F491197
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1173 | 459 | 1132 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100129420|Ga0070683_1001294201 |
| Length | 151 |
| Sequence | MRVVVEHRPAFGRQLINMNLRRRLKEDAEVHTGPLNDILFILLMFFLIVSTLANPNVVKVTQPKSKGDTKAKQTVVVSIDANKQFYVGTMRVTLDELKAKLQPFLAKETEQPSVVINADKTVPIDDVVAVMRVARDLGAKTVLAVDKNGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 4 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 5 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 6 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 7 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 8 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 9 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 10 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 11 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 12 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 13 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 14 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 15 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 16 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 17 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 18 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 19 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 20 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 21 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 22 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 23 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 24 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 25 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 26 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 27 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 28 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 29 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 30 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 31 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 32 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 33 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 34 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 35 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 36 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 37 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 42 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 45 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 46 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 47 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 50 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 60 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 130 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 169 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 250 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 251 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 253 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 254 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 287 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 288 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 289 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 290 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 291 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 292 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 300 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 301 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 302 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 303 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 304 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 305 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 306 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 309 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 310 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 311 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 312 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 313 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 314 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 318 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 398 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 399 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 401 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 402 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 407 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 423 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 424 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 425 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 426 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 427 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 428 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 430 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 431 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 432 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 433 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 437 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 439 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 442 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 444 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 446 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 447 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 448 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 449 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 450 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 452 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 454 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 455 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 456 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 457 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 458 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 459 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 0.34 |
| Isolates | 3.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.84 |
| Nodule | 0.34 |
| Rhizoplane | 1.02 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2906961 | 2162886007 | Bacteria | 911 |
| 2 | JGI24736J21556_1049260 | 3300001904 | Unclassified | 648 |
| 3 | JGI24740J21852_10003263 | 3300001979 | Bacteria | 7163 |
| 4 | JGI24743J22301_10059968 | 3300001991 | Bacteria | 783 |
| 5 | JGI25154J39366_1000019 | 3300002738 | Bacteria | 234419 |
| 6 | JGI25157J39369_1005006 | 3300002741 | Bacteria | 2250 |
| 7 | JGI25159J45721_1014429 | 3300002987 | Bacteria | 1785 |
| 8 | JGI25153J46596_10002342 | 3300003215 | Bacteria | 10986 |
| 9 | JGI25153J46596_10025003 | 3300003215 | Bacteria | 2142 |
| 10 | rootH1_10162132 | 3300003316 | Bacteria | 2310 |
| 11 | rootH2_10015349 | 3300003320 | Bacteria | 24566 |
| 12 | rootH2_10056653 | 3300003320 | Bacteria | 2983 |
| 13 | rootH2_10069067 | 3300003320 | Bacteria | 1131 |
| 14 | rootH2_10078664 | 3300003320 | Bacteria | 6099 |
| 15 | rootH2_10117949 | 3300003320 | Unclassified | 1507 |
| 16 | rootH2_10252188 | 3300003320 | Bacteria | 1232 |
| 17 | rootL2_10023809 | 3300003322 | Bacteria | 1833 |
| 18 | rootL2_10103028 | 3300003322 | Bacteria | 4043 |
| 19 | rootL2_10103029 | 3300003322 | Bacteria | 6146 |
| 20 | rootL2_10146434 | 3300003322 | Bacteria | 2669 |
| 21 | rootL2_10157657 | 3300003322 | Bacteria | 1820 |
| 22 | rootH1_10007634 | 3300003323 | Bacteria | 9103 |
| 23 | rootH1_10196799 | 3300003323 | Bacteria | 7745 |
| 24 | rootH1_10224232 | 3300003323 | Bacteria | 1139 |
| 25 | rootH1_10269349 | 3300003323 | Bacteria | 1220 |
| 26 | rootH1_10317655 | 3300003323 | Bacteria | 1432 |
| 27 | rootH1_10320624 | 3300003323 | Bacteria | 1397 |
| 28 | JGI25160J50197_1005104 | 3300003354 | Bacteria | 5528 |
| 29 | JGI25160J50197_1014080 | 3300003354 | Bacteria | 2693 |
| 30 | JGI25160J50197_1038948 | 3300003354 | Bacteria | 1118 |
| 31 | Ga0006562J51391_1005593 | 3300003578 | Bacteria | 1193 |
| 32 | Ga0055535_1001390 | 3300003761 | Bacteria | 12511 |
| 33 | Ga0055526_1015126 | 3300003771 | Bacteria | 3115 |
| 34 | Ga0055528_1000383 | 3300003790 | Bacteria | 35925 |
| 35 | Ga0055530_10002275 | 3300003791 | Bacteria | 12616 |
| 36 | Ga0055531_10000293 | 3300003794 | Bacteria | 49990 |
| 37 | Ga0055531_10040366 | 3300003794 | Bacteria | 1369 |
| 38 | Ga0055543_1013114 | 3300004625 | Bacteria | 1647 |
| 39 | Ga0065165_1000402 | 3300005262 | Bacteria | 69844 |
| 40 | Ga0065165_1013242 | 3300005262 | Bacteria | 3294 |
| 41 | Ga0065165_1044615 | 3300005262 | Bacteria | 1296 |
| 42 | Ga0065714_10005480 | 3300005288 | Bacteria | 4056 |
| 43 | Ga0065714_10006409 | 3300005288 | Bacteria | 3707 |
| 44 | Ga0065714_10042358 | 3300005288 | Bacteria | 923 |
| 45 | Ga0065714_10163191 | 3300005288 | Bacteria | 1041 |
| 46 | Ga0065714_10169009 | 3300005288 | Bacteria | 968 |
| 47 | Ga0065714_10307876 | 3300005288 | Bacteria | 685 |
| 48 | Ga0065704_10074946 | 3300005289 | Bacteria | 5890 |
| 49 | Ga0065704_10093374 | 3300005289 | Bacteria | 2601 |
| 50 | Ga0065704_10110528 | 3300005289 | Unclassified | 1978 |
| 51 | Ga0065704_10268353 | 3300005289 | Unclassified | 949 |
| 52 | Ga0065712_10503847 | 3300005290 | Bacteria | 647 |
| 53 | Ga0065715_10032010 | 3300005293 | Bacteria | 1453 |
| 54 | Ga0065715_10135501 | 3300005293 | Bacteria | 1933 |
| 55 | Ga0065715_10154190 | 3300005293 | Bacteria | 1694 |
| 56 | Ga0065715_10228433 | 3300005293 | Bacteria | 1238 |
| 57 | Ga0065715_10236192 | 3300005293 | Bacteria | 1216 |
| 58 | Ga0065715_10238518 | 3300005293 | Bacteria | 1208 |
| 59 | Ga0065715_10359911 | 3300005293 | Bacteria | 876 |
| 60 | Ga0065715_10501322 | 3300005293 | Bacteria | 718 |
| 61 | Ga0065707_10012971 | 3300005295 | Unclassified | 3112 |
| 62 | Ga0065707_10123533 | 3300005295 | Bacteria | 2063 |
| 63 | Ga0070658_10171865 | 3300005327 | Unclassified | 1821 |
| 64 | Ga0070658_11482868 | 3300005327 | Bacteria | 588 |
| 65 | Ga0070676_10003832 | 3300005328 | Bacteria | 7891 |
| 66 | Ga0070676_10029768 | 3300005328 | Bacteria | 3108 |
| 67 | Ga0070676_10148793 | 3300005328 | Unclassified | 1497 |
| 68 | Ga0070676_10174270 | 3300005328 | Bacteria | 1394 |
| 69 | Ga0070683_100005538 | 3300005329 | Bacteria | 10549 |
| 70 | Ga0070683_100073580 | 3300005329 | Bacteria | 3190 |
| 71 | Ga0070683_100129420 | 3300005329 | Bacteria | 2388 |
| 72 | Ga0070683_100257331 | 3300005329 | Unclassified | 1660 |
| 73 | Ga0070690_100032678 | 3300005330 | Bacteria | 3251 |
| 74 | Ga0070690_100075145 | 3300005330 | Bacteria | 2203 |
| 75 | Ga0070690_100105034 | 3300005330 | Bacteria | 1877 |
| 76 | Ga0070690_100251042 | 3300005330 | Bacteria | 1251 |
| 77 | Ga0070690_100664657 | 3300005330 | Bacteria | 797 |
| 78 | Ga0070670_100045077 | 3300005331 | Bacteria | 3791 |
| 79 | Ga0070670_100208342 | 3300005331 | Bacteria | 1699 |
| 80 | Ga0070677_10362339 | 3300005333 | Bacteria | 754 |
| 81 | Ga0068869_100008424 | 3300005334 | Bacteria | 6647 |
| 82 | Ga0068869_100152820 | 3300005334 | Bacteria | 1791 |
| 83 | Ga0068869_100196828 | 3300005334 | Bacteria | 1587 |
| 84 | Ga0068869_100283184 | 3300005334 | Archaea | 1333 |
| 85 | Ga0068869_100441400 | 3300005334 | Unclassified | 1077 |
| 86 | Ga0068869_101706480 | 3300005334 | Bacteria | 562 |
| 87 | Ga0068869_101915320 | 3300005334 | Bacteria | 531 |
| 88 | Ga0070666_10010757 | 3300005335 | Bacteria | 5724 |
| 89 | Ga0070666_10035650 | 3300005335 | Bacteria | 3300 |
| 90 | Ga0070666_10234690 | 3300005335 | Bacteria | 1296 |
| 91 | Ga0070666_10833202 | 3300005335 | Bacteria | 680 |
| 92 | Ga0070682_100000455 | 3300005337 | Bacteria | 25816 |
| 93 | Ga0070682_100058559 | 3300005337 | Bacteria | 2430 |
| 94 | Ga0070682_100300110 | 3300005337 | Bacteria | 1178 |
| 95 | Ga0070682_100591000 | 3300005337 | Bacteria | 875 |
| 96 | Ga0070682_101253057 | 3300005337 | Archaea | 628 |
| 97 | Ga0068868_100001512 | 3300005338 | Bacteria | 15994 |
| 98 | Ga0068868_100007582 | 3300005338 | Bacteria | 7731 |
| 99 | Ga0068868_100022249 | 3300005338 | Bacteria | 4782 |
| 100 | Ga0068868_100078314 | 3300005338 | Bacteria | 2646 |
| 101 | Ga0068868_100190467 | 3300005338 | Bacteria | 1705 |
| 102 | Ga0068868_100239054 | 3300005338 | Bacteria | 1525 |
| 103 | Ga0068868_100556700 | 3300005338 | Bacteria | 1011 |
| 104 | Ga0068868_101853404 | 3300005338 | Bacteria | 570 |
| 105 | Ga0070660_100422551 | 3300005339 | Unclassified | 1104 |
| 106 | Ga0070660_101291496 | 3300005339 | Unclassified | 619 |
| 107 | Ga0070689_100199684 | 3300005340 | Unclassified | 1632 |
| 108 | Ga0070689_100274603 | 3300005340 | Bacteria | 1396 |
| 109 | Ga0070689_100911213 | 3300005340 | Unclassified | 778 |
| 110 | Ga0070691_10010823 | 3300005341 | Bacteria | 4162 |
| 111 | Ga0070687_100154834 | 3300005343 | Bacteria | 1349 |
| 112 | Ga0070687_100369569 | 3300005343 | Bacteria | 931 |
| 113 | Ga0070661_100004649 | 3300005344 | Bacteria | 9455 |
| 114 | Ga0070661_100115701 | 3300005344 | Bacteria | 2005 |
| 115 | Ga0070692_11349284 | 3300005345 | Bacteria | 513 |
| 116 | Ga0070668_100000116 | 3300005347 | Bacteria | 49265 |
| 117 | Ga0070668_100409381 | 3300005347 | Bacteria | 1159 |
| 118 | Ga0070668_100610271 | 3300005347 | Unclassified | 955 |
| 119 | Ga0070668_101953411 | 3300005347 | Bacteria | 541 |
| 120 | Ga0070669_100240392 | 3300005353 | Bacteria | 1438 |
| 121 | Ga0070669_100780637 | 3300005353 | Bacteria | 811 |
| 122 | Ga0070669_100970711 | 3300005353 | Bacteria | 728 |
| 123 | Ga0070669_101201672 | 3300005353 | Unclassified | 655 |
| 124 | Ga0070669_101239838 | 3300005353 | Unclassified | 645 |
| 125 | Ga0070669_101905596 | 3300005353 | Unclassified | 519 |
| 126 | Ga0070675_100058001 | 3300005354 | Bacteria | 3193 |
| 127 | Ga0070675_100101445 | 3300005354 | Unclassified | 2424 |
| 128 | Ga0070675_100861924 | 3300005354 | Bacteria | 829 |
| 129 | Ga0070675_101138776 | 3300005354 | Bacteria | 718 |
| 130 | Ga0070675_101473107 | 3300005354 | Unclassified | 628 |
| 131 | Ga0070671_100010319 | 3300005355 | Bacteria | 7493 |
| 132 | Ga0070671_100359288 | 3300005355 | Bacteria | 1243 |
| 133 | Ga0070671_100385471 | 3300005355 | Bacteria | 1198 |
| 134 | Ga0070671_100491160 | 3300005355 | Bacteria | 1055 |
| 135 | Ga0070674_100105333 | 3300005356 | Unclassified | 2062 |
| 136 | Ga0070674_101640451 | 3300005356 | Unclassified | 580 |
| 137 | Ga0070673_100000521 | 3300005364 | Bacteria | 20630 |
| 138 | Ga0070673_100014403 | 3300005364 | Bacteria | 5506 |
| 139 | Ga0070673_100029227 | 3300005364 | Bacteria | 4108 |
| 140 | Ga0070673_100115725 | 3300005364 | Unclassified | 2230 |
| 141 | Ga0070673_100191410 | 3300005364 | Bacteria | 1757 |
| 142 | Ga0070673_100414535 | 3300005364 | Unclassified | 1207 |
| 143 | Ga0070659_100021434 | 3300005366 | Bacteria | 4922 |
| 144 | Ga0070659_100284264 | 3300005366 | Archaea | 1376 |
| 145 | Ga0070667_100000652 | 3300005367 | Bacteria | 33714 |
| 146 | Ga0070667_100004905 | 3300005367 | Bacteria | 11210 |
| 147 | Ga0070667_100142222 | 3300005367 | Unclassified | 2102 |
| 148 | Ga0070667_100326558 | 3300005367 | Bacteria | 1385 |
| 149 | Ga0070667_100562074 | 3300005367 | Bacteria | 1049 |
| 150 | Ga0070667_100916342 | 3300005367 | Bacteria | 816 |
| 151 | Ga0070667_101017854 | 3300005367 | Bacteria | 773 |
| 152 | Ga0070667_101637740 | 3300005367 | Bacteria | 605 |
| 153 | Ga0070709_10352906 | 3300005434 | Bacteria | 1087 |
| 154 | Ga0070700_100343367 | 3300005441 | Bacteria | 1104 |
| 155 | Ga0070663_100355677 | 3300005455 | Archaea | 1187 |
| 156 | Ga0070663_101057995 | 3300005455 | Bacteria | 708 |
| 157 | Ga0070678_100048749 | 3300005456 | Bacteria | 3053 |
| 158 | Ga0070678_100054602 | 3300005456 | Bacteria | 2912 |
| 159 | Ga0070678_100104468 | 3300005456 | Unclassified | 2203 |
| 160 | Ga0070678_100211589 | 3300005456 | Bacteria | 1607 |
| 161 | Ga0070678_101074435 | 3300005456 | Unclassified | 742 |
| 162 | Ga0070662_100001029 | 3300005457 | Bacteria | 17060 |
| 163 | Ga0070662_100006211 | 3300005457 | Bacteria | 7694 |
| 164 | Ga0070662_100012518 | 3300005457 | Bacteria | 5627 |
| 165 | Ga0070662_100463440 | 3300005457 | Bacteria | 1053 |
| 166 | Ga0070681_10059194 | 3300005458 | Unclassified | 3810 |
| 167 | Ga0070681_10079737 | 3300005458 | Bacteria | 3230 |
| 168 | Ga0070681_10725615 | 3300005458 | Unclassified | 910 |
| 169 | Ga0068867_100009722 | 3300005459 | Bacteria | 6783 |
| 170 | Ga0068867_100045254 | 3300005459 | Bacteria | 3227 |
| 171 | Ga0068867_100049540 | 3300005459 | Bacteria | 3093 |
| 172 | Ga0068867_100117447 | 3300005459 | Bacteria | 2051 |
| 173 | Ga0068867_100130694 | 3300005459 | Unclassified | 1951 |
| 174 | Ga0068867_100188411 | 3300005459 | Bacteria | 1645 |
| 175 | Ga0068867_100668434 | 3300005459 | Bacteria | 913 |
| 176 | Ga0068867_100796767 | 3300005459 | Bacteria | 842 |
| 177 | Ga0068867_101407982 | 3300005459 | Unclassified | 647 |
| 178 | Ga0068867_101422563 | 3300005459 | Bacteria | 644 |
| 179 | Ga0070685_10143849 | 3300005466 | Bacteria | 1504 |
| 180 | Ga0070698_100008986 | 3300005471 | Bacteria | 10747 |
| 181 | Ga0070698_100083465 | 3300005471 | Bacteria | 3184 |
| 182 | Ga0070699_101122065 | 3300005518 | Unclassified | 721 |
| 183 | Ga0070679_100000973 | 3300005530 | Bacteria | 24934 |
| 184 | Ga0070684_100003219 | 3300005535 | Bacteria | 12214 |
| 185 | Ga0070684_100006634 | 3300005535 | Bacteria | 8966 |
| 186 | Ga0070684_100030438 | 3300005535 | Bacteria | 4585 |
| 187 | Ga0070684_100265370 | 3300005535 | Unclassified | 1571 |
| 188 | Ga0070684_100605154 | 3300005535 | Bacteria | 1019 |
| 189 | Ga0070684_101668291 | 3300005535 | Unclassified | 601 |
| 190 | Ga0070684_101718550 | 3300005535 | Unclassified | 592 |
| 191 | Ga0068853_100003822 | 3300005539 | Bacteria | 11533 |
| 192 | Ga0068853_100014740 | 3300005539 | Bacteria | 6415 |
| 193 | Ga0068853_100038019 | 3300005539 | Bacteria | 4098 |
| 194 | Ga0068853_100046145 | 3300005539 | Bacteria | 3735 |
| 195 | Ga0068853_100132094 | 3300005539 | Bacteria | 2236 |
| 196 | Ga0068853_100281948 | 3300005539 | Bacteria | 1532 |
| 197 | Ga0068853_100709590 | 3300005539 | Bacteria | 960 |
| 198 | Ga0068853_100981450 | 3300005539 | Unclassified | 813 |
| 199 | Ga0068853_101296095 | 3300005539 | Unclassified | 704 |
| 200 | Ga0068853_101741675 | 3300005539 | Bacteria | 604 |
| 201 | Ga0068853_102171321 | 3300005539 | Bacteria | 538 |
| 202 | Ga0070672_100000038 | 3300005543 | Bacteria | 57709 |
| 203 | Ga0070672_100046787 | 3300005543 | Unclassified | 3353 |
| 204 | Ga0070672_100172094 | 3300005543 | Bacteria | 1801 |
| 205 | Ga0070672_100605382 | 3300005543 | Unclassified | 955 |
| 206 | Ga0070672_101130050 | 3300005543 | Unclassified | 697 |
| 207 | Ga0070672_101362529 | 3300005543 | Bacteria | 634 |
| 208 | Ga0070672_101562481 | 3300005543 | Bacteria | 592 |
| 209 | Ga0070686_100177737 | 3300005544 | Unclassified | 1510 |
| 210 | Ga0070686_100209651 | 3300005544 | Unclassified | 1402 |
| 211 | Ga0070693_100052194 | 3300005547 | Unclassified | 2343 |
| 212 | Ga0070693_100126555 | 3300005547 | Unclassified | 1592 |
| 213 | Ga0070693_100189197 | 3300005547 | Bacteria | 1330 |
| 214 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 215 | Ga0070665_100000504 | 3300005548 | Bacteria | 55959 |
| 216 | Ga0070665_100002898 | 3300005548 | Bacteria | 18535 |
| 217 | Ga0070665_100327378 | 3300005548 | Bacteria | 1536 |
| 218 | Ga0068855_100000424 | 3300005563 | Bacteria | 52152 |
| 219 | Ga0068855_100002280 | 3300005563 | Bacteria | 23696 |
| 220 | Ga0068855_100004440 | 3300005563 | Bacteria | 17135 |
| 221 | Ga0068855_100005197 | 3300005563 | Bacteria | 15879 |
| 222 | Ga0068855_100067080 | 3300005563 | Bacteria | 4182 |
| 223 | Ga0068855_100615564 | 3300005563 | Unclassified | 1170 |
| 224 | Ga0068855_100658624 | 3300005563 | Bacteria | 1124 |
| 225 | Ga0068855_100940746 | 3300005563 | Bacteria | 911 |
| 226 | Ga0070664_100021144 | 3300005564 | Bacteria | 5360 |
| 227 | Ga0070664_100021537 | 3300005564 | Bacteria | 5315 |
| 228 | Ga0070664_100114993 | 3300005564 | Bacteria | 2351 |
| 229 | Ga0070664_100171059 | 3300005564 | Unclassified | 1927 |
