ga0114129_102032912 236
199 3300009148 Ga0105243_10200438 Ga0105243_102004383 236
200 3300009174 Ga0105241_10003252 Ga0105241_100032529 236
201 3300009176 Ga0105242_10254012 Ga0105242_102540122 236
202 3300009551 Ga0105238_10023373 Ga0105238_100233732 236
203 3300009553 Ga0105249_10054023 Ga0105249_100540234 236
204 3300011119 Ga0105246_10253651 Ga0105246_102536512 236
205 3300013296 Ga0157374_10232293 Ga0157374_102322932 236
206 3300013308 Ga0157375_10249144 Ga0157375_102491443 236
207 3300014326 Ga0157380_10583369 Ga0157380_105833692 236
208 3300020069 Ga0197907_10524558 Ga0197907_105245582 236
209 3300020081 Ga0206354_11026499 Ga0206354_110264992 236
210 3300025904 Ga0207647_10011354 Ga0207647_100113542 236
211 3300025904 Ga0207647_10216053 Ga0207647_102160531 236
212 3300025909 Ga0207705_10312685 Ga0207705_103126852 236
213 3300025911 Ga0207654_10009462 Ga0207654_100094622 236
214 3300025913 Ga0207695_10003245 Ga0207695_100032452 236
215 3300025914 Ga0207671_10000084 Ga0207671_100000842 236
216 3300025924 Ga0207694_10000838 Ga0207694_1000083819 236
217 3300025935 Ga0207709_10129769 Ga0207709_101297693 236
218 3300025937 Ga0207669_10100060 Ga0207669_101000602 236
219 3300025949 Ga0207667_10033783 Ga0207667_100337832 236
220 3300025981 Ga0207640_10347760 Ga0207640_103477602 236
221 3300026067 Ga0207678_10851683 Ga0207678_108516831 236
222 3300026078 Ga0207702_10686648 Ga0207702_106866481 236
223 3300026118 Ga0207675_100074166 Ga0207675_1000741664 236
224 3300026121 Ga0207683_10281864 Ga0207683_102818642 236
225 3300026142 Ga0207698_10114975 Ga0207698_101149752 236
226 3300031251 Ga0265327_10002519 Ga0265327_1000251914 236
227 3300031251 Ga0265327_10056214 Ga0265327_100562142 236
228 3300031665 Ga0316575_10017224 Ga0316575_100172242 236
229 3300031691 Ga0316579_10125553 Ga0316579_101255532 236
230 3300031727 Ga0316576_10533570 Ga0316576_105335702 236
231 3300031728 Ga0316578_10009892 Ga0316578_100098923 236
232 3300031728 Ga0316578_10075009 Ga0316578_100750092 236
233 3300032133 Ga0316583_10007536 Ga0316583_100075362 236
234 3300032137 Ga0316585_10031261 Ga0316585_100312612 236
235 3300032139 Ga0316580_10043200 Ga0316580_100432002 236
236 3300038443 Ga0395901_0447419 Ga0395901_0447419_179_901 236
237 3300048907 Ga0496104_0220641 Ga0496104_0220641_454_1188 236
238 3300048911 Ga0496108_0017530 Ga0496108_0017530_2453_3187 236
239 3300048912 Ga0496109_0021605 Ga0496109_0021605_463_1197 236
240 3300048915 Ga0496112_0328289 Ga0496112_0328289_118_852 236
241 3300049586 Ga0501070_0152991 Ga0501070_0152991_1127_1879 236
242 3300050507 nmdc:mga05p37_19744_c1 nmdc:mga05p37_19744_c1_6206_6925 236
243 3300050508 nmdc:mga09592_155159_c1 nmdc:mga09592_155159_c1_976_1695 236
244 3300050508 nmdc:mga09592_65810_c1 nmdc:mga09592_65810_c1_733_1452 236
245 3300054114 Ga0501084_0000010 Ga0501084_0000010_21561_22295 236
246 iso_pu_bacteria 2675903058 2676473599 236
247 iso_pu_bacteria 2827628540 2827632112 236
248 iso_pu_bacteria 2873314349 2873322051 236
249 iso_pu_bacteria 8055066027 8055073246 236
250 iso_pu_bacteria 8055172936 8055181300 236
251 3300005327 Ga0070658_10000873 Ga0070658_100008732 237
252 3300005327 Ga0070658_10403280 Ga0070658_104032802 237
253 3300005327 Ga0070658_10427271 Ga0070658_104272712 237
254 3300005334 Ga0068869_100028764 Ga0068869_1000287643 237
255 3300005337 Ga0070682_100057475 Ga0070682_1000574752 237
256 3300005339 Ga0070660_100126413 Ga0070660_1001264133 237
257 3300005339 Ga0070660_100213840 Ga0070660_1002138402 237
258 3300005344 Ga0070661_100254299 Ga0070661_1002542992 237
259 3300005353 Ga0070669_100144723 Ga0070669_1001447231 237
260 3300005365 Ga0070688_100437853 Ga0070688_1004378531 237
261 3300005367 Ga0070667_100074881 Ga0070667_1000748813 237
262 3300005367 Ga0070667_100130496 Ga0070667_1001304962 237
263 3300005434 Ga0070709_10059134 Ga0070709_100591341 237
264 3300005441 Ga0070700_100352502 Ga0070700_1003525021 237
265 3300005445 Ga0070708_100210724 Ga0070708_1002107243 237
266 3300005455 Ga0070663_100122690 Ga0070663_1001226902 237
267 3300005455 Ga0070663_100413294 Ga0070663_1004132942 237
268 3300005456 Ga0070678_100092962 Ga0070678_1000929622 237
269 3300005457 Ga0070662_100052156 Ga0070662_1000521563 237
270 3300005467 Ga0070706_100003833 Ga0070706_1000038335 237
271 3300005467 Ga0070706_100206478 Ga0070706_1002064781 237
272 3300005467 Ga0070706_100243135 Ga0070706_1002431351 237
273 3300005467 Ga0070706_100270858 Ga0070706_1002708582 237
274 3300005467 Ga0070706_100299309 Ga0070706_1002993092 237
275 3300005468 Ga0070707_100003915 Ga0070707_1000039154 237
276 3300005468 Ga0070707_100012607 Ga0070707_1000126073 237
277 3300005468 Ga0070707_100214458 Ga0070707_1002144582 237
278 3300005471 Ga0070698_100003058 Ga0070698_1000030588 237
279 3300005518 Ga0070699_100027648 Ga0070699_1000276481 237
280 3300005518 Ga0070699_100128863 Ga0070699_1001288632 237
281 3300005530 Ga0070679_100279321 Ga0070679_1002793212 237
282 3300005563 Ga0068855_100011828 Ga0068855_10001182811 237
283 3300005563 Ga0068855_100240344 Ga0068855_1002403442 237
284 3300005564 Ga0070664_100503452 Ga0070664_1005034522 237
285 3300005578 Ga0068854_100110153 Ga0068854_1001101533 237
286 3300005614 Ga0068856_100180970 Ga0068856_1001809704 237
287 3300005615 Ga0070702_100445884 Ga0070702_1004458841 237
288 3300005616 Ga0068852_100155928 Ga0068852_1001559282 237
289 3300005616 Ga0068852_100278223 Ga0068852_1002782232 237
290 3300005618 Ga0068864_100301129 Ga0068864_1003011292 237
291 3300005618 Ga0068864_100596394 Ga0068864_1005963942 237
292 3300005719 Ga0068861_100102389 Ga0068861_1001023892 237
293 3300005983 Ga0081540_1001397 Ga0081540_100139714 237
294 3300006028 Ga0070717_10012249 Ga0070717_100122493 237
295 3300006028 Ga0070717_10108166 Ga0070717_101081662 237
296 3300006028 Ga0070717_10720377 Ga0070717_107203772 237
297 3300006173 Ga0070716_100354744 Ga0070716_1003547441 237
298 3300006881 Ga0068865_100368315 Ga0068865_1003683151 237
299 3300009093 Ga0105240_10018361 Ga0105240_100183612 237
300 3300009094 Ga0111539_10102409 Ga0111539_101024093 237
301 3300009148 Ga0105243_10124866 Ga0105243_101248662 237
302 3300009148 Ga0105243_10531517 Ga0105243_105315171 237
303 3300009177 Ga0105248_10939263 Ga0105248_109392631 237
304 3300009551 Ga0105238_10297312 Ga0105238_102973121 237
305 3300010375 Ga0105239_10169841 Ga0105239_101698412 237
306 3300013104 Ga0157370_10002163 Ga0157370_100021638 237
307 3300013104 Ga0157370_10336482 Ga0157370_103364821 237
308 3300013105 Ga0157369_10002312 Ga0157369_100023128 237
309 3300013105 Ga0157369_10935719 Ga0157369_109357191 237
310 3300013306 Ga0163162_10843403 Ga0163162_108434032 237
311 3300013308 Ga0157375_10119685 Ga0157375_101196851 237
312 3300020080 Ga0206350_11111617 Ga0206350_111116172 237
313 3300020082 Ga0206353_11912876 Ga0206353_119128762 237
314 3300022467 Ga0224712_10004193 Ga0224712_100041931 237
315 3300025901 Ga0207688_10043740 Ga0207688_100437403 237
316 3300025901 Ga0207688_10091287 Ga0207688_100912872 237
317 3300025906 Ga0207699_10071298 Ga0207699_100712981 237
318 3300025908 Ga0207643_10065429 Ga0207643_100654293 237
319 3300025909 Ga0207705_10003827 Ga0207705_100038272 237
320 3300025909 Ga0207705_10103219 Ga0207705_101032193 237
321 3300025910 Ga0207684_10353653 Ga0207684_103536531 237
322 3300025910 Ga0207684_10390624 Ga0207684_103906241 237
323 3300025913 Ga0207695_10007764 Ga0207695_1000776411 237
324 3300025919 Ga0207657_10066075 Ga0207657_100660753 237
325 3300025919 Ga0207657_10111971 Ga0207657_101119713 237
326 3300025921 Ga0207652_10714537 Ga0207652_107145371 237
327 3300025922 Ga0207646_10023902 Ga0207646_100239023 237
328 3300025922 Ga0207646_10459428 Ga0207646_104594281 237