| 230 | Ga0070664_100522891 | 3300005564 | Unclassified | 1095 |
| 231 | Ga0070664_100769485 | 3300005564 | Bacteria | 899 |
| 232 | Ga0068857_100001435 | 3300005577 | Bacteria | 18887 |
| 233 | Ga0068857_100028333 | 3300005577 | Bacteria | 4943 |
| 234 | Ga0068857_100037405 | 3300005577 | Bacteria | 4299 |
| 235 | Ga0068857_100040695 | 3300005577 | Bacteria | 4122 |
| 236 | Ga0068857_100596504 | 3300005577 | Bacteria | 1044 |
| 237 | Ga0068857_100694775 | 3300005577 | Bacteria | 966 |
| 238 | Ga0068854_100026033 | 3300005578 | Bacteria | 4016 |
| 239 | Ga0068854_100256180 | 3300005578 | Bacteria | 1399 |
| 240 | Ga0068854_101143516 | 3300005578 | Bacteria | 695 |
| 241 | Ga0068854_101204852 | 3300005578 | Unclassified | 678 |
| 242 | Ga0068856_100046162 | 3300005614 | Bacteria | 4291 |
| 243 | Ga0068856_100143359 | 3300005614 | Bacteria | 2397 |
| 244 | Ga0068856_100490995 | 3300005614 | Bacteria | 1249 |
| 245 | Ga0068856_101058909 | 3300005614 | Archaea | 829 |
| 246 | Ga0068856_101933320 | 3300005614 | Bacteria | 601 |
| 247 | Ga0070702_100088405 | 3300005615 | Unclassified | 1873 |
| 248 | Ga0068852_100000342 | 3300005616 | Bacteria | 31480 |
| 249 | Ga0068852_100075871 | 3300005616 | Bacteria | 2967 |
| 250 | Ga0068852_100111383 | 3300005616 | Bacteria | 2489 |
| 251 | Ga0068852_100457027 | 3300005616 | Bacteria | 1265 |
| 252 | Ga0068852_102159510 | 3300005616 | Unclassified | 578 |
| 253 | Ga0068852_102348816 | 3300005616 | Bacteria | 554 |
| 254 | Ga0068859_100058243 | 3300005617 | Bacteria | 3891 |
| 255 | Ga0068859_100072397 | 3300005617 | Bacteria | 3483 |
| 256 | Ga0068859_100103505 | 3300005617 | Unclassified | 2905 |
| 257 | Ga0068859_100211513 | 3300005617 | Bacteria | 2026 |
| 258 | Ga0068859_100378832 | 3300005617 | Unclassified | 1510 |
| 259 | Ga0068859_100829355 | 3300005617 | Bacteria | 1011 |
| 260 | Ga0068859_100864391 | 3300005617 | Bacteria | 990 |
| 261 | Ga0068859_101719357 | 3300005617 | Bacteria | 693 |
| 262 | Ga0068864_100007905 | 3300005618 | Bacteria | 8762 |
| 263 | Ga0068864_100035920 | 3300005618 | Bacteria | 4221 |
| 264 | Ga0068864_100121641 | 3300005618 | Bacteria | 2335 |
| 265 | Ga0068864_100166775 | 3300005618 | Bacteria | 2005 |
| 266 | Ga0068864_100257290 | 3300005618 | Bacteria | 1623 |
| 267 | Ga0068866_10030908 | 3300005718 | Bacteria | 2574 |
| 268 | Ga0068866_10757015 | 3300005718 | Bacteria | 671 |
| 269 | Ga0068861_100022476 | 3300005719 | Unclassified | 4545 |
| 270 | Ga0068861_100046224 | 3300005719 | Bacteria | 3281 |
| 271 | Ga0068861_100173875 | 3300005719 | Bacteria | 1787 |
| 272 | Ga0068861_100454097 | 3300005719 | Bacteria | 1149 |
| 273 | Ga0068861_101188356 | 3300005719 | Bacteria | 737 |
| 274 | Ga0068851_10000211 | 3300005834 | Bacteria | 27822 |
| 275 | Ga0068851_10386280 | 3300005834 | Unclassified | 821 |
| 276 | Ga0068851_10999926 | 3300005834 | Unclassified | 527 |
| 277 | Ga0068863_100004928 | 3300005841 | Bacteria | 13158 |
| 278 | Ga0068863_100009598 | 3300005841 | Bacteria | 9438 |
| 279 | Ga0068863_100414817 | 3300005841 | Bacteria | 1318 |
| 280 | Ga0068863_100426465 | 3300005841 | Unclassified | 1300 |
| 281 | Ga0068863_100494205 | 3300005841 | Unclassified | 1204 |
| 282 | Ga0068863_102538137 | 3300005841 | Unclassified | 522 |
| 283 | Ga0068858_100002669 | 3300005842 | Bacteria | 17950 |
| 284 | Ga0068858_100333051 | 3300005842 | Bacteria | 1452 |
| 285 | Ga0068858_100504808 | 3300005842 | Bacteria | 1169 |
| 286 | Ga0068858_100608533 | 3300005842 | Unclassified | 1060 |
| 287 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 288 | Ga0068860_100008126 | 3300005843 | Bacteria | 10450 |
| 289 | Ga0068860_100009802 | 3300005843 | Bacteria | 9507 |
| 290 | Ga0068860_100036542 | 3300005843 | Bacteria | 4706 |
| 291 | Ga0068860_100097786 | 3300005843 | Bacteria | 2799 |
| 292 | Ga0068860_100156155 | 3300005843 | Unclassified | 2199 |
| 293 | Ga0068860_100923396 | 3300005843 | Bacteria | 889 |
| 294 | Ga0068860_101009310 | 3300005843 | Bacteria | 850 |
| 295 | Ga0068860_101095561 | 3300005843 | Bacteria | 816 |
| 296 | Ga0068860_102325711 | 3300005843 | Unclassified | 556 |
| 297 | Ga0068862_100206260 | 3300005844 | Bacteria | 1774 |
| 298 | Ga0068862_100405082 | 3300005844 | Bacteria | 1277 |
| 299 | Ga0068862_100429135 | 3300005844 | Archaea | 1242 |
| 300 | Ga0068862_101112955 | 3300005844 | Bacteria | 785 |
| 301 | Ga0068862_102567591 | 3300005844 | Unclassified | 521 |
| 302 | Ga0075366_10145326 | 3300006195 | Bacteria | 1435 |
| 303 | Ga0097621_100000538 | 3300006237 | Bacteria | 26658 |
| 304 | Ga0097621_100007933 | 3300006237 | Bacteria | 7618 |
| 305 | Ga0097621_100142701 | 3300006237 | Bacteria | 2048 |
| 306 | Ga0097621_100253931 | 3300006237 | Unclassified | 1540 |
| 307 | Ga0097621_101690988 | 3300006237 | Unclassified | 602 |
| 308 | Ga0097621_102436879 | 3300006237 | Unclassified | 501 |
| 309 | Ga0068871_100000452 | 3300006358 | Bacteria | 28201 |
| 310 | Ga0068871_100003693 | 3300006358 | Bacteria | 10518 |
| 311 | Ga0068871_100089405 | 3300006358 | Unclassified | 2563 |
| 312 | Ga0068871_100206810 | 3300006358 | Bacteria | 1696 |
| 313 | Ga0068871_100249800 | 3300006358 | Unclassified | 1545 |
| 314 | Ga0068871_100339008 | 3300006358 | Unclassified | 1327 |
| 315 | Ga0068871_100379954 | 3300006358 | Unclassified | 1255 |
| 316 | Ga0075428_100004046 | 3300006844 | Bacteria | 16116 |
| 317 | Ga0075428_100138747 | 3300006844 | Bacteria | 2643 |
| 318 | Ga0075430_100036462 | 3300006846 | Bacteria | 4169 |
| 319 | Ga0075430_100220568 | 3300006846 | Bacteria | 1573 |
| 320 | Ga0075431_100030039 | 3300006847 | Bacteria | 5596 |
| 321 | Ga0075431_100093393 | 3300006847 | Bacteria | 3105 |
| 322 | Ga0075434_100878950 | 3300006871 | Bacteria | 911 |
| 323 | Ga0075434_101701882 | 3300006871 | Bacteria | 638 |
| 324 | Ga0075429_100013930 | 3300006880 | Bacteria | 6969 |
| 325 | Ga0075429_100219308 | 3300006880 | Bacteria | 1666 |
| 326 | Ga0068865_100001621 | 3300006881 | Bacteria | 13188 |
| 327 | Ga0068865_100074201 | 3300006881 | Unclassified | 2422 |
| 328 | Ga0068865_100109400 | 3300006881 | Bacteria | 2036 |
| 329 | Ga0068865_100202490 | 3300006881 | Bacteria | 1542 |
| 330 | Ga0068865_100265409 | 3300006881 | Bacteria | 1361 |
| 331 | Ga0068865_100770297 | 3300006881 | Unclassified | 828 |
| 332 | Ga0068865_100845762 | 3300006881 | Unclassified | 792 |
| 333 | Ga0068865_100982303 | 3300006881 | Bacteria | 738 |
| 334 | Ga0068865_101298927 | 3300006881 | Bacteria | 647 |
| 335 | Ga0097620_100058243 | 3300006931 | Bacteria | 3891 |
| 336 | Ga0097620_100072404 | 3300006931 | Bacteria | 3483 |
| 337 | Ga0097620_100103499 | 3300006931 | Unclassified | 2905 |
| 338 | Ga0097620_100211516 | 3300006931 | Bacteria | 2026 |
| 339 | Ga0097620_100378853 | 3300006931 | Unclassified | 1510 |
| 340 | Ga0097620_100829359 | 3300006931 | Bacteria | 1011 |
| 341 | Ga0097620_100864529 | 3300006931 | Bacteria | 990 |
| 342 | Ga0097620_101718841 | 3300006931 | Bacteria | 693 |
| 343 | Ga0079104_1000421 | 3300006946 | Bacteria | 48367 |
| 344 | Ga0099826_10000257 | 3300006948 | Bacteria | 23529 |
| 345 | Ga0075435_101422406 | 3300007076 | Unclassified | 608 |
| 346 | Ga0105251_10594264 | 3300009011 | Unclassified | 525 |
| 347 | Ga0105244_10000057 | 3300009036 | Bacteria | 129775 |
| 348 | Ga0105250_10086884 | 3300009092 | Bacteria | 1270 |
| 349 | Ga0105240_10000486 | 3300009093 | Bacteria | 73492 |
| 350 | Ga0105240_10001336 | 3300009093 | Bacteria | 42397 |
| 351 | Ga0105240_10002538 | 3300009093 | Bacteria | 29284 |
| 352 | Ga0105240_10004786 | 3300009093 | Bacteria | 20421 |
| 353 | Ga0105240_10007443 | 3300009093 | Bacteria | 15898 |
| 354 | Ga0105240_10016576 | 3300009093 | Bacteria | 9969 |
| 355 | Ga0105240_10073956 | 3300009093 | Bacteria | 4208 |
| 356 | Ga0105240_10085020 | 3300009093 | Bacteria | 3877 |
| 357 | Ga0105240_10152230 | 3300009093 | Bacteria | 2754 |
| 358 | Ga0105240_10169245 | 3300009093 | Bacteria | 2589 |
| 359 | Ga0105240_10583631 | 3300009093 | Unclassified | 1233 |
| 360 | Ga0111539_10179830 | 3300009094 | Bacteria | 2471 |
| 361 | Ga0111539_10370989 | 3300009094 | Bacteria | 1666 |
| 362 | Ga0111539_10377407 | 3300009094 | Bacteria | 1651 |
| 363 | Ga0105245_10065037 | 3300009098 | Unclassified | 3298 |
| 364 | Ga0105247_10003291 | 3300009101 | Bacteria | 10587 |
| 365 | Ga0105247_10040609 | 3300009101 | Unclassified | 2844 |
| 366 | Ga0114129_10019537 | 3300009147 | Bacteria | 9647 |
| 367 | Ga0114129_10025061 | 3300009147 | Bacteria | 8453 |
| 368 | Ga0114129_11391192 | 3300009147 | Bacteria | 866 |
| 369 | Ga0114129_12563172 | 3300009147 | Bacteria | 609 |
| 370 | Ga0105243_10811845 | 3300009148 | Bacteria | 923 |
| 371 | Ga0105241_10000144 | 3300009174 | Bacteria | 50819 |
| 372 | Ga0105241_10001636 | 3300009174 | Bacteria | 17076 |
| 373 | Ga0105241_10014888 | 3300009174 | Bacteria | 5693 |
| 374 | Ga0105241_10241256 | 3300009174 | Unclassified | 1528 |
| 375 | Ga0105241_10297588 | 3300009174 | Bacteria | 1384 |
| 376 | Ga0105241_10409076 | 3300009174 | Unclassified | 1192 |
| 377 | Ga0105241_10676642 | 3300009174 | Unclassified | 940 |
| 378 | Ga0105241_11464025 | 3300009174 | Bacteria | 656 |
| 379 | Ga0105242_10020659 | 3300009176 | Bacteria | 5165 |
| 380 | Ga0105242_10049029 | 3300009176 | Bacteria | 3435 |
| 381 | Ga0105242_10439930 | 3300009176 | Unclassified | 1226 |
| 382 | Ga0105242_10470819 | 3300009176 | Bacteria | 1188 |
| 383 | Ga0105242_10620320 | 3300009176 | Unclassified | 1047 |
| 384 | Ga0105248_10272544 | 3300009177 | Unclassified | 1905 |
| 385 | Ga0105248_11092318 | 3300009177 | Bacteria | 902 |
| 386 | Ga0105248_12329072 | 3300009177 | Bacteria | 610 |
| 387 | Ga0105237_10000651 | 3300009545 | Bacteria | 48483 |
| 388 | Ga0105237_10006210 | 3300009545 | Bacteria | 13323 |
| 389 | Ga0105237_10037264 | 3300009545 | Unclassified | 4917 |
| 390 | Ga0105237_10049425 | 3300009545 | Bacteria | 4227 |
| 391 | Ga0105237_10070518 | 3300009545 | Bacteria | 3491 |
| 392 | Ga0105237_10097915 | 3300009545 | Unclassified | 2924 |
| 393 | Ga0105237_10124229 | 3300009545 | Unclassified | 2575 |
| 394 | Ga0105237_10153054 | 3300009545 | Bacteria | 2303 |
| 395 | Ga0105237_11045517 | 3300009545 | Unclassified | 823 |
| 396 | Ga0105238_10002965 | 3300009551 | Bacteria | 16945 |
| 397 | Ga0105238_10102105 | 3300009551 | Bacteria | 2850 |
| 398 | Ga0105238_10189261 | 3300009551 | Bacteria | 2034 |
| 399 | Ga0105238_10315880 | 3300009551 | Unclassified | 1548 |
| 400 | Ga0105238_10685442 | 3300009551 | Bacteria | 1036 |
| 401 | Ga0105238_11905213 | 3300009551 | Bacteria | 627 |
| 402 | Ga0105249_10023320 | 3300009553 | Bacteria | 5552 |
| 403 | Ga0105249_10049879 | 3300009553 | Bacteria | 3817 |
| 404 | Ga0105249_10079351 | 3300009553 | Bacteria | 3047 |
| 405 | Ga0105249_10335997 | 3300009553 | Bacteria | 1526 |
| 406 | Ga0105249_10349734 | 3300009553 | Bacteria | 1497 |
| 407 | Ga0105249_10899517 | 3300009553 | Bacteria | 952 |
| 408 | Ga0105249_10945337 | 3300009553 | Unclassified | 930 |
| 409 | Ga0105249_11021624 | 3300009553 | Bacteria | 896 |
| 410 | Ga0105249_11848708 | 3300009553 | Bacteria | 677 |
| 411 | Ga0105239_10003371 | 3300010375 | Bacteria | 19606 |
| 412 | Ga0105239_10004216 | 3300010375 | Bacteria | 17268 |
| 413 | Ga0105239_10004649 | 3300010375 | Bacteria | 16319 |
| 414 | Ga0105239_10076614 | 3300010375 | Bacteria | 3678 |
| 415 | Ga0105239_10112773 | 3300010375 | Bacteria | 3015 |
| 416 | Ga0105239_10120064 | 3300010375 | Bacteria | 2918 |
| 417 | Ga0105239_10127692 | 3300010375 | Unclassified | 2827 |
| 418 | Ga0105239_10155028 | 3300010375 | Bacteria | 2558 |
| 419 | Ga0105239_10253707 | 3300010375 | Bacteria | 1976 |
| 420 | Ga0105239_10254007 | 3300010375 | Bacteria | 1975 |
| 421 | Ga0105239_10589635 | 3300010375 | Unclassified | 1267 |
| 422 | Ga0105239_10852920 | 3300010375 | Bacteria | 1045 |
| 423 | Ga0105239_10855034 | 3300010375 | Bacteria | 1043 |
| 424 | Ga0105246_10497455 | 3300011119 | Bacteria | 1035 |
| 425 | Ga0105246_11301631 | 3300011119 | Bacteria | 674 |
| 426 | Ga0157339_1058933 | 3300012505 | Bacteria | 528 |
| 427 | Ga0157373_10012575 | 3300013100 | Bacteria | 6222 |
| 428 | Ga0157373_10044233 | 3300013100 | Bacteria | 3179 |
| 429 | Ga0157373_10049497 | 3300013100 | Bacteria | 2995 |
| 430 | Ga0157373_10183856 | 3300013100 | Bacteria | 1472 |
| 431 | Ga0157371_10028728 | 3300013102 | Bacteria | 4025 |
| 432 | Ga0157371_10171436 | 3300013102 | Unclassified | 1551 |
| 433 | Ga0157371_10248894 | 3300013102 | Bacteria | 1279 |
| 434 | Ga0157370_10006627 | 3300013104 | Bacteria | 12725 |
| 435 | Ga0157370_10008346 | 3300013104 | Bacteria | 11172 |
| 436 | Ga0157370_10017951 | 3300013104 | Bacteria | 7124 |
| 437 | Ga0157370_10027462 | 3300013104 | Bacteria | 5612 |
| 438 | Ga0157370_10039104 | 3300013104 | Bacteria | 4585 |
| 439 | Ga0157370_10042874 | 3300013104 | Bacteria | 4357 |
| 440 | Ga0157370_10067725 | 3300013104 | Bacteria | 3374 |
| 441 | Ga0157370_10105482 | 3300013104 | Bacteria | 2638 |
| 442 | Ga0157370_10121614 | 3300013104 | Bacteria | 2437 |
| 443 | Ga0157370_10200055 | 3300013104 | Bacteria | 1853 |
| 444 | Ga0157370_10293819 | 3300013104 | Bacteria | 1500 |
| 445 | Ga0157370_11117459 | 3300013104 | Bacteria | 712 |
| 446 | Ga0157370_11447386 | 3300013104 | Bacteria | 618 |
| 447 | Ga0157369_10004901 | 3300013105 | Bacteria | 15696 |
| 448 | Ga0157369_10011152 | 3300013105 | Bacteria | 10217 |
| 449 | Ga0157369_10143161 | 3300013105 | Bacteria | 2529 |
| 450 | Ga0157369_10292254 | 3300013105 | Bacteria | 1696 |
| 451 | Ga0157369_10468159 | 3300013105 | Unclassified | 1305 |
| 452 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 453 | Ga0157374_10000339 | 3300013296 | Bacteria | 43247 |
| 454 | Ga0157374_10071993 | 3300013296 | Bacteria | 3261 |
| 455 | Ga0157374_10147866 | 3300013296 | Bacteria | 2283 |
| 456 | Ga0157374_10306398 | 3300013296 | Unclassified | 1572 |
| 457 | Ga0157374_10356939 | 3300013296 | Bacteria | 1453 |
| 458 | Ga0157374_10558304 | 3300013296 | Unclassified | 1153 |
| 459 | Ga0157374_10753667 | 3300013296 | Bacteria | 988 |
| 460 | Ga0157378_10035729 | 3300013297 | Bacteria | 4397 |
| 461 | Ga0157378_10049153 | 3300013297 | Unclassified | 3752 |
| 462 | Ga0157378_10124365 | 3300013297 | Bacteria | 2381 |
| 463 | Ga0157378_10167058 | 3300013297 | Bacteria | 2061 |
| 464 | Ga0157378_11024388 | 3300013297 | Bacteria | 860 |
| 465 | Ga0157378_11037044 | 3300013297 | Archaea | 855 |
| 466 | Ga0163162_10000213 | 3300013306 | Bacteria | 53744 |
| 467 | Ga0163162_10000386 | 3300013306 | Bacteria | 40256 |
| 468 | Ga0163162_10000942 | 3300013306 | Bacteria | 27029 |
| 469 | Ga0163162_10042307 | 3300013306 | Bacteria | 4559 |
| 470 | Ga0163162_10129331 | 3300013306 | Unclassified | 2633 |
| 471 | Ga0163162_10142022 | 3300013306 | Bacteria | 2515 |
| 472 | Ga0163162_10220548 | 3300013306 | Bacteria | 2026 |
| 473 | Ga0163162_10517219 | 3300013306 | Bacteria | 1323 |
| 474 | Ga0163162_10524871 | 3300013306 | Bacteria | 1313 |
| 475 | Ga0163162_10682711 | 3300013306 | Unclassified | 1149 |
| 476 | Ga0163162_10852484 | 3300013306 | Unclassified | 1026 |
| 477 | Ga0163162_11643045 | 3300013306 | Unclassified | 733 |
| 478 | Ga0163162_11866729 | 3300013306 | Bacteria | 687 |
| 479 | Ga0157372_10000954 | 3300013307 | Bacteria | 31547 |
| 480 | Ga0157372_10005795 | 3300013307 | Bacteria | 13155 |
| 481 | Ga0157372_10014521 | 3300013307 | Bacteria | 8429 |
| 482 | Ga0157372_10015096 | 3300013307 | Bacteria | 8268 |
| 483 | Ga0157372_10232821 | 3300013307 | Bacteria | 2136 |
| 484 | Ga0157372_10458887 | 3300013307 | Bacteria | 1485 |
| 485 | Ga0157372_10500693 | 3300013307 | Bacteria | 1417 |
| 486 | Ga0157372_10520251 | 3300013307 | Bacteria | 1387 |
| 487 | Ga0157372_11004883 | 3300013307 | Bacteria | 966 |
| 488 | Ga0157372_11070967 | 3300013307 | Bacteria | 933 |
| 489 | Ga0157372_12240767 | 3300013307 | Unclassified | 627 |
| 490 | Ga0157375_10000548 | 3300013308 | Bacteria | 33804 |
| 491 | Ga0157375_10000813 | 3300013308 | Bacteria | 27357 |
| 492 | Ga0157375_10014722 | 3300013308 | Bacteria | 6989 |
| 493 | Ga0157375_10031471 | 3300013308 | Bacteria | 5016 |
| 494 | Ga0157375_10056177 | 3300013308 | Bacteria | 3885 |
| 495 | Ga0157375_10075317 | 3300013308 | Bacteria | 3399 |
| 496 | Ga0157375_10093955 | 3300013308 | Bacteria | 3066 |
| 497 | Ga0157375_10126832 | 3300013308 | Bacteria | 2668 |
| 498 | Ga0157375_10442997 | 3300013308 | Bacteria | 1464 |
| 499 | Ga0157375_10767824 | 3300013308 | Bacteria | 1114 |
| 500 | Ga0157375_10798667 | 3300013308 | Bacteria | 1092 |
| 501 | Ga0157375_10834563 | 3300013308 | Bacteria | 1069 |
| 502 | Ga0157375_11495265 | 3300013308 | Unclassified | 797 |
| 503 | Ga0157375_11980370 | 3300013308 | Bacteria | 692 |
| 504 | Ga0157375_13191713 | 3300013308 | Bacteria | 547 |
| 505 | Ga0163163_10000046 | 3300014325 | Bacteria | 133543 |
| 506 | Ga0163163_10040173 | 3300014325 | Bacteria | 4567 |
| 507 | Ga0163163_10135234 | 3300014325 | Unclassified | 2506 |
| 508 | Ga0163163_10176865 | 3300014325 | Bacteria | 2181 |
| 509 | Ga0163163_11024507 | 3300014325 | Bacteria | 889 |
| 510 | Ga0157380_10070887 | 3300014326 | Bacteria | 2818 |
| 511 | Ga0157380_10370569 | 3300014326 | Unclassified | 1347 |
| 512 | Ga0157380_10590989 | 3300014326 | Unclassified | 1096 |
| 513 | Ga0157377_10039879 | 3300014745 | Bacteria | 2599 |
| 514 | Ga0157377_10114748 | 3300014745 | Unclassified | 1624 |
| 515 | Ga0157377_11534426 | 3300014745 | Archaea | 531 |
| 516 | Ga0157379_10000020 | 3300014968 | Bacteria | 92868 |
| 517 | Ga0157379_10040831 | 3300014968 | Bacteria | 4141 |
| 518 | Ga0157379_10243117 | 3300014968 | Bacteria | 1633 |
| 519 | Ga0157379_10253462 | 3300014968 | Unclassified | 1598 |
| 520 | Ga0157379_10413592 | 3300014968 | Bacteria | 1241 |
| 521 | Ga0157379_10521428 | 3300014968 | Bacteria | 1103 |
| 522 | Ga0157379_11400081 | 3300014968 | Unclassified | 678 |
| 523 | Ga0157376_10000297 | 3300014969 | Bacteria | 33467 |
| 524 | Ga0157376_10067191 | 3300014969 | Bacteria | 3032 |
| 525 | Ga0157376_10165811 | 3300014969 | Bacteria | 2007 |
| 526 | Ga0157376_10208667 | 3300014969 | Unclassified | 1802 |
| 527 | Ga0157376_10246081 | 3300014969 | Bacteria | 1668 |
| 528 | Ga0157376_10289609 | 3300014969 | Unclassified | 1546 |
| 529 | Ga0157376_10316532 | 3300014969 | Unclassified | 1482 |
| 530 | Ga0157376_10561322 | 3300014969 | Bacteria | 1131 |
| 531 | Ga0157376_10984397 | 3300014969 | Bacteria | 865 |
| 532 | Ga0157376_11255830 | 3300014969 | Bacteria | 770 |
| 533 | Ga0157376_11538255 | 3300014969 | Unclassified | 699 |
| 534 | Ga0157376_11851269 | 3300014969 | Bacteria | 640 |
| 535 | Ga0157376_11999351 | 3300014969 | Unclassified | 617 |
| 536 | Ga0182006_1016995 | 3300015261 | Bacteria | 3097 |
| 537 | Ga0182006_1022981 | 3300015261 | Bacteria | 2585 |
| 538 | Ga0182006_1030285 | 3300015261 | Bacteria | 2187 |
| 539 | Ga0182006_1039993 | 3300015261 | Bacteria | 1847 |
| 540 | Ga0182005_1000023 | 3300015265 | Bacteria | 246328 |
| 541 | Ga0163161_10000950 | 3300017792 | Bacteria | 22231 |
| 542 | Ga0163161_10012778 | 3300017792 | Bacteria | 5832 |
| 543 | Ga0163161_10023840 | 3300017792 | Unclassified | 4318 |
| 544 | Ga0163161_10027586 | 3300017792 | Bacteria | 4030 |
| 545 | Ga0163161_10521882 | 3300017792 | Bacteria | 970 |
| 546 | Ga0163161_10575626 | 3300017792 | Bacteria | 926 |
| 547 | Ga0163161_10820570 | 3300017792 | Bacteria | 783 |
| 548 | Ga0163161_11417688 | 3300017792 | Unclassified | 607 |
| 549 | Ga0213872_10311097 | 3300021361 | Bacteria | 652 |
| 550 | Ga0213876_10018117 | 3300021384 | Bacteria | 3716 |
| 551 | Ga0224712_10579150 | 3300022467 | Bacteria | 547 |
| 552 | Ga0209436_105918 | 3300025208 | Bacteria | 2743 |
| 553 | Ga0209436_106670 | 3300025208 | Bacteria | 2501 |
| 554 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 555 | Ga0209258_106914 | 3300025242 | Bacteria | 1725 |
| 556 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 557 | Ga0209646_1000557 | 3300025246 | Bacteria | 15708 |
| 558 | Ga0209646_1019006 | 3300025246 | Bacteria | 1002 |
| 559 | Ga0209026_1001293 | 3300025250 | Bacteria | 11348 |
| 560 | Ga0209148_1000182 | 3300025254 | Bacteria | 123558 |
| 561 | Ga0209129_1007827 | 3300025258 | Bacteria | 3090 |
| 562 | Ga0209565_1017147 | 3300025263 | Bacteria | 1593 |
| 563 | Ga0209673_1000194 | 3300025273 | Bacteria | 122640 |
| 564 | Ga0209130_1001652 | 3300025284 | Bacteria | 13642 |
| 565 | Ga0209675_1034967 | 3300025291 | Bacteria | 1150 |
| 566 | Ga0209758_1008229 | 3300025297 | Bacteria | 6829 |
| 567 | Ga0209758_1035014 | 3300025297 | Bacteria | 1985 |
| 568 | Ga0209050_1000765 | 3300025298 | Bacteria | 46179 |
| 569 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 570 | Ga0207426_1000803 | 3300025302 | Bacteria | 33968 |
| 571 | Ga0207426_1002657 | 3300025302 | Bacteria | 10981 |
| 572 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 573 | Ga0209257_1001800 | 3300025304 | Bacteria | 23517 |
| 574 | Ga0207697_10016125 | 3300025315 | Bacteria | 3081 |
| 575 | Ga0207697_10120607 | 3300025315 | Archaea | 1128 |
| 576 | Ga0207697_10436429 | 3300025315 | Bacteria | 581 |
| 577 | Ga0207696_1111166 | 3300025711 | Bacteria | 742 |
| 578 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 579 | Ga0207682_10357956 | 3300025893 | Bacteria | 688 |
| 580 | Ga0207710_10001860 | 3300025900 | Bacteria | 10160 |
| 581 | Ga0207688_10126651 | 3300025901 | Bacteria | 1494 |
| 582 | Ga0207688_10255433 | 3300025901 | Unclassified | 1062 |
| 583 | Ga0207680_10013020 | 3300025903 | Bacteria | 4256 |
| 584 | Ga0207680_10016456 | 3300025903 | Bacteria | 3883 |
| 585 | Ga0207680_10072487 | 3300025903 | Bacteria | 2138 |
| 586 | Ga0207680_10443534 | 3300025903 | Archaea | 921 |
| 587 | Ga0207647_10011770 | 3300025904 | Bacteria | 6120 |
| 588 | Ga0207647_10028201 | 3300025904 | Bacteria | 3650 |
| 589 | Ga0207647_10116839 | 3300025904 | Bacteria | 1575 |
| 590 | Ga0207647_10128429 | 3300025904 | Unclassified | 1491 |
| 591 | Ga0207647_10166452 | 3300025904 | Bacteria | 1285 |
| 592 | Ga0207647_10452058 | 3300025904 | Unclassified | 720 |
| 593 | Ga0207685_10080434 | 3300025905 | Unclassified | 1347 |
| 594 | Ga0207699_10382682 | 3300025906 | Unclassified | 999 |
| 595 | Ga0207645_10000716 | 3300025907 | Bacteria | 27613 |
| 596 | Ga0207645_10024624 | 3300025907 | Bacteria | 3899 |
| 597 | Ga0207645_10188597 | 3300025907 | Bacteria | 1354 |
| 598 | Ga0207643_10148166 | 3300025908 | Bacteria | 1405 |
| 599 | Ga0207705_10015509 | 3300025909 | Bacteria | 5468 |
| 600 | Ga0207705_10128970 | 3300025909 | Unclassified | 1881 |
| 601 | Ga0207705_10834983 | 3300025909 | Bacteria | 715 |
| 602 | Ga0207654_10000765 | 3300025911 | Bacteria | 17701 |
| 603 | Ga0207654_10002286 | 3300025911 | Bacteria | 9822 |
| 604 | Ga0207654_10667864 | 3300025911 | Bacteria | 745 |
| 605 | Ga0207654_10976761 | 3300025911 | Archaea | 615 |
| 606 | Ga0207654_11110138 | 3300025911 | Unclassified | 576 |
| 607 | Ga0207707_10000317 | 3300025912 | Bacteria | 50861 |
| 608 | Ga0207707_10032387 | 3300025912 | Unclassified | 4575 |
| 609 | Ga0207707_11514523 | 3300025912 | Bacteria | 531 |
| 610 | Ga0207695_10000130 | 3300025913 | Bacteria | 224214 |
| 611 | Ga0207695_10000170 | 3300025913 | Bacteria | 192469 |
| 612 | Ga0207695_10001252 | 3300025913 | Bacteria | 43328 |
| 613 | Ga0207695_10003385 | 3300025913 | Bacteria | 22535 |
| 614 | Ga0207695_10005660 | 3300025913 | Bacteria | 16495 |
| 615 | Ga0207695_10014637 | 3300025913 | Bacteria | 9277 |
| 616 | Ga0207695_10019730 | 3300025913 | Bacteria | 7751 |
| 617 | Ga0207695_10082396 | 3300025913 | Bacteria | 3253 |
| 618 | Ga0207695_10122313 | 3300025913 | Bacteria | 2569 |
| 619 | Ga0207695_10146013 | 3300025913 | Bacteria | 2309 |
| 620 | Ga0207695_10496260 | 3300025913 | Bacteria | 1103 |
| 621 | Ga0207695_10781442 | 3300025913 | Bacteria | 835 |
| 622 | Ga0207671_10003613 | 3300025914 | Bacteria | 15278 |
| 623 | Ga0207671_10006005 | 3300025914 | Bacteria | 10980 |
| 624 | Ga0207671_10007695 | 3300025914 | Bacteria | 9302 |
| 625 | Ga0207671_10050128 | 3300025914 | Unclassified | 3091 |
| 626 | Ga0207671_10099825 | 3300025914 | Bacteria | 2197 |
| 627 | Ga0207671_10334900 | 3300025914 | Bacteria | 1199 |
| 628 | Ga0207671_10511850 | 3300025914 | Bacteria | 957 |
| 629 | Ga0207660_10001972 | 3300025917 | Bacteria | 13679 |
| 630 | Ga0207662_10045504 | 3300025918 | Bacteria | 2594 |
| 631 | Ga0207662_10271871 | 3300025918 | Bacteria | 1119 |
| 632 | Ga0207657_10115523 | 3300025919 | Bacteria | 2212 |
| 633 | Ga0207657_10194543 | 3300025919 | Bacteria | 1634 |
| 634 | Ga0207649_10012710 | 3300025920 | Bacteria | 4679 |
| 635 | Ga0207652_10000456 | 3300025921 | Bacteria | 42137 |
| 636 | Ga0207694_10010257 | 3300025924 | Bacteria | 7064 |
| 637 | Ga0207694_10246202 | 3300025924 | Unclassified | 1462 |
| 638 | Ga0207694_10326039 | 3300025924 | Unclassified | 1268 |
| 639 | Ga0207694_10461571 | 3300025924 | Bacteria | 1061 |
| 640 | Ga0207694_10554200 | 3300025924 | Bacteria | 965 |
| 641 | Ga0207650_10061157 | 3300025925 | Bacteria | 2811 |
| 642 | Ga0207650_10110693 | 3300025925 | Bacteria | 2125 |
| 643 | Ga0207650_10630446 | 3300025925 | Bacteria | 903 |
| 644 | Ga0207659_10218326 | 3300025926 | Bacteria | 1531 |
| 645 | Ga0207659_10737889 | 3300025926 | Unclassified | 844 |
| 646 | Ga0207659_11515077 | 3300025926 | Bacteria | 573 |
| 647 | Ga0207659_11792454 | 3300025926 | Unclassified | 521 |
| 648 | Ga0207644_10084955 | 3300025931 | Bacteria | 2347 |
| 649 | Ga0207644_10109732 | 3300025931 | Bacteria | 2085 |
| 650 | Ga0207644_10210051 | 3300025931 | Bacteria | 1539 |
| 651 | Ga0207644_10224539 | 3300025931 | Unclassified | 1490 |
| 652 | Ga0207644_10520692 | 3300025931 | Bacteria | 982 |
| 653 | Ga0207690_10023014 | 3300025932 | Bacteria | 3883 |
| 654 | Ga0207690_10741747 | 3300025932 | Archaea | 809 |
| 655 | Ga0207706_10002658 | 3300025933 | Bacteria | 17397 |
| 656 | Ga0207706_10014472 | 3300025933 | Bacteria | 7151 |
| 657 | Ga0207706_10014939 | 3300025933 | Bacteria | 7032 |
| 658 | Ga0207706_10065352 | 3300025933 | Bacteria | 3203 |
| 659 | Ga0207706_10244841 | 3300025933 | Unclassified | 1567 |
| 660 | Ga0207706_10763496 | 3300025933 | Unclassified | 823 |
| 661 | Ga0207686_10217870 | 3300025934 | Bacteria | 1376 |
| 662 | Ga0207686_10801010 | 3300025934 | Bacteria | 755 |
| 663 | Ga0207670_10015308 | 3300025936 | Bacteria | 4580 |
| 664 | Ga0207670_10870212 | 3300025936 | Bacteria | 753 |
| 665 | Ga0207669_10562061 | 3300025937 | Unclassified | 922 |
| 666 | Ga0207669_10953948 | 3300025937 | Bacteria | 719 |
| 667 | Ga0207704_10001715 | 3300025938 | Bacteria | 9809 |
| 668 | Ga0207704_10055030 | 3300025938 | Bacteria | 2429 |
| 669 | Ga0207704_10087633 | 3300025938 | Bacteria | 2034 |
| 670 | Ga0207704_10174063 | 3300025938 | Unclassified | 1547 |
| 671 | Ga0207691_10000013 | 3300025940 | Bacteria | 147349 |
| 672 | Ga0207691_10016423 | 3300025940 | Bacteria | 7028 |
| 673 | Ga0207691_10044291 | 3300025940 | Bacteria | 4097 |
| 674 | Ga0207691_10533510 | 3300025940 | Unclassified | 996 |
| 675 | Ga0207691_10950959 | 3300025940 | Bacteria | 718 |
| 676 | Ga0207711_10121595 | 3300025941 | Bacteria | 2331 |
| 677 | Ga0207711_11557490 | 3300025941 | Unclassified | 604 |
| 678 | Ga0207689_10004605 | 3300025942 | Bacteria | 12472 |
| 679 | Ga0207689_10011865 | 3300025942 | Bacteria | 7466 |
| 680 | Ga0207689_10037638 | 3300025942 | Bacteria | 4012 |
| 681 | Ga0207689_10111224 | 3300025942 | Bacteria | 2251 |
| 682 | Ga0207689_10132759 | 3300025942 | Bacteria | 2049 |
| 683 | Ga0207689_11013559 | 3300025942 | Unclassified | 700 |
| 684 | Ga0207661_10015513 | 3300025944 | Bacteria | 5608 |
| 685 | Ga0207661_10019534 | 3300025944 | Bacteria | 5054 |
| 686 | Ga0207661_10031717 | 3300025944 | Bacteria | 4086 |
| 687 | Ga0207661_10704745 | 3300025944 | Bacteria | 929 |
| 688 | Ga0207679_10020993 | 3300025945 | Bacteria | 4419 |
| 689 | Ga0207679_10022054 | 3300025945 | Bacteria | 4330 |
| 690 | Ga0207679_10161133 | 3300025945 | Unclassified | 1837 |
| 691 | Ga0207679_10682508 | 3300025945 | Bacteria | 931 |
| 692 | Ga0207679_10689972 | 3300025945 | Bacteria | 926 |
| 693 | Ga0207667_10000876 | 3300025949 | Bacteria | 38469 |
| 694 | Ga0207667_10005154 | 3300025949 | Bacteria | 15964 |
| 695 | Ga0207667_10010158 | 3300025949 | Bacteria | 11026 |
| 696 | Ga0207667_10039331 | 3300025949 | Bacteria | 5042 |
| 697 | Ga0207667_10050854 | 3300025949 | Bacteria | 4371 |
| 698 | Ga0207667_10053350 | 3300025949 | Bacteria | 4255 |
| 699 | Ga0207667_10474131 | 3300025949 | Bacteria | 1271 |
| 700 | Ga0207667_10881920 | 3300025949 | Bacteria | 887 |
| 701 | Ga0207667_10916014 | 3300025949 | Unclassified | 868 |
| 702 | Ga0207651_10000468 | 3300025960 | Bacteria | 17037 |
| 703 | Ga0207651_10019959 | 3300025960 | Bacteria | 4032 |
| 704 | Ga0207651_10090796 | 3300025960 | Bacteria | 2234 |
| 705 | Ga0207712_10019045 | 3300025961 | Bacteria | 4478 |
| 706 | Ga0207712_10029238 | 3300025961 | Bacteria | 3694 |
| 707 | Ga0207712_10061839 | 3300025961 | Bacteria | 2659 |
| 708 | Ga0207712_10915753 | 3300025961 | Bacteria | 775 |
| 709 | Ga0207712_11037252 | 3300025961 | Bacteria | 728 |
| 710 | Ga0207668_10000295 | 3300025972 | Bacteria | 32756 |
| 711 | Ga0207668_10462652 | 3300025972 | Bacteria | 1085 |
| 712 | Ga0207668_10732966 | 3300025972 | Bacteria | 871 |
| 713 | Ga0207668_10839937 | 3300025972 | Unclassified | 815 |
| 714 | Ga0207668_10908612 | 3300025972 | Bacteria | 784 |
| 715 | Ga0207640_10022361 | 3300025981 | Bacteria | 3783 |
| 716 | Ga0207640_10112734 | 3300025981 | Bacteria | 1931 |
| 717 | Ga0207640_10248673 | 3300025981 | Bacteria | 1379 |
| 718 | Ga0207658_10005989 | 3300025986 | Bacteria | 8313 |
| 719 | Ga0207658_10039948 | 3300025986 | Bacteria | 3388 |
| 720 | Ga0207658_10132740 | 3300025986 | Bacteria | 2003 |
| 721 | Ga0207658_10136739 | 3300025986 | Bacteria | 1977 |
| 722 | Ga0207658_10374134 | 3300025986 | Bacteria | 1246 |
| 723 | Ga0207658_10532619 | 3300025986 | Bacteria | 1049 |
| 724 | Ga0207658_10699936 | 3300025986 | Bacteria | 916 |
| 725 | Ga0207658_11101638 | 3300025986 | Unclassified | 725 |
| 726 | Ga0207658_11116102 | 3300025986 | Unclassified | 720 |
| 727 | Ga0207677_10002177 | 3300026023 | Bacteria | 10299 |
| 728 | Ga0207677_10020249 | 3300026023 | Bacteria | 4035 |
| 729 | Ga0207677_10048097 | 3300026023 | Bacteria | 2869 |
| 730 | Ga0207677_10054092 | 3300026023 | Bacteria | 2737 |
| 731 | Ga0207677_10123314 | 3300026023 | Unclassified | 1953 |
| 732 | Ga0207677_10894324 | 3300026023 | Bacteria | 800 |
| 733 | Ga0207703_10001005 | 3300026035 | Bacteria | 27079 |
| 734 | Ga0207703_10166712 | 3300026035 | Bacteria | 1934 |
| 735 | Ga0207703_10421325 | 3300026035 | Unclassified | 1242 |
| 736 | Ga0207703_10695737 | 3300026035 | Bacteria | 966 |
| 737 | Ga0207639_10001884 | 3300026041 | Bacteria | 14093 |
| 738 | Ga0207639_10009995 | 3300026041 | Bacteria | 6558 |
| 739 | Ga0207639_10079293 | 3300026041 | Bacteria | 2595 |
| 740 | Ga0207639_10130798 | 3300026041 | Bacteria | 2077 |
| 741 | Ga0207639_10238583 | 3300026041 | Unclassified | 1579 |
| 742 | Ga0207639_10329654 | 3300026041 | Unclassified | 1358 |
| 743 | Ga0207639_10347899 | 3300026041 | Bacteria | 1323 |
| 744 | Ga0207639_10687348 | 3300026041 | Bacteria | 949 |
| 745 | Ga0207639_11082349 | 3300026041 | Bacteria | 752 |
| 746 | Ga0207639_11233658 | 3300026041 | Unclassified | 702 |
| 747 | Ga0207639_11877624 | 3300026041 | Bacteria | 560 |
| 748 | Ga0207678_10169409 | 3300026067 | Bacteria | 1864 |
| 749 | Ga0207678_10874452 | 3300026067 | Unclassified | 794 |
| 750 | Ga0207702_10074911 | 3300026078 | Bacteria | 2923 |
| 751 | Ga0207702_11613979 | 3300026078 | Bacteria | 642 |
| 752 | Ga0207641_10005007 | 3300026088 | Bacteria | 11359 |
| 753 | Ga0207641_10013024 | 3300026088 | Bacteria | 6821 |
| 754 | Ga0207641_10480945 | 3300026088 | Unclassified | 1203 |
| 755 | Ga0207641_10755342 | 3300026088 | Unclassified | 960 |
| 756 | Ga0207641_10920700 | 3300026088 | Bacteria | 869 |
| 757 | Ga0207641_10934364 | 3300026088 | Unclassified | 862 |
| 758 | Ga0207641_11556071 | 3300026088 | Bacteria | 663 |
| 759 | Ga0207648_10006608 | 3300026089 | Bacteria | 11516 |
| 760 | Ga0207648_10019286 | 3300026089 | Bacteria | 6156 |
| 761 | Ga0207648_10088214 | 3300026089 | Bacteria | 2708 |
| 762 | Ga0207648_10119591 | 3300026089 | Unclassified | 2315 |
| 763 | Ga0207648_10151451 | 3300026089 | Unclassified | 2047 |
| 764 | Ga0207648_10292252 | 3300026089 | Unclassified | 1459 |
| 765 | Ga0207648_10320205 | 3300026089 | Unclassified | 1393 |
| 766 | Ga0207648_10576955 | 3300026089 | Bacteria | 1035 |
| 767 | Ga0207648_11697011 | 3300026089 | Unclassified | 593 |
| 768 | Ga0207676_10016838 | 3300026095 | Bacteria | 5293 |
| 769 | Ga0207676_10024521 | 3300026095 | Bacteria | 4465 |
| 770 | Ga0207676_10025761 | 3300026095 | Bacteria | 4366 |
| 771 | Ga0207676_10038335 | 3300026095 | Bacteria | 3657 |
| 772 | Ga0207676_10051614 | 3300026095 | Bacteria | 3211 |
| 773 | Ga0207676_10512360 | 3300026095 | Bacteria | 1141 |
| 774 | Ga0207674_10002964 | 3300026116 | Bacteria | 21086 |
| 775 | Ga0207674_10007545 | 3300026116 | Bacteria | 12670 |
| 776 | Ga0207674_10019908 | 3300026116 | Bacteria | 7261 |
| 777 | Ga0207674_10152379 | 3300026116 | Bacteria | 2268 |
| 778 | Ga0207674_10517136 | 3300026116 | Bacteria | 1153 |
| 779 | Ga0207674_10627852 | 3300026116 | Bacteria | 1038 |
| 780 | Ga0207674_11580605 | 3300026116 | Bacteria | 624 |
| 781 | Ga0207675_100135163 | 3300026118 | Bacteria | 2339 |
| 782 | Ga0207675_100268394 | 3300026118 | Bacteria | 1655 |
| 783 | Ga0207675_100321928 | 3300026118 | Bacteria | 1510 |
| 784 | Ga0207683_10045175 | 3300026121 | Bacteria | 3851 |
| 785 | Ga0207683_10060212 | 3300026121 | Bacteria | 3337 |
| 786 | Ga0207683_10233766 | 3300026121 | Bacteria | 1676 |
| 787 | Ga0207683_10747903 | 3300026121 | Bacteria | 907 |
| 788 | Ga0207683_11204266 | 3300026121 | Unclassified | 702 |
| 789 | Ga0207698_10078635 | 3300026142 | Unclassified | 2649 |
| 790 | Ga0207698_10113740 | 3300026142 | Bacteria | 2275 |
| 791 | Ga0207698_10242966 | 3300026142 | Bacteria | 1642 |
| 792 | Ga0207698_10266884 | 3300026142 | Unclassified | 1575 |
| 793 | Ga0207698_10963147 | 3300026142 | Bacteria | 863 |
| 794 | Ga0207698_12338779 | 3300026142 | Bacteria | 546 |
| 795 | Ga0209281_1000570 | 3300027111 | Bacteria | 44049 |
| 796 | Ga0209969_1046382 | 3300027360 | Bacteria | 679 |
| 797 | Ga0209968_1001511 | 3300027526 | Bacteria | 3533 |
| 798 | Ga0209999_1029439 | 3300027543 | Bacteria | 1019 |
| 799 | Ga0209999_1059873 | 3300027543 | Bacteria | 724 |
| 800 | Ga0209282_1010717 | 3300027666 | Bacteria | 5805 |
| 801 | Ga0209971_1168392 | 3300027682 | Bacteria | 540 |
| 802 | Ga0209974_10055137 | 3300027876 | Bacteria | 1340 |
| 803 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 804 | Ga0268266_10003677 | 3300028379 | Bacteria | 15140 |
| 805 | Ga0268266_10007487 | 3300028379 | Bacteria | 9843 |
| 806 | Ga0268265_10471789 | 3300028380 | Bacteria | 1177 |
| 807 | Ga0268264_10000109 | 3300028381 | Bacteria | 208477 |
| 808 | Ga0268264_10009730 | 3300028381 | Bacteria | 7958 |
| 809 | Ga0268264_10014974 | 3300028381 | Bacteria | 6365 |
| 810 | Ga0268264_10106766 | 3300028381 | Unclassified | 2445 |
| 811 | Ga0268264_10386704 | 3300028381 | Bacteria | 1341 |
| 812 | Ga0268264_10850421 | 3300028381 | Bacteria | 914 |
| 813 | Ga0307517_10004572 | 3300028786 | Bacteria | 21214 |
| 814 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 815 | Ga0307515_10102798 | 3300028794 | Bacteria | 3433 |
| 816 | Ga0265324_10182885 | 3300029957 | Bacteria | 712 |
| 817 | Ga0307511_10000455 | 3300030521 | Bacteria | 44094 |
| 818 | Ga0316177_1021152 | 3300030731 | Bacteria | 699 |
| 819 | Ga0316179_1081379 | 3300030734 | Bacteria | 2559 |
| 820 | Ga0265327_10000009 | 3300031251 | Bacteria | 616360 |
| 821 | Ga0265327_10000219 | 3300031251 | Bacteria | 116606 |
| 822 | Ga0265327_10004167 | 3300031251 | Bacteria | 13044 |
| 823 | Ga0265316_10138506 | 3300031344 | Bacteria | 1830 |
| 824 | Ga0307509_10079477 | 3300031507 | Bacteria | 3395 |
| 825 | Ga0307408_100002005 | 3300031548 | Bacteria | 14705 |
| 826 | Ga0265313_10054220 | 3300031595 | Bacteria | 1905 |
| 827 | Ga0307508_10266298 | 3300031616 | Bacteria | 1308 |
| 828 | Ga0307516_10286305 | 3300031730 | Bacteria | 1328 |
| 829 | Ga0307405_11624296 | 3300031731 | Bacteria | 571 |
| 830 | Ga0307405_11949210 | 3300031731 | Bacteria | 525 |
| 831 | Ga0307413_10000274 | 3300031824 | Bacteria | 15735 |
| 832 | Ga0307413_10212917 | 3300031824 | Bacteria | 1405 |
| 833 | Ga0307413_11632368 | 3300031824 | Bacteria | 573 |
| 834 | Ga0307410_10000048 | 3300031852 | Bacteria | 42322 |
| 835 | Ga0307410_10366619 | 3300031852 | Bacteria | 1155 |
| 836 | Ga0307406_10000004 | 3300031901 | Bacteria | 179772 |
| 837 | Ga0307406_10207111 | 3300031901 | Bacteria | 1448 |
| 838 | Ga0307407_10084970 | 3300031903 | Bacteria | 1924 |
| 839 | Ga0307416_100003753 | 3300032002 | Bacteria | 9013 |
| 840 | Ga0307414_10000051 | 3300032004 | Bacteria | 127567 |
| 841 | Ga0307414_10001420 | 3300032004 | Bacteria | 12435 |
| 842 | Ga0307414_10045305 | 3300032004 | Bacteria | 3011 |
| 843 | Ga0307414_10319570 | 3300032004 | Bacteria | 1321 |
| 844 | Ga0307414_10836380 | 3300032004 | Bacteria | 841 |
| 845 | Ga0307414_11773549 | 3300032004 | Bacteria | 576 |
| 846 | Ga0307411_10000020 | 3300032005 | Bacteria | 75190 |
| 847 | Ga0307411_10025263 | 3300032005 | Bacteria | 3557 |
| 848 | Ga0307411_11028116 | 3300032005 | Unclassified | 739 |
| 849 | Ga0307415_102068937 | 3300032126 | Bacteria | 555 |
| 850 | Ga0307507_10486053 | 3300033179 | Bacteria | 670 |
| 851 | Ga0307510_10038492 | 3300033180 | Bacteria | 5287 |
| 852 | Ga0307510_10047929 | 3300033180 | Bacteria | 4567 |
| 853 | Ga0373934_0225434 | 3300035086 | Bacteria | 773 |
| 854 | Ga0373944_0175204 | 3300035089 | Bacteria | 767 |
| 855 | Ga0373936_0318064 | 3300035113 | Bacteria | 705 |
| 856 | Ga0373939_0180524 | 3300035114 | Bacteria | 787 |
| 857 | Ga0373941_0295771 | 3300035115 | Bacteria | 645 |
| 858 | Ga0373954_0099197 | 3300035118 | Bacteria | 1404 |
| 859 | Ga0373955_0120482 | 3300035172 | Bacteria | 1525 |
| 860 | Ga0373935_0216448 | 3300035692 | Bacteria | 1329 |
| 861 | Ga0373935_0575918 | 3300035692 | Bacteria | 822 |
| 862 | Ga0373927_0045920 | 3300035695 | Bacteria | 2827 |
| 863 | Ga0373933_0235715 | 3300035724 | Bacteria | 1176 |
| 864 | Ga0373937_0043690 | 3300036401 | Bacteria | 4092 |
| 865 | Ga0373937_0474512 | 3300036401 | Bacteria | 1188 |
| 866 | Ga0373925_0540967 | 3300037068 | Bacteria | 958 |
| 867 | Ga0436365_0090513 | 3300039437 | Bacteria | 14251 |
| 868 | Ga0436361_0102070 | 3300039447 | Bacteria | 2568 |
| 869 | Ga0439436_0006422 | 3300041404 | Bacteria | 3611 |
| 870 | Ga0439439_0221112 | 3300041406 | Bacteria | 555 |
| 871 | Ga0439447_001368 | 3300041407 | Bacteria | 8913 |
| 872 | Ga0439466_0001833 | 3300041411 | Bacteria | 8335 |
| 873 | Ga0439466_0015264 | 3300041411 | Bacteria | 2791 |
| 874 | Ga0439465_0093575 | 3300041413 | Bacteria | 1031 |
| 875 | Ga0451787_098082 | 3300041441 | Bacteria | 712 |
| 876 | Ga0451793_0847059 | 3300041452 | Bacteria | 553 |
| 877 | Ga0451797_0679504 | 3300041453 | Bacteria | 950 |
| 878 | Ga0451795_0707805 | 3300041456 | Bacteria | 674 |
| 879 | Ga0451800_1624960 | 3300041459 | Bacteria | 849 |
| 880 | Ga0451802_0508158 | 3300041460 | Bacteria | 1185 |
| 881 | Ga0451802_1818999 | 3300041460 | Bacteria | 1584 |
| 882 | Ga0451807_0677323 | 3300041486 | Bacteria | 531 |
| 883 | Ga0451833_1095634 | 3300041491 | Bacteria | 782 |
| 884 | Ga0451835_0691656 | 3300041492 | Bacteria | 1114 |
| 885 | Ga0451837_1190987 | 3300041494 | Bacteria | 584 |
| 886 | Ga0451841_0596099 | 3300041498 | Bacteria | 721 |
| 887 | Ga0451851_0019816 | 3300041507 | Bacteria | 1080 |
| 888 | Ga0451855_0703264 | 3300041511 | Bacteria | 558 |
| 889 | Ga0451853_1034895 | 3300041512 | Bacteria | 1528 |