329 3300025925 Ga0207650_10203611 Ga0207650_102036113 237
330 3300025926 Ga0207659_10673889 Ga0207659_106738891 237
331 3300025927 Ga0207687_10104496 Ga0207687_101044962 237
332 3300025928 Ga0207700_10354781 Ga0207700_103547812 237
333 3300025933 Ga0207706_10066405 Ga0207706_100664051 237
334 3300025935 Ga0207709_10159879 Ga0207709_101598793 237
335 3300025935 Ga0207709_10699263 Ga0207709_106992631 237
336 3300025937 Ga0207669_10306870 Ga0207669_103068701 237
337 3300025938 Ga0207704_10467081 Ga0207704_104670811 237
338 3300025939 Ga0207665_10366208 Ga0207665_103662081 237
339 3300025940 Ga0207691_10648928 Ga0207691_106489281 237
340 3300025941 Ga0207711_10210385 Ga0207711_102103852 237
341 3300025942 Ga0207689_10025258 Ga0207689_100252583 237
342 3300025949 Ga0207667_10159752 Ga0207667_101597523 237
343 3300025981 Ga0207640_10240676 Ga0207640_102406763 237
344 3300025986 Ga0207658_10013270 Ga0207658_100132703 237
345 3300025986 Ga0207658_10228659 Ga0207658_102286592 237
346 3300026067 Ga0207678_10117908 Ga0207678_101179082 237
347 3300026067 Ga0207678_10186271 Ga0207678_101862712 237
348 3300026075 Ga0207708_10017313 Ga0207708_100173134 237
349 3300026078 Ga0207702_10160192 Ga0207702_101601922 237
350 3300026078 Ga0207702_10776131 Ga0207702_107761311 237
351 3300026089 Ga0207648_10251537 Ga0207648_102515371 237
352 3300026095 Ga0207676_10418352 Ga0207676_104183522 237
353 3300026116 Ga0207674_10100426 Ga0207674_101004262 237
354 3300026118 Ga0207675_100140095 Ga0207675_1001400951 237
355 3300026121 Ga0207683_10137439 Ga0207683_101374393 237
356 3300026142 Ga0207698_10106602 Ga0207698_101066022 237
357 3300026142 Ga0207698_10136929 Ga0207698_101369292 237
358 3300028379 Ga0268266_10312168 Ga0268266_103121682 237
359 3300028381 Ga0268264_10153417 Ga0268264_101534173 237
360 3300031665 Ga0316575_10158561 Ga0316575_101585611 237
361 3300031727 Ga0316576_10048738 Ga0316576_100487383 237
362 3300031727 Ga0316576_10160548 Ga0316576_101605482 237
363 3300031727 Ga0316576_10169726 Ga0316576_101697262 237
364 3300031728 Ga0316578_10020680 Ga0316578_100206803 237
365 3300031728 Ga0316578_10024813 Ga0316578_100248134 237
366 3300031728 Ga0316578_10061302 Ga0316578_100613022 237
367 3300032126 Ga0307415_100347123 Ga0307415_1003471231 237
368 3300032137 Ga0316585_10116608 Ga0316585_101166081 237
369 3300032139 Ga0316580_10005050 Ga0316580_100050504 237
370 3300035398 Ga0316574_0009422 Ga0316574_0009422_144_872 237
371 3300035398 Ga0316574_0050755 Ga0316574_0050755_112_840 237
372 3300035398 Ga0316574_0098849 Ga0316574_0098849_300_1028 237
373 3300035398 Ga0316574_0174122 Ga0316574_0174122_223_951 237
374 3300035398 Ga0316574_0414037 Ga0316574_0414037_29_766 237
375 3300036647 Ga0316582_0009720 Ga0316582_0009720_3736_4464 237
376 3300036712 Ga0316584_0001023 Ga0316584_0001023_6684_7421 237
377 3300036712 Ga0316584_0002391 Ga0316584_0002391_6166_6894 237
378 3300036712 Ga0316584_0079084 Ga0316584_0079084_321_1049 237
379 3300036712 Ga0316584_0253120 Ga0316584_0253120_120_848 237
380 3300037312 Ga0395899_0031959 Ga0395899_0031959_1660_2385 237
381 3300037418 Ga0395900_0220774 Ga0395900_0220774_533_1285 237
382 3300038443 Ga0395901_0049909 Ga0395901_0049909_2833_3585 237
383 3300039438 Ga0436360_0195882 Ga0436360_0195882_349_1101 237
384 3300039438 Ga0436360_1064513 Ga0436360_1064513_1951_2676 237
385 3300039447 Ga0436361_0590157 Ga0436361_0590157_1720_2472 237
386 3300041451 Ga0451791_0375960 Ga0451791_0375960_88_804 237
387 3300041486 Ga0451807_0098985 Ga0451807_0098985_122_838 237
388 3300041512 Ga0451853_1187230 Ga0451853_1187230_305_1021 237
389 3300044656 Ga0466969_0009648 Ga0466969_0009648_2844_3569 237
390 3300046681 Ga0495647_0165702 Ga0495647_0165702_135_851 237
391 3300047320 Ga0495672_0008693 Ga0495672_0008693_3049_3786 237
392 3300048903 Ga0496100_0062597 Ga0496100_0062597_1424_2170 237
393 3300048907 Ga0496104_0262661 Ga0496104_0262661_685_1407 237
394 3300048907 Ga0496104_0473714 Ga0496104_0473714_268_993 237
395 3300048912 Ga0496109_0043294 Ga0496109_0043294_478_1200 237
396 3300048913 Ga0496110_0451264 Ga0496110_0451264_67_792 237
397 3300048914 Ga0496111_0464479 Ga0496111_0464479_145_867 237
398 3300049578 Ga0501042_0002888 Ga0501042_0002888_2234_3001 237
399 3300049586 Ga0501070_0108029 Ga0501070_0108029_1198_1947 237
400 3300053078 Ga0495612_0014365 Ga0495612_0014365_786_1505 237
401 3300053085 Ga0495619_0089057 Ga0495619_0089057_1176_1895 237
402 iso_pu_bacteria 2731639228 2731909010 237
403 iso_pu_bacteria 2799112218 2799184898 237
404 3300003320 rootH2_10041817 rootH2_100418172 238
405 3300003659 JGI25404J52841_10000650 JGI25404J52841_100006501 238
406 3300005327 Ga0070658_10375750 Ga0070658_103757502 238
407 3300005327 Ga0070658_10411448 Ga0070658_104114481 238
408 3300005328 Ga0070676_10115376 Ga0070676_101153762 238
409 3300005328 Ga0070676_10164378 Ga0070676_101643782 238
410 3300005330 Ga0070690_100078306 Ga0070690_1000783062 238
411 3300005339 Ga0070660_100261049 Ga0070660_1002610491 238
412 3300005340 Ga0070689_100261111 Ga0070689_1002611112 238
413 3300005344 Ga0070661_100152856 Ga0070661_1001528562 238
414 3300005345 Ga0070692_10076543 Ga0070692_100765432 238
415 3300005347 Ga0070668_100438224 Ga0070668_1004382242 238
416 3300005354 Ga0070675_100102255 Ga0070675_1001022552 238
417 3300005356 Ga0070674_100339251 Ga0070674_1003392512 238
418 3300005364 Ga0070673_100176926 Ga0070673_1001769262 238
419 3300005366 Ga0070659_100041701 Ga0070659_1000417012 238
420 3300005434 Ga0070709_10058198 Ga0070709_100581982 238
421 3300005434 Ga0070709_10087873 Ga0070709_100878732 238
422 3300005434 Ga0070709_10102706 Ga0070709_101027061 238
423 3300005434 Ga0070709_10294576 Ga0070709_102945761 238
424 3300005435 Ga0070714_100001479 Ga0070714_1000014795 238
425 3300005435 Ga0070714_100009096 Ga0070714_1000090961 238
426 3300005435 Ga0070714_100059883 Ga0070714_1000598832 238
427 3300005435 Ga0070714_100101602 Ga0070714_1001016022 238
428 3300005435 Ga0070714_100206918 Ga0070714_1002069181 238
429 3300005436 Ga0070713_100006079 Ga0070713_1000060793 238
430 3300005436 Ga0070713_100143189 Ga0070713_1001431891 238
431 3300005436 Ga0070713_100228004 Ga0070713_1002280041 238
432 3300005436 Ga0070713_100538628 Ga0070713_1005386282 238
433 3300005437 Ga0070710_10000020 Ga0070710_1000002064 238
434 3300005437 Ga0070710_10019048 Ga0070710_100190485 238
435 3300005437 Ga0070710_10048460 Ga0070710_100484601 238
436 3300005437 Ga0070710_10055647 Ga0070710_100556473 238
437 3300005437 Ga0070710_10090241 Ga0070710_100902413 238
438 3300005439 Ga0070711_100007900 Ga0070711_1000079005 238
439 3300005439 Ga0070711_100098649 Ga0070711_1000986493 238
440 3300005439 Ga0070711_100151211 Ga0070711_1001512112 238
441 3300005439 Ga0070711_100181286 Ga0070711_1001812862 238
442 3300005439 Ga0070711_100194005 Ga0070711_1001940051 238
443 3300005439 Ga0070711_100204756 Ga0070711_1002047561 238
444 3300005440 Ga0070705_100216908 Ga0070705_1002169082 238
445 3300005440 Ga0070705_100319160 Ga0070705_1003191601 238
446 3300005441 Ga0070700_100100330 Ga0070700_1001003302 238
447 3300005445 Ga0070708_100017408 Ga0070708_1000174084 238
448 3300005445 Ga0070708_100050975 Ga0070708_1000509753 238
449 3300005445 Ga0070708_100192134 Ga0070708_1001921342 238
450 3300005455 Ga0070663_100406058 Ga0070663_1004060581 238
451 3300005456 Ga0070678_100485092 Ga0070678_1004850921 238
452 3300005456 Ga0070678_100508086 Ga0070678_1005080862 238
453 3300005467 Ga0070706_100007075 Ga0070706_1000070757 238
454 3300005467 Ga0070706_100008175 Ga0070706_1000081754 238
455 3300005467 Ga0070706_100052075 Ga0070706_1000520753 238
456 3300005467 Ga0070706_100097316 Ga0070706_1000973163 238