| 890 | Ga0439431_0001740 | 3300041997 | Bacteria | 4797 |
| 891 | Ga0439431_0022343 | 3300041997 | Bacteria | 1524 |
| 892 | Ga0439449_0040120 | 3300042007 | Bacteria | 1741 |
| 893 | Ga0439457_003389 | 3300042014 | Bacteria | 4336 |
| 894 | Ga0439462_0014919 | 3300042015 | Bacteria | 2000 |
| 895 | Ga0451577_0009728 | 3300042876 | Bacteria | 9218 |
| 896 | Ga0451577_0147917 | 3300042876 | Bacteria | 2113 |
| 897 | Ga0451577_0204822 | 3300042876 | Bacteria | 1781 |
| 898 | Ga0451577_0548777 | 3300042876 | Bacteria | 1049 |
| 899 | Ga0451577_0894456 | 3300042876 | Unclassified | 800 |
| 900 | Ga0451577_1634822 | 3300042876 | Bacteria | 568 |
| 901 | Ga0466969_0000149 | 3300044656 | Bacteria | 37747 |
| 902 | Ga0466969_0055902 | 3300044656 | Bacteria | 1929 |
| 903 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 904 | Ga0466972_0009022 | 3300044658 | Bacteria | 5005 |
| 905 | Ga0466972_0055893 | 3300044658 | Bacteria | 1898 |
| 906 | Ga0466972_0070919 | 3300044658 | Bacteria | 1662 |
| 907 | Ga0453683_0776247 | 3300044673 | Bacteria | 630 |
| 908 | Ga0466965_0016082 | 3300044683 | Bacteria | 3555 |
| 909 | Ga0466966_0541218 | 3300044684 | Bacteria | 701 |
| 910 | Ga0466961_0018040 | 3300044693 | Bacteria | 4538 |
| 911 | Ga0466964_0013676 | 3300044706 | Bacteria | 3080 |
| 912 | Ga0466964_0110784 | 3300044706 | Bacteria | 1224 |
| 913 | Ga0453684_0054028 | 3300044712 | Bacteria | 5237 |
| 914 | Ga0453684_0192811 | 3300044712 | Bacteria | 2382 |
| 915 | Ga0453684_0462562 | 3300044712 | Unclassified | 1410 |
| 916 | Ga0466971_0043276 | 3300044719 | Bacteria | 2024 |
| 917 | Ga0466971_0410629 | 3300044719 | Unclassified | 661 |
| 918 | Ga0466968_0031740 | 3300044735 | Bacteria | 2193 |
| 919 | Ga0466968_0358445 | 3300044735 | Bacteria | 709 |
| 920 | Ga0466968_0373239 | 3300044735 | Bacteria | 696 |
| 921 | Ga0466970_0101719 | 3300044765 | Bacteria | 1565 |
| 922 | Ga0466970_0112116 | 3300044765 | Bacteria | 1490 |
| 923 | Ga0466970_0214363 | 3300044765 | Bacteria | 1073 |
| 924 | Ga0466957_0001230 | 3300044842 | Bacteria | 13374 |
| 925 | Ga0466957_0008061 | 3300044842 | Bacteria | 5976 |
| 926 | Ga0466957_0207593 | 3300044842 | Bacteria | 1289 |
| 927 | Ga0466957_0281260 | 3300044842 | Bacteria | 1114 |
| 928 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 929 | Ga0466959_0002751 | 3300045049 | Bacteria | 11327 |
| 930 | Ga0466959_0032629 | 3300045049 | Bacteria | 3854 |
| 931 | Ga0451576_0345050 | 3300045051 | Bacteria | 1559 |
| 932 | Ga0466958_0033971 | 3300045836 | Bacteria | 3041 |
| 933 | Ga0495627_002397 | 3300046453 | Bacteria | 9089 |
| 934 | Ga0495638_0114742 | 3300046460 | Bacteria | 1597 |
| 935 | Ga0495651_0223746 | 3300046462 | Bacteria | 1301 |
| 936 | Ga0495651_0447595 | 3300046462 | Bacteria | 835 |
| 937 | Ga0495651_0714589 | 3300046462 | Bacteria | 624 |
| 938 | Ga0495653_0152396 | 3300046463 | Bacteria | 1614 |
| 939 | Ga0495653_0828790 | 3300046463 | Bacteria | 555 |
| 940 | Ga0495580_0135454 | 3300046472 | Unclassified | 1708 |
| 941 | Ga0495580_0337634 | 3300046472 | Unclassified | 1022 |
| 942 | Ga0495608_0060018 | 3300046511 | Bacteria | 2504 |
| 943 | Ga0495610_0068951 | 3300046512 | Bacteria | 1656 |
| 944 | Ga0495618_0060481 | 3300046514 | Bacteria | 2402 |
| 945 | Ga0495628_0061099 | 3300046516 | Unclassified | 2955 |
| 946 | Ga0495630_0025827 | 3300046517 | Bacteria | 4345 |
| 947 | Ga0495630_0189077 | 3300046517 | Bacteria | 1571 |
| 948 | Ga0495632_0148631 | 3300046519 | Bacteria | 1084 |
| 949 | Ga0495632_0324580 | 3300046519 | Bacteria | 680 |
| 950 | Ga0495648_0265597 | 3300046524 | Bacteria | 821 |
| 951 | Ga0495640_0703869 | 3300046533 | Bacteria | 606 |
| 952 | Ga0495586_0398048 | 3300046535 | Bacteria | 792 |
| 953 | Ga0495598_0071004 | 3300046537 | Unclassified | 1097 |
| 954 | Ga0495621_0478100 | 3300046539 | Bacteria | 536 |
| 955 | Ga0495645_0732894 | 3300046543 | Bacteria | 598 |
| 956 | Ga0495622_0245260 | 3300046557 | Bacteria | 789 |
| 957 | Ga0495633_0000058 | 3300046558 | Bacteria | 147584 |
| 958 | Ga0495633_0028198 | 3300046558 | Bacteria | 2739 |
| 959 | Ga0495667_0404024 | 3300046559 | Bacteria | 860 |
| 960 | Ga0495667_0673626 | 3300046559 | Bacteria | 642 |
| 961 | Ga0495634_0121772 | 3300046642 | Bacteria | 1670 |
| 962 | Ga0495611_0000883 | 3300046648 | Bacteria | 16291 |
| 963 | Ga0495625_0303361 | 3300046660 | Bacteria | 1021 |
| 964 | Ga0495635_0220148 | 3300046663 | Bacteria | 1284 |
| 965 | Ga0495657_0321763 | 3300046675 | Bacteria | 919 |
| 966 | Ga0495646_0197748 | 3300046680 | Bacteria | 1096 |
| 967 | Ga0495647_0091463 | 3300046681 | Bacteria | 1248 |
| 968 | Ga0495613_0057376 | 3300046689 | Bacteria | 2859 |
| 969 | Ga0495670_0070067 | 3300046691 | Bacteria | 1774 |
| 970 | Ga0495671_0018522 | 3300046692 | Bacteria | 3695 |
| 971 | Ga0495649_0153742 | 3300046694 | Bacteria | 1208 |
| 972 | Ga0495649_0245781 | 3300046694 | Unclassified | 920 |
| 973 | Ga0495674_0221266 | 3300047319 | Bacteria | 1565 |
| 974 | Ga0495674_0429891 | 3300047319 | Bacteria | 1063 |
| 975 | Ga0495674_0443521 | 3300047319 | Bacteria | 1044 |
| 976 | Ga0495672_0015969 | 3300047320 | Bacteria | 5083 |
| 977 | Ga0495672_0071262 | 3300047320 | Bacteria | 1967 |
| 978 | Ga0495672_0172061 | 3300047320 | Bacteria | 1104 |
| 979 | Ga0495680_0454391 | 3300047322 | Bacteria | 876 |
| 980 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 981 | Ga0495684_0263139 | 3300047471 | Bacteria | 1250 |
| 982 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 983 | Ga0495602_0334819 | 3300048088 | Bacteria | 1097 |
| 984 | Ga0496102_0791356 | 3300048905 | Unclassified | 871 |
| 985 | Ga0496108_0642207 | 3300048911 | Bacteria | 923 |
| 986 | Ga0496109_1472235 | 3300048912 | Archaea | 616 |
| 987 | Ga0496114_0153449 | 3300048917 | Bacteria | 1999 |
| 988 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 989 | Ga0496117_0099196 | 3300048920 | Bacteria | 1849 |
| 990 | Ga0496118_0017695 | 3300048921 | Bacteria | 6471 |
| 991 | Ga0496121_0000343 | 3300048924 | Bacteria | 96972 |
| 992 | Ga0496121_0592952 | 3300048924 | Bacteria | 685 |
| 993 | Ga0496124_0026742 | 3300048927 | Bacteria | 5197 |
| 994 | Ga0496124_0567710 | 3300048927 | Bacteria | 745 |
| 995 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 996 | Ga0496125_0299882 | 3300048928 | Bacteria | 985 |
| 997 | Ga0496126_0015334 | 3300048929 | Bacteria | 7711 |
| 998 | Ga0496126_0129830 | 3300048929 | Bacteria | 2178 |
| 999 | Ga0496126_0884120 | 3300048929 | Bacteria | 679 |
| 1000 | Ga0501314_004831 | 3300049530 | Bacteria | 1131 |
| 1001 | Ga0501323_042247 | 3300049539 | Bacteria | 672 |
| 1002 | Ga0501032_0520407 | 3300049569 | Bacteria | 759 |
| 1003 | Ga0501033_0408860 | 3300049570 | Bacteria | 946 |
| 1004 | Ga0501033_0569298 | 3300049570 | Bacteria | 779 |
| 1005 | Ga0501034_0041587 | 3300049571 | Bacteria | 4651 |
| 1006 | Ga0501034_0076420 | 3300049571 | Bacteria | 3355 |
| 1007 | Ga0501034_0127733 | 3300049571 | Unclassified | 2527 |
| 1008 | Ga0501034_0556429 | 3300049571 | Bacteria | 1056 |
| 1009 | Ga0501036_1119338 | 3300049572 | Bacteria | 643 |
| 1010 | Ga0501037_0101058 | 3300049573 | Bacteria | 2082 |
| 1011 | Ga0501037_0242958 | 3300049573 | Bacteria | 1262 |
| 1012 | Ga0501038_0754453 | 3300049574 | Unclassified | 726 |
| 1013 | Ga0501038_1057760 | 3300049574 | Unclassified | 594 |
| 1014 | Ga0501043_0163965 | 3300049579 | Bacteria | 1736 |
| 1015 | Ga0501043_0169642 | 3300049579 | Bacteria | 1703 |
| 1016 | Ga0501043_0481483 | 3300049579 | Bacteria | 929 |
| 1017 | Ga0501046_0253019 | 3300049580 | Bacteria | 1296 |
| 1018 | Ga0501047_0007483 | 3300049581 | Bacteria | 10275 |
| 1019 | Ga0501047_0013459 | 3300049581 | Bacteria | 7754 |
| 1020 | Ga0501047_0034117 | 3300049581 | Bacteria | 4913 |
| 1021 | Ga0501047_0318956 | 3300049581 | Bacteria | 1394 |
| 1022 | Ga0501047_0847117 | 3300049581 | Unclassified | 728 |
| 1023 | Ga0501048_0393024 | 3300049582 | Bacteria | 991 |
| 1024 | Ga0501048_0481198 | 3300049582 | Bacteria | 890 |
| 1025 | Ga0501067_0020451 | 3300049583 | Bacteria | 3664 |
| 1026 | Ga0501068_0158276 | 3300049584 | Unclassified | 1427 |
| 1027 | Ga0501069_0071502 | 3300049585 | Unclassified | 1944 |
| 1028 | Ga0501070_0350320 | 3300049586 | Unclassified | 1198 |
| 1029 | Ga0501071_0427149 | 3300049587 | Bacteria | 1013 |
| 1030 | Ga0501072_0170211 | 3300049588 | Bacteria | 1738 |
| 1031 | Ga0501073_0032565 | 3300049589 | Unclassified | 3716 |
| 1032 | Ga0501074_0393963 | 3300049590 | Unclassified | 982 |
| 1033 | Ga0501075_0443545 | 3300049591 | Unclassified | 990 |
| 1034 | Ga0501076_1319878 | 3300049592 | Bacteria | 593 |
| 1035 | Ga0501206_015621 | 3300049653 | Bacteria | 1052 |
| 1036 | Ga0501224_032948 | 3300049664 | Bacteria | 777 |
| 1037 | Ga0501238_000137 | 3300049671 | Bacteria | 11188 |
| 1038 | Ga0501249_000008 | 3300049679 | Bacteria | 197587 |
| 1039 | Ga0501249_046621 | 3300049679 | Bacteria | 990 |
| 1040 | Ga0501257_005850 | 3300049686 | Bacteria | 2719 |
| 1041 | Ga0501225_0000104 | 3300049705 | Bacteria | 26591 |
| 1042 | Ga0501225_0268064 | 3300049705 | Bacteria | 568 |
| 1043 | Ga0501079_0239449 | 3300049741 | Unclassified | 1418 |
| 1044 | Ga0501080_0166988 | 3300049742 | Unclassified | 2030 |
| 1045 | Ga0501080_0173150 | 3300049742 | Bacteria | 1990 |
| 1046 | Ga0501080_0459377 | 3300049742 | Unclassified | 1141 |
| 1047 | Ga0501083_0324308 | 3300049744 | Unclassified | 1001 |
| 1048 | Ga0501083_0494973 | 3300049744 | Bacteria | 796 |
| 1049 | Ga0501241_001363 | 3300049758 | Bacteria | 5009 |
| 1050 | Ga0501241_024987 | 3300049758 | Bacteria | 1111 |
| 1051 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 1052 | Ga0501035_0287587 | 3300049822 | Bacteria | 1388 |
| 1053 | Ga0501035_0670468 | 3300049822 | Bacteria | 839 |
| 1054 | Ga0501035_0735828 | 3300049822 | Bacteria | 793 |
| 1055 | Ga0501044_0008528 | 3300049823 | Bacteria | 11230 |
| 1056 | Ga0501044_0119948 | 3300049823 | Unclassified | 2632 |
| 1057 | Ga0501044_0468793 | 3300049823 | Bacteria | 1164 |
| 1058 | Ga0501044_0520711 | 3300049823 | Bacteria | 1089 |
| 1059 | nmdc:mga0k408_129423_c1 | 3300050493 | Bacteria | 1498 |
| 1060 | nmdc:mga0k408_881244_c1 | 3300050493 | Bacteria | 520 |
| 1061 | nmdc:mga05p37_1165314_c1 | 3300050507 | Bacteria | 800 |
| 1062 | nmdc:mga05p37_19037_c1 | 3300050507 | Bacteria | 8304 |
| 1063 | nmdc:mga05p37_85001_c1 | 3300050507 | Bacteria | 3898 |
| 1064 | nmdc:mga09592_19444_c1 | 3300050508 | Bacteria | 5577 |
| 1065 | nmdc:mga09592_320115_c1 | 3300050508 | Bacteria | 1344 |
| 1066 | nmdc:mga0qj67_117394_c1 | 3300050509 | Bacteria | 2151 |
| 1067 | nmdc:mga0qj67_220327_c1 | 3300050509 | Bacteria | 1540 |
| 1068 | nmdc:mga06r32_87315_c1 | 3300050510 | Bacteria | 3043 |
| 1069 | nmdc:mga08y16_1891338_c1 | 3300050511 | Bacteria | 548 |
| 1070 | nmdc:mga08y16_295496_c1 | 3300050511 | Bacteria | 1670 |
| 1071 | nmdc:mga0n895_1405155_c1 | 3300050512 | Bacteria | 666 |
| 1072 | nmdc:mga0rr50_1385595_c1 | 3300050513 | Unclassified | 595 |
| 1073 | Ga0495619_0026132 | 3300053085 | Bacteria | 3755 |
| 1074 | Ga0495619_1084585 | 3300053085 | Bacteria | 533 |
| 1075 | Ga0500578_0000155 | 3300053086 | Bacteria | 80380 |
| 1076 | Ga0500578_0025346 | 3300053086 | Bacteria | 3806 |
| 1077 | Ga0500578_0476921 | 3300053086 | Bacteria | 706 |
| 1078 | Ga0500644_0000900 | 3300053088 | Bacteria | 9535 |
| 1079 | Ga0500644_0104298 | 3300053088 | Bacteria | 1082 |
| 1080 | Ga0500644_0433852 | 3300053088 | Bacteria | 575 |
| 1081 | Ga0500581_347230 | 3300053089 | Bacteria | 564 |
| 1082 | Ga0500646_0005321 | 3300053090 | Bacteria | 3253 |
| 1083 | Ga0500646_0008848 | 3300053090 | Bacteria | 2579 |
| 1084 | Ga0500646_0015297 | 3300053090 | Bacteria | 1997 |
| 1085 | Ga0500646_0065725 | 3300053090 | Bacteria | 1077 |
| 1086 | Ga0500647_0349435 | 3300053091 | Bacteria | 616 |
| 1087 | Ga0500583_0000043 | 3300053092 | Bacteria | 81313 |
| 1088 | Ga0500583_0000936 | 3300053092 | Bacteria | 8306 |
| 1089 | Ga0500583_0012195 | 3300053092 | Bacteria | 3269 |
| 1090 | Ga0500651_0102482 | 3300053093 | Bacteria | 1754 |
| 1091 | Ga0500651_0132295 | 3300053093 | Bacteria | 1508 |
| 1092 | Ga0500651_0409219 | 3300053093 | Bacteria | 761 |
| 1093 | Ga0500641_0000008 | 3300053096 | Bacteria | 174314 |
| 1094 | Ga0500641_0108557 | 3300053096 | Bacteria | 1193 |
| 1095 | Ga0500554_023107 | 3300053102 | Bacteria | 1745 |
| 1096 | Ga0500569_334284 | 3300053109 | Bacteria | 506 |
| 1097 | Ga0500592_003352 | 3300053116 | Bacteria | 2557 |
| 1098 | Ga0500642_0051616 | 3300053130 | Bacteria | 1818 |
| 1099 | Ga0500652_002832 | 3300053131 | Bacteria | 5239 |
| 1100 | Ga0500655_044110 | 3300053133 | Bacteria | 879 |
| 1101 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 1102 | Ga0500658_0000550 | 3300053134 | Bacteria | 15772 |
| 1103 | Ga0500658_0204766 | 3300053134 | Bacteria | 903 |
| 1104 | Ga0500559_0022943 | 3300053136 | Bacteria | 2648 |
| 1105 | Ga0500568_0004276 | 3300053139 | Bacteria | 7671 |
| 1106 | Ga0500573_0191533 | 3300053140 | Bacteria | 1092 |
| 1107 | Ga0500573_0391559 | 3300053140 | Bacteria | 661 |
| 1108 | Ga0500577_0005752 | 3300053142 | Bacteria | 3369 |
| 1109 | Ga0500589_021847 | 3300053147 | Bacteria | 2939 |
| 1110 | Ga0500590_143916 | 3300053148 | Bacteria | 1085 |
| 1111 | Ga0500616_0023882 | 3300053153 | Bacteria | 3402 |
| 1112 | Ga0500616_0058494 | 3300053153 | Bacteria | 2005 |
| 1113 | Ga0500616_0146079 | 3300053153 | Unclassified | 1100 |
| 1114 | Ga0500622_0000841 | 3300053156 | Bacteria | 26265 |
| 1115 | Ga0500622_0007178 | 3300053156 | Bacteria | 6352 |
| 1116 | Ga0500622_0029703 | 3300053156 | Bacteria | 2872 |
| 1117 | Ga0500622_0099070 | 3300053156 | Bacteria | 1438 |
| 1118 | Ga0500622_0198805 | 3300053156 | Bacteria | 913 |
| 1119 | Ga0500633_0009087 | 3300053160 | Bacteria | 2596 |
| 1120 | Ga0500634_0119396 | 3300053161 | Bacteria | 1286 |
| 1121 | Ga0500636_0070130 | 3300053177 | Bacteria | 2034 |
| 1122 | Ga0500636_0147365 | 3300053177 | Bacteria | 1296 |
| 1123 | Ga0500637_0257405 | 3300053178 | Bacteria | 971 |
| 1124 | Ga0500637_0434532 | 3300053178 | Bacteria | 671 |
| 1125 | Ga0500584_085375 | 3300053726 | Bacteria | 1339 |
| 1126 | Ga0500611_000077 | 3300053727 | Bacteria | 38126 |
| 1127 | Ga0500656_070997 | 3300053732 | Bacteria | 536 |
| 1128 | Ga0500587_011321 | 3300053739 | Bacteria | 1128 |
| 1129 | Ga0501084_0000686 | 3300054114 | Bacteria | 25875 |
| 1130 | Ga0500661_008389 | 3300055283 | Bacteria | 1901 |
| 1131 | Ga0501082_0046764 | 3300060353 | Bacteria | 3729 |
| 1132 | Ga0466962_0402373 | 3300061719 | Bacteria | 686 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10065352 | Ga0207706_100653523 | 94 |
| 2 | 3300053726 | Ga0500584_085375 | Ga0500584_085375_977_1309 | 100 |
| 3 | 3300041456 | Ga0451795_0707805 | Ga0451795_0707805_235_576 | 103 |
| 4 | 3300050493 | nmdc:mga0k408_881244_c1 | nmdc:mga0k408_881244_c1_149_505 | 103 |
| 5 | 3300005434 | Ga0070709_10352906 | Ga0070709_103529062 | 104 |
| 6 | 3300006871 | Ga0075434_100878950 | Ga0075434_1008789502 | 104 |
| 7 | 3300050513 | nmdc:mga0rr50_1385595_c1 | nmdc:mga0rr50_1385595_c1_122_535 | 104 |
| 8 | iso_pu_bacteria | 2818991442 | 2819572541 | 104 |
| 9 | 3300041452 | Ga0451793_0847059 | Ga0451793_0847059_137_493 | 107 |
| 10 | 3300003320 | rootH2_10069067 | rootH2_100690672 | 108 |
| 11 | 3300003761 | Ga0055535_1001390 | Ga0055535_10013908 | 108 |
| 12 | 3300005262 | Ga0065165_1013242 | Ga0065165_10132423 | 108 |
| 13 | 3300005338 | Ga0068868_100190467 | Ga0068868_1001904671 | 108 |
| 14 | 3300005367 | Ga0070667_100142222 | Ga0070667_1001422222 | 108 |
| 15 | 3300005577 | Ga0068857_100694775 | Ga0068857_1006947751 | 108 |
| 16 | 3300005834 | Ga0068851_10999926 | Ga0068851_109999261 | 108 |
| 17 | 3300005842 | Ga0068858_100333051 | Ga0068858_1003330513 | 108 |
| 18 | 3300005843 | Ga0068860_100156155 | Ga0068860_1001561552 | 108 |
| 19 | 3300013307 | Ga0157372_10232821 | Ga0157372_102328213 | 108 |
| 20 | 3300025208 | Ga0209436_106670 | Ga0209436_1066702 | 108 |
| 21 | 3300025242 | Ga0209258_100068 | Ga0209258_100068194 | 108 |
| 22 | 3300025246 | Ga0209646_1019006 | Ga0209646_10190062 | 108 |
| 23 | 3300025254 | Ga0209148_1000182 | Ga0209148_100018240 | 108 |
| 24 | 3300025903 | Ga0207680_10016456 | Ga0207680_100164563 | 108 |
| 25 | 3300025904 | Ga0207647_10128429 | Ga0207647_101284292 | 108 |
| 26 | 3300025912 | Ga0207707_11514523 | Ga0207707_115145232 | 108 |
| 27 | 3300025913 | Ga0207695_10014637 | Ga0207695_100146375 | 108 |
| 28 | 3300025913 | Ga0207695_10781442 | Ga0207695_107814422 | 108 |
| 29 | 3300025914 | Ga0207671_10007695 | Ga0207671_100076956 | 108 |
| 30 | 3300025914 | Ga0207671_10050128 | Ga0207671_100501283 | 108 |
| 31 | 3300025924 | Ga0207694_10246202 | Ga0207694_102462022 | 108 |
| 32 | 3300025949 | Ga0207667_10916014 | Ga0207667_109160142 | 108 |
| 33 | 3300025961 | Ga0207712_11037252 | Ga0207712_110372521 | 108 |
| 34 | 3300025986 | Ga0207658_10132740 | Ga0207658_101327402 | 108 |
| 35 | 3300025986 | Ga0207658_10374134 | Ga0207658_103741342 | 108 |
| 36 | 3300026116 | Ga0207674_10152379 | Ga0207674_101523793 | 108 |
| 37 | 3300028381 | Ga0268264_10106766 | Ga0268264_101067663 | 108 |
| 38 | 3300032004 | Ga0307414_10319570 | Ga0307414_103195702 | 108 |
| 39 | 3300033180 | Ga0307510_10038492 | Ga0307510_100384922 | 108 |
| 40 | 3300044735 | Ga0466968_0358445 | Ga0466968_0358445_321_689 | 108 |
| 41 | 3300046557 | Ga0495622_0245260 | Ga0495622_0245260_173_544 | 108 |
| 42 | 3300049571 | Ga0501034_0041587 | Ga0501034_0041587_426_794 | 108 |
| 43 | 3300049574 | Ga0501038_0754453 | Ga0501038_0754453_249_617 | 108 |
| 44 | 3300049742 | Ga0501080_0459377 | Ga0501080_0459377_634_1002 | 108 |
| 45 | 3300053088 | Ga0500644_0000900 | Ga0500644_0000900_8900_9271 | 108 |
| 46 | 3300053109 | Ga0500569_334284 | Ga0500569_334284_115_486 | 108 |
| 47 | 3300053148 | Ga0500590_143916 | Ga0500590_143916_557_928 | 108 |
| 48 | 3300053160 | Ga0500633_0009087 | Ga0500633_0009087_1254_1625 | 108 |
| 49 | 3300053161 | Ga0500634_0119396 | Ga0500634_0119396_475_846 | 108 |
| 50 | 3300053177 | Ga0500636_0147365 | Ga0500636_0147365_482_853 | 108 |
| 51 | 3300003316 | rootH1_10162132 | rootH1_101621322 | 110 |
| 52 | 3300003322 | rootL2_10157657 | rootL2_101576572 | 110 |
| 53 | 3300003794 | Ga0055531_10000293 | Ga0055531_1000029319 | 110 |
| 54 | 3300025304 | Ga0209257_1000025 | Ga0209257_1000025413 | 110 |
| 55 | 3300053156 | Ga0500622_0000841 | Ga0500622_0000841_14447_14824 | 110 |
| 56 | 3300049573 | Ga0501037_0242958 | Ga0501037_0242958_549_929 | 111 |
| 57 | 3300049581 | Ga0501047_0007483 | Ga0501047_0007483_7202_7582 | 111 |
| 58 | 3300049822 | Ga0501035_0670468 | Ga0501035_0670468_158_538 | 111 |
| 59 | 3300005335 | Ga0070666_10833202 | Ga0070666_108332021 | 114 |
| 60 | 3300005356 | Ga0070674_100105333 | Ga0070674_1001053332 | 114 |
| 61 | 3300009094 | Ga0111539_10370989 | Ga0111539_103709892 | 114 |
| 62 | 3300009148 | Ga0105243_10811845 | Ga0105243_108118452 | 114 |
| 63 | 3300009174 | Ga0105241_11464025 | Ga0105241_114640251 | 114 |
| 64 | 3300009176 | Ga0105242_10620320 | Ga0105242_106203201 | 114 |
| 65 | 3300009177 | Ga0105248_11092318 | Ga0105248_110923181 | 114 |
| 66 | 3300013297 | Ga0157378_10035729 | Ga0157378_100357292 | 114 |
| 67 | 3300013306 | Ga0163162_11643045 | Ga0163162_116430452 | 114 |
| 68 | 3300013308 | Ga0157375_10442997 | Ga0157375_104429972 | 114 |
| 69 | 3300014326 | Ga0157380_10590989 | Ga0157380_105909891 | 114 |
| 70 | 3300014745 | Ga0157377_10114748 | Ga0157377_101147482 | 114 |
| 71 | 3300025901 | Ga0207688_10255433 | Ga0207688_102554332 | 114 |
| 72 | 3300025937 | Ga0207669_10562061 | Ga0207669_105620611 | 114 |
| 73 | 3300035115 | Ga0373941_0295771 | Ga0373941_0295771_97_483 | 114 |
| 74 | 3300049570 | Ga0501033_0408860 | Ga0501033_0408860_93_479 | 114 |
| 75 | 3300005330 | Ga0070690_100664657 | Ga0070690_1006646572 | 115 |
| 76 | 3300005334 | Ga0068869_101706480 | Ga0068869_1017064801 | 115 |
| 77 | 3300005347 | Ga0070668_101953411 | Ga0070668_1019534111 | 115 |