457 3300005467 Ga0070706_100101304 Ga0070706_1001013042 238
458 3300005468 Ga0070707_100000256 Ga0070707_10000025616 238
459 3300005468 Ga0070707_100020625 Ga0070707_1000206255 238
460 3300005468 Ga0070707_100132249 Ga0070707_1001322492 238
461 3300005468 Ga0070707_100311621 Ga0070707_1003116211 238
462 3300005468 Ga0070707_100725596 Ga0070707_1007255961 238
463 3300005471 Ga0070698_100000292 Ga0070698_10000029234 238
464 3300005471 Ga0070698_100000333 Ga0070698_10000033311 238
465 3300005471 Ga0070698_100001168 Ga0070698_10000116813 238
466 3300005471 Ga0070698_100037912 Ga0070698_1000379122 238
467 3300005471 Ga0070698_100039511 Ga0070698_1000395115 238
468 3300005471 Ga0070698_100083329 Ga0070698_1000833293 238
469 3300005471 Ga0070698_100315991 Ga0070698_1003159912 238
470 3300005471 Ga0070698_100530810 Ga0070698_1005308102 238
471 3300005471 Ga0070698_100691201 Ga0070698_1006912011 238
472 3300005518 Ga0070699_100005166 Ga0070699_1000051669 238
473 3300005518 Ga0070699_100082594 Ga0070699_1000825943 238
474 3300005518 Ga0070699_100140942 Ga0070699_1001409423 238
475 3300005530 Ga0070679_100226125 Ga0070679_1002261252 238
476 3300005535 Ga0070684_100111329 Ga0070684_1001113291 238
477 3300005535 Ga0070684_100266519 Ga0070684_1002665191 238
478 3300005535 Ga0070684_100330337 Ga0070684_1003303372 238
479 3300005539 Ga0068853_100074513 Ga0068853_1000745132 238
480 3300005544 Ga0070686_100148851 Ga0070686_1001488512 238
481 3300005546 Ga0070696_100121381 Ga0070696_1001213812 238
482 3300005548 Ga0070665_100294631 Ga0070665_1002946313 238
483 3300005563 Ga0068855_100163774 Ga0068855_1001637743 238
484 3300005563 Ga0068855_100188899 Ga0068855_1001888993 238
485 3300005564 Ga0070664_100111903 Ga0070664_1001119032 238
486 3300005578 Ga0068854_100021085 Ga0068854_1000210856 238
487 3300005614 Ga0068856_100019202 Ga0068856_1000192023 238
488 3300005614 Ga0068856_100028186 Ga0068856_1000281864 238
489 3300005616 Ga0068852_100281208 Ga0068852_1002812081 238
490 3300005617 Ga0068859_100071345 Ga0068859_1000713454 238
491 3300005618 Ga0068864_100078054 Ga0068864_1000780543 238
492 3300005718 Ga0068866_10201750 Ga0068866_102017502 238
493 3300005719 Ga0068861_100670025 Ga0068861_1006700251 238
494 3300005719 Ga0068861_100958797 Ga0068861_1009587971 238
495 3300005840 Ga0068870_10106007 Ga0068870_101060072 238
496 3300005841 Ga0068863_100092480 Ga0068863_1000924803 238
497 3300005842 Ga0068858_100127173 Ga0068858_1001271732 238
498 3300005842 Ga0068858_100480948 Ga0068858_1004809482 238
499 3300005843 Ga0068860_100060801 Ga0068860_1000608013 238
500 3300005844 Ga0068862_100213252 Ga0068862_1002132522 238
501 3300005937 Ga0081455_10087175 Ga0081455_100871754 238
502 3300005983 Ga0081540_1000347 Ga0081540_10003478 238
503 3300006028 Ga0070717_10003811 Ga0070717_100038115 238
504 3300006028 Ga0070717_10032502 Ga0070717_100325022 238
505 3300006028 Ga0070717_10035438 Ga0070717_100354383 238
506 3300006028 Ga0070717_10036952 Ga0070717_100369523 238
507 3300006028 Ga0070717_10045906 Ga0070717_100459063 238
508 3300006028 Ga0070717_10141585 Ga0070717_101415851 238
509 3300006028 Ga0070717_10174251 Ga0070717_101742512 238
510 3300006028 Ga0070717_10177790 Ga0070717_101777902 238
511 3300006028 Ga0070717_10286661 Ga0070717_102866612 238
512 3300006028 Ga0070717_10434754 Ga0070717_104347542 238
513 3300006028 Ga0070717_10592651 Ga0070717_105926511 238
514 3300006163 Ga0070715_10007893 Ga0070715_100078933 238
515 3300006163 Ga0070715_10015951 Ga0070715_100159513 238
516 3300006163 Ga0070715_10017375 Ga0070715_100173753 238
517 3300006163 Ga0070715_10085555 Ga0070715_100855552 238
518 3300006163 Ga0070715_10087639 Ga0070715_100876392 238
519 3300006173 Ga0070716_100001346 Ga0070716_1000013465 238
520 3300006173 Ga0070716_100068831 Ga0070716_1000688312 238
521 3300006173 Ga0070716_100125569 Ga0070716_1001255692 238
522 3300006175 Ga0070712_100004001 Ga0070712_1000040017 238
523 3300006175 Ga0070712_100036738 Ga0070712_1000367382 238
524 3300006175 Ga0070712_100203933 Ga0070712_1002039332 238
525 3300006175 Ga0070712_100233680 Ga0070712_1002336802 238
526 3300006175 Ga0070712_100583432 Ga0070712_1005834321 238
527 3300006237 Ga0097621_100049061 Ga0097621_1000490613 238
528 3300006237 Ga0097621_100364605 Ga0097621_1003646052 238
529 3300006358 Ga0068871_100346781 Ga0068871_1003467812 238
530 3300006844 Ga0075428_100076521 Ga0075428_1000765212 238
531 3300006852 Ga0075433_10099722 Ga0075433_100997221 238
532 3300006852 Ga0075433_10411052 Ga0075433_104110521 238
533 3300006871 Ga0075434_100015888 Ga0075434_1000158885 238
534 3300006871 Ga0075434_100227337 Ga0075434_1002273372 238
535 3300006871 Ga0075434_100236314 Ga0075434_1002363142 238
536 3300006881 Ga0068865_100464962 Ga0068865_1004649622 238
537 3300006914 Ga0075436_100023153 Ga0075436_1000231532 238
538 3300006914 Ga0075436_100077556 Ga0075436_1000775561 238
539 3300006914 Ga0075436_100149263 Ga0075436_1001492632 238
540 3300006914 Ga0075436_100164945 Ga0075436_1001649451 238
541 3300006931 Ga0097620_100071349 Ga0097620_1000713492 238
542 3300007076 Ga0075435_100025231 Ga0075435_1000252314 238
543 3300007076 Ga0075435_100230238 Ga0075435_1002302382 238
544 3300007076 Ga0075435_100245189 Ga0075435_1002451892 238
545 3300007076 Ga0075435_100472037 Ga0075435_1004720371 238
546 3300007076 Ga0075435_100579412 Ga0075435_1005794122 238
547 3300007788 Ga0099795_10037345 Ga0099795_100373452 238
548 3300009011 Ga0105251_10032047 Ga0105251_100320473 238
549 3300009093 Ga0105240_10069191 Ga0105240_100691913 238
550 3300009094 Ga0111539_10030655 Ga0111539_100306554 238
551 3300009098 Ga0105245_10013600 Ga0105245_100136004 238
552 3300009098 Ga0105245_10138453 Ga0105245_101384532 238
553 3300009101 Ga0105247_10057469 Ga0105247_100574692 238
554 3300009101 Ga0105247_10077209 Ga0105247_100772092 238
555 3300009147 Ga0114129_10019257 Ga0114129_100192574 238
556 3300009148 Ga0105243_10264051 Ga0105243_102640512 238
557 3300009176 Ga0105242_10039533 Ga0105242_100395332 238
558 3300009177 Ga0105248_10364293 Ga0105248_103642932 238
559 3300009545 Ga0105237_10237987 Ga0105237_102379872 238
560 3300009553 Ga0105249_10011734 Ga0105249_100117344 238
561 3300010375 Ga0105239_10321144 Ga0105239_103211442 238
562 3300011119 Ga0105246_10071452 Ga0105246_100714523 238
563 3300011119 Ga0105246_10100691 Ga0105246_101006912 238
564 3300012481 Ga0157320_1006499 Ga0157320_10064991 238
565 3300012515 Ga0157338_1003066 Ga0157338_10030661 238
566 3300013102 Ga0157371_10039265 Ga0157371_100392653 238
567 3300013296 Ga0157374_10498788 Ga0157374_104987882 238
568 3300013297 Ga0157378_10269351 Ga0157378_102693512 238
569 3300013306 Ga0163162_11235580 Ga0163162_112355801 238
570 3300013308 Ga0157375_10021555 Ga0157375_100215557 238
571 3300013308 Ga0157375_10036370 Ga0157375_100363703 238
572 3300014325 Ga0163163_10054650 Ga0163163_100546505 238
573 3300014325 Ga0163163_10080825 Ga0163163_100808253 238
574 3300014325 Ga0163163_10323645 Ga0163163_103236452 238
575 3300014326 Ga0157380_10366883 Ga0157380_103668831 238
576 3300014326 Ga0157380_10785431 Ga0157380_107854312 238
577 3300014968 Ga0157379_10194533 Ga0157379_101945332 238
578 3300014968 Ga0157379_10328405 Ga0157379_103284052 238
579 3300014969 Ga0157376_10160513 Ga0157376_101605133 238
580 3300014969 Ga0157376_10382239 Ga0157376_103822392 238
581 3300014969 Ga0157376_10696784 Ga0157376_106967842 238
582 3300017792 Ga0163161_10034035 Ga0163161_100340352 238
583 3300020070 Ga0206356_11448904 Ga0206356_114489042 238
584 3300021388 Ga0213875_10000593 Ga0213875_1000059317 238
585 3300021388 Ga0213875_10012651 Ga0213875_100126514 238
586 3300021388 Ga0213875_10028541 Ga0213875_100285412 238
587 3300021388 Ga0213875_10046922 Ga0213875_100469222 238
588 3300021388 Ga0213875_10224812 Ga0213875_102248121 238
589 3300024225 Ga0224572_1001665 Ga0224572_10016653 238
590 3300024225 Ga0224572_1008184 Ga0224572_10081842 238
591 3300025321 Ga0207656_10119271 Ga0207656_101192712 238
592 3300025898 Ga0207692_10016925 Ga0207692_100169253 238
593 3300025901 Ga0207688_10014603 Ga0207688_100146034 238
594 3300025903 Ga0207680_10050470 Ga0207680_100504702 238
595 3300025905 Ga0207685_10010139 Ga0207685_100101393 238
596 3300025905 Ga0207685_10026050 Ga0207685_100260501 238
597 3300025905 Ga0207685_10043009 Ga0207685_100430093 238
598 3300025906 Ga0207699_10001820 Ga0207699_100018204 238
599 3300025906 Ga0207699_10012515 Ga0207699_100125153 238
600 3300025906 Ga0207699_10057587 Ga0207699_100575872 238
601 3300025906 Ga0207699_10074012 Ga0207699_100740122 238
602 3300025906 Ga0207699_10085093 Ga0207699_100850932 238
603 3300025906 Ga0207699_10120297 Ga0207699_101202972 238
604 3300025908 Ga0207643_10007439 Ga0207643_100074392 238
605 3300025909 Ga0207705_10121347 Ga0207705_101213471 238
606 3300025910 Ga0207684_10001419 Ga0207684_100014192 238
607 3300025910 Ga0207684_10011757 Ga0207684_100117578 238
608 3300025910 Ga0207684_10624394 Ga0207684_106243941 238
609 3300025911 Ga0207654_10158008 Ga0207654_101580082 238
610 3300025915 Ga0207693_10006708 Ga0207693_100067086 238
611 3300025915 Ga0207693_10024565 Ga0207693_100245656 238
612 3300025915 Ga0207693_10028558 Ga0207693_100285583 238
613 3300025915 Ga0207693_10049527 Ga0207693_100495272 238
614 3300025915 Ga0207693_10083802 Ga0207693_100838022 238
615 3300025915 Ga0207693_10110958 Ga0207693_101109582 238
616 3300025915 Ga0207693_10141649 Ga0207693_101416492 238
617 3300025915 Ga0207693_10210924 Ga0207693_102109242 238
618 3300025916 Ga0207663_10004402 Ga0207663_100044022 238
619 3300025916 Ga0207663_10052859 Ga0207663_100528593 238
620 3300025916 Ga0207663_10114102 Ga0207663_101141022 238
621 3300025916 Ga0207663_10138638 Ga0207663_101386382 238
622 3300025916 Ga0207663_10293890 Ga0207663_102938901 238
623 3300025917 Ga0207660_10217108 Ga0207660_102171081 238
624 3300025918 Ga0207662_10016343 Ga0207662_100163433 238
625 3300025919 Ga0207657_10014199 Ga0207657_100141992 238
626 3300025921 Ga0207652_10041753 Ga0207652_100417533 238
627 3300025921 Ga0207652_10045698 Ga0207652_100456982 238
628 3300025922 Ga0207646_10018804 Ga0207646_100188042 238
629 3300025922 Ga0207646_10032929 Ga0207646_100329295 238
630 3300025922 Ga0207646_10043043 Ga0207646_100430434 238
631 3300025922 Ga0207646_10088253 Ga0207646_100882532 238
632 3300025922 Ga0207646_10344410 Ga0207646_103444102 238
633 3300025924 Ga0207694_10380683 Ga0207694_103806832 238
634 3300025927 Ga0207687_10007838 Ga0207687_100078384 238
635 3300025927 Ga0207687_10057736 Ga0207687_100577363 238
636 3300025928 Ga0207700_10000310 Ga0207700_1000031018 238
637 3300025928 Ga0207700_10017584 Ga0207700_100175841 238
638 3300025928 Ga0207700_10043317 Ga0207700_100433172 238
639 3300025928 Ga0207700_10075550 Ga0207700_100755503 238
640 3300025928 Ga0207700_10098953 Ga0207700_100989532 238
641 3300025928 Ga0207700_10196595 Ga0207700_101965952 238
642 3300025928 Ga0207700_10278050 Ga0207700_102780502 238
643 3300025928 Ga0207700_10353926 Ga0207700_103539262 238
644 3300025928 Ga0207700_10423869 Ga0207700_104238692 238
645 3300025928 Ga0207700_10434246 Ga0207700_104342462 238
646 3300025928 Ga0207700_10545213 Ga0207700_105452132 238
647 3300025928 Ga0207700_10629900 Ga0207700_106299001 238
648 3300025929 Ga0207664_10000526 Ga0207664_1000052617 238
649 3300025929 Ga0207664_10012144 Ga0207664_100121443 238
650 3300025929 Ga0207664_10041475 Ga0207664_100414751 238
651 3300025929 Ga0207664_10106881 Ga0207664_101068812 238
652 3300025929 Ga0207664_10172575 Ga0207664_101725751 238
653 3300025929 Ga0207664_10206660 Ga0207664_102066602 238
654 3300025929 Ga0207664_10222742 Ga0207664_102227422 238
655 3300025929 Ga0207664_10661220 Ga0207664_106612201 238
656 3300025931 Ga0207644_10319838 Ga0207644_103198382 238
657 3300025932 Ga0207690_10087612 Ga0207690_100876122 238
658 3300025933 Ga0207706_10051852 Ga0207706_100518523 238
659 3300025934 Ga0207686_10060887 Ga0207686_100608873 238
660 3300025935 Ga0207709_10091442 Ga0207709_100914423 238
661 3300025939 Ga0207665_10000491 Ga0207665_100004917 238
662 3300025939 Ga0207665_10002136 Ga0207665_100021366 238
663 3300025939 Ga0207665_10040618 Ga0207665_100406182 238
664 3300025939 Ga0207665_10068949 Ga0207665_100689491 238
665 3300025939 Ga0207665_10086767 Ga0207665_100867672 238
666 3300025939 Ga0207665_10087674 Ga0207665_100876743 238
667 3300025939 Ga0207665_10331572 Ga0207665_103315722 238
668 3300025940 Ga0207691_10081824 Ga0207691_100818242 238
669 3300025942 Ga0207689_10053010 Ga0207689_100530102 238
670 3300025944 Ga0207661_10094137 Ga0207661_100941372 238
671 3300025944 Ga0207661_10278577 Ga0207661_102785771 238
672 3300025945 Ga0207679_10059797 Ga0207679_100597972 238
673 3300025949 Ga0207667_10024640 Ga0207667_100246405 238
674 3300025949 Ga0207667_10265136 Ga0207667_102651362 238
675 3300025961 Ga0207712_10182424 Ga0207712_101824242 238
676 3300025986 Ga0207658_10073734 Ga0207658_100737342 238
677 3300026067 Ga0207678_10021933 Ga0207678_100219335 238
678 3300026075 Ga0207708_10115664 Ga0207708_101156643 238
679 3300026078 Ga0207702_10051457 Ga0207702_100514573 238
680 3300026078 Ga0207702_10230756 Ga0207702_102307563 238
681 3300026078 Ga0207702_10251113 Ga0207702_102511132 238
682 3300026078 Ga0207702_10275931 Ga0207702_102759311 238
683 3300026088 Ga0207641_10005170 Ga0207641_100051705 238
684 3300026088 Ga0207641_10019140 Ga0207641_100191403 238
685 3300026095 Ga0207676_10781177 Ga0207676_107811771 238
686 3300026116 Ga0207674_10007070 Ga0207674_100070702 238
687 3300026118 Ga0207675_100017685 Ga0207675_1000176857 238
688 3300026121 Ga0207683_10027857 Ga0207683_100278573 238
689 3300026142 Ga0207698_10247085 Ga0207698_102470851 238
690 3300027907 Ga0207428_10107503 Ga0207428_101075033 238
691 3300028380 Ga0268265_10090268 Ga0268265_100902682 238
692 3300028666 Ga0265336_10005985 Ga0265336_100059852 238
693 3300028800 Ga0265338_10002247 Ga0265338_100022476 238
694 3300031852 Ga0307410_10098675 Ga0307410_100986751 238
695 3300034816 Ga0373930_0075364 Ga0373930_0075364_23_751 238
696 3300034817 Ga0373948_0004868 Ga0373948_0004868_1039_1758 238
697 3300035083 Ga0373926_0002263 Ga0373926_0002263_2061_2789 238
698 3300035083 Ga0373926_0009305 Ga0373926_0009305_59_778 238
699 3300035083 Ga0373926_0185800 Ga0373926_0185800_26_745 238
700 3300035084 Ga0373928_0012131 Ga0373928_0012131_947_1675 238
701 3300035085 Ga0373929_0007096 Ga0373929_0007096_224_943 238
702 3300035085 Ga0373929_0022838 Ga0373929_0022838_529_1257 238
703 3300035086 Ga0373934_0000178 Ga0373934_0000178_21974_22693 238
704 3300035086 Ga0373934_0024467 Ga0373934_0024467_574_1302 238
705 3300035086 Ga0373934_0027208 Ga0373934_0027208_1035_1754 238
706 3300035086 Ga0373934_0053597 Ga0373934_0053597_818_1537 238
707 3300035088 Ga0373940_0000334 Ga0373940_0000334_1010_1729 238
708 3300035089 Ga0373944_0001105 Ga0373944_0001105_4620_5339 238
709 3300035089 Ga0373944_0002206 Ga0373944_0002206_3889_4617 238
710 3300035091 Ga0373951_0100470 Ga0373951_0100470_22_741 238
711 3300035092 Ga0373952_0009007 Ga0373952_0009007_586_1314 238
712 3300035111 Ga0373923_0010792 Ga0373923_0010792_1445_2164 238
713 3300035111 Ga0373923_0031550 Ga0373923_0031550_528_1247 238
714 3300035111 Ga0373923_0056984 Ga0373923_0056984_66_785 238
715 3300035111 Ga0373923_0213472 Ga0373923_0213472_137_865 238
716 3300035113 Ga0373936_0004300 Ga0373936_0004300_3739_4467 238
717 3300035113 Ga0373936_0004395 Ga0373936_0004395_3751_4470 238