| 78 | 3300005456 | Ga0070678_100211589 | Ga0070678_1002115892 | 115 |
| 79 | 3300005459 | Ga0068867_100188411 | Ga0068867_1001884113 | 115 |
| 80 | 3300005578 | Ga0068854_101143516 | Ga0068854_1011435162 | 115 |
| 81 | 3300005617 | Ga0068859_101719357 | Ga0068859_1017193571 | 115 |
| 82 | 3300005618 | Ga0068864_100166775 | Ga0068864_1001667752 | 115 |
| 83 | 3300005719 | Ga0068861_101188356 | Ga0068861_1011883562 | 115 |
| 84 | 3300006237 | Ga0097621_100142701 | Ga0097621_1001427012 | 115 |
| 85 | 3300006358 | Ga0068871_100206810 | Ga0068871_1002068103 | 115 |
| 86 | 3300006881 | Ga0068865_101298927 | Ga0068865_1012989272 | 115 |
| 87 | 3300006931 | Ga0097620_101718841 | Ga0097620_1017188412 | 115 |
| 88 | 3300009176 | Ga0105242_10470819 | Ga0105242_104708192 | 115 |
| 89 | 3300013306 | Ga0163162_10524871 | Ga0163162_105248713 | 115 |
| 90 | 3300013308 | Ga0157375_10075317 | Ga0157375_100753173 | 115 |
| 91 | 3300014969 | Ga0157376_10561322 | Ga0157376_105613222 | 115 |
| 92 | 3300017792 | Ga0163161_10521882 | Ga0163161_105218822 | 115 |
| 93 | 3300025907 | Ga0207645_10188597 | Ga0207645_101885972 | 115 |
| 94 | 3300025925 | Ga0207650_10630446 | Ga0207650_106304461 | 115 |
| 95 | 3300025926 | Ga0207659_10218326 | Ga0207659_102183262 | 115 |
| 96 | 3300025934 | Ga0207686_10217870 | Ga0207686_102178703 | 115 |
| 97 | 3300025937 | Ga0207669_10953948 | Ga0207669_109539482 | 115 |
| 98 | 3300025972 | Ga0207668_10908612 | Ga0207668_109086122 | 115 |
| 99 | 3300025986 | Ga0207658_10699936 | Ga0207658_106999361 | 115 |
| 100 | 3300026089 | Ga0207648_10088214 | Ga0207648_100882143 | 115 |
| 101 | 3300026095 | Ga0207676_10024521 | Ga0207676_100245212 | 115 |
| 102 | 3300026121 | Ga0207683_10233766 | Ga0207683_102337662 | 115 |
| 103 | iso_pu_bacteria | 2818991460 | 2819680691 | 115 |
| 104 | iso_pu_bacteria | 2884791551 | 2884795430 | 115 |
| 105 | iso_pu_bacteria | 2929177148 | 2929178994 | 115 |
| 106 | iso_pu_bacteria | 2945977869 | 2945981397 | 115 |
| 107 | iso_pu_bacteria | 2946013367 | 2946019204 | 115 |
| 108 | 3300003320 | rootH2_10078664 | rootH2_100786642 | 116 |
| 109 | 3300005289 | Ga0065704_10268353 | Ga0065704_102683532 | 116 |
| 110 | 3300005295 | Ga0065707_10123533 | Ga0065707_101235331 | 116 |
| 111 | 3300005328 | Ga0070676_10029768 | Ga0070676_100297684 | 116 |
| 112 | 3300005328 | Ga0070676_10148793 | Ga0070676_101487932 | 116 |
| 113 | 3300005329 | Ga0070683_100005538 | Ga0070683_1000055388 | 116 |
| 114 | 3300005329 | Ga0070683_100073580 | Ga0070683_1000735804 | 116 |
| 115 | 3300005329 | Ga0070683_100257331 | Ga0070683_1002573314 | 116 |
| 116 | 3300005330 | Ga0070690_100032678 | Ga0070690_1000326784 | 116 |
| 117 | 3300005330 | Ga0070690_100075145 | Ga0070690_1000751453 | 116 |
| 118 | 3300005330 | Ga0070690_100105034 | Ga0070690_1001050342 | 116 |
| 119 | 3300005334 | Ga0068869_100008424 | Ga0068869_1000084245 | 116 |
| 120 | 3300005334 | Ga0068869_100196828 | Ga0068869_1001968282 | 116 |
| 121 | 3300005334 | Ga0068869_100283184 | Ga0068869_1002831842 | 116 |
| 122 | 3300005335 | Ga0070666_10010757 | Ga0070666_100107576 | 116 |
| 123 | 3300005337 | Ga0070682_100300110 | Ga0070682_1003001101 | 116 |
| 124 | 3300005337 | Ga0070682_100591000 | Ga0070682_1005910002 | 116 |
| 125 | 3300005337 | Ga0070682_101253057 | Ga0070682_1012530572 | 116 |
| 126 | 3300005338 | Ga0068868_100007582 | Ga0068868_1000075823 | 116 |
| 127 | 3300005338 | Ga0068868_100022249 | Ga0068868_1000222495 | 116 |
| 128 | 3300005338 | Ga0068868_100078314 | Ga0068868_1000783143 | 116 |
| 129 | 3300005339 | Ga0070660_100422551 | Ga0070660_1004225512 | 116 |
| 130 | 3300005340 | Ga0070689_100199684 | Ga0070689_1001996842 | 116 |
| 131 | 3300005340 | Ga0070689_100911213 | Ga0070689_1009112132 | 116 |
| 132 | 3300005343 | Ga0070687_100369569 | Ga0070687_1003695692 | 116 |
| 133 | 3300005344 | Ga0070661_100004649 | Ga0070661_1000046497 | 116 |
| 134 | 3300005344 | Ga0070661_100115701 | Ga0070661_1001157012 | 116 |
| 135 | 3300005347 | Ga0070668_100610271 | Ga0070668_1006102712 | 116 |
| 136 | 3300005353 | Ga0070669_100780637 | Ga0070669_1007806371 | 116 |
| 137 | 3300005353 | Ga0070669_101201672 | Ga0070669_1012016721 | 116 |
| 138 | 3300005353 | Ga0070669_101239838 | Ga0070669_1012398381 | 116 |
| 139 | 3300005353 | Ga0070669_101905596 | Ga0070669_1019055961 | 116 |
| 140 | 3300005354 | Ga0070675_100058001 | Ga0070675_1000580013 | 116 |
| 141 | 3300005354 | Ga0070675_100861924 | Ga0070675_1008619242 | 116 |
| 142 | 3300005354 | Ga0070675_101473107 | Ga0070675_1014731072 | 116 |
| 143 | 3300005355 | Ga0070671_100359288 | Ga0070671_1003592882 | 116 |
| 144 | 3300005356 | Ga0070674_101640451 | Ga0070674_1016404512 | 116 |
| 145 | 3300005364 | Ga0070673_100014403 | Ga0070673_1000144032 | 116 |
| 146 | 3300005364 | Ga0070673_100115725 | Ga0070673_1001157255 | 116 |
| 147 | 3300005364 | Ga0070673_100414535 | Ga0070673_1004145352 | 116 |
| 148 | 3300005366 | Ga0070659_100021434 | Ga0070659_1000214345 | 116 |
| 149 | 3300005366 | Ga0070659_100284264 | Ga0070659_1002842643 | 116 |
| 150 | 3300005367 | Ga0070667_101637740 | Ga0070667_1016377401 | 116 |
| 151 | 3300005441 | Ga0070700_100343367 | Ga0070700_1003433672 | 116 |
| 152 | 3300005455 | Ga0070663_100355677 | Ga0070663_1003556772 | 116 |
| 153 | 3300005455 | Ga0070663_101057995 | Ga0070663_1010579951 | 116 |
| 154 | 3300005456 | Ga0070678_100048749 | Ga0070678_1000487493 | 116 |
| 155 | 3300005457 | Ga0070662_100006211 | Ga0070662_1000062111 | 116 |
| 156 | 3300005457 | Ga0070662_100012518 | Ga0070662_1000125185 | 116 |
| 157 | 3300005459 | Ga0068867_100045254 | Ga0068867_1000452544 | 116 |
| 158 | 3300005459 | Ga0068867_100117447 | Ga0068867_1001174472 | 116 |
| 159 | 3300005518 | Ga0070699_101122065 | Ga0070699_1011220652 | 116 |
| 160 | 3300005535 | Ga0070684_100006634 | Ga0070684_10000663410 | 116 |
| 161 | 3300005535 | Ga0070684_100030438 | Ga0070684_1000304386 | 116 |
| 162 | 3300005535 | Ga0070684_100265370 | Ga0070684_1002653702 | 116 |
| 163 | 3300005535 | Ga0070684_100605154 | Ga0070684_1006051542 | 116 |
| 164 | 3300005539 | Ga0068853_100014740 | Ga0068853_1000147402 | 116 |
| 165 | 3300005539 | Ga0068853_100038019 | Ga0068853_1000380195 | 116 |
| 166 | 3300005539 | Ga0068853_100981450 | Ga0068853_1009814501 | 116 |
| 167 | 3300005539 | Ga0068853_101296095 | Ga0068853_1012960951 | 116 |
| 168 | 3300005543 | Ga0070672_100172094 | Ga0070672_1001720941 | 116 |
| 169 | 3300005544 | Ga0070686_100177737 | Ga0070686_1001777372 | 116 |
| 170 | 3300005547 | Ga0070693_100126555 | Ga0070693_1001265553 | 116 |
| 171 | 3300005548 | Ga0070665_100327378 | Ga0070665_1003273781 | 116 |
| 172 | 3300005563 | Ga0068855_100940746 | Ga0068855_1009407461 | 116 |
| 173 | 3300005564 | Ga0070664_100021144 | Ga0070664_1000211442 | 116 |
| 174 | 3300005564 | Ga0070664_100114993 | Ga0070664_1001149933 | 116 |
| 175 | 3300005564 | Ga0070664_100171059 | Ga0070664_1001710593 | 116 |
| 176 | 3300005577 | Ga0068857_100028333 | Ga0068857_1000283335 | 116 |
| 177 | 3300005577 | Ga0068857_100037405 | Ga0068857_1000374057 | 116 |
| 178 | 3300005577 | Ga0068857_100596504 | Ga0068857_1005965042 | 116 |
| 179 | 3300005614 | Ga0068856_101058909 | Ga0068856_1010589092 | 116 |
| 180 | 3300005614 | Ga0068856_101933320 | Ga0068856_1019333201 | 116 |
| 181 | 3300005615 | Ga0070702_100088405 | Ga0070702_1000884053 | 116 |
| 182 | 3300005616 | Ga0068852_100111383 | Ga0068852_1001113832 | 116 |
| 183 | 3300005616 | Ga0068852_102348816 | Ga0068852_1023488162 | 116 |
| 184 | 3300005617 | Ga0068859_100072397 | Ga0068859_1000723972 | 116 |
| 185 | 3300005617 | Ga0068859_100103505 | Ga0068859_1001035055 | 116 |
| 186 | 3300005617 | Ga0068859_100211513 | Ga0068859_1002115132 | 116 |
| 187 | 3300005617 | Ga0068859_100378832 | Ga0068859_1003788323 | 116 |
| 188 | 3300005618 | Ga0068864_100035920 | Ga0068864_1000359203 | 116 |
| 189 | 3300005618 | Ga0068864_100121641 | Ga0068864_1001216411 | 116 |
| 190 | 3300005618 | Ga0068864_100257290 | Ga0068864_1002572901 | 116 |
| 191 | 3300005718 | Ga0068866_10030908 | Ga0068866_100309084 | 116 |
| 192 | 3300005719 | Ga0068861_100046224 | Ga0068861_1000462242 | 116 |
| 193 | 3300005719 | Ga0068861_100173875 | Ga0068861_1001738751 | 116 |
| 194 | 3300005834 | Ga0068851_10386280 | Ga0068851_103862802 | 116 |
| 195 | 3300005841 | Ga0068863_100426465 | Ga0068863_1004264652 | 116 |
| 196 | 3300005841 | Ga0068863_100494205 | Ga0068863_1004942052 | 116 |
| 197 | 3300005841 | Ga0068863_102538137 | Ga0068863_1025381371 | 116 |
| 198 | 3300005842 | Ga0068858_100608533 | Ga0068858_1006085332 | 116 |
| 199 | 3300005843 | Ga0068860_101009310 | Ga0068860_1010093102 | 116 |
| 200 | 3300005844 | Ga0068862_100405082 | Ga0068862_1004050822 | 116 |
| 201 | 3300005844 | Ga0068862_100429135 | Ga0068862_1004291352 | 116 |
| 202 | 3300005844 | Ga0068862_101112955 | Ga0068862_1011129552 | 116 |
| 203 | 3300005844 | Ga0068862_102567591 | Ga0068862_1025675911 | 116 |
| 204 | 3300006237 | Ga0097621_100253931 | Ga0097621_1002539312 | 116 |
| 205 | 3300006881 | Ga0068865_100074201 | Ga0068865_1000742011 | 116 |
| 206 | 3300006881 | Ga0068865_100202490 | Ga0068865_1002024903 | 116 |
| 207 | 3300006881 | Ga0068865_100770297 | Ga0068865_1007702971 | 116 |
| 208 | 3300006881 | Ga0068865_100982303 | Ga0068865_1009823032 | 116 |
| 209 | 3300006931 | Ga0097620_100072404 | Ga0097620_1000724042 | 116 |
| 210 | 3300006931 | Ga0097620_100103499 | Ga0097620_1001034993 | 116 |
| 211 | 3300006931 | Ga0097620_100211516 | Ga0097620_1002115162 | 116 |
| 212 | 3300006931 | Ga0097620_100378853 | Ga0097620_1003788533 | 116 |
| 213 | 3300007076 | Ga0075435_101422406 | Ga0075435_1014224061 | 116 |
| 214 | 3300009011 | Ga0105251_10594264 | Ga0105251_105942641 | 116 |
| 215 | 3300009101 | Ga0105247_10003291 | Ga0105247_100032913 | 116 |
| 216 | 3300009174 | Ga0105241_10241256 | Ga0105241_102412563 | 116 |
| 217 | 3300009174 | Ga0105241_10409076 | Ga0105241_104090763 | 116 |
| 218 | 3300009176 | Ga0105242_10020659 | Ga0105242_100206592 | 116 |
| 219 | 3300009176 | Ga0105242_10439930 | Ga0105242_104399302 | 116 |
| 220 | 3300009177 | Ga0105248_10272544 | Ga0105248_102725442 | 116 |
| 221 | 3300009553 | Ga0105249_10049879 | Ga0105249_100498792 | 116 |
| 222 | 3300009553 | Ga0105249_10349734 | Ga0105249_103497343 | 116 |
| 223 | 3300009553 | Ga0105249_10945337 | Ga0105249_109453372 | 116 |
| 224 | 3300011119 | Ga0105246_11301631 | Ga0105246_113016311 | 116 |
| 225 | 3300013100 | Ga0157373_10044233 | Ga0157373_100442332 | 116 |
| 226 | 3300013102 | Ga0157371_10171436 | Ga0157371_101714362 | 116 |
| 227 | 3300013104 | Ga0157370_11447386 | Ga0157370_114473862 | 116 |
| 228 | 3300013296 | Ga0157374_10071993 | Ga0157374_100719933 | 116 |
| 229 | 3300013296 | Ga0157374_10306398 | Ga0157374_103063982 | 116 |
| 230 | 3300013297 | Ga0157378_10167058 | Ga0157378_101670582 | 116 |
| 231 | 3300013297 | Ga0157378_11037044 | Ga0157378_110370441 | 116 |
| 232 | 3300013306 | Ga0163162_10129331 | Ga0163162_101293311 | 116 |
| 233 | 3300013306 | Ga0163162_10142022 | Ga0163162_101420224 | 116 |
| 234 | 3300013306 | Ga0163162_10517219 | Ga0163162_105172191 | 116 |
| 235 | 3300013307 | Ga0157372_10458887 | Ga0157372_104588871 | 116 |
| 236 | 3300013308 | Ga0157375_10014722 | Ga0157375_100147227 | 116 |
| 237 | 3300013308 | Ga0157375_10093955 | Ga0157375_100939554 | 116 |
| 238 | 3300013308 | Ga0157375_10834563 | Ga0157375_108345632 | 116 |
| 239 | 3300013308 | Ga0157375_11495265 | Ga0157375_114952652 | 116 |
| 240 | 3300013308 | Ga0157375_13191713 | Ga0157375_131917132 | 116 |
| 241 | 3300014325 | Ga0163163_10040173 | Ga0163163_100401733 | 116 |
| 242 | 3300014325 | Ga0163163_10135234 | Ga0163163_101352343 | 116 |
| 243 | 3300014326 | Ga0157380_10370569 | Ga0157380_103705692 | 116 |
| 244 | 3300014745 | Ga0157377_10039879 | Ga0157377_100398793 | 116 |
| 245 | 3300014745 | Ga0157377_11534426 | Ga0157377_115344261 | 116 |
| 246 | 3300014968 | Ga0157379_10040831 | Ga0157379_100408314 | 116 |
| 247 | 3300014968 | Ga0157379_10253462 | Ga0157379_102534622 | 116 |
| 248 | 3300014968 | Ga0157379_11400081 | Ga0157379_114000811 | 116 |
| 249 | 3300014969 | Ga0157376_10246081 | Ga0157376_102460812 | 116 |
| 250 | 3300014969 | Ga0157376_10289609 | Ga0157376_102896092 | 116 |
| 251 | 3300014969 | Ga0157376_10316532 | Ga0157376_103165321 | 116 |
| 252 | 3300017792 | Ga0163161_10023840 | Ga0163161_100238404 | 116 |
| 253 | 3300025315 | Ga0207697_10016125 | Ga0207697_100161254 | 116 |
| 254 | 3300025315 | Ga0207697_10120607 | Ga0207697_101206072 | 116 |
| 255 | 3300025900 | Ga0207710_10001860 | Ga0207710_100018604 | 116 |
| 256 | 3300025901 | Ga0207688_10126651 | Ga0207688_101266512 | 116 |
| 257 | 3300025903 | Ga0207680_10013020 | Ga0207680_100130204 | 116 |
| 258 | 3300025903 | Ga0207680_10443534 | Ga0207680_104435342 | 116 |
| 259 | 3300025904 | Ga0207647_10028201 | Ga0207647_100282014 | 116 |
| 260 | 3300025905 | Ga0207685_10080434 | Ga0207685_100804342 | 116 |
| 261 | 3300025906 | Ga0207699_10382682 | Ga0207699_103826822 | 116 |
| 262 | 3300025907 | Ga0207645_10024624 | Ga0207645_100246246 | 116 |
| 263 | 3300025908 | Ga0207643_10148166 | Ga0207643_101481661 | 116 |
| 264 | 3300025911 | Ga0207654_10976761 | Ga0207654_109767611 | 116 |
| 265 | 3300025919 | Ga0207657_10194543 | Ga0207657_101945432 | 116 |
| 266 | 3300025920 | Ga0207649_10012710 | Ga0207649_100127108 | 116 |
| 267 | 3300025926 | Ga0207659_11792454 | Ga0207659_117924541 | 116 |
| 268 | 3300025931 | Ga0207644_10109732 | Ga0207644_101097322 | 116 |
| 269 | 3300025931 | Ga0207644_10224539 | Ga0207644_102245393 | 116 |
| 270 | 3300025931 | Ga0207644_10520692 | Ga0207644_105206921 | 116 |
| 271 | 3300025932 | Ga0207690_10023014 | Ga0207690_100230146 | 116 |
| 272 | 3300025932 | Ga0207690_10741747 | Ga0207690_107417471 | 116 |
| 273 | 3300025933 | Ga0207706_10014472 | Ga0207706_100144728 | 116 |
| 274 | 3300025933 | Ga0207706_10014939 | Ga0207706_100149395 | 116 |
| 275 | 3300025933 | Ga0207706_10244841 | Ga0207706_102448411 | 116 |
| 276 | 3300025934 | Ga0207686_10801010 | Ga0207686_108010101 | 116 |
| 277 | 3300025936 | Ga0207670_10015308 | Ga0207670_100153083 | 116 |
| 278 | 3300025938 | Ga0207704_10087633 | Ga0207704_100876333 | 116 |
| 279 | 3300025938 | Ga0207704_10174063 | Ga0207704_101740633 | 116 |
| 280 | 3300025940 | Ga0207691_10044291 | Ga0207691_100442912 | 116 |
| 281 | 3300025941 | Ga0207711_11557490 | Ga0207711_115574901 | 116 |
| 282 | 3300025942 | Ga0207689_10004605 | Ga0207689_1000460512 | 116 |
| 283 | 3300025942 | Ga0207689_10011865 | Ga0207689_100118657 | 116 |
| 284 | 3300025942 | Ga0207689_10037638 | Ga0207689_100376383 | 116 |
| 285 | 3300025942 | Ga0207689_11013559 | Ga0207689_110135592 | 116 |
| 286 | 3300025944 | Ga0207661_10019534 | Ga0207661_100195346 | 116 |
| 287 | 3300025944 | Ga0207661_10031717 | Ga0207661_100317177 | 116 |
| 288 | 3300025944 | Ga0207661_10704745 | Ga0207661_107047452 | 116 |
| 289 | 3300025945 | Ga0207679_10020993 | Ga0207679_100209932 | 116 |
| 290 | 3300025945 | Ga0207679_10022054 | Ga0207679_100220547 | 116 |
| 291 | 3300025945 | Ga0207679_10682508 | Ga0207679_106825081 | 116 |
| 292 | 3300025949 | Ga0207667_10881920 | Ga0207667_108819201 | 116 |
| 293 | 3300025960 | Ga0207651_10019959 | Ga0207651_100199594 | 116 |
| 294 | 3300025960 | Ga0207651_10090796 | Ga0207651_100907962 | 116 |
| 295 | 3300025961 | Ga0207712_10029238 | Ga0207712_100292383 | 116 |
| 296 | 3300025961 | Ga0207712_10061839 | Ga0207712_100618393 | 116 |
| 297 | 3300025961 | Ga0207712_10915753 | Ga0207712_109157532 | 116 |
| 298 | 3300025972 | Ga0207668_10839937 | Ga0207668_108399372 | 116 |
| 299 | 3300025981 | Ga0207640_10112734 | Ga0207640_101127343 | 116 |
| 300 | 3300025981 | Ga0207640_10248673 | Ga0207640_102486731 | 116 |
| 301 | 3300026023 | Ga0207677_10002177 | Ga0207677_100021773 | 116 |
| 302 | 3300026023 | Ga0207677_10048097 | Ga0207677_100480972 | 116 |
| 303 | 3300026023 | Ga0207677_10123314 | Ga0207677_101233143 | 116 |
| 304 | 3300026035 | Ga0207703_10166712 | Ga0207703_101667122 | 116 |
| 305 | 3300026035 | Ga0207703_10421325 | Ga0207703_104213253 | 116 |
| 306 | 3300026041 | Ga0207639_10009995 | Ga0207639_100099958 | 116 |
| 307 | 3300026041 | Ga0207639_10238583 | Ga0207639_102385831 | 116 |
| 308 | 3300026041 | Ga0207639_10687348 | Ga0207639_106873482 | 116 |
| 309 | 3300026067 | Ga0207678_10169409 | Ga0207678_101694093 | 116 |
| 310 | 3300026067 | Ga0207678_10874452 | Ga0207678_108744521 | 116 |
| 311 | 3300026078 | Ga0207702_11613979 | Ga0207702_116139791 | 116 |
| 312 | 3300026088 | Ga0207641_10480945 | Ga0207641_104809451 | 116 |
| 313 | 3300026088 | Ga0207641_10755342 | Ga0207641_107553422 | 116 |
| 314 | 3300026088 | Ga0207641_10934364 | Ga0207641_109343642 | 116 |
| 315 | 3300026088 | Ga0207641_11556071 | Ga0207641_115560712 | 116 |
| 316 | 3300026089 | Ga0207648_10019286 | Ga0207648_100192867 | 116 |
| 317 | 3300026089 | Ga0207648_10320205 | Ga0207648_103202051 | 116 |
| 318 | 3300026095 | Ga0207676_10025761 | Ga0207676_100257616 | 116 |
| 319 | 3300026095 | Ga0207676_10051614 | Ga0207676_100516143 | 116 |
| 320 | 3300026095 | Ga0207676_10512360 | Ga0207676_105123603 | 116 |
| 321 | 3300026116 | Ga0207674_10007545 | Ga0207674_100075455 | 116 |
| 322 | 3300026116 | Ga0207674_10019908 | Ga0207674_100199086 | 116 |
| 323 | 3300026116 | Ga0207674_10627852 | Ga0207674_106278522 | 116 |
| 324 | 3300026118 | Ga0207675_100135163 | Ga0207675_1001351633 | 116 |
| 325 | 3300026118 | Ga0207675_100321928 | Ga0207675_1003219282 | 116 |
| 326 | 3300026121 | Ga0207683_10060212 | Ga0207683_100602124 | 116 |
| 327 | 3300026121 | Ga0207683_11204266 | Ga0207683_112042661 | 116 |
| 328 | 3300026142 | Ga0207698_10266884 | Ga0207698_102668843 | 116 |
| 329 | 3300026142 | Ga0207698_10963147 | Ga0207698_109631472 | 116 |
| 330 | 3300026142 | Ga0207698_12338779 | Ga0207698_123387792 | 116 |
| 331 | 3300028380 | Ga0268265_10471789 | Ga0268265_104717892 | 116 |
| 332 | 3300028381 | Ga0268264_10850421 | Ga0268264_108504212 | 116 |
| 333 | 3300031731 | Ga0307405_11949210 | Ga0307405_119492101 | 116 |
| 334 | 3300032126 | Ga0307415_102068937 | Ga0307415_1020689371 | 116 |
| 335 | 3300035086 | Ga0373934_0225434 | Ga0373934_0225434_188_586 | 116 |
| 336 | 3300035089 | Ga0373944_0175204 | Ga0373944_0175204_228_626 | 116 |
| 337 | 3300035118 | Ga0373954_0099197 | Ga0373954_0099197_430_828 | 116 |
| 338 | 3300035172 | Ga0373955_0120482 | Ga0373955_0120482_849_1247 | 116 |
| 339 | 3300035692 | Ga0373935_0575918 | Ga0373935_0575918_145_543 | 116 |
| 340 | 3300035724 | Ga0373933_0235715 | Ga0373933_0235715_551_949 | 116 |
| 341 | 3300036401 | Ga0373937_0043690 | Ga0373937_0043690_1450_1848 | 116 |
| 342 | 3300042876 | Ga0451577_0894456 | Ga0451577_0894456_365_763 | 116 |
| 343 | 3300046462 | Ga0495651_0223746 | Ga0495651_0223746_444_842 | 116 |
| 344 | 3300046463 | Ga0495653_0152396 | Ga0495653_0152396_275_673 | 116 |
| 345 | 3300046511 | Ga0495608_0060018 | Ga0495608_0060018_1556_1954 | 116 |
| 346 | 3300046514 | Ga0495618_0060481 | Ga0495618_0060481_1912_2310 | 116 |
| 347 | 3300046516 | Ga0495628_0061099 | Ga0495628_0061099_2022_2420 | 116 |
| 348 | 3300046517 | Ga0495630_0025827 | Ga0495630_0025827_1334_1732 | 116 |
| 349 | 3300046533 | Ga0495640_0703869 | Ga0495640_0703869_39_437 | 116 |
| 350 | 3300046535 | Ga0495586_0398048 | Ga0495586_0398048_304_702 | 116 |
| 351 | 3300046537 | Ga0495598_0071004 | Ga0495598_0071004_586_984 | 116 |
| 352 | 3300046559 | Ga0495667_0404024 | Ga0495667_0404024_242_640 | 116 |
| 353 | 3300046642 | Ga0495634_0121772 | Ga0495634_0121772_704_1102 | 116 |
| 354 | 3300046663 | Ga0495635_0220148 | Ga0495635_0220148_585_983 | 116 |
| 355 | 3300046675 | Ga0495657_0321763 | Ga0495657_0321763_178_576 | 116 |
| 356 | 3300046680 | Ga0495646_0197748 | Ga0495646_0197748_569_967 | 116 |
| 357 | 3300046689 | Ga0495613_0057376 | Ga0495613_0057376_1031_1429 | 116 |
| 358 | 3300047319 | Ga0495674_0221266 | Ga0495674_0221266_338_736 | 116 |
| 359 | 3300047320 | Ga0495672_0071262 | Ga0495672_0071262_847_1245 | 116 |