718 3300035113 Ga0373936_0016310 Ga0373936_0016310_653_1372 238
719 3300035113 Ga0373936_0028332 Ga0373936_0028332_981_1709 238
720 3300035116 Ga0373945_0001773 Ga0373945_0001773_3787_4506 238
721 3300035116 Ga0373945_0003885 Ga0373945_0003885_2140_2868 238
722 3300035116 Ga0373945_0030731 Ga0373945_0030731_471_1187 238
723 3300035117 Ga0373953_0000696 Ga0373953_0000696_4284_5003 238
724 3300035117 Ga0373953_0081552 Ga0373953_0081552_156_884 238
725 3300035117 Ga0373953_0083099 Ga0373953_0083099_404_1123 238
726 3300035117 Ga0373953_0217476 Ga0373953_0217476_86_805 238
727 3300035118 Ga0373954_0009781 Ga0373954_0009781_1477_2196 238
728 3300035118 Ga0373954_0016521 Ga0373954_0016521_147_866 238
729 3300035119 Ga0373956_0000007 Ga0373956_0000007_37271_37990 238
730 3300035119 Ga0373956_0013689 Ga0373956_0013689_1386_2105 238
731 3300035119 Ga0373956_0013750 Ga0373956_0013750_878_1597 238
732 3300035119 Ga0373956_0044151 Ga0373956_0044151_1184_1912 238
733 3300035120 Ga0373957_0000024 Ga0373957_0000024_18004_18723 238
734 3300035120 Ga0373957_0000648 Ga0373957_0000648_634_1353 238
735 3300035120 Ga0373957_0011153 Ga0373957_0011153_1490_2209 238
736 3300035120 Ga0373957_0039868 Ga0373957_0039868_975_1703 238
737 3300035121 Ga0373960_0021841 Ga0373960_0021841_936_1664 238
738 3300035170 Ga0373943_0006873 Ga0373943_0006873_1194_1922 238
739 3300035170 Ga0373943_0013679 Ga0373943_0013679_2330_3049 238
740 3300035171 Ga0373946_0000327 Ga0373946_0000327_1168_1887 238
741 3300035171 Ga0373946_0002911 Ga0373946_0002911_3672_4400 238
742 3300035172 Ga0373955_0000007 Ga0373955_0000007_17292_18011 238
743 3300035172 Ga0373955_0002791 Ga0373955_0002791_751_1470 238
744 3300035172 Ga0373955_0005022 Ga0373955_0005022_4395_5114 238
745 3300035172 Ga0373955_0010689 Ga0373955_0010689_3282_4001 238
746 3300035172 Ga0373955_0183118 Ga0373955_0183118_331_1059 238
747 3300035207 Ga0373942_0018861 Ga0373942_0018861_435_1154 238
748 3300035207 Ga0373942_0024404 Ga0373942_0024404_458_1186 238
749 3300035241 Ga0373961_0017989 Ga0373961_0017989_418_1146 238
750 3300035241 Ga0373961_0030034 Ga0373961_0030034_231_950 238
751 3300035398 Ga0316574_0025746 Ga0316574_0025746_1997_2725 238
752 3300035410 Ga0373924_0001299 Ga0373924_0001299_5203_5922 238
753 3300035410 Ga0373924_0005508 Ga0373924_0005508_3135_3854 238
754 3300035410 Ga0373924_0010699 Ga0373924_0010699_1766_2485 238
755 3300035410 Ga0373924_0268401 Ga0373924_0268401_14_742 238
756 3300035691 Ga0373931_0030267 Ga0373931_0030267_600_1319 238
757 3300035691 Ga0373931_0042816 Ga0373931_0042816_97_813 238
758 3300035691 Ga0373931_0174482 Ga0373931_0174482_511_1230 238
759 3300035691 Ga0373931_0194989 Ga0373931_0194989_27_746 238
760 3300035691 Ga0373931_0363681 Ga0373931_0363681_17_745 238
761 3300035691 Ga0373931_0380633 Ga0373931_0380633_73_801 238
762 3300035692 Ga0373935_0006552 Ga0373935_0006552_3145_3873 238
763 3300035692 Ga0373935_0027546 Ga0373935_0027546_71_799 238
764 3300035692 Ga0373935_0038058 Ga0373935_0038058_1556_2275 238
765 3300035692 Ga0373935_0060602 Ga0373935_0060602_1472_2191 238
766 3300035692 Ga0373935_0158069 Ga0373935_0158069_290_1009 238
767 3300035692 Ga0373935_0184846 Ga0373935_0184846_243_962 238
768 3300035692 Ga0373935_0473924 Ga0373935_0473924_109_837 238
769 3300035695 Ga0373927_0013530 Ga0373927_0013530_3274_3993 238
770 3300035695 Ga0373927_0060456 Ga0373927_0060456_516_1244 238
771 3300035724 Ga0373933_0000002 Ga0373933_0000002_81134_81853 238
772 3300035724 Ga0373933_0002549 Ga0373933_0002549_6288_7007 238
773 3300035724 Ga0373933_0013620 Ga0373933_0013620_1652_2371 238
774 3300035724 Ga0373933_0027940 Ga0373933_0027940_1945_2673 238
775 3300035724 Ga0373933_0029337 Ga0373933_0029337_111_830 238
776 3300035724 Ga0373933_0080777 Ga0373933_0080777_298_1026 238
777 3300035724 Ga0373933_0081322 Ga0373933_0081322_876_1595 238
778 3300035724 Ga0373933_0279046 Ga0373933_0279046_162_881 238
779 3300035724 Ga0373933_0428221 Ga0373933_0428221_91_810 238
780 3300035725 Ga0373947_0005412 Ga0373947_0005412_752_1480 238
781 3300035725 Ga0373947_0400845 Ga0373947_0400845_56_775 238
782 3300035725 Ga0373947_0486175 Ga0373947_0486175_23_742 238
783 3300036401 Ga0373937_0000014 Ga0373937_0000014_69933_70652 238
784 3300036401 Ga0373937_0005563 Ga0373937_0005563_3278_3997 238
785 3300036401 Ga0373937_0020358 Ga0373937_0020358_304_1023 238
786 3300036401 Ga0373937_0060449 Ga0373937_0060449_129_848 238
787 3300036401 Ga0373937_0064687 Ga0373937_0064687_1202_1930 238
788 3300036401 Ga0373937_0135505 Ga0373937_0135505_299_1027 238
789 3300036401 Ga0373937_0142160 Ga0373937_0142160_286_1005 238
790 3300036401 Ga0373937_0156739 Ga0373937_0156739_607_1326 238
791 3300036401 Ga0373937_0338579 Ga0373937_0338579_530_1249 238
792 3300036401 Ga0373937_0639025 Ga0373937_0639025_187_915 238
793 3300036459 Ga0372808_000497 Ga0372808_000497_2279_2998 238
794 3300036712 Ga0316584_0007712 Ga0316584_0007712_6435_7163 238
795 3300036712 Ga0316584_0393239 Ga0316584_0393239_249_968 238
796 3300037068 Ga0373925_0000386 Ga0373925_0000386_30948_31667 238
797 3300037068 Ga0373925_0008493 Ga0373925_0008493_3649_4377 238
798 3300037068 Ga0373925_0010386 Ga0373925_0010386_5446_6165 238
799 3300037068 Ga0373925_0025652 Ga0373925_0025652_2887_3606 238
800 3300037068 Ga0373925_0054033 Ga0373925_0054033_1506_2225 238
801 3300037068 Ga0373925_0072768 Ga0373925_0072768_1123_1842 238
802 3300037068 Ga0373925_0128358 Ga0373925_0128358_12_731 238
803 3300037068 Ga0373925_0411770 Ga0373925_0411770_12_731 238
804 3300037853 Ga0436364_0473707 Ga0436364_0473707_1043_1771 238
805 3300037853 Ga0436364_0614856 Ga0436364_0614856_8822_9541 238
806 3300037853 Ga0436364_0929327 Ga0436364_0929327_1003_1722 238
807 3300037853 Ga0436364_1121015 Ga0436364_1121015_31_759 238
808 3300037853 Ga0436364_1224579 Ga0436364_1224579_16171_16893 238
809 3300037853 Ga0436364_1419794 Ga0436364_1419794_469_1203 238
810 3300037853 Ga0436364_1557633 Ga0436364_1557633_1541_2266 238
811 3300039437 Ga0436365_0284137 Ga0436365_0284137_68_796 238
812 3300042876 Ga0451577_0005184 Ga0451577_0005184_1195_1929 238
813 3300044684 Ga0466966_0022589 Ga0466966_0022589_2649_3377 238
814 3300044684 Ga0466966_0298613 Ga0466966_0298613_96_821 238
815 3300044693 Ga0466961_0212492 Ga0466961_0212492_85_855 238
816 3300044693 Ga0466961_0231279 Ga0466961_0231279_393_1121 238
817 3300044712 Ga0453684_0046076 Ga0453684_0046076_1340_2074 238
818 3300045049 Ga0466959_0125910 Ga0466959_0125910_661_1386 238
819 3300045836 Ga0466958_0004717 Ga0466958_0004717_3933_4661 238
820 3300045976 Ga0466967_0157834 Ga0466967_0157834_948_1697 238
821 3300045976 Ga0466967_0300560 Ga0466967_0300560_511_1278 238
822 3300045976 Ga0466967_0948864 Ga0466967_0948864_49_810 238
823 3300046454 Ga0495592_0000077 Ga0495592_0000077_15186_15905 238
824 3300046454 Ga0495592_0016114 Ga0495592_0016114_574_1293 238
825 3300046454 Ga0495592_0081060 Ga0495592_0081060_125_844 238
826 3300046454 Ga0495592_0158292 Ga0495592_0158292_821_1537 238
827 3300046454 Ga0495592_0302894 Ga0495592_0302894_272_1000 238
828 3300046455 Ga0495603_0002146 Ga0495603_0002146_8845_9564 238
829 3300046455 Ga0495603_0083631 Ga0495603_0083631_402_1121 238
830 3300046459 Ga0495629_0014897 Ga0495629_0014897_4128_4847 238
831 3300046459 Ga0495629_0017639 Ga0495629_0017639_2698_3417 238
832 3300046459 Ga0495629_0199859 Ga0495629_0199859_633_1361 238
833 3300046459 Ga0495629_0207285 Ga0495629_0207285_80_799 238
834 3300046461 Ga0495641_0020237 Ga0495641_0020237_183_911 238
835 3300046461 Ga0495641_0024989 Ga0495641_0024989_1934_2653 238
836 3300046461 Ga0495641_0123042 Ga0495641_0123042_406_1125 238
837 3300046462 Ga0495651_0000019 Ga0495651_0000019_69933_70652 238
838 3300046462 Ga0495651_0015418 Ga0495651_0015418_1884_2603 238
839 3300046462 Ga0495651_0016634 Ga0495651_0016634_4479_5198 238
840 3300046462 Ga0495651_0021996 Ga0495651_0021996_4174_4902 238
841 3300046462 Ga0495651_0028479 Ga0495651_0028479_3092_3811 238
842 3300046462 Ga0495651_0085790 Ga0495651_0085790_1307_2026 238
843 3300046462 Ga0495651_0130927 Ga0495651_0130927_1046_1774 238
844 3300046462 Ga0495651_0159964 Ga0495651_0159964_409_1128 238
845 3300046463 Ga0495653_0029955 Ga0495653_0029955_1853_2572 238
846 3300046463 Ga0495653_0034240 Ga0495653_0034240_843_1571 238
847 3300046463 Ga0495653_0041955 Ga0495653_0041955_281_1000 238
848 3300046463 Ga0495653_0064840 Ga0495653_0064840_1572_2291 238
849 3300046463 Ga0495653_0074947 Ga0495653_0074947_373_1092 238
850 3300046463 Ga0495653_0079650 Ga0495653_0079650_1031_1759 238
851 3300046463 Ga0495653_0086682 Ga0495653_0086682_1438_2157 238
852 3300046463 Ga0495653_0168347 Ga0495653_0168347_738_1457 238
853 3300046463 Ga0495653_0184688 Ga0495653_0184688_216_935 238
854 3300046463 Ga0495653_0238815 Ga0495653_0238815_90_818 238
855 3300046472 Ga0495580_0005000 Ga0495580_0005000_8256_8975 238
856 3300046473 Ga0495582_0032621 Ga0495582_0032621_1445_2164 238
857 3300046473 Ga0495582_0038542 Ga0495582_0038542_968_1687 238
858 3300046473 Ga0495582_0206452 Ga0495582_0206452_96_815 238
859 3300046475 Ga0495639_0001825 Ga0495639_0001825_962_1681 238
860 3300046475 Ga0495639_0069621 Ga0495639_0069621_813_1532 238
861 3300046476 Ga0495662_0002061 Ga0495662_0002061_7902_8621 238
862 3300046476 Ga0495662_0055381 Ga0495662_0055381_563_1291 238
863 3300046477 Ga0495664_0002274 Ga0495664_0002274_5605_6333 238
864 3300046477 Ga0495664_0036255 Ga0495664_0036255_703_1422 238
865 3300046477 Ga0495664_0112003 Ga0495664_0112003_560_1279 238
866 3300046499 Ga0495594_0036555 Ga0495594_0036555_803_1522 238
867 3300046499 Ga0495594_0117303 Ga0495594_0117303_335_1054 238
868 3300046499 Ga0495594_0120319 Ga0495594_0120319_126_845 238
869 3300046511 Ga0495608_0000028 Ga0495608_0000028_81126_81845 238
870 3300046511 Ga0495608_0007762 Ga0495608_0007762_6490_7209 238
871 3300046511 Ga0495608_0011341 Ga0495608_0011341_1785_2504 238
872 3300046511 Ga0495608_0034561 Ga0495608_0034561_2253_2972 238
873 3300046511 Ga0495608_0043346 Ga0495608_0043346_1649_2377 238
874 3300046511 Ga0495608_0073174 Ga0495608_0073174_1168_1887 238
875 3300046511 Ga0495608_0226423 Ga0495608_0226423_245_964 238
876 3300046511 Ga0495608_0403640 Ga0495608_0403640_22_750 238
877 3300046514 Ga0495618_0020924 Ga0495618_0020924_2868_3587 238
878 3300046514 Ga0495618_0027798 Ga0495618_0027798_1036_1755 238
879 3300046514 Ga0495618_0039948 Ga0495618_0039948_1561_2289 238
880 3300046514 Ga0495618_0054126 Ga0495618_0054126_882_1601 238
881 3300046514 Ga0495618_0310421 Ga0495618_0310421_28_756 238
882 3300046516 Ga0495628_0000337 Ga0495628_0000337_23558_24277 238
883 3300046516 Ga0495628_0055160 Ga0495628_0055160_1171_1890 238
884 3300046516 Ga0495628_0087344 Ga0495628_0087344_542_1261 238
885 3300046516 Ga0495628_0095685 Ga0495628_0095685_1063_1782 238
886 3300046516 Ga0495628_0100556 Ga0495628_0100556_1466_2185 238
887 3300046516 Ga0495628_0193003 Ga0495628_0193003_479_1207 238
888 3300046516 Ga0495628_0207250 Ga0495628_0207250_530_1249 238
889 3300046517 Ga0495630_0019317 Ga0495630_0019317_24_752 238
890 3300046517 Ga0495630_0020707 Ga0495630_0020707_778_1497 238
891 3300046517 Ga0495630_0084355 Ga0495630_0084355_419_1138 238
892 3300046517 Ga0495630_0154028 Ga0495630_0154028_229_945 238
893 3300046517 Ga0495630_0178799 Ga0495630_0178799_796_1515 238
894 3300046526 Ga0495666_0001318 Ga0495666_0001318_2888_3607 238
895 3300046529 Ga0495652_0000031 Ga0495652_0000031_81114_81833 238
896 3300046529 Ga0495652_0009083 Ga0495652_0009083_1947_2666 238
897 3300046529 Ga0495652_0087437 Ga0495652_0087437_1572_2291 238
898 3300046529 Ga0495652_0099435 Ga0495652_0099435_1626_2345 238
899 3300046529 Ga0495652_0109846 Ga0495652_0109846_927_1646 238
900 3300046529 Ga0495652_0128119 Ga0495652_0128119_605_1333 238
901 3300046531 Ga0495665_0001806 Ga0495665_0001806_149_868 238
902 3300046531 Ga0495665_0009930 Ga0495665_0009930_3428_4147 238
903 3300046531 Ga0495665_0016348 Ga0495665_0016348_950_1669 238
904 3300046533 Ga0495640_0006719 Ga0495640_0006719_7955_8674 238
905 3300046533 Ga0495640_0022291 Ga0495640_0022291_2613_3332 238
906 3300046533 Ga0495640_0027147 Ga0495640_0027147_2917_3636 238
907 3300046533 Ga0495640_0035192 Ga0495640_0035192_2432_3160 238
908 3300046533 Ga0495640_0079302 Ga0495640_0079302_366_1085 238
909 3300046533 Ga0495640_0202859 Ga0495640_0202859_341_1069 238
910 3300046533 Ga0495640_0228459 Ga0495640_0228459_401_1120 238
911 3300046535 Ga0495586_0039162 Ga0495586_0039162_378_1097 238
912 3300046535 Ga0495586_0066457 Ga0495586_0066457_722_1441 238
913 3300046535 Ga0495586_0075096 Ga0495586_0075096_307_1023 238
914 3300046536 Ga0495587_0000023 Ga0495587_0000023_69911_70630 238
915 3300046536 Ga0495587_0010360 Ga0495587_0010360_4597_5316 238
916 3300046536 Ga0495587_0015544 Ga0495587_0015544_1071_1790 238
917 3300046536 Ga0495587_0057581 Ga0495587_0057581_851_1570 238
918 3300046536 Ga0495587_0066315 Ga0495587_0066315_1068_1787 238
919 3300046536 Ga0495587_0069693 Ga0495587_0069693_463_1182 238
920 3300046543 Ga0495645_0009718 Ga0495645_0009718_4582_5301 238
921 3300046543 Ga0495645_0037752 Ga0495645_0037752_1720_2439 238
922 3300046543 Ga0495645_0040802 Ga0495645_0040802_2503_3222 238
923 3300046543 Ga0495645_0057048 Ga0495645_0057048_139_858 238
924 3300046543 Ga0495645_0098946 Ga0495645_0098946_669_1388 238
925 3300046559 Ga0495667_0000054 Ga0495667_0000054_81126_81845 238
926 3300046559 Ga0495667_0003678 Ga0495667_0003678_8769_9488 238
927 3300046559 Ga0495667_0005611 Ga0495667_0005611_3955_4674 238
928 3300046559 Ga0495667_0016694 Ga0495667_0016694_2476_3195 238
929 3300046559 Ga0495667_0025078 Ga0495667_0025078_373_1092 238
930 3300046559 Ga0495667_0049312 Ga0495667_0049312_489_1217 238
931 3300046559 Ga0495667_0049945 Ga0495667_0049945_603_1331 238
932 3300046559 Ga0495667_0327836 Ga0495667_0327836_192_920 238
933 3300046642 Ga0495634_0015195 Ga0495634_0015195_4640_5359 238
934 3300046642 Ga0495634_0015203 Ga0495634_0015203_2143_2862 238
935 3300046642 Ga0495634_0052627 Ga0495634_0052627_1914_2633 238
936 3300046642 Ga0495634_0172169 Ga0495634_0172169_72_800 238
937 3300046663 Ga0495635_0003379 Ga0495635_0003379_1479_2207 238
938 3300046663 Ga0495635_0009152 Ga0495635_0009152_468_1196 238
939 3300046663 Ga0495635_0023322 Ga0495635_0023322_3325_4044 238
940 3300046663 Ga0495635_0063598 Ga0495635_0063598_1241_1960 238
941 3300046663 Ga0495635_0064048 Ga0495635_0064048_40_759 238
942 3300046663 Ga0495635_0088812 Ga0495635_0088812_477_1196 238
943 3300046674 Ga0495588_0033638 Ga0495588_0033638_420_1139 238
944 3300046674 Ga0495588_0103668 Ga0495588_0103668_624_1343 238
945 3300046675 Ga0495657_0000022 Ga0495657_0000022_81134_81853 238
946 3300046675 Ga0495657_0011867 Ga0495657_0011867_2668_3387 238
947 3300046675 Ga0495657_0018129 Ga0495657_0018129_1914_2642 238
948 3300046675 Ga0495657_0023212 Ga0495657_0023212_3681_4400 238
949 3300046675 Ga0495657_0024268 Ga0495657_0024268_3554_4273 238
950 3300046675 Ga0495657_0044914 Ga0495657_0044914_1041_1760 238
951 3300046675 Ga0495657_0068295 Ga0495657_0068295_1011_1730 238
952 3300046675 Ga0495657_0090107 Ga0495657_0090107_979_1707 238
953 3300046675 Ga0495657_0090770 Ga0495657_0090770_1213_1941 238
954 3300046675 Ga0495657_0128882 Ga0495657_0128882_777_1496 238
955 3300046678 Ga0495599_0000125 Ga0495599_0000125_27775_28494 238
956 3300046678 Ga0495599_0009774 Ga0495599_0009774_1767_2486 238