| 360 | 3300047471 | Ga0495684_0263139 | Ga0495684_0263139_236_634 | 116 |
| 361 | 3300048912 | Ga0496109_1472235 | Ga0496109_1472235_114_512 | 116 |
| 362 | 3300048917 | Ga0496114_0153449 | Ga0496114_0153449_637_1035 | 116 |
| 363 | 3300049588 | Ga0501072_0170211 | Ga0501072_0170211_621_1019 | 116 |
| 364 | 3300053085 | Ga0495619_0026132 | Ga0495619_0026132_1340_1738 | 116 |
| 365 | 3300053139 | Ga0500568_0004276 | Ga0500568_0004276_5167_5571 | 116 |
| 366 | 3300053727 | Ga0500611_000077 | Ga0500611_000077_36620_37021 | 116 |
| 367 | iso_pu_bacteria | 2738541278 | 2738726297 | 116 |
| 368 | iso_pu_bacteria | 2821136567 | 2821140066 | 116 |
| 369 | iso_pu_bacteria | 2904467357 | 2904472187 | 116 |
| 370 | iso_pu_bacteria | 2929239360 | 2929244906 | 116 |
| 371 | iso_pu_bacteria | 2929921140 | 2929927149 | 116 |
| 372 | iso_pu_bacteria | 8003151029 | 8003157141 | 116 |
| 373 | 3300005459 | Ga0068867_100130694 | Ga0068867_1001306942 | 117 |
| 374 | 3300005578 | Ga0068854_101204852 | Ga0068854_1012048522 | 117 |
| 375 | 3300026089 | Ga0207648_10151451 | Ga0207648_101514512 | 117 |
| 376 | iso_pu_bacteria | 2513020052 | 2513235217 | 117 |
| 377 | iso_pu_bacteria | 2519899754 | 2520879475 | 117 |
| 378 | iso_pu_bacteria | 2643221600 | 2644009119 | 117 |
| 379 | iso_pu_bacteria | 2643221667 | 2644371206 | 117 |
| 380 | iso_pu_bacteria | 2643221716 | 2644643999 | 117 |
| 381 | iso_pu_bacteria | 2643221725 | 2644681892 | 117 |
| 382 | iso_pu_bacteria | 2738541279 | 2738733168 | 117 |
| 383 | iso_pu_bacteria | 2738541285 | 2738765706 | 117 |
| 384 | iso_pu_bacteria | 2738543007 | 2739214749 | 117 |
| 385 | iso_pu_bacteria | 2739367857 | 2740002759 | 117 |
| 386 | iso_pu_bacteria | 2739367858 | 2740007576 | 117 |
| 387 | iso_pu_bacteria | 2802428842 | 2802655198 | 117 |
| 388 | iso_pu_bacteria | 2816332280 | 2817413611 | 117 |
| 389 | iso_pu_bacteria | 2857613821 | 2857616980 | 117 |
| 390 | iso_pu_bacteria | 2857618242 | 2857619633 | 117 |
| 391 | iso_pu_bacteria | 2881359912 | 2881362595 | 117 |
| 392 | iso_pu_bacteria | 2890804823 | 2890805947 | 117 |
| 393 | iso_pu_bacteria | 2903895155 | 2903896744 | 117 |
| 394 | iso_pu_bacteria | 2904419702 | 2904422467 | 117 |
| 395 | iso_pu_bacteria | 2904555929 | 2904558423 | 117 |
| 396 | iso_pu_bacteria | 2919191525 | 2919194138 | 117 |
| 397 | iso_pu_bacteria | 2929150217 | 2929150681 | 117 |
| 398 | iso_pu_bacteria | 2958458903 | 2958463478 | 117 |
| 399 | iso_pu_bacteria | 2977268062 | 2977272135 | 117 |
| 400 | iso_pu_bacteria | 8036736890 | 8036737809 | 117 |
| 401 | iso_pu_bacteria | 8054307821 | 8054311355 | 117 |
| 402 | iso_pu_bacteria | 8055419101 | 8055423642 | 117 |
| 403 | iso_pu_bacteria | 8055592153 | 8055595000 | 117 |
| 404 | iso_pu_bacteria | 8056440228 | 8056443586 | 117 |
| 405 | 3300026088 | Ga0207641_10920700 | Ga0207641_109207001 | 118 |
| 406 | 3300002987 | JGI25159J45721_1014429 | JGI25159J45721_10144292 | 119 |
| 407 | 3300003354 | JGI25160J50197_1038948 | JGI25160J50197_10389482 | 119 |
| 408 | 3300017792 | Ga0163161_10575626 | Ga0163161_105756262 | 119 |
| 409 | 3300025208 | Ga0209436_105918 | Ga0209436_1059183 | 119 |
| 410 | 3300025284 | Ga0209130_1001652 | Ga0209130_10016528 | 119 |
| 411 | 3300025302 | Ga0207426_1000051 | Ga0207426_1000051147 | 119 |
| 412 | 3300031251 | Ga0265327_10000219 | Ga0265327_1000021923 | 119 |
| 413 | 3300032004 | Ga0307414_10001420 | Ga0307414_100014209 | 119 |
| 414 | 3300032005 | Ga0307411_11028116 | Ga0307411_110281162 | 119 |
| 415 | 3300041997 | Ga0439431_0001740 | Ga0439431_0001740_3668_4084 | 119 |
| 416 | 3300044658 | Ga0466972_0070919 | Ga0466972_0070919_44_439 | 119 |
| 417 | 3300044673 | Ga0453683_0776247 | Ga0453683_0776247_203_616 | 119 |
| 418 | 3300044765 | Ga0466970_0101719 | Ga0466970_0101719_142_537 | 119 |
| 419 | 3300045049 | Ga0466959_0032629 | Ga0466959_0032629_1651_2046 | 119 |
| 420 | 3300048928 | Ga0496125_0299882 | Ga0496125_0299882_152_547 | 119 |
| 421 | 3300049823 | Ga0501044_0520711 | Ga0501044_0520711_25_420 | 119 |
| 422 | 3300001904 | JGI24736J21556_1049260 | JGI24736J21556_10492602 | 120 |
| 423 | 3300001979 | JGI24740J21852_10003263 | JGI24740J21852_100032635 | 120 |
| 424 | 3300001991 | JGI24743J22301_10059968 | JGI24743J22301_100599682 | 120 |
| 425 | 3300002738 | JGI25154J39366_1000019 | JGI25154J39366_1000019165 | 120 |
| 426 | 3300002741 | JGI25157J39369_1005006 | JGI25157J39369_10050062 | 120 |
| 427 | 3300003215 | JGI25153J46596_10002342 | JGI25153J46596_100023424 | 120 |
| 428 | 3300003215 | JGI25153J46596_10025003 | JGI25153J46596_100250032 | 120 |
| 429 | 3300003320 | rootH2_10015349 | rootH2_1001534919 | 120 |
| 430 | 3300003320 | rootH2_10056653 | rootH2_100566533 | 120 |
| 431 | 3300003320 | rootH2_10117949 | rootH2_101179492 | 120 |
| 432 | 3300003320 | rootH2_10252188 | rootH2_102521882 | 120 |
| 433 | 3300003322 | rootL2_10023809 | rootL2_100238093 | 120 |
| 434 | 3300003322 | rootL2_10103028 | rootL2_101030284 | 120 |
| 435 | 3300003322 | rootL2_10103029 | rootL2_101030294 | 120 |
| 436 | 3300003322 | rootL2_10146434 | rootL2_101464343 | 120 |
| 437 | 3300003323 | rootH1_10007634 | rootH1_100076342 | 120 |
| 438 | 3300003323 | rootH1_10196799 | rootH1_101967998 | 120 |
| 439 | 3300003323 | rootH1_10224232 | rootH1_102242322 | 120 |
| 440 | 3300003323 | rootH1_10269349 | rootH1_102693492 | 120 |
| 441 | 3300003323 | rootH1_10317655 | rootH1_103176552 | 120 |
| 442 | 3300003354 | JGI25160J50197_1005104 | JGI25160J50197_10051043 | 120 |
| 443 | 3300003354 | JGI25160J50197_1014080 | JGI25160J50197_10140803 | 120 |
| 444 | 3300003771 | Ga0055526_1015126 | Ga0055526_10151263 | 120 |
| 445 | 3300003790 | Ga0055528_1000383 | Ga0055528_100038310 | 120 |
| 446 | 3300003791 | Ga0055530_10002275 | Ga0055530_100022756 | 120 |
| 447 | 3300003794 | Ga0055531_10040366 | Ga0055531_100403662 | 120 |
| 448 | 3300004625 | Ga0055543_1013114 | Ga0055543_10131143 | 120 |
| 449 | 3300005262 | Ga0065165_1000402 | Ga0065165_100040239 | 120 |
| 450 | 3300005262 | Ga0065165_1044615 | Ga0065165_10446151 | 120 |
| 451 | 3300005289 | Ga0065704_10110528 | Ga0065704_101105283 | 120 |
| 452 | 3300005290 | Ga0065712_10503847 | Ga0065712_105038472 | 120 |
| 453 | 3300005295 | Ga0065707_10012971 | Ga0065707_100129712 | 120 |
| 454 | 3300005327 | Ga0070658_10171865 | Ga0070658_101718652 | 120 |
| 455 | 3300005327 | Ga0070658_11482868 | Ga0070658_114828681 | 120 |
| 456 | 3300005328 | Ga0070676_10003832 | Ga0070676_100038323 | 120 |
| 457 | 3300005328 | Ga0070676_10174270 | Ga0070676_101742702 | 120 |
| 458 | 3300005329 | Ga0070683_100129420 | Ga0070683_1001294201 | 120 |
| 459 | 3300005330 | Ga0070690_100251042 | Ga0070690_1002510422 | 120 |
| 460 | 3300005331 | Ga0070670_100045077 | Ga0070670_1000450773 | 120 |
| 461 | 3300005331 | Ga0070670_100208342 | Ga0070670_1002083422 | 120 |
| 462 | 3300005333 | Ga0070677_10362339 | Ga0070677_103623392 | 120 |
| 463 | 3300005334 | Ga0068869_100152820 | Ga0068869_1001528202 | 120 |
| 464 | 3300005334 | Ga0068869_100441400 | Ga0068869_1004414001 | 120 |
| 465 | 3300005334 | Ga0068869_101915320 | Ga0068869_1019153201 | 120 |
| 466 | 3300005335 | Ga0070666_10035650 | Ga0070666_100356503 | 120 |
| 467 | 3300005335 | Ga0070666_10234690 | Ga0070666_102346902 | 120 |
| 468 | 3300005337 | Ga0070682_100000455 | Ga0070682_10000045512 | 120 |
| 469 | 3300005338 | Ga0068868_100001512 | Ga0068868_1000015129 | 120 |
| 470 | 3300005338 | Ga0068868_100239054 | Ga0068868_1002390541 | 120 |
| 471 | 3300005338 | Ga0068868_100556700 | Ga0068868_1005567002 | 120 |
| 472 | 3300005338 | Ga0068868_101853404 | Ga0068868_1018534041 | 120 |
| 473 | 3300005339 | Ga0070660_101291496 | Ga0070660_1012914961 | 120 |
| 474 | 3300005340 | Ga0070689_100274603 | Ga0070689_1002746032 | 120 |
| 475 | 3300005341 | Ga0070691_10010823 | Ga0070691_100108232 | 120 |
| 476 | 3300005343 | Ga0070687_100154834 | Ga0070687_1001548342 | 120 |
| 477 | 3300005347 | Ga0070668_100000116 | Ga0070668_1000001169 | 120 |
| 478 | 3300005347 | Ga0070668_100409381 | Ga0070668_1004093812 | 120 |
| 479 | 3300005353 | Ga0070669_100240392 | Ga0070669_1002403922 | 120 |
| 480 | 3300005353 | Ga0070669_100970711 | Ga0070669_1009707111 | 120 |
| 481 | 3300005354 | Ga0070675_100101445 | Ga0070675_1001014452 | 120 |
| 482 | 3300005354 | Ga0070675_101138776 | Ga0070675_1011387761 | 120 |
| 483 | 3300005355 | Ga0070671_100010319 | Ga0070671_1000103197 | 120 |
| 484 | 3300005355 | Ga0070671_100385471 | Ga0070671_1003854712 | 120 |
| 485 | 3300005355 | Ga0070671_100491160 | Ga0070671_1004911601 | 120 |
| 486 | 3300005364 | Ga0070673_100000521 | Ga0070673_10000052118 | 120 |
| 487 | 3300005364 | Ga0070673_100029227 | Ga0070673_1000292272 | 120 |
| 488 | 3300005364 | Ga0070673_100191410 | Ga0070673_1001914102 | 120 |
| 489 | 3300005367 | Ga0070667_100000652 | Ga0070667_1000006526 | 120 |
| 490 | 3300005367 | Ga0070667_100004905 | Ga0070667_10000490512 | 120 |
| 491 | 3300005367 | Ga0070667_100326558 | Ga0070667_1003265582 | 120 |
| 492 | 3300005367 | Ga0070667_100562074 | Ga0070667_1005620742 | 120 |
| 493 | 3300005367 | Ga0070667_100916342 | Ga0070667_1009163421 | 120 |
| 494 | 3300005367 | Ga0070667_101017854 | Ga0070667_1010178542 | 120 |
| 495 | 3300005456 | Ga0070678_100054602 | Ga0070678_1000546023 | 120 |
| 496 | 3300005456 | Ga0070678_100104468 | Ga0070678_1001044683 | 120 |
| 497 | 3300005456 | Ga0070678_101074435 | Ga0070678_1010744352 | 120 |
| 498 | 3300005457 | Ga0070662_100001029 | Ga0070662_10000102918 | 120 |
| 499 | 3300005457 | Ga0070662_100463440 | Ga0070662_1004634402 | 120 |
| 500 | 3300005458 | Ga0070681_10059194 | Ga0070681_100591943 | 120 |
| 501 | 3300005458 | Ga0070681_10079737 | Ga0070681_100797373 | 120 |
| 502 | 3300005458 | Ga0070681_10725615 | Ga0070681_107256152 | 120 |
| 503 | 3300005459 | Ga0068867_100009722 | Ga0068867_1000097222 | 120 |
| 504 | 3300005459 | Ga0068867_100049540 | Ga0068867_1000495404 | 120 |
| 505 | 3300005459 | Ga0068867_100668434 | Ga0068867_1006684342 | 120 |
| 506 | 3300005459 | Ga0068867_100796767 | Ga0068867_1007967672 | 120 |
| 507 | 3300005459 | Ga0068867_101407982 | Ga0068867_1014079821 | 120 |
| 508 | 3300005459 | Ga0068867_101422563 | Ga0068867_1014225632 | 120 |
| 509 | 3300005466 | Ga0070685_10143849 | Ga0070685_101438491 | 120 |
| 510 | 3300005471 | Ga0070698_100008986 | Ga0070698_1000089863 | 120 |
| 511 | 3300005471 | Ga0070698_100083465 | Ga0070698_1000834653 | 120 |
| 512 | 3300005530 | Ga0070679_100000973 | Ga0070679_10000097312 | 120 |
| 513 | 3300005535 | Ga0070684_100003219 | Ga0070684_1000032192 | 120 |
| 514 | 3300005535 | Ga0070684_101668291 | Ga0070684_1016682912 | 120 |
| 515 | 3300005535 | Ga0070684_101718550 | Ga0070684_1017185501 | 120 |
| 516 | 3300005539 | Ga0068853_100003822 | Ga0068853_1000038225 | 120 |
| 517 | 3300005539 | Ga0068853_100046145 | Ga0068853_1000461452 | 120 |
| 518 | 3300005539 | Ga0068853_100132094 | Ga0068853_1001320942 | 120 |
| 519 | 3300005539 | Ga0068853_100281948 | Ga0068853_1002819482 | 120 |
| 520 | 3300005539 | Ga0068853_100709590 | Ga0068853_1007095902 | 120 |
| 521 | 3300005539 | Ga0068853_101741675 | Ga0068853_1017416751 | 120 |
| 522 | 3300005539 | Ga0068853_102171321 | Ga0068853_1021713211 | 120 |
| 523 | 3300005543 | Ga0070672_100000038 | Ga0070672_10000003820 | 120 |
| 524 | 3300005543 | Ga0070672_100046787 | Ga0070672_1000467874 | 120 |
| 525 | 3300005543 | Ga0070672_100605382 | Ga0070672_1006053822 | 120 |
| 526 | 3300005543 | Ga0070672_101130050 | Ga0070672_1011300501 | 120 |
| 527 | 3300005543 | Ga0070672_101362529 | Ga0070672_1013625292 | 120 |
| 528 | 3300005543 | Ga0070672_101562481 | Ga0070672_1015624812 | 120 |
| 529 | 3300005544 | Ga0070686_100209651 | Ga0070686_1002096512 | 120 |
| 530 | 3300005547 | Ga0070693_100052194 | Ga0070693_1000521942 | 120 |
| 531 | 3300005547 | Ga0070693_100189197 | Ga0070693_1001891972 | 120 |
| 532 | 3300005548 | Ga0070665_100000013 | Ga0070665_100000013197 | 120 |
| 533 | 3300005548 | Ga0070665_100000504 | Ga0070665_10000050427 | 120 |
| 534 | 3300005548 | Ga0070665_100002898 | Ga0070665_10000289812 | 120 |
| 535 | 3300005563 | Ga0068855_100000424 | Ga0068855_10000042420 | 120 |
| 536 | 3300005563 | Ga0068855_100002280 | Ga0068855_1000022802 | 120 |
| 537 | 3300005563 | Ga0068855_100004440 | Ga0068855_1000044407 | 120 |
| 538 | 3300005563 | Ga0068855_100005197 | Ga0068855_10000519713 | 120 |
| 539 | 3300005563 | Ga0068855_100067080 | Ga0068855_1000670803 | 120 |
| 540 | 3300005563 | Ga0068855_100615564 | Ga0068855_1006155642 | 120 |
| 541 | 3300005563 | Ga0068855_100658624 | Ga0068855_1006586242 | 120 |
| 542 | 3300005564 | Ga0070664_100021537 | Ga0070664_1000215375 | 120 |
| 543 | 3300005564 | Ga0070664_100522891 | Ga0070664_1005228912 | 120 |
| 544 | 3300005577 | Ga0068857_100001435 | Ga0068857_1000014356 | 120 |
| 545 | 3300005577 | Ga0068857_100040695 | Ga0068857_1000406953 | 120 |
| 546 | 3300005578 | Ga0068854_100026033 | Ga0068854_1000260334 | 120 |
| 547 | 3300005578 | Ga0068854_100256180 | Ga0068854_1002561802 | 120 |
| 548 | 3300005614 | Ga0068856_100046162 | Ga0068856_1000461622 | 120 |
| 549 | 3300005614 | Ga0068856_100143359 | Ga0068856_1001433592 | 120 |
| 550 | 3300005614 | Ga0068856_100490995 | Ga0068856_1004909952 | 120 |
| 551 | 3300005616 | Ga0068852_100000342 | Ga0068852_10000034213 | 120 |
| 552 | 3300005616 | Ga0068852_100075871 | Ga0068852_1000758713 | 120 |
| 553 | 3300005616 | Ga0068852_100457027 | Ga0068852_1004570272 | 120 |
| 554 | 3300005616 | Ga0068852_102159510 | Ga0068852_1021595101 | 120 |
| 555 | 3300005617 | Ga0068859_100058243 | Ga0068859_1000582433 | 120 |
| 556 | 3300005617 | Ga0068859_100829355 | Ga0068859_1008293552 | 120 |
| 557 | 3300005617 | Ga0068859_100864391 | Ga0068859_1008643911 | 120 |
| 558 | 3300005618 | Ga0068864_100007905 | Ga0068864_10000790510 | 120 |
| 559 | 3300005718 | Ga0068866_10757015 | Ga0068866_107570152 | 120 |
| 560 | 3300005719 | Ga0068861_100022476 | Ga0068861_1000224765 | 120 |
| 561 | 3300005719 | Ga0068861_100454097 | Ga0068861_1004540972 | 120 |
| 562 | 3300005834 | Ga0068851_10000211 | Ga0068851_1000021125 | 120 |
| 563 | 3300005841 | Ga0068863_100004928 | Ga0068863_1000049286 | 120 |
| 564 | 3300005841 | Ga0068863_100009598 | Ga0068863_1000095989 | 120 |
| 565 | 3300005841 | Ga0068863_100414817 | Ga0068863_1004148172 | 120 |
| 566 | 3300005842 | Ga0068858_100002669 | Ga0068858_1000026695 | 120 |
| 567 | 3300005842 | Ga0068858_100504808 | Ga0068858_1005048082 | 120 |
| 568 | 3300005843 | Ga0068860_100000060 | Ga0068860_100000060164 | 120 |
| 569 | 3300005843 | Ga0068860_100008126 | Ga0068860_10000812611 | 120 |
| 570 | 3300005843 | Ga0068860_100009802 | Ga0068860_1000098022 | 120 |
| 571 | 3300005843 | Ga0068860_100036542 | Ga0068860_1000365423 | 120 |
| 572 | 3300005843 | Ga0068860_100097786 | Ga0068860_1000977863 | 120 |
| 573 | 3300005843 | Ga0068860_100923396 | Ga0068860_1009233961 | 120 |
| 574 | 3300005843 | Ga0068860_101095561 | Ga0068860_1010955611 | 120 |
| 575 | 3300005843 | Ga0068860_102325711 | Ga0068860_1023257112 | 120 |
| 576 | 3300005844 | Ga0068862_100206260 | Ga0068862_1002062601 | 120 |
| 577 | 3300006195 | Ga0075366_10145326 | Ga0075366_101453262 | 120 |
| 578 | 3300006237 | Ga0097621_100000538 | Ga0097621_10000053818 | 120 |
| 579 | 3300006237 | Ga0097621_100007933 | Ga0097621_1000079336 | 120 |
| 580 | 3300006237 | Ga0097621_101690988 | Ga0097621_1016909882 | 120 |
| 581 | 3300006237 | Ga0097621_102436879 | Ga0097621_1024368791 | 120 |
| 582 | 3300006358 | Ga0068871_100000452 | Ga0068871_10000045214 | 120 |
| 583 | 3300006358 | Ga0068871_100003693 | Ga0068871_1000036936 | 120 |
| 584 | 3300006358 | Ga0068871_100089405 | Ga0068871_1000894053 | 120 |
| 585 | 3300006358 | Ga0068871_100249800 | Ga0068871_1002498002 | 120 |
| 586 | 3300006358 | Ga0068871_100339008 | Ga0068871_1003390082 | 120 |
| 587 | 3300006358 | Ga0068871_100379954 | Ga0068871_1003799542 | 120 |
| 588 | 3300006844 | Ga0075428_100004046 | Ga0075428_10000404611 | 120 |
| 589 | 3300006844 | Ga0075428_100138747 | Ga0075428_1001387472 | 120 |
| 590 | 3300006846 | Ga0075430_100036462 | Ga0075430_1000364623 | 120 |
| 591 | 3300006846 | Ga0075430_100220568 | Ga0075430_1002205682 | 120 |
| 592 | 3300006847 | Ga0075431_100030039 | Ga0075431_1000300392 | 120 |
| 593 | 3300006847 | Ga0075431_100093393 | Ga0075431_1000933932 | 120 |
| 594 | 3300006871 | Ga0075434_101701882 | Ga0075434_1017018822 | 120 |
| 595 | 3300006880 | Ga0075429_100013930 | Ga0075429_1000139303 | 120 |
| 596 | 3300006880 | Ga0075429_100219308 | Ga0075429_1002193082 | 120 |
| 597 | 3300006881 | Ga0068865_100001621 | Ga0068865_1000016216 | 120 |
| 598 | 3300006881 | Ga0068865_100109400 | Ga0068865_1001094003 | 120 |
| 599 | 3300006881 | Ga0068865_100265409 | Ga0068865_1002654092 | 120 |
| 600 | 3300006881 | Ga0068865_100845762 | Ga0068865_1008457621 | 120 |
| 601 | 3300006931 | Ga0097620_100058243 | Ga0097620_1000582433 | 120 |
| 602 | 3300006931 | Ga0097620_100829359 | Ga0097620_1008293592 | 120 |
| 603 | 3300006931 | Ga0097620_100864529 | Ga0097620_1008645292 | 120 |
| 604 | 3300009093 | Ga0105240_10000486 | Ga0105240_1000048624 | 120 |
| 605 | 3300009093 | Ga0105240_10001336 | Ga0105240_100013368 | 120 |
| 606 | 3300009093 | Ga0105240_10002538 | Ga0105240_1000253820 | 120 |
| 607 | 3300009093 | Ga0105240_10004786 | Ga0105240_1000478620 | 120 |
| 608 | 3300009093 | Ga0105240_10007443 | Ga0105240_100074437 | 120 |
| 609 | 3300009093 | Ga0105240_10016576 | Ga0105240_100165765 | 120 |
| 610 | 3300009093 | Ga0105240_10073956 | Ga0105240_100739562 | 120 |
| 611 | 3300009093 | Ga0105240_10085020 | Ga0105240_100850202 | 120 |
| 612 | 3300009093 | Ga0105240_10152230 | Ga0105240_101522303 | 120 |
| 613 | 3300009093 | Ga0105240_10169245 | Ga0105240_101692453 | 120 |
| 614 | 3300009093 | Ga0105240_10583631 | Ga0105240_105836312 | 120 |
| 615 | 3300009094 | Ga0111539_10179830 | Ga0111539_101798304 | 120 |
| 616 | 3300009094 | Ga0111539_10377407 | Ga0111539_103774072 | 120 |
| 617 | 3300009098 | Ga0105245_10065037 | Ga0105245_100650374 | 120 |
| 618 | 3300009101 | Ga0105247_10040609 | Ga0105247_100406093 | 120 |
| 619 | 3300009147 | Ga0114129_10019537 | Ga0114129_100195377 | 120 |
| 620 | 3300009147 | Ga0114129_10025061 | Ga0114129_100250613 | 120 |
| 621 | 3300009147 | Ga0114129_11391192 | Ga0114129_113911922 | 120 |
| 622 | 3300009147 | Ga0114129_12563172 | Ga0114129_125631721 | 120 |
| 623 | 3300009174 | Ga0105241_10000144 | Ga0105241_1000014412 | 120 |
| 624 | 3300009174 | Ga0105241_10001636 | Ga0105241_100016364 | 120 |
| 625 | 3300009174 | Ga0105241_10014888 | Ga0105241_100148882 | 120 |
| 626 | 3300009174 | Ga0105241_10297588 | Ga0105241_102975881 | 120 |
| 627 | 3300009174 | Ga0105241_10676642 | Ga0105241_106766422 | 120 |
| 628 | 3300009176 | Ga0105242_10049029 | Ga0105242_100490293 | 120 |
| 629 | 3300009177 | Ga0105248_12329072 | Ga0105248_123290722 | 120 |
| 630 | 3300009545 | Ga0105237_10000651 | Ga0105237_100006518 | 120 |
| 631 | 3300009545 | Ga0105237_10006210 | Ga0105237_1000621014 | 120 |
| 632 | 3300009545 | Ga0105237_10037264 | Ga0105237_100372644 | 120 |
| 633 | 3300009545 | Ga0105237_10049425 | Ga0105237_100494254 | 120 |
| 634 | 3300009545 | Ga0105237_10070518 | Ga0105237_100705182 | 120 |
| 635 | 3300009545 | Ga0105237_10097915 | Ga0105237_100979153 | 120 |
| 636 | 3300009545 | Ga0105237_10124229 | Ga0105237_101242293 | 120 |
| 637 | 3300009545 | Ga0105237_10153054 | Ga0105237_101530543 | 120 |
| 638 | 3300009545 | Ga0105237_11045517 | Ga0105237_110455171 | 120 |
| 639 | 3300009551 | Ga0105238_10002965 | Ga0105238_1000296511 | 120 |
| 640 | 3300009551 | Ga0105238_10102105 | Ga0105238_101021053 | 120 |
| 641 | 3300009551 | Ga0105238_10189261 | Ga0105238_101892613 | 120 |
| 642 | 3300009551 | Ga0105238_10315880 | Ga0105238_103158802 | 120 |
| 643 | 3300009551 | Ga0105238_10685442 | Ga0105238_106854422 | 120 |
| 644 | 3300009551 | Ga0105238_11905213 | Ga0105238_119052131 | 120 |
| 645 | 3300009553 | Ga0105249_10023320 | Ga0105249_100233206 | 120 |