957 3300046678 Ga0495599_0015168 Ga0495599_0015168_1362_2081 238
958 3300046678 Ga0495599_0031267 Ga0495599_0031267_1063_1782 238
959 3300046678 Ga0495599_0081111 Ga0495599_0081111_232_951 238
960 3300046678 Ga0495599_0105055 Ga0495599_0105055_579_1298 238
961 3300046678 Ga0495599_0310631 Ga0495599_0310631_11_739 238
962 3300046679 Ga0495623_0000797 Ga0495623_0000797_17338_18057 238
963 3300046679 Ga0495623_0015589 Ga0495623_0015589_2750_3469 238
964 3300046679 Ga0495623_0067815 Ga0495623_0067815_801_1520 238
965 3300046679 Ga0495623_0079290 Ga0495623_0079290_978_1697 238
966 3300046679 Ga0495623_0114069 Ga0495623_0114069_706_1425 238
967 3300046679 Ga0495623_0153471 Ga0495623_0153471_374_1093 238
968 3300046680 Ga0495646_0008062 Ga0495646_0008062_5040_5759 238
969 3300046680 Ga0495646_0010047 Ga0495646_0010047_1492_2211 238
970 3300046680 Ga0495646_0019837 Ga0495646_0019837_2298_3017 238
971 3300046680 Ga0495646_0024184 Ga0495646_0024184_930_1649 238
972 3300046680 Ga0495646_0026611 Ga0495646_0026611_2754_3473 238
973 3300046680 Ga0495646_0047563 Ga0495646_0047563_565_1284 238
974 3300046680 Ga0495646_0104435 Ga0495646_0104435_840_1568 238
975 3300046680 Ga0495646_0289224 Ga0495646_0289224_111_839 238
976 3300046681 Ga0495647_0079380 Ga0495647_0079380_40_759 238
977 3300046683 Ga0495658_0002496 Ga0495658_0002496_6367_7086 238
978 3300046683 Ga0495658_0008261 Ga0495658_0008261_3660_4379 238
979 3300046689 Ga0495613_0001385 Ga0495613_0001385_7062_7778 238
980 3300046689 Ga0495613_0033969 Ga0495613_0033969_927_1646 238
981 3300046689 Ga0495613_0035450 Ga0495613_0035450_2837_3556 238
982 3300046689 Ga0495613_0143885 Ga0495613_0143885_928_1647 238
983 3300046690 Ga0495624_0021852 Ga0495624_0021852_1835_2563 238
984 3300046690 Ga0495624_0094544 Ga0495624_0094544_585_1304 238
985 3300046690 Ga0495624_0205833 Ga0495624_0205833_439_1158 238
986 3300046809 Ga0495600_0004170 Ga0495600_0004170_3596_4315 238
987 3300046809 Ga0495600_0004827 Ga0495600_0004827_6206_6925 238
988 3300046809 Ga0495600_0009896 Ga0495600_0009896_551_1270 238
989 3300046809 Ga0495600_0112200 Ga0495600_0112200_613_1332 238
990 3300047315 Ga0495581_0002443 Ga0495581_0002443_8762_9481 238
991 3300047315 Ga0495581_0053632 Ga0495581_0053632_1442_2161 238
992 3300047315 Ga0495581_0061380 Ga0495581_0061380_270_989 238
993 3300047315 Ga0495581_0090165 Ga0495581_0090165_240_968 238
994 3300047315 Ga0495581_0214482 Ga0495581_0214482_344_1063 238
995 3300047317 Ga0495604_0000022 Ga0495604_0000022_81093_81812 238
996 3300047317 Ga0495604_0001765 Ga0495604_0001765_8209_8928 238
997 3300047317 Ga0495604_0031910 Ga0495604_0031910_3218_3937 238
998 3300047317 Ga0495604_0047725 Ga0495604_0047725_2103_2822 238
999 3300047317 Ga0495604_0080450 Ga0495604_0080450_1515_2234 238
1000 3300047317 Ga0495604_0085425 Ga0495604_0085425_209_928 238
1001 3300047319 Ga0495674_0000494 Ga0495674_0000494_27977_28705 238
1002 3300047319 Ga0495674_0004554 Ga0495674_0004554_7116_7835 238
1003 3300047319 Ga0495674_0010807 Ga0495674_0010807_6154_6873 238
1004 3300047319 Ga0495674_0029470 Ga0495674_0029470_425_1144 238
1005 3300047319 Ga0495674_0038833 Ga0495674_0038833_1001_1720 238
1006 3300047319 Ga0495674_0150371 Ga0495674_0150371_370_1089 238
1007 3300047321 Ga0495676_0013531 Ga0495676_0013531_2748_3476 238
1008 3300047321 Ga0495676_0020535 Ga0495676_0020535_2248_2967 238
1009 3300047322 Ga0495680_0000154 Ga0495680_0000154_45311_46030 238
1010 3300047322 Ga0495680_0002272 Ga0495680_0002272_17206_17934 238
1011 3300047322 Ga0495680_0003207 Ga0495680_0003207_8362_9081 238
1012 3300047322 Ga0495680_0021868 Ga0495680_0021868_190_909 238
1013 3300047322 Ga0495680_0075393 Ga0495680_0075393_1328_2047 238
1014 3300047322 Ga0495680_0082276 Ga0495680_0082276_856_1575 238
1015 3300047322 Ga0495680_0082341 Ga0495680_0082341_1241_1960 238
1016 3300047322 Ga0495680_0262846 Ga0495680_0262846_211_930 238
1017 3300047322 Ga0495680_0389736 Ga0495680_0389736_211_930 238
1018 3300047322 Ga0495680_0415797 Ga0495680_0415797_140_856 238
1019 3300047444 Ga0495675_0000235 Ga0495675_0000235_25922_26641 238
1020 3300047444 Ga0495675_0057165 Ga0495675_0057165_176_895 238
1021 3300047444 Ga0495675_0123536 Ga0495675_0123536_738_1457 238
1022 3300047471 Ga0495684_0002869 Ga0495684_0002869_9018_9746 238
1023 3300047471 Ga0495684_0012510 Ga0495684_0012510_478_1197 238
1024 3300047471 Ga0495684_0015089 Ga0495684_0015089_2109_2828 238
1025 3300047471 Ga0495684_0016613 Ga0495684_0016613_4885_5613 238
1026 3300047471 Ga0495684_0025760 Ga0495684_0025760_3666_4385 238
1027 3300047471 Ga0495684_0034261 Ga0495684_0034261_3089_3808 238
1028 3300047471 Ga0495684_0091242 Ga0495684_0091242_33_752 238
1029 3300047673 Ga0495593_0040534 Ga0495593_0040534_1556_2275 238
1030 3300047673 Ga0495593_0159731 Ga0495593_0159731_124_852 238
1031 3300048088 Ga0495602_0000251 Ga0495602_0000251_9202_9921 238
1032 3300048088 Ga0495602_0031755 Ga0495602_0031755_551_1270 238
1033 3300048088 Ga0495602_0047899 Ga0495602_0047899_775_1494 238
1034 3300048088 Ga0495602_0098103 Ga0495602_0098103_1645_2364 238
1035 3300048088 Ga0495602_0129271 Ga0495602_0129271_227_946 238
1036 3300048088 Ga0495602_0134951 Ga0495602_0134951_1051_1770 238
1037 3300048088 Ga0495602_0216176 Ga0495602_0216176_19_747 238
1038 3300048088 Ga0495602_0305968 Ga0495602_0305968_39_758 238
1039 3300048089 Ga0495614_0011860 Ga0495614_0011860_3067_3786 238
1040 3300048089 Ga0495614_0200634 Ga0495614_0200634_90_809 238
1041 3300048903 Ga0496100_0022256 Ga0496100_0022256_295_1011 238
1042 3300048903 Ga0496100_0249927 Ga0496100_0249927_65_784 238
1043 3300048904 Ga0496101_0033097 Ga0496101_0033097_2629_3345 238
1044 3300048904 Ga0496101_0077013 Ga0496101_0077013_982_1701 238
1045 3300048905 Ga0496102_0021652 Ga0496102_0021652_1086_1802 238
1046 3300048905 Ga0496102_0033453 Ga0496102_0033453_2831_3586 238
1047 3300048905 Ga0496102_0049769 Ga0496102_0049769_1339_2058 238
1048 3300048905 Ga0496102_0076608 Ga0496102_0076608_165_884 238
1049 3300048905 Ga0496102_0080804 Ga0496102_0080804_517_1245 238
1050 3300048905 Ga0496102_0204436 Ga0496102_0204436_365_1111 238
1051 3300048906 Ga0496103_0105046 Ga0496103_0105046_906_1625 238
1052 3300048907 Ga0496104_0000798 Ga0496104_0000798_2013_2732 238
1053 3300048907 Ga0496104_0020944 Ga0496104_0020944_2685_3401 238
1054 3300048907 Ga0496104_0087856 Ga0496104_0087856_435_1154 238
1055 3300048907 Ga0496104_0109492 Ga0496104_0109492_207_935 238
1056 3300048907 Ga0496104_0219756 Ga0496104_0219756_373_1119 238
1057 3300048908 Ga0496105_0001126 Ga0496105_0001126_5353_6072 238
1058 3300048908 Ga0496105_0004860 Ga0496105_0004860_457_1185 238
1059 3300048908 Ga0496105_0009994 Ga0496105_0009994_1016_1735 238
1060 3300048908 Ga0496105_0041023 Ga0496105_0041023_2099_2845 238
1061 3300048908 Ga0496105_0087943 Ga0496105_0087943_1717_2436 238
1062 3300048908 Ga0496105_0263643 Ga0496105_0263643_393_1148 238
1063 3300048909 Ga0496106_0197015 Ga0496106_0197015_238_966 238
1064 3300048909 Ga0496106_0369870 Ga0496106_0369870_123_869 238
1065 3300048909 Ga0496106_0686605 Ga0496106_0686605_54_773 238
1066 3300048910 Ga0496107_0169151 Ga0496107_0169151_91_819 238
1067 3300048910 Ga0496107_0660902 Ga0496107_0660902_30_749 238
1068 3300048911 Ga0496108_0010116 Ga0496108_0010116_4862_5581 238
1069 3300048911 Ga0496108_0058645 Ga0496108_0058645_986_1705 238
1070 3300048911 Ga0496108_0171082 Ga0496108_0171082_883_1602 238
1071 3300048912 Ga0496109_0010754 Ga0496109_0010754_6217_6936 238
1072 3300048912 Ga0496109_0069469 Ga0496109_0069469_544_1290 238
1073 3300048912 Ga0496109_0088948 Ga0496109_0088948_1858_2577 238
1074 3300048912 Ga0496109_0153563 Ga0496109_0153563_527_1246 238
1075 3300048912 Ga0496109_0664365 Ga0496109_0664365_187_942 238
1076 3300048913 Ga0496110_0002119 Ga0496110_0002119_4804_5523 238
1077 3300048913 Ga0496110_0051330 Ga0496110_0051330_499_1227 238
1078 3300048913 Ga0496110_0059226 Ga0496110_0059226_2401_3156 238
1079 3300048913 Ga0496110_0066320 Ga0496110_0066320_158_904 238
1080 3300048913 Ga0496110_0081208 Ga0496110_0081208_2031_2750 238
1081 3300048913 Ga0496110_0503852 Ga0496110_0503852_334_1053 238
1082 3300048914 Ga0496111_0015650 Ga0496111_0015650_2163_2891 238
1083 3300048914 Ga0496111_0065831 Ga0496111_0065831_1795_2550 238
1084 3300048914 Ga0496111_0126246 Ga0496111_0126246_1079_1825 238
1085 3300048915 Ga0496112_0000937 Ga0496112_0000937_6942_7661 238
1086 3300048915 Ga0496112_0064145 Ga0496112_0064145_756_1475 238
1087 3300048915 Ga0496112_0425477 Ga0496112_0425477_406_1125 238
1088 3300048916 Ga0496113_0048136 Ga0496113_0048136_879_1598 238
1089 3300048916 Ga0496113_0094461 Ga0496113_0094461_1195_1941 238
1090 3300048916 Ga0496113_0108558 Ga0496113_0108558_512_1231 238
1091 3300048916 Ga0496113_0654438 Ga0496113_0654438_11_730 238
1092 3300048917 Ga0496114_0007913 Ga0496114_0007913_2919_3638 238
1093 3300048917 Ga0496114_0022774 Ga0496114_0022774_2105_2824 238
1094 3300048917 Ga0496114_0026592 Ga0496114_0026592_2902_3648 238
1095 3300048917 Ga0496114_0051258 Ga0496114_0051258_2284_3012 238
1096 3300048917 Ga0496114_0240459 Ga0496114_0240459_442_1161 238
1097 3300048918 Ga0496115_0002788 Ga0496115_0002788_2168_2884 238
1098 3300048918 Ga0496115_0017876 Ga0496115_0017876_599_1318 238
1099 3300048918 Ga0496115_0037786 Ga0496115_0037786_1035_1754 238
1100 3300048918 Ga0496115_0068363 Ga0496115_0068363_604_1359 238
1101 3300048918 Ga0496115_0127063 Ga0496115_0127063_513_1232 238
1102 3300048929 Ga0496126_0457827 Ga0496126_0457827_158_886 238
1103 3300049568 Ga0501031_0343747 Ga0501031_0343747_206_925 238
1104 3300049569 Ga0501032_0131420 Ga0501032_0131420_814_1533 238
1105 3300049573 Ga0501037_0390454 Ga0501037_0390454_169_888 238
1106 3300049574 Ga0501038_0060613 Ga0501038_0060613_2094_2813 238
1107 3300049575 Ga0501039_0021168 Ga0501039_0021168_3882_4601 238
1108 3300049576 Ga0501040_0008399 Ga0501040_0008399_296_1015 238
1109 3300049576 Ga0501040_0080288 Ga0501040_0080288_209_934 238
1110 3300049576 Ga0501040_0438936 Ga0501040_0438936_22_741 238
1111 3300049577 Ga0501041_0021802 Ga0501041_0021802_473_1192 238
1112 3300049577 Ga0501041_0164436 Ga0501041_0164436_38_757 238
1113 3300049578 Ga0501042_0083950 Ga0501042_0083950_989_1708 238
1114 3300049581 Ga0501047_0716450 Ga0501047_0716450_62_781 238
1115 3300049582 Ga0501048_0019722 Ga0501048_0019722_709_1428 238
1116 3300049582 Ga0501048_0358636 Ga0501048_0358636_61_780 238
1117 3300049586 Ga0501070_0227360 Ga0501070_0227360_702_1421 238
1118 3300049587 Ga0501071_0011060 Ga0501071_0011060_2360_3079 238
1119 3300049588 Ga0501072_0016014 Ga0501072_0016014_3090_3809 238
1120 3300049590 Ga0501074_0160877 Ga0501074_0160877_120_839 238
1121 3300049591 Ga0501075_0185946 Ga0501075_0185946_769_1497 238
1122 3300049592 Ga0501076_0027580 Ga0501076_0027580_3366_4085 238
1123 3300049593 Ga0501077_0083268 Ga0501077_0083268_843_1562 238
1124 3300049741 Ga0501079_0104256 Ga0501079_0104256_43_762 238
1125 3300049743 Ga0501081_0116935 Ga0501081_0116935_576_1295 238
1126 3300049744 Ga0501083_0204432 Ga0501083_0204432_555_1274 238
1127 3300049822 Ga0501035_0191888 Ga0501035_0191888_550_1269 238
1128 3300049823 Ga0501044_0641213 Ga0501044_0641213_127_846 238
1129 3300050507 nmdc:mga05p37_40546_c1 nmdc:mga05p37_40546_c1_2308_3027 238
1130 3300050511 nmdc:mga08y16_61137_c1 nmdc:mga08y16_61137_c1_186_905 238
1131 3300050512 nmdc:mga0n895_285428_c1 nmdc:mga0n895_285428_c1_431_1150 238
1132 3300050512 nmdc:mga0n895_32660_c1 nmdc:mga0n895_32660_c1_1819_2538 238
1133 3300050513 nmdc:mga0rr50_157904_c1 nmdc:mga0rr50_157904_c1_538_1257 238
1134 3300050513 nmdc:mga0rr50_202178_c1 nmdc:mga0rr50_202178_c1_153_872 238
1135 3300050513 nmdc:mga0rr50_701450_c1 nmdc:mga0rr50_701450_c1_79_807 238
1136 3300050514 nmdc:mga08x19_107954_c1 nmdc:mga08x19_107954_c1_702_1421 238
1137 3300050514 nmdc:mga08x19_508315_c1 nmdc:mga08x19_508315_c1_34_762 238
1138 3300050514 nmdc:mga08x19_629170_c1 nmdc:mga08x19_629170_c1_31_750 238
1139 3300053077 Ga0495601_0006711 Ga0495601_0006711_1355_2074 238
1140 3300053077 Ga0495601_0007677 Ga0495601_0007677_454_1173 238
1141 3300053077 Ga0495601_0018237 Ga0495601_0018237_617_1336 238
1142 3300053077 Ga0495601_0106249 Ga0495601_0106249_787_1503 238
1143 3300053077 Ga0495601_0136800 Ga0495601_0136800_151_870 238
1144 3300053077 Ga0495601_0208939 Ga0495601_0208939_14_742 238
1145 3300053077 Ga0495601_0448109 Ga0495601_0448109_44_763 238
1146 3300053078 Ga0495612_0001584 Ga0495612_0001584_1045_1764 238
1147 3300053078 Ga0495612_0033386 Ga0495612_0033386_88_807 238
1148 3300053084 Ga0495595_0002186 Ga0495595_0002186_3973_4692 238
1149 3300053084 Ga0495595_0009141 Ga0495595_0009141_3004_3723 238
1150 3300053084 Ga0495595_0009413 Ga0495595_0009413_427_1146 238
1151 3300053084 Ga0495595_0046501 Ga0495595_0046501_373_1092 238
1152 3300053084 Ga0495595_0069903 Ga0495595_0069903_284_1000 238
1153 3300053085 Ga0495619_0000588 Ga0495619_0000588_22836_23555 238
1154 3300053085 Ga0495619_0013237 Ga0495619_0013237_4305_5024 238
1155 3300053085 Ga0495619_0101555 Ga0495619_0101555_738_1457 238
1156 3300053085 Ga0495619_0292950 Ga0495619_0292950_338_1057 238
1157 3300053094 Ga0500566_0000478 Ga0500566_0000478_12800_13516 238
1158 3300053139 Ga0500568_0113430 Ga0500568_0113430_78_818 238
1159 3300053140 Ga0500573_0038146 Ga0500573_0038146_1158_1886 238
1160 3300060353 Ga0501082_0019912 Ga0501082_0019912_457_1176 238
1161 3300061719 Ga0466962_0051291 Ga0466962_0051291_352_1080 238
1162 3300061734 Ga0530510_0090218 Ga0530510_0090218_783_1502 238
1163 iso_pu_bacteria 2856741275 2856745306 238
1164 iso_pu_bacteria 2891395885 2891401783 238
1165 iso_pu_bacteria 2891562705 2891567220 238
1166 iso_pu_bacteria 3002998708 3003001515 238
1167 3300003203 JGI25406J46586_10056762 JGI25406J46586_100567621 239
1168 3300005435 Ga0070714_100017500 Ga0070714_1000175009 239
1169 3300005985 Ga0081539_10005050 Ga0081539_100050509 239
1170 3300009098 Ga0105245_10335338 Ga0105245_103353382 239
1171 3300049580 Ga0501046_0010722 Ga0501046_0010722_5474_6205 239
1172 3300049581 Ga0501047_0171447 Ga0501047_0171447_1174_1908 239
1173 3300049586 Ga0501070_0026719 Ga0501070_0026719_1953_2684 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

45

176

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9466 2 238
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9402 4 238
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9374 2 238
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9122 2 238
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9072 2 238
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9358 2 238 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9057 2 238 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.871 1 236 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8677 8 239 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8538 1 236 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7K0MWA2-F1-model_v4 PIG-L family deacetylase 0.9919 28 239 GO:0016137
GO:0016811
AF-A0A7K0MX43-F1-model_v4 PIG-L family deacetylase 0.9917 3 148 GO:0016137
GO:0016811
AF-A0A7Y2GRF1-F1-model_v4 PIG-L family deacetylase 0.9916 40 239 GO:0016137
GO:0016811
AF-A0A5B2XDB1-F1-model_v4 PIG-L family deacetylase 0.9886 8 239 GO:0016137
GO:0016811
AF-A0A849IWU0-F1-model_v4 PIG-L family deacetylase 0.9882 9 238 GO:0016137
GO:0016811

Feature Viewer

pLDDT pTM Quality
95.97 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map