| 646 | 3300009553 | Ga0105249_10079351 | Ga0105249_100793511 | 120 |
| 647 | 3300009553 | Ga0105249_10335997 | Ga0105249_103359972 | 120 |
| 648 | 3300009553 | Ga0105249_10899517 | Ga0105249_108995171 | 120 |
| 649 | 3300009553 | Ga0105249_11021624 | Ga0105249_110216242 | 120 |
| 650 | 3300009553 | Ga0105249_11848708 | Ga0105249_118487081 | 120 |
| 651 | 3300010375 | Ga0105239_10003371 | Ga0105239_100033715 | 120 |
| 652 | 3300010375 | Ga0105239_10004216 | Ga0105239_1000421613 | 120 |
| 653 | 3300010375 | Ga0105239_10004649 | Ga0105239_100046499 | 120 |
| 654 | 3300010375 | Ga0105239_10076614 | Ga0105239_100766143 | 120 |
| 655 | 3300010375 | Ga0105239_10112773 | Ga0105239_101127734 | 120 |
| 656 | 3300010375 | Ga0105239_10120064 | Ga0105239_101200641 | 120 |
| 657 | 3300010375 | Ga0105239_10127692 | Ga0105239_101276924 | 120 |
| 658 | 3300010375 | Ga0105239_10155028 | Ga0105239_101550283 | 120 |
| 659 | 3300010375 | Ga0105239_10253707 | Ga0105239_102537073 | 120 |
| 660 | 3300010375 | Ga0105239_10254007 | Ga0105239_102540074 | 120 |
| 661 | 3300010375 | Ga0105239_10589635 | Ga0105239_105896351 | 120 |
| 662 | 3300010375 | Ga0105239_10852920 | Ga0105239_108529201 | 120 |
| 663 | 3300010375 | Ga0105239_10855034 | Ga0105239_108550342 | 120 |
| 664 | 3300011119 | Ga0105246_10497455 | Ga0105246_104974552 | 120 |
| 665 | 3300013100 | Ga0157373_10049497 | Ga0157373_100494973 | 120 |
| 666 | 3300013100 | Ga0157373_10183856 | Ga0157373_101838562 | 120 |
| 667 | 3300013102 | Ga0157371_10028728 | Ga0157371_100287282 | 120 |
| 668 | 3300013104 | Ga0157370_10006627 | Ga0157370_100066279 | 120 |
| 669 | 3300013104 | Ga0157370_10008346 | Ga0157370_1000834610 | 120 |
| 670 | 3300013104 | Ga0157370_10039104 | Ga0157370_100391042 | 120 |
| 671 | 3300013104 | Ga0157370_10067725 | Ga0157370_100677254 | 120 |
| 672 | 3300013104 | Ga0157370_10200055 | Ga0157370_102000552 | 120 |
| 673 | 3300013104 | Ga0157370_10293819 | Ga0157370_102938192 | 120 |
| 674 | 3300013104 | Ga0157370_11117459 | Ga0157370_111174591 | 120 |
| 675 | 3300013105 | Ga0157369_10011152 | Ga0157369_100111524 | 120 |
| 676 | 3300013105 | Ga0157369_10143161 | Ga0157369_101431612 | 120 |
| 677 | 3300013105 | Ga0157369_10292254 | Ga0157369_102922543 | 120 |
| 678 | 3300013105 | Ga0157369_10468159 | Ga0157369_104681592 | 120 |
| 679 | 3300013296 | Ga0157374_10000007 | Ga0157374_10000007189 | 120 |
| 680 | 3300013296 | Ga0157374_10000339 | Ga0157374_1000033940 | 120 |
| 681 | 3300013296 | Ga0157374_10147866 | Ga0157374_101478663 | 120 |
| 682 | 3300013296 | Ga0157374_10356939 | Ga0157374_103569391 | 120 |
| 683 | 3300013296 | Ga0157374_10558304 | Ga0157374_105583042 | 120 |
| 684 | 3300013296 | Ga0157374_10753667 | Ga0157374_107536671 | 120 |
| 685 | 3300013297 | Ga0157378_10049153 | Ga0157378_100491534 | 120 |
| 686 | 3300013297 | Ga0157378_10124365 | Ga0157378_101243652 | 120 |
| 687 | 3300013297 | Ga0157378_11024388 | Ga0157378_110243882 | 120 |
| 688 | 3300013306 | Ga0163162_10000213 | Ga0163162_1000021315 | 120 |
| 689 | 3300013306 | Ga0163162_10000386 | Ga0163162_1000038622 | 120 |
| 690 | 3300013306 | Ga0163162_10000942 | Ga0163162_100009428 | 120 |
| 691 | 3300013306 | Ga0163162_10042307 | Ga0163162_100423072 | 120 |
| 692 | 3300013306 | Ga0163162_10220548 | Ga0163162_102205482 | 120 |
| 693 | 3300013306 | Ga0163162_10682711 | Ga0163162_106827112 | 120 |
| 694 | 3300013306 | Ga0163162_10852484 | Ga0163162_108524841 | 120 |
| 695 | 3300013306 | Ga0163162_11866729 | Ga0163162_118667292 | 120 |
| 696 | 3300013307 | Ga0157372_10000954 | Ga0157372_1000095415 | 120 |
| 697 | 3300013307 | Ga0157372_10005795 | Ga0157372_100057954 | 120 |
| 698 | 3300013307 | Ga0157372_10014521 | Ga0157372_100145214 | 120 |
| 699 | 3300013307 | Ga0157372_10015096 | Ga0157372_100150962 | 120 |
| 700 | 3300013307 | Ga0157372_10500693 | Ga0157372_105006932 | 120 |
| 701 | 3300013307 | Ga0157372_10520251 | Ga0157372_105202511 | 120 |
| 702 | 3300013307 | Ga0157372_11004883 | Ga0157372_110048832 | 120 |
| 703 | 3300013307 | Ga0157372_11070967 | Ga0157372_110709672 | 120 |
| 704 | 3300013307 | Ga0157372_12240767 | Ga0157372_122407672 | 120 |
| 705 | 3300013308 | Ga0157375_10000548 | Ga0157375_100005486 | 120 |
| 706 | 3300013308 | Ga0157375_10000813 | Ga0157375_1000081318 | 120 |
| 707 | 3300013308 | Ga0157375_10031471 | Ga0157375_100314713 | 120 |
| 708 | 3300013308 | Ga0157375_10056177 | Ga0157375_100561773 | 120 |
| 709 | 3300013308 | Ga0157375_10126832 | Ga0157375_101268321 | 120 |
| 710 | 3300013308 | Ga0157375_10767824 | Ga0157375_107678242 | 120 |
| 711 | 3300013308 | Ga0157375_10798667 | Ga0157375_107986672 | 120 |
| 712 | 3300013308 | Ga0157375_11980370 | Ga0157375_119803701 | 120 |
| 713 | 3300014325 | Ga0163163_10000046 | Ga0163163_1000004699 | 120 |
| 714 | 3300014325 | Ga0163163_10176865 | Ga0163163_101768652 | 120 |
| 715 | 3300014325 | Ga0163163_11024507 | Ga0163163_110245072 | 120 |
| 716 | 3300014326 | Ga0157380_10070887 | Ga0157380_100708873 | 120 |
| 717 | 3300014968 | Ga0157379_10000020 | Ga0157379_1000002033 | 120 |
| 718 | 3300014968 | Ga0157379_10243117 | Ga0157379_102431172 | 120 |
| 719 | 3300014968 | Ga0157379_10413592 | Ga0157379_104135922 | 120 |
| 720 | 3300014968 | Ga0157379_10521428 | Ga0157379_105214282 | 120 |
| 721 | 3300014969 | Ga0157376_10000297 | Ga0157376_100002976 | 120 |
| 722 | 3300014969 | Ga0157376_10067191 | Ga0157376_100671913 | 120 |
| 723 | 3300014969 | Ga0157376_10165811 | Ga0157376_101658113 | 120 |
| 724 | 3300014969 | Ga0157376_10208667 | Ga0157376_102086672 | 120 |
| 725 | 3300014969 | Ga0157376_10984397 | Ga0157376_109843971 | 120 |
| 726 | 3300014969 | Ga0157376_11255830 | Ga0157376_112558301 | 120 |
| 727 | 3300014969 | Ga0157376_11538255 | Ga0157376_115382551 | 120 |
| 728 | 3300014969 | Ga0157376_11851269 | Ga0157376_118512691 | 120 |
| 729 | 3300014969 | Ga0157376_11999351 | Ga0157376_119993511 | 120 |
| 730 | 3300015265 | Ga0182005_1000023 | Ga0182005_100002324 | 120 |
| 731 | 3300017792 | Ga0163161_10000950 | Ga0163161_1000095014 | 120 |
| 732 | 3300017792 | Ga0163161_10012778 | Ga0163161_100127784 | 120 |
| 733 | 3300017792 | Ga0163161_10820570 | Ga0163161_108205701 | 120 |
| 734 | 3300017792 | Ga0163161_11417688 | Ga0163161_114176882 | 120 |
| 735 | 3300021361 | Ga0213872_10311097 | Ga0213872_103110971 | 120 |
| 736 | 3300021384 | Ga0213876_10018117 | Ga0213876_100181173 | 120 |
| 737 | 3300025242 | Ga0209258_106914 | Ga0209258_1069142 | 120 |
| 738 | 3300025246 | Ga0209646_1000003 | Ga0209646_1000003777 | 120 |
| 739 | 3300025246 | Ga0209646_1000557 | Ga0209646_100055714 | 120 |
| 740 | 3300025250 | Ga0209026_1001293 | Ga0209026_10012933 | 120 |
| 741 | 3300025258 | Ga0209129_1007827 | Ga0209129_10078273 | 120 |
| 742 | 3300025263 | Ga0209565_1017147 | Ga0209565_10171472 | 120 |
| 743 | 3300025273 | Ga0209673_1000194 | Ga0209673_100019418 | 120 |
| 744 | 3300025291 | Ga0209675_1034967 | Ga0209675_10349672 | 120 |
| 745 | 3300025297 | Ga0209758_1008229 | Ga0209758_10082294 | 120 |
| 746 | 3300025297 | Ga0209758_1035014 | Ga0209758_10350142 | 120 |
| 747 | 3300025298 | Ga0209050_1000765 | Ga0209050_100076532 | 120 |
| 748 | 3300025302 | Ga0207426_1000803 | Ga0207426_100080318 | 120 |
| 749 | 3300025302 | Ga0207426_1002657 | Ga0207426_10026578 | 120 |
| 750 | 3300025304 | Ga0209257_1001800 | Ga0209257_100180012 | 120 |
| 751 | 3300025315 | Ga0207697_10436429 | Ga0207697_104364291 | 120 |
| 752 | 3300025893 | Ga0207682_10357956 | Ga0207682_103579561 | 120 |
| 753 | 3300025903 | Ga0207680_10072487 | Ga0207680_100724873 | 120 |
| 754 | 3300025904 | Ga0207647_10011770 | Ga0207647_100117702 | 120 |
| 755 | 3300025904 | Ga0207647_10116839 | Ga0207647_101168392 | 120 |
| 756 | 3300025904 | Ga0207647_10166452 | Ga0207647_101664522 | 120 |
| 757 | 3300025904 | Ga0207647_10452058 | Ga0207647_104520582 | 120 |
| 758 | 3300025907 | Ga0207645_10000716 | Ga0207645_1000071610 | 120 |
| 759 | 3300025909 | Ga0207705_10015509 | Ga0207705_100155095 | 120 |
| 760 | 3300025909 | Ga0207705_10128970 | Ga0207705_101289702 | 120 |
| 761 | 3300025909 | Ga0207705_10834983 | Ga0207705_108349832 | 120 |
| 762 | 3300025911 | Ga0207654_10000765 | Ga0207654_100007653 | 120 |
| 763 | 3300025911 | Ga0207654_10002286 | Ga0207654_100022867 | 120 |
| 764 | 3300025911 | Ga0207654_10667864 | Ga0207654_106678641 | 120 |
| 765 | 3300025911 | Ga0207654_11110138 | Ga0207654_111101382 | 120 |
| 766 | 3300025912 | Ga0207707_10000317 | Ga0207707_1000031735 | 120 |
| 767 | 3300025912 | Ga0207707_10032387 | Ga0207707_100323873 | 120 |
| 768 | 3300025913 | Ga0207695_10000130 | Ga0207695_1000013036 | 120 |
| 769 | 3300025913 | Ga0207695_10000170 | Ga0207695_10000170151 | 120 |
| 770 | 3300025913 | Ga0207695_10001252 | Ga0207695_1000125221 | 120 |
| 771 | 3300025913 | Ga0207695_10003385 | Ga0207695_100033852 | 120 |
| 772 | 3300025913 | Ga0207695_10005660 | Ga0207695_100056605 | 120 |
| 773 | 3300025913 | Ga0207695_10019730 | Ga0207695_100197302 | 120 |
| 774 | 3300025913 | Ga0207695_10082396 | Ga0207695_100823962 | 120 |
| 775 | 3300025913 | Ga0207695_10122313 | Ga0207695_101223133 | 120 |
| 776 | 3300025913 | Ga0207695_10146013 | Ga0207695_101460132 | 120 |
| 777 | 3300025913 | Ga0207695_10496260 | Ga0207695_104962601 | 120 |
| 778 | 3300025914 | Ga0207671_10003613 | Ga0207671_100036133 | 120 |
| 779 | 3300025914 | Ga0207671_10006005 | Ga0207671_100060056 | 120 |
| 780 | 3300025914 | Ga0207671_10099825 | Ga0207671_100998253 | 120 |
| 781 | 3300025914 | Ga0207671_10334900 | Ga0207671_103349001 | 120 |
| 782 | 3300025914 | Ga0207671_10511850 | Ga0207671_105118501 | 120 |
| 783 | 3300025917 | Ga0207660_10001972 | Ga0207660_1000197210 | 120 |
| 784 | 3300025918 | Ga0207662_10045504 | Ga0207662_100455042 | 120 |
| 785 | 3300025918 | Ga0207662_10271871 | Ga0207662_102718712 | 120 |
| 786 | 3300025919 | Ga0207657_10115523 | Ga0207657_101155232 | 120 |
| 787 | 3300025921 | Ga0207652_10000456 | Ga0207652_1000045621 | 120 |
| 788 | 3300025924 | Ga0207694_10010257 | Ga0207694_100102574 | 120 |
| 789 | 3300025924 | Ga0207694_10326039 | Ga0207694_103260393 | 120 |
| 790 | 3300025924 | Ga0207694_10461571 | Ga0207694_104615712 | 120 |
| 791 | 3300025924 | Ga0207694_10554200 | Ga0207694_105542002 | 120 |
| 792 | 3300025925 | Ga0207650_10061157 | Ga0207650_100611573 | 120 |
| 793 | 3300025925 | Ga0207650_10110693 | Ga0207650_101106932 | 120 |
| 794 | 3300025926 | Ga0207659_10737889 | Ga0207659_107378892 | 120 |
| 795 | 3300025926 | Ga0207659_11515077 | Ga0207659_115150771 | 120 |
| 796 | 3300025931 | Ga0207644_10084955 | Ga0207644_100849551 | 120 |
| 797 | 3300025931 | Ga0207644_10210051 | Ga0207644_102100512 | 120 |
| 798 | 3300025933 | Ga0207706_10002658 | Ga0207706_1000265819 | 120 |
| 799 | 3300025933 | Ga0207706_10763496 | Ga0207706_107634962 | 120 |
| 800 | 3300025936 | Ga0207670_10870212 | Ga0207670_108702122 | 120 |
| 801 | 3300025938 | Ga0207704_10001715 | Ga0207704_100017157 | 120 |
| 802 | 3300025938 | Ga0207704_10055030 | Ga0207704_100550303 | 120 |
| 803 | 3300025940 | Ga0207691_10000013 | Ga0207691_1000001372 | 120 |
| 804 | 3300025940 | Ga0207691_10016423 | Ga0207691_100164238 | 120 |
| 805 | 3300025940 | Ga0207691_10533510 | Ga0207691_105335102 | 120 |
| 806 | 3300025940 | Ga0207691_10950959 | Ga0207691_109509592 | 120 |
| 807 | 3300025941 | Ga0207711_10121595 | Ga0207711_101215953 | 120 |
| 808 | 3300025942 | Ga0207689_10111224 | Ga0207689_101112242 | 120 |
| 809 | 3300025942 | Ga0207689_10132759 | Ga0207689_101327593 | 120 |
| 810 | 3300025944 | Ga0207661_10015513 | Ga0207661_100155133 | 120 |
| 811 | 3300025945 | Ga0207679_10161133 | Ga0207679_101611333 | 120 |
| 812 | 3300025949 | Ga0207667_10000876 | Ga0207667_1000087614 | 120 |
| 813 | 3300025949 | Ga0207667_10005154 | Ga0207667_100051544 | 120 |
| 814 | 3300025949 | Ga0207667_10010158 | Ga0207667_1001015812 | 120 |
| 815 | 3300025949 | Ga0207667_10039331 | Ga0207667_100393314 | 120 |
| 816 | 3300025949 | Ga0207667_10050854 | Ga0207667_100508544 | 120 |
| 817 | 3300025949 | Ga0207667_10053350 | Ga0207667_100533504 | 120 |
| 818 | 3300025949 | Ga0207667_10474131 | Ga0207667_104741312 | 120 |
| 819 | 3300025960 | Ga0207651_10000468 | Ga0207651_1000046814 | 120 |
| 820 | 3300025961 | Ga0207712_10019045 | Ga0207712_100190452 | 120 |
| 821 | 3300025972 | Ga0207668_10000295 | Ga0207668_100002955 | 120 |
| 822 | 3300025972 | Ga0207668_10462652 | Ga0207668_104626522 | 120 |
| 823 | 3300025972 | Ga0207668_10732966 | Ga0207668_107329661 | 120 |
| 824 | 3300025981 | Ga0207640_10022361 | Ga0207640_100223613 | 120 |
| 825 | 3300025986 | Ga0207658_10005989 | Ga0207658_100059894 | 120 |
| 826 | 3300025986 | Ga0207658_10039948 | Ga0207658_100399482 | 120 |
| 827 | 3300025986 | Ga0207658_10136739 | Ga0207658_101367392 | 120 |
| 828 | 3300025986 | Ga0207658_10532619 | Ga0207658_105326192 | 120 |
| 829 | 3300025986 | Ga0207658_11101638 | Ga0207658_111016381 | 120 |
| 830 | 3300025986 | Ga0207658_11116102 | Ga0207658_111161022 | 120 |
| 831 | 3300026023 | Ga0207677_10020249 | Ga0207677_100202493 | 120 |
| 832 | 3300026023 | Ga0207677_10054092 | Ga0207677_100540922 | 120 |
| 833 | 3300026023 | Ga0207677_10894324 | Ga0207677_108943242 | 120 |
| 834 | 3300026035 | Ga0207703_10001005 | Ga0207703_100010056 | 120 |
| 835 | 3300026035 | Ga0207703_10695737 | Ga0207703_106957372 | 120 |
| 836 | 3300026041 | Ga0207639_10001884 | Ga0207639_100018848 | 120 |
| 837 | 3300026041 | Ga0207639_10079293 | Ga0207639_100792933 | 120 |
| 838 | 3300026041 | Ga0207639_10130798 | Ga0207639_101307982 | 120 |
| 839 | 3300026041 | Ga0207639_10329654 | Ga0207639_103296542 | 120 |
| 840 | 3300026041 | Ga0207639_10347899 | Ga0207639_103478992 | 120 |
| 841 | 3300026041 | Ga0207639_11082349 | Ga0207639_110823491 | 120 |
| 842 | 3300026041 | Ga0207639_11233658 | Ga0207639_112336581 | 120 |
| 843 | 3300026041 | Ga0207639_11877624 | Ga0207639_118776241 | 120 |
| 844 | 3300026078 | Ga0207702_10074911 | Ga0207702_100749113 | 120 |
| 845 | 3300026088 | Ga0207641_10005007 | Ga0207641_100050079 | 120 |
| 846 | 3300026088 | Ga0207641_10013024 | Ga0207641_100130243 | 120 |
| 847 | 3300026089 | Ga0207648_10006608 | Ga0207648_100066088 | 120 |
| 848 | 3300026089 | Ga0207648_10119591 | Ga0207648_101195913 | 120 |
| 849 | 3300026089 | Ga0207648_10292252 | Ga0207648_102922522 | 120 |
| 850 | 3300026089 | Ga0207648_10576955 | Ga0207648_105769552 | 120 |
| 851 | 3300026089 | Ga0207648_11697011 | Ga0207648_116970111 | 120 |
| 852 | 3300026095 | Ga0207676_10016838 | Ga0207676_100168386 | 120 |
| 853 | 3300026095 | Ga0207676_10038335 | Ga0207676_100383352 | 120 |
| 854 | 3300026116 | Ga0207674_10002964 | Ga0207674_1000296413 | 120 |
| 855 | 3300026116 | Ga0207674_10517136 | Ga0207674_105171362 | 120 |
| 856 | 3300026116 | Ga0207674_11580605 | Ga0207674_115806051 | 120 |
| 857 | 3300026118 | Ga0207675_100268394 | Ga0207675_1002683942 | 120 |
| 858 | 3300026121 | Ga0207683_10045175 | Ga0207683_100451752 | 120 |
| 859 | 3300026121 | Ga0207683_10747903 | Ga0207683_107479031 | 120 |
| 860 | 3300026142 | Ga0207698_10078635 | Ga0207698_100786353 | 120 |
| 861 | 3300026142 | Ga0207698_10113740 | Ga0207698_101137403 | 120 |
| 862 | 3300026142 | Ga0207698_10242966 | Ga0207698_102429662 | 120 |
| 863 | 3300027360 | Ga0209969_1046382 | Ga0209969_10463822 | 120 |
| 864 | 3300027543 | Ga0209999_1059873 | Ga0209999_10598732 | 120 |
| 865 | 3300028379 | Ga0268266_10000024 | Ga0268266_10000024204 | 120 |
| 866 | 3300028379 | Ga0268266_10003677 | Ga0268266_1000367716 | 120 |
| 867 | 3300028379 | Ga0268266_10007487 | Ga0268266_100074875 | 120 |
| 868 | 3300028381 | Ga0268264_10000109 | Ga0268264_10000109122 | 120 |
| 869 | 3300028381 | Ga0268264_10009730 | Ga0268264_100097303 | 120 |
| 870 | 3300028381 | Ga0268264_10014974 | Ga0268264_100149742 | 120 |
| 871 | 3300028381 | Ga0268264_10386704 | Ga0268264_103867041 | 120 |
| 872 | 3300028786 | Ga0307517_10004572 | Ga0307517_100045725 | 120 |
| 873 | 3300028794 | Ga0307515_10000010 | Ga0307515_10000010186 | 120 |
| 874 | 3300029957 | Ga0265324_10182885 | Ga0265324_101828852 | 120 |
| 875 | 3300030521 | Ga0307511_10000455 | Ga0307511_100004558 | 120 |
| 876 | 3300030731 | Ga0316177_1021152 | Ga0316177_10211521 | 120 |
| 877 | 3300031251 | Ga0265327_10000009 | Ga0265327_10000009318 | 120 |
| 878 | 3300031251 | Ga0265327_10004167 | Ga0265327_100041675 | 120 |
| 879 | 3300031344 | Ga0265316_10138506 | Ga0265316_101385062 | 120 |
| 880 | 3300031507 | Ga0307509_10079477 | Ga0307509_100794772 | 120 |
| 881 | 3300031595 | Ga0265313_10054220 | Ga0265313_100542201 | 120 |
| 882 | 3300031616 | Ga0307508_10266298 | Ga0307508_102662983 | 120 |
| 883 | 3300031730 | Ga0307516_10286305 | Ga0307516_102863052 | 120 |
| 884 | 3300033179 | Ga0307507_10486053 | Ga0307507_104860532 | 120 |
| 885 | 3300035113 | Ga0373936_0318064 | Ga0373936_0318064_157_561 | 120 |
| 886 | 3300035114 | Ga0373939_0180524 | Ga0373939_0180524_72_473 | 120 |
| 887 | 3300035692 | Ga0373935_0216448 | Ga0373935_0216448_306_710 | 120 |
| 888 | 3300035695 | Ga0373927_0045920 | Ga0373927_0045920_837_1238 | 120 |
| 889 | 3300036401 | Ga0373937_0474512 | Ga0373937_0474512_59_463 | 120 |
| 890 | 3300037068 | Ga0373925_0540967 | Ga0373925_0540967_76_477 | 120 |
| 891 | 3300039437 | Ga0436365_0090513 | Ga0436365_0090513_9716_10117 | 120 |
| 892 | 3300039447 | Ga0436361_0102070 | Ga0436361_0102070_1075_1479 | 120 |
| 893 | 3300041404 | Ga0439436_0006422 | Ga0439436_0006422_3015_3416 | 120 |
| 894 | 3300041406 | Ga0439439_0221112 | Ga0439439_0221112_140_541 | 120 |
| 895 | 3300041413 | Ga0439465_0093575 | Ga0439465_0093575_236_646 | 120 |
| 896 | 3300041441 | Ga0451787_098082 | Ga0451787_098082_84_485 | 120 |
| 897 | 3300041453 | Ga0451797_0679504 | Ga0451797_0679504_13_414 | 120 |
| 898 | 3300041459 | Ga0451800_1624960 | Ga0451800_1624960_56_457 | 120 |
| 899 | 3300041460 | Ga0451802_0508158 | Ga0451802_0508158_689_1090 | 120 |
| 900 | 3300041460 | Ga0451802_1818999 | Ga0451802_1818999_552_953 | 120 |
| 901 | 3300041486 | Ga0451807_0677323 | Ga0451807_0677323_98_502 | 120 |
| 902 | 3300041491 | Ga0451833_1095634 | Ga0451833_1095634_355_756 | 120 |
| 903 | 3300041492 | Ga0451835_0691656 | Ga0451835_0691656_680_1081 | 120 |
| 904 | 3300041498 | Ga0451841_0596099 | Ga0451841_0596099_71_472 | 120 |
| 905 | 3300041507 | Ga0451851_0019816 | Ga0451851_0019816_533_931 | 120 |
| 906 | 3300041511 | Ga0451855_0703264 | Ga0451855_0703264_84_485 | 120 |
| 907 | 3300041512 | Ga0451853_1034895 | Ga0451853_1034895_403_804 | 120 |
| 908 | 3300041997 | Ga0439431_0022343 | Ga0439431_0022343_847_1257 | 120 |
| 909 | 3300042007 | Ga0439449_0040120 | Ga0439449_0040120_373_774 | 120 |
| 910 | 3300042014 | Ga0439457_003389 | Ga0439457_003389_475_876 | 120 |
| 911 | 3300042015 | Ga0439462_0014919 | Ga0439462_0014919_696_1097 | 120 |
| 912 | 3300042876 | Ga0451577_0009728 | Ga0451577_0009728_4040_4435 | 120 |
| 913 | 3300042876 | Ga0451577_0147917 | Ga0451577_0147917_1180_1578 | 120 |
| 914 | 3300042876 | Ga0451577_0204822 | Ga0451577_0204822_43_438 | 120 |
| 915 | 3300042876 | Ga0451577_0548777 | Ga0451577_0548777_391_789 | 120 |
| 916 | 3300042876 | Ga0451577_1634822 | Ga0451577_1634822_94_498 | 120 |
| 917 | 3300044656 | Ga0466969_0000149 | Ga0466969_0000149_34582_34983 | 120 |
| 918 | 3300044656 | Ga0466969_0055902 | Ga0466969_0055902_443_847 | 120 |
| 919 | 3300044658 | Ga0466972_0000013 | Ga0466972_0000013_158949_159350 | 120 |
| 920 | 3300044658 | Ga0466972_0009022 | Ga0466972_0009022_2820_3224 | 120 |
| 921 | 3300044658 | Ga0466972_0055893 | Ga0466972_0055893_284_685 | 120 |
| 922 | 3300044683 | Ga0466965_0016082 | Ga0466965_0016082_1588_1992 | 120 |
| 923 | 3300044684 | Ga0466966_0541218 | Ga0466966_0541218_37_441 | 120 |
| 924 | 3300044693 | Ga0466961_0018040 | Ga0466961_0018040_3840_4244 | 120 |
| 925 | 3300044706 | Ga0466964_0013676 | Ga0466964_0013676_751_1152 | 120 |
| 926 | 3300044706 | Ga0466964_0110784 | Ga0466964_0110784_140_544 | 120 |
| 927 | 3300044712 | Ga0453684_0054028 | Ga0453684_0054028_4306_4704 | 120 |
| 928 | 3300044712 | Ga0453684_0192811 | Ga0453684_0192811_1378_1773 | 120 |
| 929 | 3300044712 | Ga0453684_0462562 | Ga0453684_0462562_296_694 | 120 |
| 930 | 3300044719 | Ga0466971_0043276 | Ga0466971_0043276_1059_1463 | 120 |
| 931 | 3300044719 | Ga0466971_0410629 | Ga0466971_0410629_142_546 | 120 |
| 932 | 3300044735 | Ga0466968_0031740 | Ga0466968_0031740_1412_1813 | 120 |
| 933 | 3300044735 | Ga0466968_0373239 | Ga0466968_0373239_117_521 | 120 |
| 934 | 3300044765 | Ga0466970_0112116 | Ga0466970_0112116_321_725 | 120 |
| 935 | 3300044765 | Ga0466970_0214363 | Ga0466970_0214363_45_449 | 120 |
| 936 | 3300044842 | Ga0466957_0001230 | Ga0466957_0001230_11979_12380 | 120 |
| 937 | 3300044842 | Ga0466957_0008061 | Ga0466957_0008061_816_1217 | 120 |
| 938 | 3300044842 | Ga0466957_0207593 | Ga0466957_0207593_128_532 | 120 |
| 939 | 3300044842 | Ga0466957_0281260 | Ga0466957_0281260_547_951 | 120 |
| 940 | 3300045049 | Ga0466959_0000023 | Ga0466959_0000023_3383_3784 | 120 |
| 941 | 3300045049 | Ga0466959_0002751 | Ga0466959_0002751_929_1333 | 120 |
| 942 | 3300045051 | Ga0451576_0345050 | Ga0451576_0345050_1092_1487 | 120 |
| 943 | 3300045836 | Ga0466958_0033971 | Ga0466958_0033971_2066_2470 | 120 |
| 944 | 3300046453 | Ga0495627_002397 | Ga0495627_002397_6749_7159 | 120 |
| 945 | 3300046460 | Ga0495638_0114742 | Ga0495638_0114742_292_696 | 120 |
| 946 | 3300046462 | Ga0495651_0447595 | Ga0495651_0447595_407_811 | 120 |
| 947 | 3300046462 | Ga0495651_0714589 | Ga0495651_0714589_84_488 | 120 |
| 948 | 3300046463 | Ga0495653_0828790 | Ga0495653_0828790_16_420 | 120 |
| 949 | 3300046472 | Ga0495580_0135454 | Ga0495580_0135454_52_456 | 120 |
| 950 | 3300046472 | Ga0495580_0337634 | Ga0495580_0337634_567_974 | 120 |
| 951 | 3300046517 | Ga0495630_0189077 | Ga0495630_0189077_1108_1512 | 120 |
| 952 | 3300046519 | Ga0495632_0148631 | Ga0495632_0148631_297_707 | 120 |
| 953 | 3300046519 | Ga0495632_0324580 | Ga0495632_0324580_92_493 | 120 |
| 954 | 3300046524 | Ga0495648_0265597 | Ga0495648_0265597_187_591 | 120 |
| 955 | 3300046539 | Ga0495621_0478100 | Ga0495621_0478100_54_458 | 120 |
| 956 | 3300046543 | Ga0495645_0732894 | Ga0495645_0732894_173_577 | 120 |
| 957 | 3300046558 | Ga0495633_0000058 | Ga0495633_0000058_53527_53937 | 120 |
| 958 | 3300046558 | Ga0495633_0028198 | Ga0495633_0028198_230_634 | 120 |
| 959 | 3300046559 | Ga0495667_0673626 | Ga0495667_0673626_46_450 | 120 |
| 960 | 3300046648 | Ga0495611_0000883 | Ga0495611_0000883_4868_5272 | 120 |
| 961 | 3300046681 | Ga0495647_0091463 | Ga0495647_0091463_499_903 | 120 |
| 962 | 3300046691 | Ga0495670_0070067 | Ga0495670_0070067_692_1096 | 120 |
| 963 | 3300046694 | Ga0495649_0153742 | Ga0495649_0153742_602_1006 | 120 |
| 964 | 3300046694 | Ga0495649_0245781 | Ga0495649_0245781_461_865 | 120 |
| 965 | 3300047319 | Ga0495674_0429891 | Ga0495674_0429891_561_965 | 120 |
| 966 | 3300047319 | Ga0495674_0443521 | Ga0495674_0443521_132_536 | 120 |
| 967 | 3300047320 | Ga0495672_0015969 | Ga0495672_0015969_1045_1449 | 120 |
| 968 | 3300047320 | Ga0495672_0172061 | Ga0495672_0172061_211_615 | 120 |
| 969 | 3300047322 | Ga0495680_0454391 | Ga0495680_0454391_259_663 | 120 |
| 970 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_141499_141903 | 120 |
| 971 | 3300047472 | Ga0495686_0000034 | Ga0495686_0000034_219126_219530 | 120 |
| 972 | 3300048088 | Ga0495602_0334819 | Ga0495602_0334819_647_1051 | 120 |
| 973 | 3300048905 | Ga0496102_0791356 | Ga0496102_0791356_368_772 | 120 |
| 974 | 3300048911 | Ga0496108_0642207 | Ga0496108_0642207_200_604 | 120 |
| 975 | 3300048924 | Ga0496121_0000343 | Ga0496121_0000343_59503_59919 | 120 |
| 976 | 3300048929 | Ga0496126_0015334 | Ga0496126_0015334_2542_2952 | 120 |
| 977 | 3300049569 | Ga0501032_0520407 | Ga0501032_0520407_172_567 | 120 |
| 978 | 3300049570 | Ga0501033_0569298 | Ga0501033_0569298_40_435 | 120 |
| 979 | 3300049571 | Ga0501034_0076420 | Ga0501034_0076420_1098_1493 | 120 |
| 980 | 3300049571 | Ga0501034_0127733 | Ga0501034_0127733_1269_1673 | 120 |
| 981 | 3300049571 | Ga0501034_0556429 | Ga0501034_0556429_437_838 | 120 |
| 982 | 3300049572 | Ga0501036_1119338 | Ga0501036_1119338_112_507 | 120 |
| 983 | 3300049573 | Ga0501037_0101058 | Ga0501037_0101058_858_1253 | 120 |
| 984 | 3300049574 | Ga0501038_1057760 | Ga0501038_1057760_84_488 | 120 |
| 985 | 3300049579 | Ga0501043_0163965 | Ga0501043_0163965_11_412 | 120 |
| 986 | 3300049579 | Ga0501043_0169642 | Ga0501043_0169642_626_1027 | 120 |
| 987 | 3300049579 | Ga0501043_0481483 | Ga0501043_0481483_82_477 | 120 |
| 988 | 3300049580 | Ga0501046_0253019 | Ga0501046_0253019_599_1003 | 120 |
| 989 | 3300049581 | Ga0501047_0013459 | Ga0501047_0013459_6731_7132 | 120 |
| 990 | 3300049581 | Ga0501047_0034117 | Ga0501047_0034117_3790_4191 | 120 |
| 991 | 3300049581 | Ga0501047_0318956 | Ga0501047_0318956_144_539 | 120 |
| 992 | 3300049581 | Ga0501047_0847117 | Ga0501047_0847117_123_527 | 120 |
| 993 | 3300049582 | Ga0501048_0393024 | Ga0501048_0393024_207_608 | 120 |
| 994 | 3300049582 | Ga0501048_0481198 | Ga0501048_0481198_280_684 | 120 |
| 995 | 3300049583 | Ga0501067_0020451 | Ga0501067_0020451_515_919 | 120 |
| 996 | 3300049584 | Ga0501068_0158276 | Ga0501068_0158276_346_750 | 120 |
| 997 | 3300049585 | Ga0501069_0071502 | Ga0501069_0071502_1320_1724 | 120 |
| 998 | 3300049586 | Ga0501070_0350320 | Ga0501070_0350320_491_895 | 120 |
| 999 | 3300049587 | Ga0501071_0427149 | Ga0501071_0427149_452_856 | 120 |
| 1000 | 3300049589 | Ga0501073_0032565 | Ga0501073_0032565_489_893 | 120 |
| 1001 | 3300049590 | Ga0501074_0393963 | Ga0501074_0393963_413_817 | 120 |
| 1002 | 3300049591 | Ga0501075_0443545 | Ga0501075_0443545_314_718 | 120 |
| 1003 | 3300049592 | Ga0501076_1319878 | Ga0501076_1319878_76_480 | 120 |
| 1004 | 3300049653 | Ga0501206_015621 | Ga0501206_015621_315_716 | 120 |
| 1005 | 3300049686 | Ga0501257_005850 | Ga0501257_005850_688_1089 | 120 |
| 1006 | 3300049705 | Ga0501225_0000104 | Ga0501225_0000104_3926_4327 | 120 |
| 1007 | 3300049705 | Ga0501225_0268064 | Ga0501225_0268064_89_490 | 120 |
| 1008 | 3300049741 | Ga0501079_0239449 | Ga0501079_0239449_737_1141 | 120 |
| 1009 | 3300049742 | Ga0501080_0166988 | Ga0501080_0166988_1316_1720 | 120 |
| 1010 | 3300049742 | Ga0501080_0173150 | Ga0501080_0173150_210_614 | 120 |
| 1011 | 3300049744 | Ga0501083_0324308 | Ga0501083_0324308_501_905 | 120 |
| 1012 | 3300049744 | Ga0501083_0494973 | Ga0501083_0494973_225_629 | 120 |
| 1013 | 3300049758 | Ga0501241_001363 | Ga0501241_001363_2468_2878 | 120 |
| 1014 | 3300049822 | Ga0501035_0287587 | Ga0501035_0287587_149_553 | 120 |
| 1015 | 3300049822 | Ga0501035_0735828 | Ga0501035_0735828_279_680 | 120 |
| 1016 | 3300049823 | Ga0501044_0008528 | Ga0501044_0008528_9353_9754 | 120 |
| 1017 | 3300049823 | Ga0501044_0119948 | Ga0501044_0119948_1080_1484 | 120 |
| 1018 | 3300049823 | Ga0501044_0468793 | Ga0501044_0468793_160_561 | 120 |
| 1019 | 3300050493 | nmdc:mga0k408_129423_c1 | nmdc:mga0k408_129423_c1_209_610 | 120 |
| 1020 | 3300050507 | nmdc:mga05p37_1165314_c1 | nmdc:mga05p37_1165314_c1_72_476 | 120 |
| 1021 | 3300050507 | nmdc:mga05p37_19037_c1 | nmdc:mga05p37_19037_c1_1668_2069 | 120 |
| 1022 | 3300050507 | nmdc:mga05p37_85001_c1 | nmdc:mga05p37_85001_c1_1865_2272 | 120 |
| 1023 | 3300050508 | nmdc:mga09592_19444_c1 | nmdc:mga09592_19444_c1_1159_1566 | 120 |
| 1024 | 3300050508 | nmdc:mga09592_320115_c1 | nmdc:mga09592_320115_c1_204_608 | 120 |
| 1025 | 3300050509 | nmdc:mga0qj67_117394_c1 | nmdc:mga0qj67_117394_c1_1707_2111 | 120 |
| 1026 | 3300050509 | nmdc:mga0qj67_220327_c1 | nmdc:mga0qj67_220327_c1_520_927 | 120 |
| 1027 | 3300050510 | nmdc:mga06r32_87315_c1 | nmdc:mga06r32_87315_c1_32_436 | 120 |
| 1028 | 3300050511 | nmdc:mga08y16_1891338_c1 | nmdc:mga08y16_1891338_c1_92_496 | 120 |
| 1029 | 3300050511 | nmdc:mga08y16_295496_c1 | nmdc:mga08y16_295496_c1_309_710 | 120 |
| 1030 | 3300050512 | nmdc:mga0n895_1405155_c1 | nmdc:mga0n895_1405155_c1_241_648 | 120 |
| 1031 | 3300053085 | Ga0495619_1084585 | Ga0495619_1084585_75_479 | 120 |
| 1032 | 3300053086 | Ga0500578_0000155 | Ga0500578_0000155_55376_55777 | 120 |
| 1033 | 3300053086 | Ga0500578_0025346 | Ga0500578_0025346_445_846 | 120 |
| 1034 | 3300053086 | Ga0500578_0476921 | Ga0500578_0476921_99_500 | 120 |
| 1035 | 3300053088 | Ga0500644_0104298 | Ga0500644_0104298_558_962 | 120 |
| 1036 | 3300053089 | Ga0500581_347230 | Ga0500581_347230_29_430 | 120 |
| 1037 | 3300053090 | Ga0500646_0008848 | Ga0500646_0008848_94_504 | 120 |
| 1038 | 3300053090 | Ga0500646_0015297 | Ga0500646_0015297_1198_1599 | 120 |
| 1039 | 3300053090 | Ga0500646_0065725 | Ga0500646_0065725_278_679 | 120 |
| 1040 | 3300053092 | Ga0500583_0000043 | Ga0500583_0000043_18179_18580 | 120 |
| 1041 | 3300053092 | Ga0500583_0000936 | Ga0500583_0000936_1560_1961 | 120 |
| 1042 | 3300053092 | Ga0500583_0012195 | Ga0500583_0012195_1378_1782 | 120 |
| 1043 | 3300053093 | Ga0500651_0102482 | Ga0500651_0102482_21_431 | 120 |
| 1044 | 3300053093 | Ga0500651_0132295 | Ga0500651_0132295_443_853 | 120 |
| 1045 | 3300053093 | Ga0500651_0409219 | Ga0500651_0409219_343_744 | 120 |
| 1046 | 3300053102 | Ga0500554_023107 | Ga0500554_023107_291_692 | 120 |
| 1047 | 3300053116 | Ga0500592_003352 | Ga0500592_003352_1251_1655 | 120 |
| 1048 | 3300053130 | Ga0500642_0051616 | Ga0500642_0051616_1155_1559 | 120 |
| 1049 | 3300053131 | Ga0500652_002832 | Ga0500652_002832_1499_1909 | 120 |
| 1050 | 3300053133 | Ga0500655_044110 | Ga0500655_044110_223_624 | 120 |
| 1051 | 3300053134 | Ga0500658_0000550 | Ga0500658_0000550_7339_7749 | 120 |
| 1052 | 3300053134 | Ga0500658_0204766 | Ga0500658_0204766_32_433 | 120 |
| 1053 | 3300053140 | Ga0500573_0391559 | Ga0500573_0391559_151_552 | 120 |
| 1054 | 3300053142 | Ga0500577_0005752 | Ga0500577_0005752_775_1185 | 120 |
| 1055 | 3300053147 | Ga0500589_021847 | Ga0500589_021847_112_513 | 120 |
| 1056 | 3300053153 | Ga0500616_0023882 | Ga0500616_0023882_2262_2672 | 120 |
| 1057 | 3300053153 | Ga0500616_0058494 | Ga0500616_0058494_294_695 | 120 |
| 1058 | 3300053153 | Ga0500616_0146079 | Ga0500616_0146079_355_759 | 120 |
| 1059 | 3300053156 | Ga0500622_0007178 | Ga0500622_0007178_3639_4040 | 120 |
| 1060 | 3300053156 | Ga0500622_0029703 | Ga0500622_0029703_1288_1692 | 120 |
| 1061 | 3300053156 | Ga0500622_0099070 | Ga0500622_0099070_693_1094 | 120 |
| 1062 | 3300053156 | Ga0500622_0198805 | Ga0500622_0198805_485_886 | 120 |
| 1063 | 3300053177 | Ga0500636_0070130 | Ga0500636_0070130_178_579 | 120 |
| 1064 | 3300053178 | Ga0500637_0257405 | Ga0500637_0257405_296_697 | 120 |
| 1065 | 3300053178 | Ga0500637_0434532 | Ga0500637_0434532_29_433 | 120 |
| 1066 | 3300053732 | Ga0500656_070997 | Ga0500656_070997_109_519 | 120 |
| 1067 | 3300053739 | Ga0500587_011321 | Ga0500587_011321_307_708 | 120 |
| 1068 | 3300054114 | Ga0501084_0000686 | Ga0501084_0000686_24039_24443 | 120 |
| 1069 | 3300055283 | Ga0500661_008389 | Ga0500661_008389_81_494 | 120 |
| 1070 | 3300060353 | Ga0501082_0046764 | Ga0501082_0046764_896_1300 | 120 |
| 1071 | 3300061719 | Ga0466962_0402373 | Ga0466962_0402373_65_466 | 120 |
| 1072 | 2162886007 | SwRhRL2b_contig_2906961 | SwRhRL2b_0428.00003550 | 121 |
| 1073 | 3300003323 | rootH1_10320624 | rootH1_103206243 | 121 |
| 1074 | 3300003578 | Ga0006562J51391_1005593 | Ga0006562J51391_10055932 | 121 |
| 1075 | 3300005288 | Ga0065714_10005480 | Ga0065714_100054804 | 121 |
| 1076 | 3300005288 | Ga0065714_10006409 | Ga0065714_100064091 | 121 |
| 1077 | 3300005288 | Ga0065714_10042358 | Ga0065714_100423582 | 121 |
| 1078 | 3300005288 | Ga0065714_10163191 | Ga0065714_101631911 | 121 |
| 1079 | 3300005288 | Ga0065714_10169009 | Ga0065714_101690092 | 121 |
| 1080 | 3300005288 | Ga0065714_10307876 | Ga0065714_103078762 | 121 |
| 1081 | 3300005289 | Ga0065704_10074946 | Ga0065704_100749464 | 121 |
| 1082 | 3300005289 | Ga0065704_10093374 | Ga0065704_100933744 | 121 |
| 1083 | 3300005293 | Ga0065715_10032010 | Ga0065715_100320102 | 121 |
| 1084 | 3300005293 | Ga0065715_10135501 | Ga0065715_101355011 | 121 |
| 1085 | 3300005293 | Ga0065715_10154190 | Ga0065715_101541901 | 121 |
| 1086 | 3300005293 | Ga0065715_10228433 | Ga0065715_102284332 | 121 |
| 1087 | 3300005293 | Ga0065715_10236192 | Ga0065715_102361922 | 121 |
| 1088 | 3300005293 | Ga0065715_10238518 | Ga0065715_102385182 | 121 |
| 1089 | 3300005293 | Ga0065715_10359911 | Ga0065715_103599112 | 121 |
| 1090 | 3300005293 | Ga0065715_10501322 | Ga0065715_105013222 | 121 |
| 1091 | 3300005337 | Ga0070682_100058559 | Ga0070682_1000585592 | 121 |
| 1092 | 3300005345 | Ga0070692_11349284 | Ga0070692_113492841 | 121 |
| 1093 | 3300005564 | Ga0070664_100769485 | Ga0070664_1007694852 | 121 |
| 1094 | 3300006946 | Ga0079104_1000421 | Ga0079104_100042137 | 121 |
| 1095 | 3300006948 | Ga0099826_10000257 | Ga0099826_1000025718 | 121 |
| 1096 | 3300009036 | Ga0105244_10000057 | Ga0105244_1000005742 | 121 |
| 1097 | 3300009092 | Ga0105250_10086884 | Ga0105250_100868841 | 121 |
| 1098 | 3300012505 | Ga0157339_1058933 | Ga0157339_10589331 | 121 |
| 1099 | 3300013100 | Ga0157373_10012575 | Ga0157373_100125757 | 121 |
| 1100 | 3300013102 | Ga0157371_10248894 | Ga0157371_102488942 | 121 |
| 1101 | 3300013104 | Ga0157370_10017951 | Ga0157370_100179517 | 121 |
| 1102 | 3300013104 | Ga0157370_10027462 | Ga0157370_100274625 | 121 |
| 1103 | 3300013104 | Ga0157370_10042874 | Ga0157370_100428743 | 121 |
| 1104 | 3300013104 | Ga0157370_10105482 | Ga0157370_101054822 | 121 |
| 1105 | 3300013104 | Ga0157370_10121614 | Ga0157370_101216143 | 121 |
| 1106 | 3300013105 | Ga0157369_10004901 | Ga0157369_100049013 | 121 |
| 1107 | 3300015261 | Ga0182006_1016995 | Ga0182006_10169952 | 121 |
| 1108 | 3300015261 | Ga0182006_1022981 | Ga0182006_10229812 | 121 |
| 1109 | 3300015261 | Ga0182006_1030285 | Ga0182006_10302853 | 121 |
| 1110 | 3300015261 | Ga0182006_1039993 | Ga0182006_10399932 | 121 |
| 1111 | 3300017792 | Ga0163161_10027586 | Ga0163161_100275865 | 121 |
| 1112 | 3300022467 | Ga0224712_10579150 | Ga0224712_105791502 | 121 |
| 1113 | 3300025711 | Ga0207696_1111166 | Ga0207696_11111662 | 121 |
| 1114 | 3300025728 | Ga0207655_1000038 | Ga0207655_1000038294 | 121 |
| 1115 | 3300025945 | Ga0207679_10689972 | Ga0207679_106899722 | 121 |
| 1116 | 3300027111 | Ga0209281_1000570 | Ga0209281_10005703 | 121 |
| 1117 | 3300027526 | Ga0209968_1001511 | Ga0209968_10015114 | 121 |
| 1118 | 3300027543 | Ga0209999_1029439 | Ga0209999_10294391 | 121 |
| 1119 | 3300027666 | Ga0209282_1010717 | Ga0209282_10107174 | 121 |
| 1120 | 3300027682 | Ga0209971_1168392 | Ga0209971_11683921 | 121 |
| 1121 | 3300027876 | Ga0209974_10055137 | Ga0209974_100551371 | 121 |
| 1122 | 3300028794 | Ga0307515_10102798 | Ga0307515_101027983 | 121 |
| 1123 | 3300030734 | Ga0316179_1081379 | Ga0316179_10813793 | 121 |
| 1124 | 3300031548 | Ga0307408_100002005 | Ga0307408_1000020057 | 121 |
| 1125 | 3300031731 | Ga0307405_11624296 | Ga0307405_116242961 | 121 |
| 1126 | 3300031824 | Ga0307413_10000274 | Ga0307413_1000027417 | 121 |
| 1127 | 3300031824 | Ga0307413_10212917 | Ga0307413_102129173 | 121 |
| 1128 | 3300031824 | Ga0307413_11632368 | Ga0307413_116323681 | 121 |
| 1129 | 3300031852 | Ga0307410_10000048 | Ga0307410_100000484 | 121 |
| 1130 | 3300031852 | Ga0307410_10366619 | Ga0307410_103666192 | 121 |
| 1131 | 3300031901 | Ga0307406_10000004 | Ga0307406_1000000443 | 121 |
| 1132 | 3300031901 | Ga0307406_10207111 | Ga0307406_102071112 | 121 |
| 1133 | 3300031903 | Ga0307407_10084970 | Ga0307407_100849702 | 121 |
| 1134 | 3300032002 | Ga0307416_100003753 | Ga0307416_10000375310 | 121 |
| 1135 | 3300032004 | Ga0307414_10000051 | Ga0307414_1000005133 | 121 |
| 1136 | 3300032004 | Ga0307414_10045305 | Ga0307414_100453053 | 121 |
| 1137 | 3300032004 | Ga0307414_10836380 | Ga0307414_108363801 | 121 |
| 1138 | 3300032004 | Ga0307414_11773549 | Ga0307414_117735491 | 121 |
| 1139 | 3300032005 | Ga0307411_10000020 | Ga0307411_1000002033 | 121 |
| 1140 | 3300032005 | Ga0307411_10025263 | Ga0307411_100252632 | 121 |
| 1141 | 3300033180 | Ga0307510_10047929 | Ga0307510_100479292 | 121 |
| 1142 | 3300041407 | Ga0439447_001368 | Ga0439447_001368_7003_7398 | 121 |
| 1143 | 3300041411 | Ga0439466_0001833 | Ga0439466_0001833_7169_7564 | 121 |
| 1144 | 3300041411 | Ga0439466_0015264 | Ga0439466_0015264_2197_2592 | 121 |
| 1145 | 3300041494 | Ga0451837_1190987 | Ga0451837_1190987_110_505 | 121 |
| 1146 | 3300046512 | Ga0495610_0068951 | Ga0495610_0068951_902_1297 | 121 |
| 1147 | 3300046660 | Ga0495625_0303361 | Ga0495625_0303361_263_658 | 121 |
| 1148 | 3300046692 | Ga0495671_0018522 | Ga0495671_0018522_593_988 | 121 |
| 1149 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_23475_23870 | 121 |
| 1150 | 3300048920 | Ga0496117_0099196 | Ga0496117_0099196_1404_1799 | 121 |
| 1151 | 3300048921 | Ga0496118_0017695 | Ga0496118_0017695_5409_5804 | 121 |
| 1152 | 3300048924 | Ga0496121_0592952 | Ga0496121_0592952_233_628 | 121 |
| 1153 | 3300048927 | Ga0496124_0026742 | Ga0496124_0026742_1276_1671 | 121 |
| 1154 | 3300048927 | Ga0496124_0567710 | Ga0496124_0567710_16_411 | 121 |
| 1155 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_456676_457071 | 121 |
| 1156 | 3300048929 | Ga0496126_0129830 | Ga0496126_0129830_1732_2127 | 121 |
| 1157 | 3300048929 | Ga0496126_0884120 | Ga0496126_0884120_264_659 | 121 |
| 1158 | 3300049530 | Ga0501314_004831 | Ga0501314_004831_722_1117 | 121 |
| 1159 | 3300049539 | Ga0501323_042247 | Ga0501323_042247_178_573 | 121 |
| 1160 | 3300049664 | Ga0501224_032948 | Ga0501224_032948_46_441 | 121 |
| 1161 | 3300049671 | Ga0501238_000137 | Ga0501238_000137_4024_4419 | 121 |
| 1162 | 3300049679 | Ga0501249_000008 | Ga0501249_000008_123986_124381 | 121 |
| 1163 | 3300049679 | Ga0501249_046621 | Ga0501249_046621_258_653 | 121 |
| 1164 | 3300049758 | Ga0501241_024987 | Ga0501241_024987_515_910 | 121 |
| 1165 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_423283_423678 | 121 |
| 1166 | 3300053088 | Ga0500644_0433852 | Ga0500644_0433852_54_449 | 121 |
| 1167 | 3300053090 | Ga0500646_0005321 | Ga0500646_0005321_1071_1466 | 121 |
| 1168 | 3300053091 | Ga0500647_0349435 | Ga0500647_0349435_132_527 | 121 |
| 1169 | 3300053096 | Ga0500641_0000008 | Ga0500641_0000008_103198_103593 | 121 |
| 1170 | 3300053096 | Ga0500641_0108557 | Ga0500641_0108557_321_716 | 121 |
| 1171 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_104676_105071 | 121 |
| 1172 | 3300053136 | Ga0500559_0022943 | Ga0500559_0022943_1268_1663 | 121 |
| 1173 | 3300053140 | Ga0500573_0191533 | Ga0500573_0191533_550_945 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8893 | 49 | 117 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.8351 | 49 | 117 |
| 2pfu-assembly1.cif.gz_A | nmr structure determination of the periplasmic domain of exbd from e.coli | 0.8106 | 48 | 121 |
| 1z26-assembly1.cif.gz_A | structure of pyrococcus furiosus argonaute with bound tungstate | 0.7783 | 69 | 119 |
| 5by4-assembly1.cif.gz_A-2 | structure and function of the escherichia coli tol-pal stator protein tolr | 0.7566 | 48 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60357_1_228_3.75.10.10 | Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A | 0.889 | 90 | 121 | 3.75.10.10 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.8467 | 49 | 115 | 3.30.420.270 |
| 2pfuA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.8051 | 49 | 115 | 3.30.420.270 |
| 1zejA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.799 | 86 | 121 | 3.40.50.720 |
| af_Q8I1V9_11_208_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.767 | 70 | 119 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9FA47-F1-model_v4 | Protein TolR | 0.9405 | 48 | 120 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A3D6A0Z2-F1-model_v4 | deleted | 0.9009 | 48 | 121 |
|
| AF-X1KHT6-F1-model_v4 | Biopolymer transporter ExbD | 0.8958 | 48 | 121 |
GO:0005886
GO:0022857 |
| AF-A0A2D9BSU1-F1-model_v4 | deleted | 0.874 | 33 | 121 |
|
| AF-A0A0R2UZN4-F1-model_v4 | Biopolymer transporter ExbD | 0.8705 | 33 | 121 |
GO:0005886
GO:0015031 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar