F491197

General Info

Members Datasets Scaffolds Average Seq Length
1173 459 1132 131

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100129420|Ga0070683_1001294201
Length 151
Sequence MRVVVEHRPAFGRQLINMNLRRRLKEDAEVHTGPLNDILFILLMFFLIVSTLANPNVVKVTQPKSKGDTKAKQTVVVSIDANKQFYVGTMRVTLDELKAKLQPFLAKETEQPSVVINADKTVPIDDVVAVMRVARDLGAKTVLAVDKNGVK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541278 Niastella sp. CF465 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
17 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
18 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
19 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
20 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
21 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
22 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
23 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
24 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
25 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
26 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
27 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
28 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
29 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
30 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
31 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
32 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
33 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
34 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
35 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
36 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
37 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
60 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
160 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
240 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
252 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
253 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
254 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
289 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
290 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
291 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
292 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
293 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
294 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
295 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
298 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
299 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
300 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
301 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
302 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
303 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
304 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
305 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
306 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
309 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
312 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
313 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
314 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
318 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
324 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
335 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
336 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
392 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
396 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
397 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
398 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
399 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
400 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
401 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
402 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
407 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
422 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
423 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
424 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
425 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
428 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
429 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
430 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
431 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
432 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
433 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
434 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
435 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
436 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
437 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
438 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
439 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
443 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
444 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
445 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
446 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
447 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
448 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
449 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
452 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
453 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
454 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
455 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
456 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
457 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
458 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
459 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.34
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0.34
Rhizoplane 1.02
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2906961 2162886007 Bacteria 911
2 JGI24736J21556_1049260 3300001904 Unclassified 648
3 JGI24740J21852_10003263 3300001979 Bacteria 7163
4 JGI24743J22301_10059968 3300001991 Bacteria 783
5 JGI25154J39366_1000019 3300002738 Bacteria 234419
6 JGI25157J39369_1005006 3300002741 Bacteria 2250
7 JGI25159J45721_1014429 3300002987 Bacteria 1785
8 JGI25153J46596_10002342 3300003215 Bacteria 10986
9 JGI25153J46596_10025003 3300003215 Bacteria 2142
10 rootH1_10162132 3300003316 Bacteria 2310
11 rootH2_10015349 3300003320 Bacteria 24566
12 rootH2_10056653 3300003320 Bacteria 2983
13 rootH2_10069067 3300003320 Bacteria 1131
14 rootH2_10078664 3300003320 Bacteria 6099
15 rootH2_10117949 3300003320 Unclassified 1507
16 rootH2_10252188 3300003320 Bacteria 1232
17 rootL2_10023809 3300003322 Bacteria 1833
18 rootL2_10103028 3300003322 Bacteria 4043
19 rootL2_10103029 3300003322 Bacteria 6146
20 rootL2_10146434 3300003322 Bacteria 2669
21 rootL2_10157657 3300003322 Bacteria 1820
22 rootH1_10007634 3300003323 Bacteria 9103
23 rootH1_10196799 3300003323 Bacteria 7745
24 rootH1_10224232 3300003323 Bacteria 1139
25 rootH1_10269349 3300003323 Bacteria 1220
26 rootH1_10317655 3300003323 Bacteria 1432
27 rootH1_10320624 3300003323 Bacteria 1397
28 JGI25160J50197_1005104 3300003354 Bacteria 5528
29 JGI25160J50197_1014080 3300003354 Bacteria 2693
30 JGI25160J50197_1038948 3300003354 Bacteria 1118
31 Ga0006562J51391_1005593 3300003578 Bacteria 1193
32 Ga0055535_1001390 3300003761 Bacteria 12511
33 Ga0055526_1015126 3300003771 Bacteria 3115
34 Ga0055528_1000383 3300003790 Bacteria 35925
35 Ga0055530_10002275 3300003791 Bacteria 12616
36 Ga0055531_10000293 3300003794 Bacteria 49990
37 Ga0055531_10040366 3300003794 Bacteria 1369
38 Ga0055543_1013114 3300004625 Bacteria 1647
39 Ga0065165_1000402 3300005262 Bacteria 69844
40 Ga0065165_1013242 3300005262 Bacteria 3294
41 Ga0065165_1044615 3300005262 Bacteria 1296
42 Ga0065714_10005480 3300005288 Bacteria 4056
43 Ga0065714_10006409 3300005288 Bacteria 3707
44 Ga0065714_10042358 3300005288 Bacteria 923
45 Ga0065714_10163191 3300005288 Bacteria 1041
46 Ga0065714_10169009 3300005288 Bacteria 968
47 Ga0065714_10307876 3300005288 Bacteria 685
48 Ga0065704_10074946 3300005289 Bacteria 5890
49 Ga0065704_10093374 3300005289 Bacteria 2601
50 Ga0065704_10110528 3300005289 Unclassified 1978
51 Ga0065704_10268353 3300005289 Unclassified 949
52 Ga0065712_10503847 3300005290 Bacteria 647
53 Ga0065715_10032010 3300005293 Bacteria 1453
54 Ga0065715_10135501 3300005293 Bacteria 1933
55 Ga0065715_10154190 3300005293 Bacteria 1694
56 Ga0065715_10228433 3300005293 Bacteria 1238
57 Ga0065715_10236192 3300005293 Bacteria 1216
58 Ga0065715_10238518 3300005293 Bacteria 1208
59 Ga0065715_10359911 3300005293 Bacteria 876
60 Ga0065715_10501322 3300005293 Bacteria 718
61 Ga0065707_10012971 3300005295 Unclassified 3112
62 Ga0065707_10123533 3300005295 Bacteria 2063
63 Ga0070658_10171865 3300005327 Unclassified 1821
64 Ga0070658_11482868 3300005327 Bacteria 588
65 Ga0070676_10003832 3300005328 Bacteria 7891
66 Ga0070676_10029768 3300005328 Bacteria 3108
67 Ga0070676_10148793 3300005328 Unclassified 1497
68 Ga0070676_10174270 3300005328 Bacteria 1394
69 Ga0070683_100005538 3300005329 Bacteria 10549
70 Ga0070683_100073580 3300005329 Bacteria 3190
71 Ga0070683_100129420 3300005329 Bacteria 2388
72 Ga0070683_100257331 3300005329 Unclassified 1660
73 Ga0070690_100032678 3300005330 Bacteria 3251
74 Ga0070690_100075145 3300005330 Bacteria 2203
75 Ga0070690_100105034 3300005330 Bacteria 1877
76 Ga0070690_100251042 3300005330 Bacteria 1251
77 Ga0070690_100664657 3300005330 Bacteria 797
78 Ga0070670_100045077 3300005331 Bacteria 3791
79 Ga0070670_100208342 3300005331 Bacteria 1699
80 Ga0070677_10362339 3300005333 Bacteria 754
81 Ga0068869_100008424 3300005334 Bacteria 6647
82 Ga0068869_100152820 3300005334 Bacteria 1791
83 Ga0068869_100196828 3300005334 Bacteria 1587
84 Ga0068869_100283184 3300005334 Archaea 1333
85 Ga0068869_100441400 3300005334 Unclassified 1077
86 Ga0068869_101706480 3300005334 Bacteria 562
87 Ga0068869_101915320 3300005334 Bacteria 531
88 Ga0070666_10010757 3300005335 Bacteria 5724
89 Ga0070666_10035650 3300005335 Bacteria 3300
90 Ga0070666_10234690 3300005335 Bacteria 1296
91 Ga0070666_10833202 3300005335 Bacteria 680
92 Ga0070682_100000455 3300005337 Bacteria 25816
93 Ga0070682_100058559 3300005337 Bacteria 2430
94 Ga0070682_100300110 3300005337 Bacteria 1178
95 Ga0070682_100591000 3300005337 Bacteria 875
96 Ga0070682_101253057 3300005337 Archaea 628
97 Ga0068868_100001512 3300005338 Bacteria 15994
98 Ga0068868_100007582 3300005338 Bacteria 7731
99 Ga0068868_100022249 3300005338 Bacteria 4782
100 Ga0068868_100078314 3300005338 Bacteria 2646
101 Ga0068868_100190467 3300005338 Bacteria 1705
102 Ga0068868_100239054 3300005338 Bacteria 1525
103 Ga0068868_100556700 3300005338 Bacteria 1011
104 Ga0068868_101853404 3300005338 Bacteria 570
105 Ga0070660_100422551 3300005339 Unclassified 1104
106 Ga0070660_101291496 3300005339 Unclassified 619
107 Ga0070689_100199684 3300005340 Unclassified 1632
108 Ga0070689_100274603 3300005340 Bacteria 1396
109 Ga0070689_100911213 3300005340 Unclassified 778
110 Ga0070691_10010823 3300005341 Bacteria 4162
111 Ga0070687_100154834 3300005343 Bacteria 1349
112 Ga0070687_100369569 3300005343 Bacteria 931
113 Ga0070661_100004649 3300005344 Bacteria 9455
114 Ga0070661_100115701 3300005344 Bacteria 2005
115 Ga0070692_11349284 3300005345 Bacteria 513
116 Ga0070668_100000116 3300005347 Bacteria 49265
117 Ga0070668_100409381 3300005347 Bacteria 1159
118 Ga0070668_100610271 3300005347 Unclassified 955
119 Ga0070668_101953411 3300005347 Bacteria 541
120 Ga0070669_100240392 3300005353 Bacteria 1438
121 Ga0070669_100780637 3300005353 Bacteria 811
122 Ga0070669_100970711 3300005353 Bacteria 728
123 Ga0070669_101201672 3300005353 Unclassified 655
124 Ga0070669_101239838 3300005353 Unclassified 645
125 Ga0070669_101905596 3300005353 Unclassified 519
126 Ga0070675_100058001 3300005354 Bacteria 3193
127 Ga0070675_100101445 3300005354 Unclassified 2424
128 Ga0070675_100861924 3300005354 Bacteria 829
129 Ga0070675_101138776 3300005354 Bacteria 718
130 Ga0070675_101473107 3300005354 Unclassified 628
131 Ga0070671_100010319 3300005355 Bacteria 7493
132 Ga0070671_100359288 3300005355 Bacteria 1243
133 Ga0070671_100385471 3300005355 Bacteria 1198
134 Ga0070671_100491160 3300005355 Bacteria 1055
135 Ga0070674_100105333 3300005356 Unclassified 2062
136 Ga0070674_101640451 3300005356 Unclassified 580
137 Ga0070673_100000521 3300005364 Bacteria 20630
138 Ga0070673_100014403 3300005364 Bacteria 5506
139 Ga0070673_100029227 3300005364 Bacteria 4108
140 Ga0070673_100115725 3300005364 Unclassified 2230
141 Ga0070673_100191410 3300005364 Bacteria 1757
142 Ga0070673_100414535 3300005364 Unclassified 1207
143 Ga0070659_100021434 3300005366 Bacteria 4922
144 Ga0070659_100284264 3300005366 Archaea 1376
145 Ga0070667_100000652 3300005367 Bacteria 33714
146 Ga0070667_100004905 3300005367 Bacteria 11210
147 Ga0070667_100142222 3300005367 Unclassified 2102
148 Ga0070667_100326558 3300005367 Bacteria 1385
149 Ga0070667_100562074 3300005367 Bacteria 1049
150 Ga0070667_100916342 3300005367 Bacteria 816
151 Ga0070667_101017854 3300005367 Bacteria 773
152 Ga0070667_101637740 3300005367 Bacteria 605
153 Ga0070709_10352906 3300005434 Bacteria 1087
154 Ga0070700_100343367 3300005441 Bacteria 1104
155 Ga0070663_100355677 3300005455 Archaea 1187
156 Ga0070663_101057995 3300005455 Bacteria 708
157 Ga0070678_100048749 3300005456 Bacteria 3053
158 Ga0070678_100054602 3300005456 Bacteria 2912
159 Ga0070678_100104468 3300005456 Unclassified 2203
160 Ga0070678_100211589 3300005456 Bacteria 1607
161 Ga0070678_101074435 3300005456 Unclassified 742
162 Ga0070662_100001029 3300005457 Bacteria 17060
163 Ga0070662_100006211 3300005457 Bacteria 7694
164 Ga0070662_100012518 3300005457 Bacteria 5627
165 Ga0070662_100463440 3300005457 Bacteria 1053
166 Ga0070681_10059194 3300005458 Unclassified 3810
167 Ga0070681_10079737 3300005458 Bacteria 3230
168 Ga0070681_10725615 3300005458 Unclassified 910
169 Ga0068867_100009722 3300005459 Bacteria 6783
170 Ga0068867_100045254 3300005459 Bacteria 3227
171 Ga0068867_100049540 3300005459 Bacteria 3093
172 Ga0068867_100117447 3300005459 Bacteria 2051
173 Ga0068867_100130694 3300005459 Unclassified 1951
174 Ga0068867_100188411 3300005459 Bacteria 1645
175 Ga0068867_100668434 3300005459 Bacteria 913
176 Ga0068867_100796767 3300005459 Bacteria 842
177 Ga0068867_101407982 3300005459 Unclassified 647
178 Ga0068867_101422563 3300005459 Bacteria 644
179 Ga0070685_10143849 3300005466 Bacteria 1504
180 Ga0070698_100008986 3300005471 Bacteria 10747
181 Ga0070698_100083465 3300005471 Bacteria 3184
182 Ga0070699_101122065 3300005518 Unclassified 721
183 Ga0070679_100000973 3300005530 Bacteria 24934
184 Ga0070684_100003219 3300005535 Bacteria 12214
185 Ga0070684_100006634 3300005535 Bacteria 8966
186 Ga0070684_100030438 3300005535 Bacteria 4585
187 Ga0070684_100265370 3300005535 Unclassified 1571
188 Ga0070684_100605154 3300005535 Bacteria 1019
189 Ga0070684_101668291 3300005535 Unclassified 601
190 Ga0070684_101718550 3300005535 Unclassified 592
191 Ga0068853_100003822 3300005539 Bacteria 11533
192 Ga0068853_100014740 3300005539 Bacteria 6415
193 Ga0068853_100038019 3300005539 Bacteria 4098
194 Ga0068853_100046145 3300005539 Bacteria 3735
195 Ga0068853_100132094 3300005539 Bacteria 2236
196 Ga0068853_100281948 3300005539 Bacteria 1532
197 Ga0068853_100709590 3300005539 Bacteria 960
198 Ga0068853_100981450 3300005539 Unclassified 813
199 Ga0068853_101296095 3300005539 Unclassified 704
200 Ga0068853_101741675 3300005539 Bacteria 604
201 Ga0068853_102171321 3300005539 Bacteria 538
202 Ga0070672_100000038 3300005543 Bacteria 57709
203 Ga0070672_100046787 3300005543 Unclassified 3353
204 Ga0070672_100172094 3300005543 Bacteria 1801
205 Ga0070672_100605382 3300005543 Unclassified 955
206 Ga0070672_101130050 3300005543 Unclassified 697
207 Ga0070672_101362529 3300005543 Bacteria 634
208 Ga0070672_101562481 3300005543 Bacteria 592
209 Ga0070686_100177737 3300005544 Unclassified 1510
210 Ga0070686_100209651 3300005544 Unclassified 1402
211 Ga0070693_100052194 3300005547 Unclassified 2343
212 Ga0070693_100126555 3300005547 Unclassified 1592
213 Ga0070693_100189197 3300005547 Bacteria 1330
214 Ga0070665_100000013 3300005548 Bacteria 484927
215 Ga0070665_100000504 3300005548 Bacteria 55959
216 Ga0070665_100002898 3300005548 Bacteria 18535
217 Ga0070665_100327378 3300005548 Bacteria 1536
218 Ga0068855_100000424 3300005563 Bacteria 52152
219 Ga0068855_100002280 3300005563 Bacteria 23696
220 Ga0068855_100004440 3300005563 Bacteria 17135
221 Ga0068855_100005197 3300005563 Bacteria 15879
222 Ga0068855_100067080 3300005563 Bacteria 4182
223 Ga0068855_100615564 3300005563 Unclassified 1170
224 Ga0068855_100658624 3300005563 Bacteria 1124
225 Ga0068855_100940746 3300005563 Bacteria 911
226 Ga0070664_100021144 3300005564 Bacteria 5360
227 Ga0070664_100021537 3300005564 Bacteria 5315
228 Ga0070664_100114993 3300005564 Bacteria 2351
229 Ga0070664_100171059 3300005564 Unclassified 1927
230 Ga0070664_100522891 3300005564 Unclassified 1095
231 Ga0070664_100769485 3300005564 Bacteria 899
232 Ga0068857_100001435 3300005577 Bacteria 18887
233 Ga0068857_100028333 3300005577 Bacteria 4943
234 Ga0068857_100037405 3300005577 Bacteria 4299
235 Ga0068857_100040695 3300005577 Bacteria 4122
236 Ga0068857_100596504 3300005577 Bacteria 1044
237 Ga0068857_100694775 3300005577 Bacteria 966
238 Ga0068854_100026033 3300005578 Bacteria 4016
239 Ga0068854_100256180 3300005578 Bacteria 1399
240 Ga0068854_101143516 3300005578 Bacteria 695
241 Ga0068854_101204852 3300005578 Unclassified 678
242 Ga0068856_100046162 3300005614 Bacteria 4291
243 Ga0068856_100143359 3300005614 Bacteria 2397
244 Ga0068856_100490995 3300005614 Bacteria 1249
245 Ga0068856_101058909 3300005614 Archaea 829
246 Ga0068856_101933320 3300005614 Bacteria 601
247 Ga0070702_100088405 3300005615 Unclassified 1873
248 Ga0068852_100000342 3300005616 Bacteria 31480
249 Ga0068852_100075871 3300005616 Bacteria 2967
250 Ga0068852_100111383 3300005616 Bacteria 2489
251 Ga0068852_100457027 3300005616 Bacteria 1265
252 Ga0068852_102159510 3300005616 Unclassified 578
253 Ga0068852_102348816 3300005616 Bacteria 554
254 Ga0068859_100058243 3300005617 Bacteria 3891
255 Ga0068859_100072397 3300005617 Bacteria 3483
256 Ga0068859_100103505 3300005617 Unclassified 2905
257 Ga0068859_100211513 3300005617 Bacteria 2026
258 Ga0068859_100378832 3300005617 Unclassified 1510
259 Ga0068859_100829355 3300005617 Bacteria 1011
260 Ga0068859_100864391 3300005617 Bacteria 990
261 Ga0068859_101719357 3300005617 Bacteria 693
262 Ga0068864_100007905 3300005618 Bacteria 8762
263 Ga0068864_100035920 3300005618 Bacteria 4221
264 Ga0068864_100121641 3300005618 Bacteria 2335
265 Ga0068864_100166775 3300005618 Bacteria 2005
266 Ga0068864_100257290 3300005618 Bacteria 1623
267 Ga0068866_10030908 3300005718 Bacteria 2574
268 Ga0068866_10757015 3300005718 Bacteria 671
269 Ga0068861_100022476 3300005719 Unclassified 4545
270 Ga0068861_100046224 3300005719 Bacteria 3281
271 Ga0068861_100173875 3300005719 Bacteria 1787
272 Ga0068861_100454097 3300005719 Bacteria 1149
273 Ga0068861_101188356 3300005719 Bacteria 737
274 Ga0068851_10000211 3300005834 Bacteria 27822
275 Ga0068851_10386280 3300005834 Unclassified 821
276 Ga0068851_10999926 3300005834 Unclassified 527
277 Ga0068863_100004928 3300005841 Bacteria 13158
278 Ga0068863_100009598 3300005841 Bacteria 9438
279 Ga0068863_100414817 3300005841 Bacteria 1318
280 Ga0068863_100426465 3300005841 Unclassified 1300
281 Ga0068863_100494205 3300005841 Unclassified 1204
282 Ga0068863_102538137 3300005841 Unclassified 522
283 Ga0068858_100002669 3300005842 Bacteria 17950
284 Ga0068858_100333051 3300005842 Bacteria 1452
285 Ga0068858_100504808 3300005842 Bacteria 1169
286 Ga0068858_100608533 3300005842 Unclassified 1060
287 Ga0068860_100000060 3300005843 Bacteria 195631
288 Ga0068860_100008126 3300005843 Bacteria 10450
289 Ga0068860_100009802 3300005843 Bacteria 9507
290 Ga0068860_100036542 3300005843 Bacteria 4706
291 Ga0068860_100097786 3300005843 Bacteria 2799
292 Ga0068860_100156155 3300005843 Unclassified 2199
293 Ga0068860_100923396 3300005843 Bacteria 889
294 Ga0068860_101009310 3300005843 Bacteria 850
295 Ga0068860_101095561 3300005843 Bacteria 816
296 Ga0068860_102325711 3300005843 Unclassified 556
297 Ga0068862_100206260 3300005844 Bacteria 1774
298 Ga0068862_100405082 3300005844 Bacteria 1277
299 Ga0068862_100429135 3300005844 Archaea 1242
300 Ga0068862_101112955 3300005844 Bacteria 785
301 Ga0068862_102567591 3300005844 Unclassified 521
302 Ga0075366_10145326 3300006195 Bacteria 1435
303 Ga0097621_100000538 3300006237 Bacteria 26658
304 Ga0097621_100007933 3300006237 Bacteria 7618
305 Ga0097621_100142701 3300006237 Bacteria 2048
306 Ga0097621_100253931 3300006237 Unclassified 1540
307 Ga0097621_101690988 3300006237 Unclassified 602
308 Ga0097621_102436879 3300006237 Unclassified 501
309 Ga0068871_100000452 3300006358 Bacteria 28201
310 Ga0068871_100003693 3300006358 Bacteria 10518
311 Ga0068871_100089405 3300006358 Unclassified 2563
312 Ga0068871_100206810 3300006358 Bacteria 1696
313 Ga0068871_100249800 3300006358 Unclassified 1545
314 Ga0068871_100339008 3300006358 Unclassified 1327
315 Ga0068871_100379954 3300006358 Unclassified 1255
316 Ga0075428_100004046 3300006844 Bacteria 16116
317 Ga0075428_100138747 3300006844 Bacteria 2643
318 Ga0075430_100036462 3300006846 Bacteria 4169
319 Ga0075430_100220568 3300006846 Bacteria 1573
320 Ga0075431_100030039 3300006847 Bacteria 5596
321 Ga0075431_100093393 3300006847 Bacteria 3105
322 Ga0075434_100878950 3300006871 Bacteria 911
323 Ga0075434_101701882 3300006871 Bacteria 638
324 Ga0075429_100013930 3300006880 Bacteria 6969
325 Ga0075429_100219308 3300006880 Bacteria 1666
326 Ga0068865_100001621 3300006881 Bacteria 13188
327 Ga0068865_100074201 3300006881 Unclassified 2422
328 Ga0068865_100109400 3300006881 Bacteria 2036
329 Ga0068865_100202490 3300006881 Bacteria 1542
330 Ga0068865_100265409 3300006881 Bacteria 1361
331 Ga0068865_100770297 3300006881 Unclassified 828
332 Ga0068865_100845762 3300006881 Unclassified 792
333 Ga0068865_100982303 3300006881 Bacteria 738
334 Ga0068865_101298927 3300006881 Bacteria 647
335 Ga0097620_100058243 3300006931 Bacteria 3891
336 Ga0097620_100072404 3300006931 Bacteria 3483
337 Ga0097620_100103499 3300006931 Unclassified 2905
338 Ga0097620_100211516 3300006931 Bacteria 2026
339 Ga0097620_100378853 3300006931 Unclassified 1510
340 Ga0097620_100829359 3300006931 Bacteria 1011
341 Ga0097620_100864529 3300006931 Bacteria 990
342 Ga0097620_101718841 3300006931 Bacteria 693
343 Ga0079104_1000421 3300006946 Bacteria 48367
344 Ga0099826_10000257 3300006948 Bacteria 23529
345 Ga0075435_101422406 3300007076 Unclassified 608
346 Ga0105251_10594264 3300009011 Unclassified 525
347 Ga0105244_10000057 3300009036 Bacteria 129775
348 Ga0105250_10086884 3300009092 Bacteria 1270
349 Ga0105240_10000486 3300009093 Bacteria 73492
350 Ga0105240_10001336 3300009093 Bacteria 42397
351 Ga0105240_10002538 3300009093 Bacteria 29284
352 Ga0105240_10004786 3300009093 Bacteria 20421
353 Ga0105240_10007443 3300009093 Bacteria 15898
354 Ga0105240_10016576 3300009093 Bacteria 9969
355 Ga0105240_10073956 3300009093 Bacteria 4208
356 Ga0105240_10085020 3300009093 Bacteria 3877
357 Ga0105240_10152230 3300009093 Bacteria 2754
358 Ga0105240_10169245 3300009093 Bacteria 2589
359 Ga0105240_10583631 3300009093 Unclassified 1233
360 Ga0111539_10179830 3300009094 Bacteria 2471
361 Ga0111539_10370989 3300009094 Bacteria 1666
362 Ga0111539_10377407 3300009094 Bacteria 1651
363 Ga0105245_10065037 3300009098 Unclassified 3298
364 Ga0105247_10003291 3300009101 Bacteria 10587
365 Ga0105247_10040609 3300009101 Unclassified 2844
366 Ga0114129_10019537 3300009147 Bacteria 9647
367 Ga0114129_10025061 3300009147 Bacteria 8453
368 Ga0114129_11391192 3300009147 Bacteria 866
369 Ga0114129_12563172 3300009147 Bacteria 609
370 Ga0105243_10811845 3300009148 Bacteria 923
371 Ga0105241_10000144 3300009174 Bacteria 50819
372 Ga0105241_10001636 3300009174 Bacteria 17076
373 Ga0105241_10014888 3300009174 Bacteria 5693
374 Ga0105241_10241256 3300009174 Unclassified 1528
375 Ga0105241_10297588 3300009174 Bacteria 1384
376 Ga0105241_10409076 3300009174 Unclassified 1192
377 Ga0105241_10676642 3300009174 Unclassified 940
378 Ga0105241_11464025 3300009174 Bacteria 656
379 Ga0105242_10020659 3300009176 Bacteria 5165
380 Ga0105242_10049029 3300009176 Bacteria 3435
381 Ga0105242_10439930 3300009176 Unclassified 1226
382 Ga0105242_10470819 3300009176 Bacteria 1188
383 Ga0105242_10620320 3300009176 Unclassified 1047
384 Ga0105248_10272544 3300009177 Unclassified 1905
385 Ga0105248_11092318 3300009177 Bacteria 902
386 Ga0105248_12329072 3300009177 Bacteria 610
387 Ga0105237_10000651 3300009545 Bacteria 48483
388 Ga0105237_10006210 3300009545 Bacteria 13323
389 Ga0105237_10037264 3300009545 Unclassified 4917
390 Ga0105237_10049425 3300009545 Bacteria 4227
391 Ga0105237_10070518 3300009545 Bacteria 3491
392 Ga0105237_10097915 3300009545 Unclassified 2924
393 Ga0105237_10124229 3300009545 Unclassified 2575
394 Ga0105237_10153054 3300009545 Bacteria 2303
395 Ga0105237_11045517 3300009545 Unclassified 823
396 Ga0105238_10002965 3300009551 Bacteria 16945
397 Ga0105238_10102105 3300009551 Bacteria 2850
398 Ga0105238_10189261 3300009551 Bacteria 2034
399 Ga0105238_10315880 3300009551 Unclassified 1548
400 Ga0105238_10685442 3300009551 Bacteria 1036
401 Ga0105238_11905213 3300009551 Bacteria 627
402 Ga0105249_10023320 3300009553 Bacteria 5552
403 Ga0105249_10049879 3300009553 Bacteria 3817
404 Ga0105249_10079351 3300009553 Bacteria 3047
405 Ga0105249_10335997 3300009553 Bacteria 1526
406 Ga0105249_10349734 3300009553 Bacteria 1497
407 Ga0105249_10899517 3300009553 Bacteria 952
408 Ga0105249_10945337 3300009553 Unclassified 930
409 Ga0105249_11021624 3300009553 Bacteria 896
410 Ga0105249_11848708 3300009553 Bacteria 677
411 Ga0105239_10003371 3300010375 Bacteria 19606
412 Ga0105239_10004216 3300010375 Bacteria 17268
413 Ga0105239_10004649 3300010375 Bacteria 16319
414 Ga0105239_10076614 3300010375 Bacteria 3678
415 Ga0105239_10112773 3300010375 Bacteria 3015
416 Ga0105239_10120064 3300010375 Bacteria 2918
417 Ga0105239_10127692 3300010375 Unclassified 2827
418 Ga0105239_10155028 3300010375 Bacteria 2558
419 Ga0105239_10253707 3300010375 Bacteria 1976
420 Ga0105239_10254007 3300010375 Bacteria 1975
421 Ga0105239_10589635 3300010375 Unclassified 1267
422 Ga0105239_10852920 3300010375 Bacteria 1045
423 Ga0105239_10855034 3300010375 Bacteria 1043
424 Ga0105246_10497455 3300011119 Bacteria 1035
425 Ga0105246_11301631 3300011119 Bacteria 674
426 Ga0157339_1058933 3300012505 Bacteria 528
427 Ga0157373_10012575 3300013100 Bacteria 6222
428 Ga0157373_10044233 3300013100 Bacteria 3179
429 Ga0157373_10049497 3300013100 Bacteria 2995
430 Ga0157373_10183856 3300013100 Bacteria 1472
431 Ga0157371_10028728 3300013102 Bacteria 4025
432 Ga0157371_10171436 3300013102 Unclassified 1551
433 Ga0157371_10248894 3300013102 Bacteria 1279
434 Ga0157370_10006627 3300013104 Bacteria 12725
435 Ga0157370_10008346 3300013104 Bacteria 11172
436 Ga0157370_10017951 3300013104 Bacteria 7124
437 Ga0157370_10027462 3300013104 Bacteria 5612
438 Ga0157370_10039104 3300013104 Bacteria 4585
439 Ga0157370_10042874 3300013104 Bacteria 4357
440 Ga0157370_10067725 3300013104 Bacteria 3374
441 Ga0157370_10105482 3300013104 Bacteria 2638
442 Ga0157370_10121614 3300013104 Bacteria 2437
443 Ga0157370_10200055 3300013104 Bacteria 1853
444 Ga0157370_10293819 3300013104 Bacteria 1500
445 Ga0157370_11117459 3300013104 Bacteria 712
446 Ga0157370_11447386 3300013104 Bacteria 618
447 Ga0157369_10004901 3300013105 Bacteria 15696
448 Ga0157369_10011152 3300013105 Bacteria 10217
449 Ga0157369_10143161 3300013105 Bacteria 2529
450 Ga0157369_10292254 3300013105 Bacteria 1696
451 Ga0157369_10468159 3300013105 Unclassified 1305
452 Ga0157374_10000007 3300013296 Bacteria 595643
453 Ga0157374_10000339 3300013296 Bacteria 43247
454 Ga0157374_10071993 3300013296 Bacteria 3261
455 Ga0157374_10147866 3300013296 Bacteria 2283
456 Ga0157374_10306398 3300013296 Unclassified 1572
457 Ga0157374_10356939 3300013296 Bacteria 1453
458 Ga0157374_10558304 3300013296 Unclassified 1153
459 Ga0157374_10753667 3300013296 Bacteria 988
460 Ga0157378_10035729 3300013297 Bacteria 4397
461 Ga0157378_10049153 3300013297 Unclassified 3752
462 Ga0157378_10124365 3300013297 Bacteria 2381
463 Ga0157378_10167058 3300013297 Bacteria 2061
464 Ga0157378_11024388 3300013297 Bacteria 860
465 Ga0157378_11037044 3300013297 Archaea 855
466 Ga0163162_10000213 3300013306 Bacteria 53744
467 Ga0163162_10000386 3300013306 Bacteria 40256
468 Ga0163162_10000942 3300013306 Bacteria 27029
469 Ga0163162_10042307 3300013306 Bacteria 4559
470 Ga0163162_10129331 3300013306 Unclassified 2633
471 Ga0163162_10142022 3300013306 Bacteria 2515
472 Ga0163162_10220548 3300013306 Bacteria 2026
473 Ga0163162_10517219 3300013306 Bacteria 1323
474 Ga0163162_10524871 3300013306 Bacteria 1313
475 Ga0163162_10682711 3300013306 Unclassified 1149
476 Ga0163162_10852484 3300013306 Unclassified 1026
477 Ga0163162_11643045 3300013306 Unclassified 733
478 Ga0163162_11866729 3300013306 Bacteria 687
479 Ga0157372_10000954 3300013307 Bacteria 31547
480 Ga0157372_10005795 3300013307 Bacteria 13155
481 Ga0157372_10014521 3300013307 Bacteria 8429
482 Ga0157372_10015096 3300013307 Bacteria 8268
483 Ga0157372_10232821 3300013307 Bacteria 2136
484 Ga0157372_10458887 3300013307 Bacteria 1485
485 Ga0157372_10500693 3300013307 Bacteria 1417
486 Ga0157372_10520251 3300013307 Bacteria 1387
487 Ga0157372_11004883 3300013307 Bacteria 966
488 Ga0157372_11070967 3300013307 Bacteria 933
489 Ga0157372_12240767 3300013307 Unclassified 627
490 Ga0157375_10000548 3300013308 Bacteria 33804
491 Ga0157375_10000813 3300013308 Bacteria 27357
492 Ga0157375_10014722 3300013308 Bacteria 6989
493 Ga0157375_10031471 3300013308 Bacteria 5016
494 Ga0157375_10056177 3300013308 Bacteria 3885
495 Ga0157375_10075317 3300013308 Bacteria 3399
496 Ga0157375_10093955 3300013308 Bacteria 3066
497 Ga0157375_10126832 3300013308 Bacteria 2668
498 Ga0157375_10442997 3300013308 Bacteria 1464
499 Ga0157375_10767824 3300013308 Bacteria 1114
500 Ga0157375_10798667 3300013308 Bacteria 1092
501 Ga0157375_10834563 3300013308 Bacteria 1069
502 Ga0157375_11495265 3300013308 Unclassified 797
503 Ga0157375_11980370 3300013308 Bacteria 692
504 Ga0157375_13191713 3300013308 Bacteria 547
505 Ga0163163_10000046 3300014325 Bacteria 133543
506 Ga0163163_10040173 3300014325 Bacteria 4567
507 Ga0163163_10135234 3300014325 Unclassified 2506
508 Ga0163163_10176865 3300014325 Bacteria 2181
509 Ga0163163_11024507 3300014325 Bacteria 889
510 Ga0157380_10070887 3300014326 Bacteria 2818
511 Ga0157380_10370569 3300014326 Unclassified 1347
512 Ga0157380_10590989 3300014326 Unclassified 1096
513 Ga0157377_10039879 3300014745 Bacteria 2599
514 Ga0157377_10114748 3300014745 Unclassified 1624
515 Ga0157377_11534426 3300014745 Archaea 531
516 Ga0157379_10000020 3300014968 Bacteria 92868
517 Ga0157379_10040831 3300014968 Bacteria 4141
518 Ga0157379_10243117 3300014968 Bacteria 1633
519 Ga0157379_10253462 3300014968 Unclassified 1598
520 Ga0157379_10413592 3300014968 Bacteria 1241
521 Ga0157379_10521428 3300014968 Bacteria 1103
522 Ga0157379_11400081 3300014968 Unclassified 678
523 Ga0157376_10000297 3300014969 Bacteria 33467
524 Ga0157376_10067191 3300014969 Bacteria 3032
525 Ga0157376_10165811 3300014969 Bacteria 2007
526 Ga0157376_10208667 3300014969 Unclassified 1802
527 Ga0157376_10246081 3300014969 Bacteria 1668
528 Ga0157376_10289609 3300014969 Unclassified 1546
529 Ga0157376_10316532 3300014969 Unclassified 1482
530 Ga0157376_10561322 3300014969 Bacteria 1131
531 Ga0157376_10984397 3300014969 Bacteria 865
532 Ga0157376_11255830 3300014969 Bacteria 770
533 Ga0157376_11538255 3300014969 Unclassified 699
534 Ga0157376_11851269 3300014969 Bacteria 640
535 Ga0157376_11999351 3300014969 Unclassified 617
536 Ga0182006_1016995 3300015261 Bacteria 3097
537 Ga0182006_1022981 3300015261 Bacteria 2585
538 Ga0182006_1030285 3300015261 Bacteria 2187
539 Ga0182006_1039993 3300015261 Bacteria 1847
540 Ga0182005_1000023 3300015265 Bacteria 246328
541 Ga0163161_10000950 3300017792 Bacteria 22231
542 Ga0163161_10012778 3300017792 Bacteria 5832
543 Ga0163161_10023840 3300017792 Unclassified 4318
544 Ga0163161_10027586 3300017792 Bacteria 4030
545 Ga0163161_10521882 3300017792 Bacteria 970
546 Ga0163161_10575626 3300017792 Bacteria 926
547 Ga0163161_10820570 3300017792 Bacteria 783
548 Ga0163161_11417688 3300017792 Unclassified 607
549 Ga0213872_10311097 3300021361 Bacteria 652
550 Ga0213876_10018117 3300021384 Bacteria 3716
551 Ga0224712_10579150 3300022467 Bacteria 547
552 Ga0209436_105918 3300025208 Bacteria 2743
553 Ga0209436_106670 3300025208 Bacteria 2501
554 Ga0209258_100068 3300025242 Bacteria 286288
555 Ga0209258_106914 3300025242 Bacteria 1725
556 Ga0209646_1000003 3300025246 Bacteria 1160860
557 Ga0209646_1000557 3300025246 Bacteria 15708
558 Ga0209646_1019006 3300025246 Bacteria 1002
559 Ga0209026_1001293 3300025250 Bacteria 11348
560 Ga0209148_1000182 3300025254 Bacteria 123558
561 Ga0209129_1007827 3300025258 Bacteria 3090
562 Ga0209565_1017147 3300025263 Bacteria 1593
563 Ga0209673_1000194 3300025273 Bacteria 122640
564 Ga0209130_1001652 3300025284 Bacteria 13642
565 Ga0209675_1034967 3300025291 Bacteria 1150
566 Ga0209758_1008229 3300025297 Bacteria 6829
567 Ga0209758_1035014 3300025297 Bacteria 1985
568 Ga0209050_1000765 3300025298 Bacteria 46179
569 Ga0207426_1000051 3300025302 Bacteria 391700
570 Ga0207426_1000803 3300025302 Bacteria 33968
571 Ga0207426_1002657 3300025302 Bacteria 10981
572 Ga0209257_1000025 3300025304 Bacteria 724838
573 Ga0209257_1001800 3300025304 Bacteria 23517
574 Ga0207697_10016125 3300025315 Bacteria 3081
575 Ga0207697_10120607 3300025315 Archaea 1128
576 Ga0207697_10436429 3300025315 Bacteria 581
577 Ga0207696_1111166 3300025711 Bacteria 742
578 Ga0207655_1000038 3300025728 Bacteria 348340
579 Ga0207682_10357956 3300025893 Bacteria 688
580 Ga0207710_10001860 3300025900 Bacteria 10160
581 Ga0207688_10126651 3300025901 Bacteria 1494
582 Ga0207688_10255433 3300025901 Unclassified 1062
583 Ga0207680_10013020 3300025903 Bacteria 4256
584 Ga0207680_10016456 3300025903 Bacteria 3883
585 Ga0207680_10072487 3300025903 Bacteria 2138
586 Ga0207680_10443534 3300025903 Archaea 921
587 Ga0207647_10011770 3300025904 Bacteria 6120
588 Ga0207647_10028201 3300025904 Bacteria 3650
589 Ga0207647_10116839 3300025904 Bacteria 1575
590 Ga0207647_10128429 3300025904 Unclassified 1491
591 Ga0207647_10166452 3300025904 Bacteria 1285
592 Ga0207647_10452058 3300025904 Unclassified 720
593 Ga0207685_10080434 3300025905 Unclassified 1347
594 Ga0207699_10382682 3300025906 Unclassified 999
595 Ga0207645_10000716 3300025907 Bacteria 27613
596 Ga0207645_10024624 3300025907 Bacteria 3899
597 Ga0207645_10188597 3300025907 Bacteria 1354
598 Ga0207643_10148166 3300025908 Bacteria 1405
599 Ga0207705_10015509 3300025909 Bacteria 5468
600 Ga0207705_10128970 3300025909 Unclassified 1881
601 Ga0207705_10834983 3300025909 Bacteria 715
602 Ga0207654_10000765 3300025911 Bacteria 17701
603 Ga0207654_10002286 3300025911 Bacteria 9822
604 Ga0207654_10667864 3300025911 Bacteria 745
605 Ga0207654_10976761 3300025911 Archaea 615
606 Ga0207654_11110138 3300025911 Unclassified 576
607 Ga0207707_10000317 3300025912 Bacteria 50861
608 Ga0207707_10032387 3300025912 Unclassified 4575
609 Ga0207707_11514523 3300025912 Bacteria 531
610 Ga0207695_10000130 3300025913 Bacteria 224214
611 Ga0207695_10000170 3300025913 Bacteria 192469
612 Ga0207695_10001252 3300025913 Bacteria 43328
613 Ga0207695_10003385 3300025913 Bacteria 22535
614 Ga0207695_10005660 3300025913 Bacteria 16495
615 Ga0207695_10014637 3300025913 Bacteria 9277
616 Ga0207695_10019730 3300025913 Bacteria 7751
617 Ga0207695_10082396 3300025913 Bacteria 3253
618 Ga0207695_10122313 3300025913 Bacteria 2569
619 Ga0207695_10146013 3300025913 Bacteria 2309
620 Ga0207695_10496260 3300025913 Bacteria 1103
621 Ga0207695_10781442 3300025913 Bacteria 835
622 Ga0207671_10003613 3300025914 Bacteria 15278
623 Ga0207671_10006005 3300025914 Bacteria 10980
624 Ga0207671_10007695 3300025914 Bacteria 9302
625 Ga0207671_10050128 3300025914 Unclassified 3091
626 Ga0207671_10099825 3300025914 Bacteria 2197
627 Ga0207671_10334900 3300025914 Bacteria 1199
628 Ga0207671_10511850 3300025914 Bacteria 957
629 Ga0207660_10001972 3300025917 Bacteria 13679
630 Ga0207662_10045504 3300025918 Bacteria 2594
631 Ga0207662_10271871 3300025918 Bacteria 1119
632 Ga0207657_10115523 3300025919 Bacteria 2212
633 Ga0207657_10194543 3300025919 Bacteria 1634
634 Ga0207649_10012710 3300025920 Bacteria 4679
635 Ga0207652_10000456 3300025921 Bacteria 42137
636 Ga0207694_10010257 3300025924 Bacteria 7064
637 Ga0207694_10246202 3300025924 Unclassified 1462
638 Ga0207694_10326039 3300025924 Unclassified 1268
639 Ga0207694_10461571 3300025924 Bacteria 1061
640 Ga0207694_10554200 3300025924 Bacteria 965
641 Ga0207650_10061157 3300025925 Bacteria 2811
642 Ga0207650_10110693 3300025925 Bacteria 2125
643 Ga0207650_10630446 3300025925 Bacteria 903
644 Ga0207659_10218326 3300025926 Bacteria 1531
645 Ga0207659_10737889 3300025926 Unclassified 844
646 Ga0207659_11515077 3300025926 Bacteria 573
647 Ga0207659_11792454 3300025926 Unclassified 521
648 Ga0207644_10084955 3300025931 Bacteria 2347
649 Ga0207644_10109732 3300025931 Bacteria 2085
650 Ga0207644_10210051 3300025931 Bacteria 1539
651 Ga0207644_10224539 3300025931 Unclassified 1490
652 Ga0207644_10520692 3300025931 Bacteria 982
653 Ga0207690_10023014 3300025932 Bacteria 3883
654 Ga0207690_10741747 3300025932 Archaea 809
655 Ga0207706_10002658 3300025933 Bacteria 17397
656 Ga0207706_10014472 3300025933 Bacteria 7151
657 Ga0207706_10014939 3300025933 Bacteria 7032
658 Ga0207706_10065352 3300025933 Bacteria 3203
659 Ga0207706_10244841 3300025933 Unclassified 1567
660 Ga0207706_10763496 3300025933 Unclassified 823
661 Ga0207686_10217870 3300025934 Bacteria 1376
662 Ga0207686_10801010 3300025934 Bacteria 755
663 Ga0207670_10015308 3300025936 Bacteria 4580
664 Ga0207670_10870212 3300025936 Bacteria 753
665 Ga0207669_10562061 3300025937 Unclassified 922
666 Ga0207669_10953948 3300025937 Bacteria 719
667 Ga0207704_10001715 3300025938 Bacteria 9809
668 Ga0207704_10055030 3300025938 Bacteria 2429
669 Ga0207704_10087633 3300025938 Bacteria 2034
670 Ga0207704_10174063 3300025938 Unclassified 1547
671 Ga0207691_10000013 3300025940 Bacteria 147349
672 Ga0207691_10016423 3300025940 Bacteria 7028
673 Ga0207691_10044291 3300025940 Bacteria 4097
674 Ga0207691_10533510 3300025940 Unclassified 996
675 Ga0207691_10950959 3300025940 Bacteria 718
676 Ga0207711_10121595 3300025941 Bacteria 2331
677 Ga0207711_11557490 3300025941 Unclassified 604
678 Ga0207689_10004605 3300025942 Bacteria 12472
679 Ga0207689_10011865 3300025942 Bacteria 7466
680 Ga0207689_10037638 3300025942 Bacteria 4012
681 Ga0207689_10111224 3300025942 Bacteria 2251
682 Ga0207689_10132759 3300025942 Bacteria 2049
683 Ga0207689_11013559 3300025942 Unclassified 700
684 Ga0207661_10015513 3300025944 Bacteria 5608
685 Ga0207661_10019534 3300025944 Bacteria 5054
686 Ga0207661_10031717 3300025944 Bacteria 4086
687 Ga0207661_10704745 3300025944 Bacteria 929
688 Ga0207679_10020993 3300025945 Bacteria 4419
689 Ga0207679_10022054 3300025945 Bacteria 4330
690 Ga0207679_10161133 3300025945 Unclassified 1837
691 Ga0207679_10682508 3300025945 Bacteria 931
692 Ga0207679_10689972 3300025945 Bacteria 926
693 Ga0207667_10000876 3300025949 Bacteria 38469
694 Ga0207667_10005154 3300025949 Bacteria 15964
695 Ga0207667_10010158 3300025949 Bacteria 11026
696 Ga0207667_10039331 3300025949 Bacteria 5042
697 Ga0207667_10050854 3300025949 Bacteria 4371
698 Ga0207667_10053350 3300025949 Bacteria 4255
699 Ga0207667_10474131 3300025949 Bacteria 1271
700 Ga0207667_10881920 3300025949 Bacteria 887
701 Ga0207667_10916014 3300025949 Unclassified 868
702 Ga0207651_10000468 3300025960 Bacteria 17037
703 Ga0207651_10019959 3300025960 Bacteria 4032
704 Ga0207651_10090796 3300025960 Bacteria 2234
705 Ga0207712_10019045 3300025961 Bacteria 4478
706 Ga0207712_10029238 3300025961 Bacteria 3694
707 Ga0207712_10061839 3300025961 Bacteria 2659
708 Ga0207712_10915753 3300025961 Bacteria 775
709 Ga0207712_11037252 3300025961 Bacteria 728
710 Ga0207668_10000295 3300025972 Bacteria 32756
711 Ga0207668_10462652 3300025972 Bacteria 1085
712 Ga0207668_10732966 3300025972 Bacteria 871
713 Ga0207668_10839937 3300025972 Unclassified 815
714 Ga0207668_10908612 3300025972 Bacteria 784
715 Ga0207640_10022361 3300025981 Bacteria 3783
716 Ga0207640_10112734 3300025981 Bacteria 1931
717 Ga0207640_10248673 3300025981 Bacteria 1379
718 Ga0207658_10005989 3300025986 Bacteria 8313
719 Ga0207658_10039948 3300025986 Bacteria 3388
720 Ga0207658_10132740 3300025986 Bacteria 2003
721 Ga0207658_10136739 3300025986 Bacteria 1977
722 Ga0207658_10374134 3300025986 Bacteria 1246
723 Ga0207658_10532619 3300025986 Bacteria 1049
724 Ga0207658_10699936 3300025986 Bacteria 916
725 Ga0207658_11101638 3300025986 Unclassified 725
726 Ga0207658_11116102 3300025986 Unclassified 720
727 Ga0207677_10002177 3300026023 Bacteria 10299
728 Ga0207677_10020249 3300026023 Bacteria 4035
729 Ga0207677_10048097 3300026023 Bacteria 2869
730 Ga0207677_10054092 3300026023 Bacteria 2737
731 Ga0207677_10123314 3300026023 Unclassified 1953
732 Ga0207677_10894324 3300026023 Bacteria 800
733 Ga0207703_10001005 3300026035 Bacteria 27079
734 Ga0207703_10166712 3300026035 Bacteria 1934
735 Ga0207703_10421325 3300026035 Unclassified 1242
736 Ga0207703_10695737 3300026035 Bacteria 966
737 Ga0207639_10001884 3300026041 Bacteria 14093
738 Ga0207639_10009995 3300026041 Bacteria 6558
739 Ga0207639_10079293 3300026041 Bacteria 2595
740 Ga0207639_10130798 3300026041 Bacteria 2077
741 Ga0207639_10238583 3300026041 Unclassified 1579
742 Ga0207639_10329654 3300026041 Unclassified 1358
743 Ga0207639_10347899 3300026041 Bacteria 1323
744 Ga0207639_10687348 3300026041 Bacteria 949
745 Ga0207639_11082349 3300026041 Bacteria 752
746 Ga0207639_11233658 3300026041 Unclassified 702
747 Ga0207639_11877624 3300026041 Bacteria 560
748 Ga0207678_10169409 3300026067 Bacteria 1864
749 Ga0207678_10874452 3300026067 Unclassified 794
750 Ga0207702_10074911 3300026078 Bacteria 2923
751 Ga0207702_11613979 3300026078 Bacteria 642
752 Ga0207641_10005007 3300026088 Bacteria 11359
753 Ga0207641_10013024 3300026088 Bacteria 6821
754 Ga0207641_10480945 3300026088 Unclassified 1203
755 Ga0207641_10755342 3300026088 Unclassified 960
756 Ga0207641_10920700 3300026088 Bacteria 869
757 Ga0207641_10934364 3300026088 Unclassified 862
758 Ga0207641_11556071 3300026088 Bacteria 663
759 Ga0207648_10006608 3300026089 Bacteria 11516
760 Ga0207648_10019286 3300026089 Bacteria 6156
761 Ga0207648_10088214 3300026089 Bacteria 2708
762 Ga0207648_10119591 3300026089 Unclassified 2315
763 Ga0207648_10151451 3300026089 Unclassified 2047
764 Ga0207648_10292252 3300026089 Unclassified 1459
765 Ga0207648_10320205 3300026089 Unclassified 1393
766 Ga0207648_10576955 3300026089 Bacteria 1035
767 Ga0207648_11697011 3300026089 Unclassified 593
768 Ga0207676_10016838 3300026095 Bacteria 5293
769 Ga0207676_10024521 3300026095 Bacteria 4465
770 Ga0207676_10025761 3300026095 Bacteria 4366
771 Ga0207676_10038335 3300026095 Bacteria 3657
772 Ga0207676_10051614 3300026095 Bacteria 3211
773 Ga0207676_10512360 3300026095 Bacteria 1141
774 Ga0207674_10002964 3300026116 Bacteria 21086
775 Ga0207674_10007545 3300026116 Bacteria 12670
776 Ga0207674_10019908 3300026116 Bacteria 7261
777 Ga0207674_10152379 3300026116 Bacteria 2268
778 Ga0207674_10517136 3300026116 Bacteria 1153
779 Ga0207674_10627852 3300026116 Bacteria 1038
780 Ga0207674_11580605 3300026116 Bacteria 624
781 Ga0207675_100135163 3300026118 Bacteria 2339
782 Ga0207675_100268394 3300026118 Bacteria 1655
783 Ga0207675_100321928 3300026118 Bacteria 1510
784 Ga0207683_10045175 3300026121 Bacteria 3851
785 Ga0207683_10060212 3300026121 Bacteria 3337
786 Ga0207683_10233766 3300026121 Bacteria 1676
787 Ga0207683_10747903 3300026121 Bacteria 907
788 Ga0207683_11204266 3300026121 Unclassified 702
789 Ga0207698_10078635 3300026142 Unclassified 2649
790 Ga0207698_10113740 3300026142 Bacteria 2275
791 Ga0207698_10242966 3300026142 Bacteria 1642
792 Ga0207698_10266884 3300026142 Unclassified 1575
793 Ga0207698_10963147 3300026142 Bacteria 863
794 Ga0207698_12338779 3300026142 Bacteria 546
795 Ga0209281_1000570 3300027111 Bacteria 44049
796 Ga0209969_1046382 3300027360 Bacteria 679
797 Ga0209968_1001511 3300027526 Bacteria 3533
798 Ga0209999_1029439 3300027543 Bacteria 1019
799 Ga0209999_1059873 3300027543 Bacteria 724
800 Ga0209282_1010717 3300027666 Bacteria 5805
801 Ga0209971_1168392 3300027682 Bacteria 540
802 Ga0209974_10055137 3300027876 Bacteria 1340
803 Ga0268266_10000024 3300028379 Bacteria 490820
804 Ga0268266_10003677 3300028379 Bacteria 15140
805 Ga0268266_10007487 3300028379 Bacteria 9843
806 Ga0268265_10471789 3300028380 Bacteria 1177
807 Ga0268264_10000109 3300028381 Bacteria 208477
808 Ga0268264_10009730 3300028381 Bacteria 7958
809 Ga0268264_10014974 3300028381 Bacteria 6365
810 Ga0268264_10106766 3300028381 Unclassified 2445
811 Ga0268264_10386704 3300028381 Bacteria 1341
812 Ga0268264_10850421 3300028381 Bacteria 914
813 Ga0307517_10004572 3300028786 Bacteria 21214
814 Ga0307515_10000010 3300028794 Bacteria 651586
815 Ga0307515_10102798 3300028794 Bacteria 3433
816 Ga0265324_10182885 3300029957 Bacteria 712
817 Ga0307511_10000455 3300030521 Bacteria 44094
818 Ga0316177_1021152 3300030731 Bacteria 699
819 Ga0316179_1081379 3300030734 Bacteria 2559
820 Ga0265327_10000009 3300031251 Bacteria 616360
821 Ga0265327_10000219 3300031251 Bacteria 116606
822 Ga0265327_10004167 3300031251 Bacteria 13044
823 Ga0265316_10138506 3300031344 Bacteria 1830
824 Ga0307509_10079477 3300031507 Bacteria 3395
825 Ga0307408_100002005 3300031548 Bacteria 14705
826 Ga0265313_10054220 3300031595 Bacteria 1905
827 Ga0307508_10266298 3300031616 Bacteria 1308
828 Ga0307516_10286305 3300031730 Bacteria 1328
829 Ga0307405_11624296 3300031731 Bacteria 571
830 Ga0307405_11949210 3300031731 Bacteria 525
831 Ga0307413_10000274 3300031824 Bacteria 15735
832 Ga0307413_10212917 3300031824 Bacteria 1405
833 Ga0307413_11632368 3300031824 Bacteria 573
834 Ga0307410_10000048 3300031852 Bacteria 42322
835 Ga0307410_10366619 3300031852 Bacteria 1155
836 Ga0307406_10000004 3300031901 Bacteria 179772
837 Ga0307406_10207111 3300031901 Bacteria 1448
838 Ga0307407_10084970 3300031903 Bacteria 1924
839 Ga0307416_100003753 3300032002 Bacteria 9013
840 Ga0307414_10000051 3300032004 Bacteria 127567
841 Ga0307414_10001420 3300032004 Bacteria 12435
842 Ga0307414_10045305 3300032004 Bacteria 3011
843 Ga0307414_10319570 3300032004 Bacteria 1321
844 Ga0307414_10836380 3300032004 Bacteria 841
845 Ga0307414_11773549 3300032004 Bacteria 576
846 Ga0307411_10000020 3300032005 Bacteria 75190
847 Ga0307411_10025263 3300032005 Bacteria 3557
848 Ga0307411_11028116 3300032005 Unclassified 739
849 Ga0307415_102068937 3300032126 Bacteria 555
850 Ga0307507_10486053 3300033179 Bacteria 670
851 Ga0307510_10038492 3300033180 Bacteria 5287
852 Ga0307510_10047929 3300033180 Bacteria 4567
853 Ga0373934_0225434 3300035086 Bacteria 773
854 Ga0373944_0175204 3300035089 Bacteria 767
855 Ga0373936_0318064 3300035113 Bacteria 705
856 Ga0373939_0180524 3300035114 Bacteria 787
857 Ga0373941_0295771 3300035115 Bacteria 645
858 Ga0373954_0099197 3300035118 Bacteria 1404
859 Ga0373955_0120482 3300035172 Bacteria 1525
860 Ga0373935_0216448 3300035692 Bacteria 1329
861 Ga0373935_0575918 3300035692 Bacteria 822
862 Ga0373927_0045920 3300035695 Bacteria 2827
863 Ga0373933_0235715 3300035724 Bacteria 1176
864 Ga0373937_0043690 3300036401 Bacteria 4092
865 Ga0373937_0474512 3300036401 Bacteria 1188
866 Ga0373925_0540967 3300037068 Bacteria 958
867 Ga0436365_0090513 3300039437 Bacteria 14251
868 Ga0436361_0102070 3300039447 Bacteria 2568
869 Ga0439436_0006422 3300041404 Bacteria 3611
870 Ga0439439_0221112 3300041406 Bacteria 555
871 Ga0439447_001368 3300041407 Bacteria 8913
872 Ga0439466_0001833 3300041411 Bacteria 8335
873 Ga0439466_0015264 3300041411 Bacteria 2791
874 Ga0439465_0093575 3300041413 Bacteria 1031
875 Ga0451787_098082 3300041441 Bacteria 712
876 Ga0451793_0847059 3300041452 Bacteria 553
877 Ga0451797_0679504 3300041453 Bacteria 950
878 Ga0451795_0707805 3300041456 Bacteria 674
879 Ga0451800_1624960 3300041459 Bacteria 849
880 Ga0451802_0508158 3300041460 Bacteria 1185
881 Ga0451802_1818999 3300041460 Bacteria 1584
882 Ga0451807_0677323 3300041486 Bacteria 531
883 Ga0451833_1095634 3300041491 Bacteria 782
884 Ga0451835_0691656 3300041492 Bacteria 1114
885 Ga0451837_1190987 3300041494 Bacteria 584
886 Ga0451841_0596099 3300041498 Bacteria 721
887 Ga0451851_0019816 3300041507 Bacteria 1080
888 Ga0451855_0703264 3300041511 Bacteria 558
889 Ga0451853_1034895 3300041512 Bacteria 1528
890 Ga0439431_0001740 3300041997 Bacteria 4797
891 Ga0439431_0022343 3300041997 Bacteria 1524
892 Ga0439449_0040120 3300042007 Bacteria 1741
893 Ga0439457_003389 3300042014 Bacteria 4336
894 Ga0439462_0014919 3300042015 Bacteria 2000
895 Ga0451577_0009728 3300042876 Bacteria 9218
896 Ga0451577_0147917 3300042876 Bacteria 2113
897 Ga0451577_0204822 3300042876 Bacteria 1781
898 Ga0451577_0548777 3300042876 Bacteria 1049
899 Ga0451577_0894456 3300042876 Unclassified 800
900 Ga0451577_1634822 3300042876 Bacteria 568
901 Ga0466969_0000149 3300044656 Bacteria 37747
902 Ga0466969_0055902 3300044656 Bacteria 1929
903 Ga0466972_0000013 3300044658 Bacteria 229345
904 Ga0466972_0009022 3300044658 Bacteria 5005
905 Ga0466972_0055893 3300044658 Bacteria 1898
906 Ga0466972_0070919 3300044658 Bacteria 1662
907 Ga0453683_0776247 3300044673 Bacteria 630
908 Ga0466965_0016082 3300044683 Bacteria 3555
909 Ga0466966_0541218 3300044684 Bacteria 701
910 Ga0466961_0018040 3300044693 Bacteria 4538
911 Ga0466964_0013676 3300044706 Bacteria 3080
912 Ga0466964_0110784 3300044706 Bacteria 1224
913 Ga0453684_0054028 3300044712 Bacteria 5237
914 Ga0453684_0192811 3300044712 Bacteria 2382
915 Ga0453684_0462562 3300044712 Unclassified 1410
916 Ga0466971_0043276 3300044719 Bacteria 2024
917 Ga0466971_0410629 3300044719 Unclassified 661
918 Ga0466968_0031740 3300044735 Bacteria 2193
919 Ga0466968_0358445 3300044735 Bacteria 709
920 Ga0466968_0373239 3300044735 Bacteria 696
921 Ga0466970_0101719 3300044765 Bacteria 1565
922 Ga0466970_0112116 3300044765 Bacteria 1490
923 Ga0466970_0214363 3300044765 Bacteria 1073
924 Ga0466957_0001230 3300044842 Bacteria 13374
925 Ga0466957_0008061 3300044842 Bacteria 5976
926 Ga0466957_0207593 3300044842 Bacteria 1289
927 Ga0466957_0281260 3300044842 Bacteria 1114
928 Ga0466959_0000023 3300045049 Bacteria 124545
929 Ga0466959_0002751 3300045049 Bacteria 11327
930 Ga0466959_0032629 3300045049 Bacteria 3854
931 Ga0451576_0345050 3300045051 Bacteria 1559
932 Ga0466958_0033971 3300045836 Bacteria 3041
933 Ga0495627_002397 3300046453 Bacteria 9089
934 Ga0495638_0114742 3300046460 Bacteria 1597
935 Ga0495651_0223746 3300046462 Bacteria 1301
936 Ga0495651_0447595 3300046462 Bacteria 835
937 Ga0495651_0714589 3300046462 Bacteria 624
938 Ga0495653_0152396 3300046463 Bacteria 1614
939 Ga0495653_0828790 3300046463 Bacteria 555
940 Ga0495580_0135454 3300046472 Unclassified 1708
941 Ga0495580_0337634 3300046472 Unclassified 1022
942 Ga0495608_0060018 3300046511 Bacteria 2504
943 Ga0495610_0068951 3300046512 Bacteria 1656
944 Ga0495618_0060481 3300046514 Bacteria 2402
945 Ga0495628_0061099 3300046516 Unclassified 2955
946 Ga0495630_0025827 3300046517 Bacteria 4345
947 Ga0495630_0189077 3300046517 Bacteria 1571
948 Ga0495632_0148631 3300046519 Bacteria 1084
949 Ga0495632_0324580 3300046519 Bacteria 680
950 Ga0495648_0265597 3300046524 Bacteria 821
951 Ga0495640_0703869 3300046533 Bacteria 606
952 Ga0495586_0398048 3300046535 Bacteria 792
953 Ga0495598_0071004 3300046537 Unclassified 1097
954 Ga0495621_0478100 3300046539 Bacteria 536
955 Ga0495645_0732894 3300046543 Bacteria 598
956 Ga0495622_0245260 3300046557 Bacteria 789
957 Ga0495633_0000058 3300046558 Bacteria 147584
958 Ga0495633_0028198 3300046558 Bacteria 2739
959 Ga0495667_0404024 3300046559 Bacteria 860
960 Ga0495667_0673626 3300046559 Bacteria 642
961 Ga0495634_0121772 3300046642 Bacteria 1670
962 Ga0495611_0000883 3300046648 Bacteria 16291
963 Ga0495625_0303361 3300046660 Bacteria 1021
964 Ga0495635_0220148 3300046663 Bacteria 1284
965 Ga0495657_0321763 3300046675 Bacteria 919
966 Ga0495646_0197748 3300046680 Bacteria 1096
967 Ga0495647_0091463 3300046681 Bacteria 1248
968 Ga0495613_0057376 3300046689 Bacteria 2859
969 Ga0495670_0070067 3300046691 Bacteria 1774
970 Ga0495671_0018522 3300046692 Bacteria 3695
971 Ga0495649_0153742 3300046694 Bacteria 1208
972 Ga0495649_0245781 3300046694 Unclassified 920
973 Ga0495674_0221266 3300047319 Bacteria 1565
974 Ga0495674_0429891 3300047319 Bacteria 1063
975 Ga0495674_0443521 3300047319 Bacteria 1044
976 Ga0495672_0015969 3300047320 Bacteria 5083
977 Ga0495672_0071262 3300047320 Bacteria 1967
978 Ga0495672_0172061 3300047320 Bacteria 1104
979 Ga0495680_0454391 3300047322 Bacteria 876
980 Ga0495687_000014 3300047443 Bacteria 366896
981 Ga0495684_0263139 3300047471 Bacteria 1250
982 Ga0495686_0000034 3300047472 Bacteria 325038
983 Ga0495602_0334819 3300048088 Bacteria 1097
984 Ga0496102_0791356 3300048905 Unclassified 871
985 Ga0496108_0642207 3300048911 Bacteria 923
986 Ga0496109_1472235 3300048912 Archaea 616
987 Ga0496114_0153449 3300048917 Bacteria 1999
988 Ga0496116_0000024 3300048919 Bacteria 471420
989 Ga0496117_0099196 3300048920 Bacteria 1849
990 Ga0496118_0017695 3300048921 Bacteria 6471
991 Ga0496121_0000343 3300048924 Bacteria 96972
992 Ga0496121_0592952 3300048924 Bacteria 685
993 Ga0496124_0026742 3300048927 Bacteria 5197
994 Ga0496124_0567710 3300048927 Bacteria 745
995 Ga0496125_0000018 3300048928 Bacteria 482390
996 Ga0496125_0299882 3300048928 Bacteria 985
997 Ga0496126_0015334 3300048929 Bacteria 7711
998 Ga0496126_0129830 3300048929 Bacteria 2178
999 Ga0496126_0884120 3300048929 Bacteria 679
1000 Ga0501314_004831 3300049530 Bacteria 1131
1001 Ga0501323_042247 3300049539 Bacteria 672
1002 Ga0501032_0520407 3300049569 Bacteria 759
1003 Ga0501033_0408860 3300049570 Bacteria 946
1004 Ga0501033_0569298 3300049570 Bacteria 779
1005 Ga0501034_0041587 3300049571 Bacteria 4651
1006 Ga0501034_0076420 3300049571 Bacteria 3355
1007 Ga0501034_0127733 3300049571 Unclassified 2527
1008 Ga0501034_0556429 3300049571 Bacteria 1056
1009 Ga0501036_1119338 3300049572 Bacteria 643
1010 Ga0501037_0101058 3300049573 Bacteria 2082
1011 Ga0501037_0242958 3300049573 Bacteria 1262
1012 Ga0501038_0754453 3300049574 Unclassified 726
1013 Ga0501038_1057760 3300049574 Unclassified 594
1014 Ga0501043_0163965 3300049579 Bacteria 1736
1015 Ga0501043_0169642 3300049579 Bacteria 1703
1016 Ga0501043_0481483 3300049579 Bacteria 929
1017 Ga0501046_0253019 3300049580 Bacteria 1296
1018 Ga0501047_0007483 3300049581 Bacteria 10275
1019 Ga0501047_0013459 3300049581 Bacteria 7754
1020 Ga0501047_0034117 3300049581 Bacteria 4913
1021 Ga0501047_0318956 3300049581 Bacteria 1394
1022 Ga0501047_0847117 3300049581 Unclassified 728
1023 Ga0501048_0393024 3300049582 Bacteria 991
1024 Ga0501048_0481198 3300049582 Bacteria 890
1025 Ga0501067_0020451 3300049583 Bacteria 3664
1026 Ga0501068_0158276 3300049584 Unclassified 1427
1027 Ga0501069_0071502 3300049585 Unclassified 1944
1028 Ga0501070_0350320 3300049586 Unclassified 1198
1029 Ga0501071_0427149 3300049587 Bacteria 1013
1030 Ga0501072_0170211 3300049588 Bacteria 1738
1031 Ga0501073_0032565 3300049589 Unclassified 3716
1032 Ga0501074_0393963 3300049590 Unclassified 982
1033 Ga0501075_0443545 3300049591 Unclassified 990
1034 Ga0501076_1319878 3300049592 Bacteria 593
1035 Ga0501206_015621 3300049653 Bacteria 1052
1036 Ga0501224_032948 3300049664 Bacteria 777
1037 Ga0501238_000137 3300049671 Bacteria 11188
1038 Ga0501249_000008 3300049679 Bacteria 197587
1039 Ga0501249_046621 3300049679 Bacteria 990
1040 Ga0501257_005850 3300049686 Bacteria 2719
1041 Ga0501225_0000104 3300049705 Bacteria 26591
1042 Ga0501225_0268064 3300049705 Bacteria 568
1043 Ga0501079_0239449 3300049741 Unclassified 1418
1044 Ga0501080_0166988 3300049742 Unclassified 2030
1045 Ga0501080_0173150 3300049742 Bacteria 1990
1046 Ga0501080_0459377 3300049742 Unclassified 1141
1047 Ga0501083_0324308 3300049744 Unclassified 1001
1048 Ga0501083_0494973 3300049744 Bacteria 796
1049 Ga0501241_001363 3300049758 Bacteria 5009
1050 Ga0501241_024987 3300049758 Bacteria 1111
1051 Ga0501266_000002 3300049763 Bacteria 459947
1052 Ga0501035_0287587 3300049822 Bacteria 1388
1053 Ga0501035_0670468 3300049822 Bacteria 839
1054 Ga0501035_0735828 3300049822 Bacteria 793
1055 Ga0501044_0008528 3300049823 Bacteria 11230
1056 Ga0501044_0119948 3300049823 Unclassified 2632
1057 Ga0501044_0468793 3300049823 Bacteria 1164
1058 Ga0501044_0520711 3300049823 Bacteria 1089
1059 nmdc:mga0k408_129423_c1 3300050493 Bacteria 1498
1060 nmdc:mga0k408_881244_c1 3300050493 Bacteria 520
1061 nmdc:mga05p37_1165314_c1 3300050507 Bacteria 800
1062 nmdc:mga05p37_19037_c1 3300050507 Bacteria 8304
1063 nmdc:mga05p37_85001_c1 3300050507 Bacteria 3898
1064 nmdc:mga09592_19444_c1 3300050508 Bacteria 5577
1065 nmdc:mga09592_320115_c1 3300050508 Bacteria 1344
1066 nmdc:mga0qj67_117394_c1 3300050509 Bacteria 2151
1067 nmdc:mga0qj67_220327_c1 3300050509 Bacteria 1540
1068 nmdc:mga06r32_87315_c1 3300050510 Bacteria 3043
1069 nmdc:mga08y16_1891338_c1 3300050511 Bacteria 548
1070 nmdc:mga08y16_295496_c1 3300050511 Bacteria 1670
1071 nmdc:mga0n895_1405155_c1 3300050512 Bacteria 666
1072 nmdc:mga0rr50_1385595_c1 3300050513 Unclassified 595
1073 Ga0495619_0026132 3300053085 Bacteria 3755
1074 Ga0495619_1084585 3300053085 Bacteria 533
1075 Ga0500578_0000155 3300053086 Bacteria 80380
1076 Ga0500578_0025346 3300053086 Bacteria 3806
1077 Ga0500578_0476921 3300053086 Bacteria 706
1078 Ga0500644_0000900 3300053088 Bacteria 9535
1079 Ga0500644_0104298 3300053088 Bacteria 1082
1080 Ga0500644_0433852 3300053088 Bacteria 575
1081 Ga0500581_347230 3300053089 Bacteria 564
1082 Ga0500646_0005321 3300053090 Bacteria 3253
1083 Ga0500646_0008848 3300053090 Bacteria 2579
1084 Ga0500646_0015297 3300053090 Bacteria 1997
1085 Ga0500646_0065725 3300053090 Bacteria 1077
1086 Ga0500647_0349435 3300053091 Bacteria 616
1087 Ga0500583_0000043 3300053092 Bacteria 81313
1088 Ga0500583_0000936 3300053092 Bacteria 8306
1089 Ga0500583_0012195 3300053092 Bacteria 3269
1090 Ga0500651_0102482 3300053093 Bacteria 1754
1091 Ga0500651_0132295 3300053093 Bacteria 1508
1092 Ga0500651_0409219 3300053093 Bacteria 761
1093 Ga0500641_0000008 3300053096 Bacteria 174314
1094 Ga0500641_0108557 3300053096 Bacteria 1193
1095 Ga0500554_023107 3300053102 Bacteria 1745
1096 Ga0500569_334284 3300053109 Bacteria 506
1097 Ga0500592_003352 3300053116 Bacteria 2557
1098 Ga0500642_0051616 3300053130 Bacteria 1818
1099 Ga0500652_002832 3300053131 Bacteria 5239
1100 Ga0500655_044110 3300053133 Bacteria 879
1101 Ga0500658_0000002 3300053134 Bacteria 548440
1102 Ga0500658_0000550 3300053134 Bacteria 15772
1103 Ga0500658_0204766 3300053134 Bacteria 903
1104 Ga0500559_0022943 3300053136 Bacteria 2648
1105 Ga0500568_0004276 3300053139 Bacteria 7671
1106 Ga0500573_0191533 3300053140 Bacteria 1092
1107 Ga0500573_0391559 3300053140 Bacteria 661
1108 Ga0500577_0005752 3300053142 Bacteria 3369
1109 Ga0500589_021847 3300053147 Bacteria 2939
1110 Ga0500590_143916 3300053148 Bacteria 1085
1111 Ga0500616_0023882 3300053153 Bacteria 3402
1112 Ga0500616_0058494 3300053153 Bacteria 2005
1113 Ga0500616_0146079 3300053153 Unclassified 1100
1114 Ga0500622_0000841 3300053156 Bacteria 26265
1115 Ga0500622_0007178 3300053156 Bacteria 6352
1116 Ga0500622_0029703 3300053156 Bacteria 2872
1117 Ga0500622_0099070 3300053156 Bacteria 1438
1118 Ga0500622_0198805 3300053156 Bacteria 913
1119 Ga0500633_0009087 3300053160 Bacteria 2596
1120 Ga0500634_0119396 3300053161 Bacteria 1286
1121 Ga0500636_0070130 3300053177 Bacteria 2034
1122 Ga0500636_0147365 3300053177 Bacteria 1296
1123 Ga0500637_0257405 3300053178 Bacteria 971
1124 Ga0500637_0434532 3300053178 Bacteria 671
1125 Ga0500584_085375 3300053726 Bacteria 1339
1126 Ga0500611_000077 3300053727 Bacteria 38126
1127 Ga0500656_070997 3300053732 Bacteria 536
1128 Ga0500587_011321 3300053739 Bacteria 1128
1129 Ga0501084_0000686 3300054114 Bacteria 25875
1130 Ga0500661_008389 3300055283 Bacteria 1901
1131 Ga0501082_0046764 3300060353 Bacteria 3729
1132 Ga0466962_0402373 3300061719 Bacteria 686

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10065352 Ga0207706_100653523 94
2 3300053726 Ga0500584_085375 Ga0500584_085375_977_1309 100
3 3300041456 Ga0451795_0707805 Ga0451795_0707805_235_576 103
4 3300050493 nmdc:mga0k408_881244_c1 nmdc:mga0k408_881244_c1_149_505 103
5 3300005434 Ga0070709_10352906 Ga0070709_103529062 104
6 3300006871 Ga0075434_100878950 Ga0075434_1008789502 104
7 3300050513 nmdc:mga0rr50_1385595_c1 nmdc:mga0rr50_1385595_c1_122_535 104
8 iso_pu_bacteria 2818991442 2819572541 104
9 3300041452 Ga0451793_0847059 Ga0451793_0847059_137_493 107
10 3300003320 rootH2_10069067 rootH2_100690672 108
11 3300003761 Ga0055535_1001390 Ga0055535_10013908 108
12 3300005262 Ga0065165_1013242 Ga0065165_10132423 108
13 3300005338 Ga0068868_100190467 Ga0068868_1001904671 108
14 3300005367 Ga0070667_100142222 Ga0070667_1001422222 108
15 3300005577 Ga0068857_100694775 Ga0068857_1006947751 108
16 3300005834 Ga0068851_10999926 Ga0068851_109999261 108
17 3300005842 Ga0068858_100333051 Ga0068858_1003330513 108
18 3300005843 Ga0068860_100156155 Ga0068860_1001561552 108
19 3300013307 Ga0157372_10232821 Ga0157372_102328213 108
20 3300025208 Ga0209436_106670 Ga0209436_1066702 108
21 3300025242 Ga0209258_100068 Ga0209258_100068194 108
22 3300025246 Ga0209646_1019006 Ga0209646_10190062 108
23 3300025254 Ga0209148_1000182 Ga0209148_100018240 108
24 3300025903 Ga0207680_10016456 Ga0207680_100164563 108
25 3300025904 Ga0207647_10128429 Ga0207647_101284292 108
26 3300025912 Ga0207707_11514523 Ga0207707_115145232 108
27 3300025913 Ga0207695_10014637 Ga0207695_100146375 108
28 3300025913 Ga0207695_10781442 Ga0207695_107814422 108
29 3300025914 Ga0207671_10007695 Ga0207671_100076956 108
30 3300025914 Ga0207671_10050128 Ga0207671_100501283 108
31 3300025924 Ga0207694_10246202 Ga0207694_102462022 108
32 3300025949 Ga0207667_10916014 Ga0207667_109160142 108
33 3300025961 Ga0207712_11037252 Ga0207712_110372521 108
34 3300025986 Ga0207658_10132740 Ga0207658_101327402 108
35 3300025986 Ga0207658_10374134 Ga0207658_103741342 108
36 3300026116 Ga0207674_10152379 Ga0207674_101523793 108
37 3300028381 Ga0268264_10106766 Ga0268264_101067663 108
38 3300032004 Ga0307414_10319570 Ga0307414_103195702 108
39 3300033180 Ga0307510_10038492 Ga0307510_100384922 108
40 3300044735 Ga0466968_0358445 Ga0466968_0358445_321_689 108
41 3300046557 Ga0495622_0245260 Ga0495622_0245260_173_544 108
42 3300049571 Ga0501034_0041587 Ga0501034_0041587_426_794 108
43 3300049574 Ga0501038_0754453 Ga0501038_0754453_249_617 108
44 3300049742 Ga0501080_0459377 Ga0501080_0459377_634_1002 108
45 3300053088 Ga0500644_0000900 Ga0500644_0000900_8900_9271 108
46 3300053109 Ga0500569_334284 Ga0500569_334284_115_486 108
47 3300053148 Ga0500590_143916 Ga0500590_143916_557_928 108
48 3300053160 Ga0500633_0009087 Ga0500633_0009087_1254_1625 108
49 3300053161 Ga0500634_0119396 Ga0500634_0119396_475_846 108
50 3300053177 Ga0500636_0147365 Ga0500636_0147365_482_853 108
51 3300003316 rootH1_10162132 rootH1_101621322 110
52 3300003322 rootL2_10157657 rootL2_101576572 110
53 3300003794 Ga0055531_10000293 Ga0055531_1000029319 110
54 3300025304 Ga0209257_1000025 Ga0209257_1000025413 110
55 3300053156 Ga0500622_0000841 Ga0500622_0000841_14447_14824 110
56 3300049573 Ga0501037_0242958 Ga0501037_0242958_549_929 111
57 3300049581 Ga0501047_0007483 Ga0501047_0007483_7202_7582 111
58 3300049822 Ga0501035_0670468 Ga0501035_0670468_158_538 111
59 3300005335 Ga0070666_10833202 Ga0070666_108332021 114
60 3300005356 Ga0070674_100105333 Ga0070674_1001053332 114
61 3300009094 Ga0111539_10370989 Ga0111539_103709892 114
62 3300009148 Ga0105243_10811845 Ga0105243_108118452 114
63 3300009174 Ga0105241_11464025 Ga0105241_114640251 114
64 3300009176 Ga0105242_10620320 Ga0105242_106203201 114
65 3300009177 Ga0105248_11092318 Ga0105248_110923181 114
66 3300013297 Ga0157378_10035729 Ga0157378_100357292 114
67 3300013306 Ga0163162_11643045 Ga0163162_116430452 114
68 3300013308 Ga0157375_10442997 Ga0157375_104429972 114
69 3300014326 Ga0157380_10590989 Ga0157380_105909891 114
70 3300014745 Ga0157377_10114748 Ga0157377_101147482 114
71 3300025901 Ga0207688_10255433 Ga0207688_102554332 114
72 3300025937 Ga0207669_10562061 Ga0207669_105620611 114
73 3300035115 Ga0373941_0295771 Ga0373941_0295771_97_483 114
74 3300049570 Ga0501033_0408860 Ga0501033_0408860_93_479 114
75 3300005330 Ga0070690_100664657 Ga0070690_1006646572 115
76 3300005334 Ga0068869_101706480 Ga0068869_1017064801 115
77 3300005347 Ga0070668_101953411 Ga0070668_1019534111 115
78 3300005456 Ga0070678_100211589 Ga0070678_1002115892 115
79 3300005459 Ga0068867_100188411 Ga0068867_1001884113 115
80 3300005578 Ga0068854_101143516 Ga0068854_1011435162 115
81 3300005617 Ga0068859_101719357 Ga0068859_1017193571 115
82 3300005618 Ga0068864_100166775 Ga0068864_1001667752 115
83 3300005719 Ga0068861_101188356 Ga0068861_1011883562 115
84 3300006237 Ga0097621_100142701 Ga0097621_1001427012 115
85 3300006358 Ga0068871_100206810 Ga0068871_1002068103 115
86 3300006881 Ga0068865_101298927 Ga0068865_1012989272 115
87 3300006931 Ga0097620_101718841 Ga0097620_1017188412 115
88 3300009176 Ga0105242_10470819 Ga0105242_104708192 115
89 3300013306 Ga0163162_10524871 Ga0163162_105248713 115
90 3300013308 Ga0157375_10075317 Ga0157375_100753173 115
91 3300014969 Ga0157376_10561322 Ga0157376_105613222 115
92 3300017792 Ga0163161_10521882 Ga0163161_105218822 115
93 3300025907 Ga0207645_10188597 Ga0207645_101885972 115
94 3300025925 Ga0207650_10630446 Ga0207650_106304461 115
95 3300025926 Ga0207659_10218326 Ga0207659_102183262 115
96 3300025934 Ga0207686_10217870 Ga0207686_102178703 115
97 3300025937 Ga0207669_10953948 Ga0207669_109539482 115
98 3300025972 Ga0207668_10908612 Ga0207668_109086122 115
99 3300025986 Ga0207658_10699936 Ga0207658_106999361 115
100 3300026089 Ga0207648_10088214 Ga0207648_100882143 115
101 3300026095 Ga0207676_10024521 Ga0207676_100245212 115
102 3300026121 Ga0207683_10233766 Ga0207683_102337662 115
103 iso_pu_bacteria 2818991460 2819680691 115
104 iso_pu_bacteria 2884791551 2884795430 115
105 iso_pu_bacteria 2929177148 2929178994 115
106 iso_pu_bacteria 2945977869 2945981397 115
107 iso_pu_bacteria 2946013367 2946019204 115
108 3300003320 rootH2_10078664 rootH2_100786642 116
109 3300005289 Ga0065704_10268353 Ga0065704_102683532 116
110 3300005295 Ga0065707_10123533 Ga0065707_101235331 116
111 3300005328 Ga0070676_10029768 Ga0070676_100297684 116
112 3300005328 Ga0070676_10148793 Ga0070676_101487932 116
113 3300005329 Ga0070683_100005538 Ga0070683_1000055388 116
114 3300005329 Ga0070683_100073580 Ga0070683_1000735804 116
115 3300005329 Ga0070683_100257331 Ga0070683_1002573314 116
116 3300005330 Ga0070690_100032678 Ga0070690_1000326784 116
117 3300005330 Ga0070690_100075145 Ga0070690_1000751453 116
118 3300005330 Ga0070690_100105034 Ga0070690_1001050342 116
119 3300005334 Ga0068869_100008424 Ga0068869_1000084245 116
120 3300005334 Ga0068869_100196828 Ga0068869_1001968282 116
121 3300005334 Ga0068869_100283184 Ga0068869_1002831842 116
122 3300005335 Ga0070666_10010757 Ga0070666_100107576 116
123 3300005337 Ga0070682_100300110 Ga0070682_1003001101 116
124 3300005337 Ga0070682_100591000 Ga0070682_1005910002 116
125 3300005337 Ga0070682_101253057 Ga0070682_1012530572 116
126 3300005338 Ga0068868_100007582 Ga0068868_1000075823 116
127 3300005338 Ga0068868_100022249 Ga0068868_1000222495 116
128 3300005338 Ga0068868_100078314 Ga0068868_1000783143 116
129 3300005339 Ga0070660_100422551 Ga0070660_1004225512 116
130 3300005340 Ga0070689_100199684 Ga0070689_1001996842 116
131 3300005340 Ga0070689_100911213 Ga0070689_1009112132 116
132 3300005343 Ga0070687_100369569 Ga0070687_1003695692 116
133 3300005344 Ga0070661_100004649 Ga0070661_1000046497 116
134 3300005344 Ga0070661_100115701 Ga0070661_1001157012 116
135 3300005347 Ga0070668_100610271 Ga0070668_1006102712 116
136 3300005353 Ga0070669_100780637 Ga0070669_1007806371 116
137 3300005353 Ga0070669_101201672 Ga0070669_1012016721 116
138 3300005353 Ga0070669_101239838 Ga0070669_1012398381 116
139 3300005353 Ga0070669_101905596 Ga0070669_1019055961 116
140 3300005354 Ga0070675_100058001 Ga0070675_1000580013 116
141 3300005354 Ga0070675_100861924 Ga0070675_1008619242 116
142 3300005354 Ga0070675_101473107 Ga0070675_1014731072 116
143 3300005355 Ga0070671_100359288 Ga0070671_1003592882 116
144 3300005356 Ga0070674_101640451 Ga0070674_1016404512 116
145 3300005364 Ga0070673_100014403 Ga0070673_1000144032 116
146 3300005364 Ga0070673_100115725 Ga0070673_1001157255 116
147 3300005364 Ga0070673_100414535 Ga0070673_1004145352 116
148 3300005366 Ga0070659_100021434 Ga0070659_1000214345 116
149 3300005366 Ga0070659_100284264 Ga0070659_1002842643 116
150 3300005367 Ga0070667_101637740 Ga0070667_1016377401 116
151 3300005441 Ga0070700_100343367 Ga0070700_1003433672 116
152 3300005455 Ga0070663_100355677 Ga0070663_1003556772 116
153 3300005455 Ga0070663_101057995 Ga0070663_1010579951 116
154 3300005456 Ga0070678_100048749 Ga0070678_1000487493 116
155 3300005457 Ga0070662_100006211 Ga0070662_1000062111 116
156 3300005457 Ga0070662_100012518 Ga0070662_1000125185 116
157 3300005459 Ga0068867_100045254 Ga0068867_1000452544 116
158 3300005459 Ga0068867_100117447 Ga0068867_1001174472 116
159 3300005518 Ga0070699_101122065 Ga0070699_1011220652 116
160 3300005535 Ga0070684_100006634 Ga0070684_10000663410 116
161 3300005535 Ga0070684_100030438 Ga0070684_1000304386 116
162 3300005535 Ga0070684_100265370 Ga0070684_1002653702 116
163 3300005535 Ga0070684_100605154 Ga0070684_1006051542 116
164 3300005539 Ga0068853_100014740 Ga0068853_1000147402 116
165 3300005539 Ga0068853_100038019 Ga0068853_1000380195 116
166 3300005539 Ga0068853_100981450 Ga0068853_1009814501 116
167 3300005539 Ga0068853_101296095 Ga0068853_1012960951 116
168 3300005543 Ga0070672_100172094 Ga0070672_1001720941 116
169 3300005544 Ga0070686_100177737 Ga0070686_1001777372 116
170 3300005547 Ga0070693_100126555 Ga0070693_1001265553 116
171 3300005548 Ga0070665_100327378 Ga0070665_1003273781 116
172 3300005563 Ga0068855_100940746 Ga0068855_1009407461 116
173 3300005564 Ga0070664_100021144 Ga0070664_1000211442 116
174 3300005564 Ga0070664_100114993 Ga0070664_1001149933 116
175 3300005564 Ga0070664_100171059 Ga0070664_1001710593 116
176 3300005577 Ga0068857_100028333 Ga0068857_1000283335 116
177 3300005577 Ga0068857_100037405 Ga0068857_1000374057 116
178 3300005577 Ga0068857_100596504 Ga0068857_1005965042 116
179 3300005614 Ga0068856_101058909 Ga0068856_1010589092 116
180 3300005614 Ga0068856_101933320 Ga0068856_1019333201 116
181 3300005615 Ga0070702_100088405 Ga0070702_1000884053 116
182 3300005616 Ga0068852_100111383 Ga0068852_1001113832 116
183 3300005616 Ga0068852_102348816 Ga0068852_1023488162 116
184 3300005617 Ga0068859_100072397 Ga0068859_1000723972 116
185 3300005617 Ga0068859_100103505 Ga0068859_1001035055 116
186 3300005617 Ga0068859_100211513 Ga0068859_1002115132 116
187 3300005617 Ga0068859_100378832 Ga0068859_1003788323 116
188 3300005618 Ga0068864_100035920 Ga0068864_1000359203 116
189 3300005618 Ga0068864_100121641 Ga0068864_1001216411 116
190 3300005618 Ga0068864_100257290 Ga0068864_1002572901 116
191 3300005718 Ga0068866_10030908 Ga0068866_100309084 116
192 3300005719 Ga0068861_100046224 Ga0068861_1000462242 116
193 3300005719 Ga0068861_100173875 Ga0068861_1001738751 116
194 3300005834 Ga0068851_10386280 Ga0068851_103862802 116
195 3300005841 Ga0068863_100426465 Ga0068863_1004264652 116
196 3300005841 Ga0068863_100494205 Ga0068863_1004942052 116
197 3300005841 Ga0068863_102538137 Ga0068863_1025381371 116
198 3300005842 Ga0068858_100608533 Ga0068858_1006085332 116
199 3300005843 Ga0068860_101009310 Ga0068860_1010093102 116
200 3300005844 Ga0068862_100405082 Ga0068862_1004050822 116
201 3300005844 Ga0068862_100429135 Ga0068862_1004291352 116
202 3300005844 Ga0068862_101112955 Ga0068862_1011129552 116
203 3300005844 Ga0068862_102567591 Ga0068862_1025675911 116
204 3300006237 Ga0097621_100253931 Ga0097621_1002539312 116
205 3300006881 Ga0068865_100074201 Ga0068865_1000742011 116
206 3300006881 Ga0068865_100202490 Ga0068865_1002024903 116
207 3300006881 Ga0068865_100770297 Ga0068865_1007702971 116
208 3300006881 Ga0068865_100982303 Ga0068865_1009823032 116
209 3300006931 Ga0097620_100072404 Ga0097620_1000724042 116
210 3300006931 Ga0097620_100103499 Ga0097620_1001034993 116
211 3300006931 Ga0097620_100211516 Ga0097620_1002115162 116
212 3300006931 Ga0097620_100378853 Ga0097620_1003788533 116
213 3300007076 Ga0075435_101422406 Ga0075435_1014224061 116
214 3300009011 Ga0105251_10594264 Ga0105251_105942641 116
215 3300009101 Ga0105247_10003291 Ga0105247_100032913 116
216 3300009174 Ga0105241_10241256 Ga0105241_102412563 116
217 3300009174 Ga0105241_10409076 Ga0105241_104090763 116
218 3300009176 Ga0105242_10020659 Ga0105242_100206592 116
219 3300009176 Ga0105242_10439930 Ga0105242_104399302 116
220 3300009177 Ga0105248_10272544 Ga0105248_102725442 116
221 3300009553 Ga0105249_10049879 Ga0105249_100498792 116
222 3300009553 Ga0105249_10349734 Ga0105249_103497343 116
223 3300009553 Ga0105249_10945337 Ga0105249_109453372 116
224 3300011119 Ga0105246_11301631 Ga0105246_113016311 116
225 3300013100 Ga0157373_10044233 Ga0157373_100442332 116
226 3300013102 Ga0157371_10171436 Ga0157371_101714362 116
227 3300013104 Ga0157370_11447386 Ga0157370_114473862 116
228 3300013296 Ga0157374_10071993 Ga0157374_100719933 116
229 3300013296 Ga0157374_10306398 Ga0157374_103063982 116
230 3300013297 Ga0157378_10167058 Ga0157378_101670582 116
231 3300013297 Ga0157378_11037044 Ga0157378_110370441 116
232 3300013306 Ga0163162_10129331 Ga0163162_101293311 116
233 3300013306 Ga0163162_10142022 Ga0163162_101420224 116
234 3300013306 Ga0163162_10517219 Ga0163162_105172191 116
235 3300013307 Ga0157372_10458887 Ga0157372_104588871 116
236 3300013308 Ga0157375_10014722 Ga0157375_100147227 116
237 3300013308 Ga0157375_10093955 Ga0157375_100939554 116
238 3300013308 Ga0157375_10834563 Ga0157375_108345632 116
239 3300013308 Ga0157375_11495265 Ga0157375_114952652 116
240 3300013308 Ga0157375_13191713 Ga0157375_131917132 116
241 3300014325 Ga0163163_10040173 Ga0163163_100401733 116
242 3300014325 Ga0163163_10135234 Ga0163163_101352343 116
243 3300014326 Ga0157380_10370569 Ga0157380_103705692 116
244 3300014745 Ga0157377_10039879 Ga0157377_100398793 116
245 3300014745 Ga0157377_11534426 Ga0157377_115344261 116
246 3300014968 Ga0157379_10040831 Ga0157379_100408314 116
247 3300014968 Ga0157379_10253462 Ga0157379_102534622 116
248 3300014968 Ga0157379_11400081 Ga0157379_114000811 116
249 3300014969 Ga0157376_10246081 Ga0157376_102460812 116
250 3300014969 Ga0157376_10289609 Ga0157376_102896092 116
251 3300014969 Ga0157376_10316532 Ga0157376_103165321 116
252 3300017792 Ga0163161_10023840 Ga0163161_100238404 116
253 3300025315 Ga0207697_10016125 Ga0207697_100161254 116
254 3300025315 Ga0207697_10120607 Ga0207697_101206072 116
255 3300025900 Ga0207710_10001860 Ga0207710_100018604 116
256 3300025901 Ga0207688_10126651 Ga0207688_101266512 116
257 3300025903 Ga0207680_10013020 Ga0207680_100130204 116
258 3300025903 Ga0207680_10443534 Ga0207680_104435342 116
259 3300025904 Ga0207647_10028201 Ga0207647_100282014 116
260 3300025905 Ga0207685_10080434 Ga0207685_100804342 116
261 3300025906 Ga0207699_10382682 Ga0207699_103826822 116
262 3300025907 Ga0207645_10024624 Ga0207645_100246246 116
263 3300025908 Ga0207643_10148166 Ga0207643_101481661 116
264 3300025911 Ga0207654_10976761 Ga0207654_109767611 116
265 3300025919 Ga0207657_10194543 Ga0207657_101945432 116
266 3300025920 Ga0207649_10012710 Ga0207649_100127108 116
267 3300025926 Ga0207659_11792454 Ga0207659_117924541 116
268 3300025931 Ga0207644_10109732 Ga0207644_101097322 116
269 3300025931 Ga0207644_10224539 Ga0207644_102245393 116
270 3300025931 Ga0207644_10520692 Ga0207644_105206921 116
271 3300025932 Ga0207690_10023014 Ga0207690_100230146 116
272 3300025932 Ga0207690_10741747 Ga0207690_107417471 116
273 3300025933 Ga0207706_10014472 Ga0207706_100144728 116
274 3300025933 Ga0207706_10014939 Ga0207706_100149395 116
275 3300025933 Ga0207706_10244841 Ga0207706_102448411 116
276 3300025934 Ga0207686_10801010 Ga0207686_108010101 116
277 3300025936 Ga0207670_10015308 Ga0207670_100153083 116
278 3300025938 Ga0207704_10087633 Ga0207704_100876333 116
279 3300025938 Ga0207704_10174063 Ga0207704_101740633 116
280 3300025940 Ga0207691_10044291 Ga0207691_100442912 116
281 3300025941 Ga0207711_11557490 Ga0207711_115574901 116
282 3300025942 Ga0207689_10004605 Ga0207689_1000460512 116
283 3300025942 Ga0207689_10011865 Ga0207689_100118657 116
284 3300025942 Ga0207689_10037638 Ga0207689_100376383 116
285 3300025942 Ga0207689_11013559 Ga0207689_110135592 116
286 3300025944 Ga0207661_10019534 Ga0207661_100195346 116
287 3300025944 Ga0207661_10031717 Ga0207661_100317177 116
288 3300025944 Ga0207661_10704745 Ga0207661_107047452 116
289 3300025945 Ga0207679_10020993 Ga0207679_100209932 116
290 3300025945 Ga0207679_10022054 Ga0207679_100220547 116
291 3300025945 Ga0207679_10682508 Ga0207679_106825081 116
292 3300025949 Ga0207667_10881920 Ga0207667_108819201 116
293 3300025960 Ga0207651_10019959 Ga0207651_100199594 116
294 3300025960 Ga0207651_10090796 Ga0207651_100907962 116
295 3300025961 Ga0207712_10029238 Ga0207712_100292383 116
296 3300025961 Ga0207712_10061839 Ga0207712_100618393 116
297 3300025961 Ga0207712_10915753 Ga0207712_109157532 116
298 3300025972 Ga0207668_10839937 Ga0207668_108399372 116
299 3300025981 Ga0207640_10112734 Ga0207640_101127343 116
300 3300025981 Ga0207640_10248673 Ga0207640_102486731 116
301 3300026023 Ga0207677_10002177 Ga0207677_100021773 116
302 3300026023 Ga0207677_10048097 Ga0207677_100480972 116
303 3300026023 Ga0207677_10123314 Ga0207677_101233143 116
304 3300026035 Ga0207703_10166712 Ga0207703_101667122 116
305 3300026035 Ga0207703_10421325 Ga0207703_104213253 116
306 3300026041 Ga0207639_10009995 Ga0207639_100099958 116
307 3300026041 Ga0207639_10238583 Ga0207639_102385831 116
308 3300026041 Ga0207639_10687348 Ga0207639_106873482 116
309 3300026067 Ga0207678_10169409 Ga0207678_101694093 116
310 3300026067 Ga0207678_10874452 Ga0207678_108744521 116
311 3300026078 Ga0207702_11613979 Ga0207702_116139791 116
312 3300026088 Ga0207641_10480945 Ga0207641_104809451 116
313 3300026088 Ga0207641_10755342 Ga0207641_107553422 116
314 3300026088 Ga0207641_10934364 Ga0207641_109343642 116
315 3300026088 Ga0207641_11556071 Ga0207641_115560712 116
316 3300026089 Ga0207648_10019286 Ga0207648_100192867 116
317 3300026089 Ga0207648_10320205 Ga0207648_103202051 116
318 3300026095 Ga0207676_10025761 Ga0207676_100257616 116
319 3300026095 Ga0207676_10051614 Ga0207676_100516143 116
320 3300026095 Ga0207676_10512360 Ga0207676_105123603 116
321 3300026116 Ga0207674_10007545 Ga0207674_100075455 116
322 3300026116 Ga0207674_10019908 Ga0207674_100199086 116
323 3300026116 Ga0207674_10627852 Ga0207674_106278522 116
324 3300026118 Ga0207675_100135163 Ga0207675_1001351633 116
325 3300026118 Ga0207675_100321928 Ga0207675_1003219282 116
326 3300026121 Ga0207683_10060212 Ga0207683_100602124 116
327 3300026121 Ga0207683_11204266 Ga0207683_112042661 116
328 3300026142 Ga0207698_10266884 Ga0207698_102668843 116
329 3300026142 Ga0207698_10963147 Ga0207698_109631472 116
330 3300026142 Ga0207698_12338779 Ga0207698_123387792 116
331 3300028380 Ga0268265_10471789 Ga0268265_104717892 116
332 3300028381 Ga0268264_10850421 Ga0268264_108504212 116
333 3300031731 Ga0307405_11949210 Ga0307405_119492101 116
334 3300032126 Ga0307415_102068937 Ga0307415_1020689371 116
335 3300035086 Ga0373934_0225434 Ga0373934_0225434_188_586 116
336 3300035089 Ga0373944_0175204 Ga0373944_0175204_228_626 116
337 3300035118 Ga0373954_0099197 Ga0373954_0099197_430_828 116
338 3300035172 Ga0373955_0120482 Ga0373955_0120482_849_1247 116
339 3300035692 Ga0373935_0575918 Ga0373935_0575918_145_543 116
340 3300035724 Ga0373933_0235715 Ga0373933_0235715_551_949 116
341 3300036401 Ga0373937_0043690 Ga0373937_0043690_1450_1848 116
342 3300042876 Ga0451577_0894456 Ga0451577_0894456_365_763 116
343 3300046462 Ga0495651_0223746 Ga0495651_0223746_444_842 116
344 3300046463 Ga0495653_0152396 Ga0495653_0152396_275_673 116
345 3300046511 Ga0495608_0060018 Ga0495608_0060018_1556_1954 116
346 3300046514 Ga0495618_0060481 Ga0495618_0060481_1912_2310 116
347 3300046516 Ga0495628_0061099 Ga0495628_0061099_2022_2420 116
348 3300046517 Ga0495630_0025827 Ga0495630_0025827_1334_1732 116
349 3300046533 Ga0495640_0703869 Ga0495640_0703869_39_437 116
350 3300046535 Ga0495586_0398048 Ga0495586_0398048_304_702 116
351 3300046537 Ga0495598_0071004 Ga0495598_0071004_586_984 116
352 3300046559 Ga0495667_0404024 Ga0495667_0404024_242_640 116
353 3300046642 Ga0495634_0121772 Ga0495634_0121772_704_1102 116
354 3300046663 Ga0495635_0220148 Ga0495635_0220148_585_983 116
355 3300046675 Ga0495657_0321763 Ga0495657_0321763_178_576 116
356 3300046680 Ga0495646_0197748 Ga0495646_0197748_569_967 116
357 3300046689 Ga0495613_0057376 Ga0495613_0057376_1031_1429 116
358 3300047319 Ga0495674_0221266 Ga0495674_0221266_338_736 116
359 3300047320 Ga0495672_0071262 Ga0495672_0071262_847_1245 116
360 3300047471 Ga0495684_0263139 Ga0495684_0263139_236_634 116
361 3300048912 Ga0496109_1472235 Ga0496109_1472235_114_512 116
362 3300048917 Ga0496114_0153449 Ga0496114_0153449_637_1035 116
363 3300049588 Ga0501072_0170211 Ga0501072_0170211_621_1019 116
364 3300053085 Ga0495619_0026132 Ga0495619_0026132_1340_1738 116
365 3300053139 Ga0500568_0004276 Ga0500568_0004276_5167_5571 116
366 3300053727 Ga0500611_000077 Ga0500611_000077_36620_37021 116
367 iso_pu_bacteria 2738541278 2738726297 116
368 iso_pu_bacteria 2821136567 2821140066 116
369 iso_pu_bacteria 2904467357 2904472187 116
370 iso_pu_bacteria 2929239360 2929244906 116
371 iso_pu_bacteria 2929921140 2929927149 116
372 iso_pu_bacteria 8003151029 8003157141 116
373 3300005459 Ga0068867_100130694 Ga0068867_1001306942 117
374 3300005578 Ga0068854_101204852 Ga0068854_1012048522 117
375 3300026089 Ga0207648_10151451 Ga0207648_101514512 117
376 iso_pu_bacteria 2513020052 2513235217 117
377 iso_pu_bacteria 2519899754 2520879475 117
378 iso_pu_bacteria 2643221600 2644009119 117
379 iso_pu_bacteria 2643221667 2644371206 117
380 iso_pu_bacteria 2643221716 2644643999 117
381 iso_pu_bacteria 2643221725 2644681892 117
382 iso_pu_bacteria 2738541279 2738733168 117
383 iso_pu_bacteria 2738541285 2738765706 117
384 iso_pu_bacteria 2738543007 2739214749 117
385 iso_pu_bacteria 2739367857 2740002759 117
386 iso_pu_bacteria 2739367858 2740007576 117
387 iso_pu_bacteria 2802428842 2802655198 117
388 iso_pu_bacteria 2816332280 2817413611 117
389 iso_pu_bacteria 2857613821 2857616980 117
390 iso_pu_bacteria 2857618242 2857619633 117
391 iso_pu_bacteria 2881359912 2881362595 117
392 iso_pu_bacteria 2890804823 2890805947 117
393 iso_pu_bacteria 2903895155 2903896744 117
394 iso_pu_bacteria 2904419702 2904422467 117
395 iso_pu_bacteria 2904555929 2904558423 117
396 iso_pu_bacteria 2919191525 2919194138 117
397 iso_pu_bacteria 2929150217 2929150681 117
398 iso_pu_bacteria 2958458903 2958463478 117
399 iso_pu_bacteria 2977268062 2977272135 117
400 iso_pu_bacteria 8036736890 8036737809 117
401 iso_pu_bacteria 8054307821 8054311355 117
402 iso_pu_bacteria 8055419101 8055423642 117
403 iso_pu_bacteria 8055592153 8055595000 117
404 iso_pu_bacteria 8056440228 8056443586 117
405 3300026088 Ga0207641_10920700 Ga0207641_109207001 118
406 3300002987 JGI25159J45721_1014429 JGI25159J45721_10144292 119
407 3300003354 JGI25160J50197_1038948 JGI25160J50197_10389482 119
408 3300017792 Ga0163161_10575626 Ga0163161_105756262 119
409 3300025208 Ga0209436_105918 Ga0209436_1059183 119
410 3300025284 Ga0209130_1001652 Ga0209130_10016528 119
411 3300025302 Ga0207426_1000051 Ga0207426_1000051147 119
412 3300031251 Ga0265327_10000219 Ga0265327_1000021923 119
413 3300032004 Ga0307414_10001420 Ga0307414_100014209 119
414 3300032005 Ga0307411_11028116 Ga0307411_110281162 119
415 3300041997 Ga0439431_0001740 Ga0439431_0001740_3668_4084 119
416 3300044658 Ga0466972_0070919 Ga0466972_0070919_44_439 119
417 3300044673 Ga0453683_0776247 Ga0453683_0776247_203_616 119
418 3300044765 Ga0466970_0101719 Ga0466970_0101719_142_537 119
419 3300045049 Ga0466959_0032629 Ga0466959_0032629_1651_2046 119
420 3300048928 Ga0496125_0299882 Ga0496125_0299882_152_547 119
421 3300049823 Ga0501044_0520711 Ga0501044_0520711_25_420 119
422 3300001904 JGI24736J21556_1049260 JGI24736J21556_10492602 120
423 3300001979 JGI24740J21852_10003263 JGI24740J21852_100032635 120
424 3300001991 JGI24743J22301_10059968 JGI24743J22301_100599682 120
425 3300002738 JGI25154J39366_1000019 JGI25154J39366_1000019165 120
426 3300002741 JGI25157J39369_1005006 JGI25157J39369_10050062 120
427 3300003215 JGI25153J46596_10002342 JGI25153J46596_100023424 120
428 3300003215 JGI25153J46596_10025003 JGI25153J46596_100250032 120
429 3300003320 rootH2_10015349 rootH2_1001534919 120
430 3300003320 rootH2_10056653 rootH2_100566533 120
431 3300003320 rootH2_10117949 rootH2_101179492 120
432 3300003320 rootH2_10252188 rootH2_102521882 120
433 3300003322 rootL2_10023809 rootL2_100238093 120
434 3300003322 rootL2_10103028 rootL2_101030284 120
435 3300003322 rootL2_10103029 rootL2_101030294 120
436 3300003322 rootL2_10146434 rootL2_101464343 120
437 3300003323 rootH1_10007634 rootH1_100076342 120
438 3300003323 rootH1_10196799 rootH1_101967998 120
439 3300003323 rootH1_10224232 rootH1_102242322 120
440 3300003323 rootH1_10269349 rootH1_102693492 120
441 3300003323 rootH1_10317655 rootH1_103176552 120
442 3300003354 JGI25160J50197_1005104 JGI25160J50197_10051043 120
443 3300003354 JGI25160J50197_1014080 JGI25160J50197_10140803 120
444 3300003771 Ga0055526_1015126 Ga0055526_10151263 120
445 3300003790 Ga0055528_1000383 Ga0055528_100038310 120
446 3300003791 Ga0055530_10002275 Ga0055530_100022756 120
447 3300003794 Ga0055531_10040366 Ga0055531_100403662 120
448 3300004625 Ga0055543_1013114 Ga0055543_10131143 120
449 3300005262 Ga0065165_1000402 Ga0065165_100040239 120
450 3300005262 Ga0065165_1044615 Ga0065165_10446151 120
451 3300005289 Ga0065704_10110528 Ga0065704_101105283 120
452 3300005290 Ga0065712_10503847 Ga0065712_105038472 120
453 3300005295 Ga0065707_10012971 Ga0065707_100129712 120
454 3300005327 Ga0070658_10171865 Ga0070658_101718652 120
455 3300005327 Ga0070658_11482868 Ga0070658_114828681 120
456 3300005328 Ga0070676_10003832 Ga0070676_100038323 120
457 3300005328 Ga0070676_10174270 Ga0070676_101742702 120
458 3300005329 Ga0070683_100129420 Ga0070683_1001294201 120
459 3300005330 Ga0070690_100251042 Ga0070690_1002510422 120
460 3300005331 Ga0070670_100045077 Ga0070670_1000450773 120
461 3300005331 Ga0070670_100208342 Ga0070670_1002083422 120
462 3300005333 Ga0070677_10362339 Ga0070677_103623392 120
463 3300005334 Ga0068869_100152820 Ga0068869_1001528202 120
464 3300005334 Ga0068869_100441400 Ga0068869_1004414001 120
465 3300005334 Ga0068869_101915320 Ga0068869_1019153201 120
466 3300005335 Ga0070666_10035650 Ga0070666_100356503 120
467 3300005335 Ga0070666_10234690 Ga0070666_102346902 120
468 3300005337 Ga0070682_100000455 Ga0070682_10000045512 120
469 3300005338 Ga0068868_100001512 Ga0068868_1000015129 120
470 3300005338 Ga0068868_100239054 Ga0068868_1002390541 120
471 3300005338 Ga0068868_100556700 Ga0068868_1005567002 120
472 3300005338 Ga0068868_101853404 Ga0068868_1018534041 120
473 3300005339 Ga0070660_101291496 Ga0070660_1012914961 120
474 3300005340 Ga0070689_100274603 Ga0070689_1002746032 120
475 3300005341 Ga0070691_10010823 Ga0070691_100108232 120
476 3300005343 Ga0070687_100154834 Ga0070687_1001548342 120
477 3300005347 Ga0070668_100000116 Ga0070668_1000001169 120
478 3300005347 Ga0070668_100409381 Ga0070668_1004093812 120
479 3300005353 Ga0070669_100240392 Ga0070669_1002403922 120
480 3300005353 Ga0070669_100970711 Ga0070669_1009707111 120
481 3300005354 Ga0070675_100101445 Ga0070675_1001014452 120
482 3300005354 Ga0070675_101138776 Ga0070675_1011387761 120
483 3300005355 Ga0070671_100010319 Ga0070671_1000103197 120
484 3300005355 Ga0070671_100385471 Ga0070671_1003854712 120
485 3300005355 Ga0070671_100491160 Ga0070671_1004911601 120
486 3300005364 Ga0070673_100000521 Ga0070673_10000052118 120
487 3300005364 Ga0070673_100029227 Ga0070673_1000292272 120
488 3300005364 Ga0070673_100191410 Ga0070673_1001914102 120
489 3300005367 Ga0070667_100000652 Ga0070667_1000006526 120
490 3300005367 Ga0070667_100004905 Ga0070667_10000490512 120
491 3300005367 Ga0070667_100326558 Ga0070667_1003265582 120
492 3300005367 Ga0070667_100562074 Ga0070667_1005620742 120
493 3300005367 Ga0070667_100916342 Ga0070667_1009163421 120
494 3300005367 Ga0070667_101017854 Ga0070667_1010178542 120
495 3300005456 Ga0070678_100054602 Ga0070678_1000546023 120
496 3300005456 Ga0070678_100104468 Ga0070678_1001044683 120
497 3300005456 Ga0070678_101074435 Ga0070678_1010744352 120
498 3300005457 Ga0070662_100001029 Ga0070662_10000102918 120
499 3300005457 Ga0070662_100463440 Ga0070662_1004634402 120
500 3300005458 Ga0070681_10059194 Ga0070681_100591943 120
501 3300005458 Ga0070681_10079737 Ga0070681_100797373 120
502 3300005458 Ga0070681_10725615 Ga0070681_107256152 120
503 3300005459 Ga0068867_100009722 Ga0068867_1000097222 120
504 3300005459 Ga0068867_100049540 Ga0068867_1000495404 120
505 3300005459 Ga0068867_100668434 Ga0068867_1006684342 120
506 3300005459 Ga0068867_100796767 Ga0068867_1007967672 120
507 3300005459 Ga0068867_101407982 Ga0068867_1014079821 120
508 3300005459 Ga0068867_101422563 Ga0068867_1014225632 120
509 3300005466 Ga0070685_10143849 Ga0070685_101438491 120
510 3300005471 Ga0070698_100008986 Ga0070698_1000089863 120
511 3300005471 Ga0070698_100083465 Ga0070698_1000834653 120
512 3300005530 Ga0070679_100000973 Ga0070679_10000097312 120
513 3300005535 Ga0070684_100003219 Ga0070684_1000032192 120
514 3300005535 Ga0070684_101668291 Ga0070684_1016682912 120
515 3300005535 Ga0070684_101718550 Ga0070684_1017185501 120
516 3300005539 Ga0068853_100003822 Ga0068853_1000038225 120
517 3300005539 Ga0068853_100046145 Ga0068853_1000461452 120
518 3300005539 Ga0068853_100132094 Ga0068853_1001320942 120
519 3300005539 Ga0068853_100281948 Ga0068853_1002819482 120
520 3300005539 Ga0068853_100709590 Ga0068853_1007095902 120
521 3300005539 Ga0068853_101741675 Ga0068853_1017416751 120
522 3300005539 Ga0068853_102171321 Ga0068853_1021713211 120
523 3300005543 Ga0070672_100000038 Ga0070672_10000003820 120
524 3300005543 Ga0070672_100046787 Ga0070672_1000467874 120
525 3300005543 Ga0070672_100605382 Ga0070672_1006053822 120
526 3300005543 Ga0070672_101130050 Ga0070672_1011300501 120
527 3300005543 Ga0070672_101362529 Ga0070672_1013625292 120
528 3300005543 Ga0070672_101562481 Ga0070672_1015624812 120
529 3300005544 Ga0070686_100209651 Ga0070686_1002096512 120
530 3300005547 Ga0070693_100052194 Ga0070693_1000521942 120
531 3300005547 Ga0070693_100189197 Ga0070693_1001891972 120
532 3300005548 Ga0070665_100000013 Ga0070665_100000013197 120
533 3300005548 Ga0070665_100000504 Ga0070665_10000050427 120
534 3300005548 Ga0070665_100002898 Ga0070665_10000289812 120
535 3300005563 Ga0068855_100000424 Ga0068855_10000042420 120
536 3300005563 Ga0068855_100002280 Ga0068855_1000022802 120
537 3300005563 Ga0068855_100004440 Ga0068855_1000044407 120
538 3300005563 Ga0068855_100005197 Ga0068855_10000519713 120
539 3300005563 Ga0068855_100067080 Ga0068855_1000670803 120
540 3300005563 Ga0068855_100615564 Ga0068855_1006155642 120
541 3300005563 Ga0068855_100658624 Ga0068855_1006586242 120
542 3300005564 Ga0070664_100021537 Ga0070664_1000215375 120
543 3300005564 Ga0070664_100522891 Ga0070664_1005228912 120
544 3300005577 Ga0068857_100001435 Ga0068857_1000014356 120
545 3300005577 Ga0068857_100040695 Ga0068857_1000406953 120
546 3300005578 Ga0068854_100026033 Ga0068854_1000260334 120
547 3300005578 Ga0068854_100256180 Ga0068854_1002561802 120
548 3300005614 Ga0068856_100046162 Ga0068856_1000461622 120
549 3300005614 Ga0068856_100143359 Ga0068856_1001433592 120
550 3300005614 Ga0068856_100490995 Ga0068856_1004909952 120
551 3300005616 Ga0068852_100000342 Ga0068852_10000034213 120
552 3300005616 Ga0068852_100075871 Ga0068852_1000758713 120
553 3300005616 Ga0068852_100457027 Ga0068852_1004570272 120
554 3300005616 Ga0068852_102159510 Ga0068852_1021595101 120
555 3300005617 Ga0068859_100058243 Ga0068859_1000582433 120
556 3300005617 Ga0068859_100829355 Ga0068859_1008293552 120
557 3300005617 Ga0068859_100864391 Ga0068859_1008643911 120
558 3300005618 Ga0068864_100007905 Ga0068864_10000790510 120
559 3300005718 Ga0068866_10757015 Ga0068866_107570152 120
560 3300005719 Ga0068861_100022476 Ga0068861_1000224765 120
561 3300005719 Ga0068861_100454097 Ga0068861_1004540972 120
562 3300005834 Ga0068851_10000211 Ga0068851_1000021125 120
563 3300005841 Ga0068863_100004928 Ga0068863_1000049286 120
564 3300005841 Ga0068863_100009598 Ga0068863_1000095989 120
565 3300005841 Ga0068863_100414817 Ga0068863_1004148172 120
566 3300005842 Ga0068858_100002669 Ga0068858_1000026695 120
567 3300005842 Ga0068858_100504808 Ga0068858_1005048082 120
568 3300005843 Ga0068860_100000060 Ga0068860_100000060164 120
569 3300005843 Ga0068860_100008126 Ga0068860_10000812611 120
570 3300005843 Ga0068860_100009802 Ga0068860_1000098022 120
571 3300005843 Ga0068860_100036542 Ga0068860_1000365423 120
572 3300005843 Ga0068860_100097786 Ga0068860_1000977863 120
573 3300005843 Ga0068860_100923396 Ga0068860_1009233961 120
574 3300005843 Ga0068860_101095561 Ga0068860_1010955611 120
575 3300005843 Ga0068860_102325711 Ga0068860_1023257112 120
576 3300005844 Ga0068862_100206260 Ga0068862_1002062601 120
577 3300006195 Ga0075366_10145326 Ga0075366_101453262 120
578 3300006237 Ga0097621_100000538 Ga0097621_10000053818 120
579 3300006237 Ga0097621_100007933 Ga0097621_1000079336 120
580 3300006237 Ga0097621_101690988 Ga0097621_1016909882 120
581 3300006237 Ga0097621_102436879 Ga0097621_1024368791 120
582 3300006358 Ga0068871_100000452 Ga0068871_10000045214 120
583 3300006358 Ga0068871_100003693 Ga0068871_1000036936 120
584 3300006358 Ga0068871_100089405 Ga0068871_1000894053 120
585 3300006358 Ga0068871_100249800 Ga0068871_1002498002 120
586 3300006358 Ga0068871_100339008 Ga0068871_1003390082 120
587 3300006358 Ga0068871_100379954 Ga0068871_1003799542 120
588 3300006844 Ga0075428_100004046 Ga0075428_10000404611 120
589 3300006844 Ga0075428_100138747 Ga0075428_1001387472 120
590 3300006846 Ga0075430_100036462 Ga0075430_1000364623 120
591 3300006846 Ga0075430_100220568 Ga0075430_1002205682 120
592 3300006847 Ga0075431_100030039 Ga0075431_1000300392 120
593 3300006847 Ga0075431_100093393 Ga0075431_1000933932 120
594 3300006871 Ga0075434_101701882 Ga0075434_1017018822 120
595 3300006880 Ga0075429_100013930 Ga0075429_1000139303 120
596 3300006880 Ga0075429_100219308 Ga0075429_1002193082 120
597 3300006881 Ga0068865_100001621 Ga0068865_1000016216 120
598 3300006881 Ga0068865_100109400 Ga0068865_1001094003 120
599 3300006881 Ga0068865_100265409 Ga0068865_1002654092 120
600 3300006881 Ga0068865_100845762 Ga0068865_1008457621 120
601 3300006931 Ga0097620_100058243 Ga0097620_1000582433 120
602 3300006931 Ga0097620_100829359 Ga0097620_1008293592 120
603 3300006931 Ga0097620_100864529 Ga0097620_1008645292 120
604 3300009093 Ga0105240_10000486 Ga0105240_1000048624 120
605 3300009093 Ga0105240_10001336 Ga0105240_100013368 120
606 3300009093 Ga0105240_10002538 Ga0105240_1000253820 120
607 3300009093 Ga0105240_10004786 Ga0105240_1000478620 120
608 3300009093 Ga0105240_10007443 Ga0105240_100074437 120
609 3300009093 Ga0105240_10016576 Ga0105240_100165765 120
610 3300009093 Ga0105240_10073956 Ga0105240_100739562 120
611 3300009093 Ga0105240_10085020 Ga0105240_100850202 120
612 3300009093 Ga0105240_10152230 Ga0105240_101522303 120
613 3300009093 Ga0105240_10169245 Ga0105240_101692453 120
614 3300009093 Ga0105240_10583631 Ga0105240_105836312 120
615 3300009094 Ga0111539_10179830 Ga0111539_101798304 120
616 3300009094 Ga0111539_10377407 Ga0111539_103774072 120
617 3300009098 Ga0105245_10065037 Ga0105245_100650374 120
618 3300009101 Ga0105247_10040609 Ga0105247_100406093 120
619 3300009147 Ga0114129_10019537 Ga0114129_100195377 120
620 3300009147 Ga0114129_10025061 Ga0114129_100250613 120
621 3300009147 Ga0114129_11391192 Ga0114129_113911922 120
622 3300009147 Ga0114129_12563172 Ga0114129_125631721 120
623 3300009174 Ga0105241_10000144 Ga0105241_1000014412 120
624 3300009174 Ga0105241_10001636 Ga0105241_100016364 120
625 3300009174 Ga0105241_10014888 Ga0105241_100148882 120
626 3300009174 Ga0105241_10297588 Ga0105241_102975881 120
627 3300009174 Ga0105241_10676642 Ga0105241_106766422 120
628 3300009176 Ga0105242_10049029 Ga0105242_100490293 120
629 3300009177 Ga0105248_12329072 Ga0105248_123290722 120
630 3300009545 Ga0105237_10000651 Ga0105237_100006518 120
631 3300009545 Ga0105237_10006210 Ga0105237_1000621014 120
632 3300009545 Ga0105237_10037264 Ga0105237_100372644 120
633 3300009545 Ga0105237_10049425 Ga0105237_100494254 120
634 3300009545 Ga0105237_10070518 Ga0105237_100705182 120
635 3300009545 Ga0105237_10097915 Ga0105237_100979153 120
636 3300009545 Ga0105237_10124229 Ga0105237_101242293 120
637 3300009545 Ga0105237_10153054 Ga0105237_101530543 120
638 3300009545 Ga0105237_11045517 Ga0105237_110455171 120
639 3300009551 Ga0105238_10002965 Ga0105238_1000296511 120
640 3300009551 Ga0105238_10102105 Ga0105238_101021053 120
641 3300009551 Ga0105238_10189261 Ga0105238_101892613 120
642 3300009551 Ga0105238_10315880 Ga0105238_103158802 120
643 3300009551 Ga0105238_10685442 Ga0105238_106854422 120
644 3300009551 Ga0105238_11905213 Ga0105238_119052131 120
645 3300009553 Ga0105249_10023320 Ga0105249_100233206 120
646 3300009553 Ga0105249_10079351 Ga0105249_100793511 120
647 3300009553 Ga0105249_10335997 Ga0105249_103359972 120
648 3300009553 Ga0105249_10899517 Ga0105249_108995171 120
649 3300009553 Ga0105249_11021624 Ga0105249_110216242 120
650 3300009553 Ga0105249_11848708 Ga0105249_118487081 120
651 3300010375 Ga0105239_10003371 Ga0105239_100033715 120
652 3300010375 Ga0105239_10004216 Ga0105239_1000421613 120
653 3300010375 Ga0105239_10004649 Ga0105239_100046499 120
654 3300010375 Ga0105239_10076614 Ga0105239_100766143 120
655 3300010375 Ga0105239_10112773 Ga0105239_101127734 120
656 3300010375 Ga0105239_10120064 Ga0105239_101200641 120
657 3300010375 Ga0105239_10127692 Ga0105239_101276924 120
658 3300010375 Ga0105239_10155028 Ga0105239_101550283 120
659 3300010375 Ga0105239_10253707 Ga0105239_102537073 120
660 3300010375 Ga0105239_10254007 Ga0105239_102540074 120
661 3300010375 Ga0105239_10589635 Ga0105239_105896351 120
662 3300010375 Ga0105239_10852920 Ga0105239_108529201 120
663 3300010375 Ga0105239_10855034 Ga0105239_108550342 120
664 3300011119 Ga0105246_10497455 Ga0105246_104974552 120
665 3300013100 Ga0157373_10049497 Ga0157373_100494973 120
666 3300013100 Ga0157373_10183856 Ga0157373_101838562 120
667 3300013102 Ga0157371_10028728 Ga0157371_100287282 120
668 3300013104 Ga0157370_10006627 Ga0157370_100066279 120
669 3300013104 Ga0157370_10008346 Ga0157370_1000834610 120
670 3300013104 Ga0157370_10039104 Ga0157370_100391042 120
671 3300013104 Ga0157370_10067725 Ga0157370_100677254 120
672 3300013104 Ga0157370_10200055 Ga0157370_102000552 120
673 3300013104 Ga0157370_10293819 Ga0157370_102938192 120
674 3300013104 Ga0157370_11117459 Ga0157370_111174591 120
675 3300013105 Ga0157369_10011152 Ga0157369_100111524 120
676 3300013105 Ga0157369_10143161 Ga0157369_101431612 120
677 3300013105 Ga0157369_10292254 Ga0157369_102922543 120
678 3300013105 Ga0157369_10468159 Ga0157369_104681592 120
679 3300013296 Ga0157374_10000007 Ga0157374_10000007189 120
680 3300013296 Ga0157374_10000339 Ga0157374_1000033940 120
681 3300013296 Ga0157374_10147866 Ga0157374_101478663 120
682 3300013296 Ga0157374_10356939 Ga0157374_103569391 120
683 3300013296 Ga0157374_10558304 Ga0157374_105583042 120
684 3300013296 Ga0157374_10753667 Ga0157374_107536671 120
685 3300013297 Ga0157378_10049153 Ga0157378_100491534 120
686 3300013297 Ga0157378_10124365 Ga0157378_101243652 120
687 3300013297 Ga0157378_11024388 Ga0157378_110243882 120
688 3300013306 Ga0163162_10000213 Ga0163162_1000021315 120
689 3300013306 Ga0163162_10000386 Ga0163162_1000038622 120
690 3300013306 Ga0163162_10000942 Ga0163162_100009428 120
691 3300013306 Ga0163162_10042307 Ga0163162_100423072 120
692 3300013306 Ga0163162_10220548 Ga0163162_102205482 120
693 3300013306 Ga0163162_10682711 Ga0163162_106827112 120
694 3300013306 Ga0163162_10852484 Ga0163162_108524841 120
695 3300013306 Ga0163162_11866729 Ga0163162_118667292 120
696 3300013307 Ga0157372_10000954 Ga0157372_1000095415 120
697 3300013307 Ga0157372_10005795 Ga0157372_100057954 120
698 3300013307 Ga0157372_10014521 Ga0157372_100145214 120
699 3300013307 Ga0157372_10015096 Ga0157372_100150962 120
700 3300013307 Ga0157372_10500693 Ga0157372_105006932 120
701 3300013307 Ga0157372_10520251 Ga0157372_105202511 120
702 3300013307 Ga0157372_11004883 Ga0157372_110048832 120
703 3300013307 Ga0157372_11070967 Ga0157372_110709672 120
704 3300013307 Ga0157372_12240767 Ga0157372_122407672 120
705 3300013308 Ga0157375_10000548 Ga0157375_100005486 120
706 3300013308 Ga0157375_10000813 Ga0157375_1000081318 120
707 3300013308 Ga0157375_10031471 Ga0157375_100314713 120
708 3300013308 Ga0157375_10056177 Ga0157375_100561773 120
709 3300013308 Ga0157375_10126832 Ga0157375_101268321 120
710 3300013308 Ga0157375_10767824 Ga0157375_107678242 120
711 3300013308 Ga0157375_10798667 Ga0157375_107986672 120
712 3300013308 Ga0157375_11980370 Ga0157375_119803701 120
713 3300014325 Ga0163163_10000046 Ga0163163_1000004699 120
714 3300014325 Ga0163163_10176865 Ga0163163_101768652 120
715 3300014325 Ga0163163_11024507 Ga0163163_110245072 120
716 3300014326 Ga0157380_10070887 Ga0157380_100708873 120
717 3300014968 Ga0157379_10000020 Ga0157379_1000002033 120
718 3300014968 Ga0157379_10243117 Ga0157379_102431172 120
719 3300014968 Ga0157379_10413592 Ga0157379_104135922 120
720 3300014968 Ga0157379_10521428 Ga0157379_105214282 120
721 3300014969 Ga0157376_10000297 Ga0157376_100002976 120
722 3300014969 Ga0157376_10067191 Ga0157376_100671913 120
723 3300014969 Ga0157376_10165811 Ga0157376_101658113 120
724 3300014969 Ga0157376_10208667 Ga0157376_102086672 120
725 3300014969 Ga0157376_10984397 Ga0157376_109843971 120
726 3300014969 Ga0157376_11255830 Ga0157376_112558301 120
727 3300014969 Ga0157376_11538255 Ga0157376_115382551 120
728 3300014969 Ga0157376_11851269 Ga0157376_118512691 120
729 3300014969 Ga0157376_11999351 Ga0157376_119993511 120
730 3300015265 Ga0182005_1000023 Ga0182005_100002324 120
731 3300017792 Ga0163161_10000950 Ga0163161_1000095014 120
732 3300017792 Ga0163161_10012778 Ga0163161_100127784 120
733 3300017792 Ga0163161_10820570 Ga0163161_108205701 120
734 3300017792 Ga0163161_11417688 Ga0163161_114176882 120
735 3300021361 Ga0213872_10311097 Ga0213872_103110971 120
736 3300021384 Ga0213876_10018117 Ga0213876_100181173 120
737 3300025242 Ga0209258_106914 Ga0209258_1069142 120
738 3300025246 Ga0209646_1000003 Ga0209646_1000003777 120
739 3300025246 Ga0209646_1000557 Ga0209646_100055714 120
740 3300025250 Ga0209026_1001293 Ga0209026_10012933 120
741 3300025258 Ga0209129_1007827 Ga0209129_10078273 120
742 3300025263 Ga0209565_1017147 Ga0209565_10171472 120
743 3300025273 Ga0209673_1000194 Ga0209673_100019418 120
744 3300025291 Ga0209675_1034967 Ga0209675_10349672 120
745 3300025297 Ga0209758_1008229 Ga0209758_10082294 120
746 3300025297 Ga0209758_1035014 Ga0209758_10350142 120
747 3300025298 Ga0209050_1000765 Ga0209050_100076532 120
748 3300025302 Ga0207426_1000803 Ga0207426_100080318 120
749 3300025302 Ga0207426_1002657 Ga0207426_10026578 120
750 3300025304 Ga0209257_1001800 Ga0209257_100180012 120
751 3300025315 Ga0207697_10436429 Ga0207697_104364291 120
752 3300025893 Ga0207682_10357956 Ga0207682_103579561 120
753 3300025903 Ga0207680_10072487 Ga0207680_100724873 120
754 3300025904 Ga0207647_10011770 Ga0207647_100117702 120
755 3300025904 Ga0207647_10116839 Ga0207647_101168392 120
756 3300025904 Ga0207647_10166452 Ga0207647_101664522 120
757 3300025904 Ga0207647_10452058 Ga0207647_104520582 120
758 3300025907 Ga0207645_10000716 Ga0207645_1000071610 120
759 3300025909 Ga0207705_10015509 Ga0207705_100155095 120
760 3300025909 Ga0207705_10128970 Ga0207705_101289702 120
761 3300025909 Ga0207705_10834983 Ga0207705_108349832 120
762 3300025911 Ga0207654_10000765 Ga0207654_100007653 120
763 3300025911 Ga0207654_10002286 Ga0207654_100022867 120
764 3300025911 Ga0207654_10667864 Ga0207654_106678641 120
765 3300025911 Ga0207654_11110138 Ga0207654_111101382 120
766 3300025912 Ga0207707_10000317 Ga0207707_1000031735 120
767 3300025912 Ga0207707_10032387 Ga0207707_100323873 120
768 3300025913 Ga0207695_10000130 Ga0207695_1000013036 120
769 3300025913 Ga0207695_10000170 Ga0207695_10000170151 120
770 3300025913 Ga0207695_10001252 Ga0207695_1000125221 120
771 3300025913 Ga0207695_10003385 Ga0207695_100033852 120
772 3300025913 Ga0207695_10005660 Ga0207695_100056605 120
773 3300025913 Ga0207695_10019730 Ga0207695_100197302 120
774 3300025913 Ga0207695_10082396 Ga0207695_100823962 120
775 3300025913 Ga0207695_10122313 Ga0207695_101223133 120
776 3300025913 Ga0207695_10146013 Ga0207695_101460132 120
777 3300025913 Ga0207695_10496260 Ga0207695_104962601 120
778 3300025914 Ga0207671_10003613 Ga0207671_100036133 120
779 3300025914 Ga0207671_10006005 Ga0207671_100060056 120
780 3300025914 Ga0207671_10099825 Ga0207671_100998253 120
781 3300025914 Ga0207671_10334900 Ga0207671_103349001 120
782 3300025914 Ga0207671_10511850 Ga0207671_105118501 120
783 3300025917 Ga0207660_10001972 Ga0207660_1000197210 120
784 3300025918 Ga0207662_10045504 Ga0207662_100455042 120
785 3300025918 Ga0207662_10271871 Ga0207662_102718712 120
786 3300025919 Ga0207657_10115523 Ga0207657_101155232 120
787 3300025921 Ga0207652_10000456 Ga0207652_1000045621 120
788 3300025924 Ga0207694_10010257 Ga0207694_100102574 120
789 3300025924 Ga0207694_10326039 Ga0207694_103260393 120
790 3300025924 Ga0207694_10461571 Ga0207694_104615712 120
791 3300025924 Ga0207694_10554200 Ga0207694_105542002 120
792 3300025925 Ga0207650_10061157 Ga0207650_100611573 120
793 3300025925 Ga0207650_10110693 Ga0207650_101106932 120
794 3300025926 Ga0207659_10737889 Ga0207659_107378892 120
795 3300025926 Ga0207659_11515077 Ga0207659_115150771 120
796 3300025931 Ga0207644_10084955 Ga0207644_100849551 120
797 3300025931 Ga0207644_10210051 Ga0207644_102100512 120
798 3300025933 Ga0207706_10002658 Ga0207706_1000265819 120
799 3300025933 Ga0207706_10763496 Ga0207706_107634962 120
800 3300025936 Ga0207670_10870212 Ga0207670_108702122 120
801 3300025938 Ga0207704_10001715 Ga0207704_100017157 120
802 3300025938 Ga0207704_10055030 Ga0207704_100550303 120
803 3300025940 Ga0207691_10000013 Ga0207691_1000001372 120
804 3300025940 Ga0207691_10016423 Ga0207691_100164238 120
805 3300025940 Ga0207691_10533510 Ga0207691_105335102 120
806 3300025940 Ga0207691_10950959 Ga0207691_109509592 120
807 3300025941 Ga0207711_10121595 Ga0207711_101215953 120
808 3300025942 Ga0207689_10111224 Ga0207689_101112242 120
809 3300025942 Ga0207689_10132759 Ga0207689_101327593 120
810 3300025944 Ga0207661_10015513 Ga0207661_100155133 120
811 3300025945 Ga0207679_10161133 Ga0207679_101611333 120
812 3300025949 Ga0207667_10000876 Ga0207667_1000087614 120
813 3300025949 Ga0207667_10005154 Ga0207667_100051544 120
814 3300025949 Ga0207667_10010158 Ga0207667_1001015812 120
815 3300025949 Ga0207667_10039331 Ga0207667_100393314 120
816 3300025949 Ga0207667_10050854 Ga0207667_100508544 120
817 3300025949 Ga0207667_10053350 Ga0207667_100533504 120
818 3300025949 Ga0207667_10474131 Ga0207667_104741312 120
819 3300025960 Ga0207651_10000468 Ga0207651_1000046814 120
820 3300025961 Ga0207712_10019045 Ga0207712_100190452 120
821 3300025972 Ga0207668_10000295 Ga0207668_100002955 120
822 3300025972 Ga0207668_10462652 Ga0207668_104626522 120
823 3300025972 Ga0207668_10732966 Ga0207668_107329661 120
824 3300025981 Ga0207640_10022361 Ga0207640_100223613 120
825 3300025986 Ga0207658_10005989 Ga0207658_100059894 120
826 3300025986 Ga0207658_10039948 Ga0207658_100399482 120
827 3300025986 Ga0207658_10136739 Ga0207658_101367392 120
828 3300025986 Ga0207658_10532619 Ga0207658_105326192 120
829 3300025986 Ga0207658_11101638 Ga0207658_111016381 120
830 3300025986 Ga0207658_11116102 Ga0207658_111161022 120
831 3300026023 Ga0207677_10020249 Ga0207677_100202493 120
832 3300026023 Ga0207677_10054092 Ga0207677_100540922 120
833 3300026023 Ga0207677_10894324 Ga0207677_108943242 120
834 3300026035 Ga0207703_10001005 Ga0207703_100010056 120
835 3300026035 Ga0207703_10695737 Ga0207703_106957372 120
836 3300026041 Ga0207639_10001884 Ga0207639_100018848 120
837 3300026041 Ga0207639_10079293 Ga0207639_100792933 120
838 3300026041 Ga0207639_10130798 Ga0207639_101307982 120
839 3300026041 Ga0207639_10329654 Ga0207639_103296542 120
840 3300026041 Ga0207639_10347899 Ga0207639_103478992 120
841 3300026041 Ga0207639_11082349 Ga0207639_110823491 120
842 3300026041 Ga0207639_11233658 Ga0207639_112336581 120
843 3300026041 Ga0207639_11877624 Ga0207639_118776241 120
844 3300026078 Ga0207702_10074911 Ga0207702_100749113 120
845 3300026088 Ga0207641_10005007 Ga0207641_100050079 120
846 3300026088 Ga0207641_10013024 Ga0207641_100130243 120
847 3300026089 Ga0207648_10006608 Ga0207648_100066088 120
848 3300026089 Ga0207648_10119591 Ga0207648_101195913 120
849 3300026089 Ga0207648_10292252 Ga0207648_102922522 120
850 3300026089 Ga0207648_10576955 Ga0207648_105769552 120
851 3300026089 Ga0207648_11697011 Ga0207648_116970111 120
852 3300026095 Ga0207676_10016838 Ga0207676_100168386 120
853 3300026095 Ga0207676_10038335 Ga0207676_100383352 120
854 3300026116 Ga0207674_10002964 Ga0207674_1000296413 120
855 3300026116 Ga0207674_10517136 Ga0207674_105171362 120
856 3300026116 Ga0207674_11580605 Ga0207674_115806051 120
857 3300026118 Ga0207675_100268394 Ga0207675_1002683942 120
858 3300026121 Ga0207683_10045175 Ga0207683_100451752 120
859 3300026121 Ga0207683_10747903 Ga0207683_107479031 120
860 3300026142 Ga0207698_10078635 Ga0207698_100786353 120
861 3300026142 Ga0207698_10113740 Ga0207698_101137403 120
862 3300026142 Ga0207698_10242966 Ga0207698_102429662 120
863 3300027360 Ga0209969_1046382 Ga0209969_10463822 120
864 3300027543 Ga0209999_1059873 Ga0209999_10598732 120
865 3300028379 Ga0268266_10000024 Ga0268266_10000024204 120
866 3300028379 Ga0268266_10003677 Ga0268266_1000367716 120
867 3300028379 Ga0268266_10007487 Ga0268266_100074875 120
868 3300028381 Ga0268264_10000109 Ga0268264_10000109122 120
869 3300028381 Ga0268264_10009730 Ga0268264_100097303 120
870 3300028381 Ga0268264_10014974 Ga0268264_100149742 120
871 3300028381 Ga0268264_10386704 Ga0268264_103867041 120
872 3300028786 Ga0307517_10004572 Ga0307517_100045725 120
873 3300028794 Ga0307515_10000010 Ga0307515_10000010186 120
874 3300029957 Ga0265324_10182885 Ga0265324_101828852 120
875 3300030521 Ga0307511_10000455 Ga0307511_100004558 120
876 3300030731 Ga0316177_1021152 Ga0316177_10211521 120
877 3300031251 Ga0265327_10000009 Ga0265327_10000009318 120
878 3300031251 Ga0265327_10004167 Ga0265327_100041675 120
879 3300031344 Ga0265316_10138506 Ga0265316_101385062 120
880 3300031507 Ga0307509_10079477 Ga0307509_100794772 120
881 3300031595 Ga0265313_10054220 Ga0265313_100542201 120
882 3300031616 Ga0307508_10266298 Ga0307508_102662983 120
883 3300031730 Ga0307516_10286305 Ga0307516_102863052 120
884 3300033179 Ga0307507_10486053 Ga0307507_104860532 120
885 3300035113 Ga0373936_0318064 Ga0373936_0318064_157_561 120
886 3300035114 Ga0373939_0180524 Ga0373939_0180524_72_473 120
887 3300035692 Ga0373935_0216448 Ga0373935_0216448_306_710 120
888 3300035695 Ga0373927_0045920 Ga0373927_0045920_837_1238 120
889 3300036401 Ga0373937_0474512 Ga0373937_0474512_59_463 120
890 3300037068 Ga0373925_0540967 Ga0373925_0540967_76_477 120
891 3300039437 Ga0436365_0090513 Ga0436365_0090513_9716_10117 120
892 3300039447 Ga0436361_0102070 Ga0436361_0102070_1075_1479 120
893 3300041404 Ga0439436_0006422 Ga0439436_0006422_3015_3416 120
894 3300041406 Ga0439439_0221112 Ga0439439_0221112_140_541 120
895 3300041413 Ga0439465_0093575 Ga0439465_0093575_236_646 120
896 3300041441 Ga0451787_098082 Ga0451787_098082_84_485 120
897 3300041453 Ga0451797_0679504 Ga0451797_0679504_13_414 120
898 3300041459 Ga0451800_1624960 Ga0451800_1624960_56_457 120
899 3300041460 Ga0451802_0508158 Ga0451802_0508158_689_1090 120
900 3300041460 Ga0451802_1818999 Ga0451802_1818999_552_953 120
901 3300041486 Ga0451807_0677323 Ga0451807_0677323_98_502 120
902 3300041491 Ga0451833_1095634 Ga0451833_1095634_355_756 120
903 3300041492 Ga0451835_0691656 Ga0451835_0691656_680_1081 120
904 3300041498 Ga0451841_0596099 Ga0451841_0596099_71_472 120
905 3300041507 Ga0451851_0019816 Ga0451851_0019816_533_931 120
906 3300041511 Ga0451855_0703264 Ga0451855_0703264_84_485 120
907 3300041512 Ga0451853_1034895 Ga0451853_1034895_403_804 120
908 3300041997 Ga0439431_0022343 Ga0439431_0022343_847_1257 120
909 3300042007 Ga0439449_0040120 Ga0439449_0040120_373_774 120
910 3300042014 Ga0439457_003389 Ga0439457_003389_475_876 120
911 3300042015 Ga0439462_0014919 Ga0439462_0014919_696_1097 120
912 3300042876 Ga0451577_0009728 Ga0451577_0009728_4040_4435 120
913 3300042876 Ga0451577_0147917 Ga0451577_0147917_1180_1578 120
914 3300042876 Ga0451577_0204822 Ga0451577_0204822_43_438 120
915 3300042876 Ga0451577_0548777 Ga0451577_0548777_391_789 120
916 3300042876 Ga0451577_1634822 Ga0451577_1634822_94_498 120
917 3300044656 Ga0466969_0000149 Ga0466969_0000149_34582_34983 120
918 3300044656 Ga0466969_0055902 Ga0466969_0055902_443_847 120
919 3300044658 Ga0466972_0000013 Ga0466972_0000013_158949_159350 120
920 3300044658 Ga0466972_0009022 Ga0466972_0009022_2820_3224 120
921 3300044658 Ga0466972_0055893 Ga0466972_0055893_284_685 120
922 3300044683 Ga0466965_0016082 Ga0466965_0016082_1588_1992 120
923 3300044684 Ga0466966_0541218 Ga0466966_0541218_37_441 120
924 3300044693 Ga0466961_0018040 Ga0466961_0018040_3840_4244 120
925 3300044706 Ga0466964_0013676 Ga0466964_0013676_751_1152 120
926 3300044706 Ga0466964_0110784 Ga0466964_0110784_140_544 120
927 3300044712 Ga0453684_0054028 Ga0453684_0054028_4306_4704 120
928 3300044712 Ga0453684_0192811 Ga0453684_0192811_1378_1773 120
929 3300044712 Ga0453684_0462562 Ga0453684_0462562_296_694 120
930 3300044719 Ga0466971_0043276 Ga0466971_0043276_1059_1463 120
931 3300044719 Ga0466971_0410629 Ga0466971_0410629_142_546 120
932 3300044735 Ga0466968_0031740 Ga0466968_0031740_1412_1813 120
933 3300044735 Ga0466968_0373239 Ga0466968_0373239_117_521 120
934 3300044765 Ga0466970_0112116 Ga0466970_0112116_321_725 120
935 3300044765 Ga0466970_0214363 Ga0466970_0214363_45_449 120
936 3300044842 Ga0466957_0001230 Ga0466957_0001230_11979_12380 120
937 3300044842 Ga0466957_0008061 Ga0466957_0008061_816_1217 120
938 3300044842 Ga0466957_0207593 Ga0466957_0207593_128_532 120
939 3300044842 Ga0466957_0281260 Ga0466957_0281260_547_951 120
940 3300045049 Ga0466959_0000023 Ga0466959_0000023_3383_3784 120
941 3300045049 Ga0466959_0002751 Ga0466959_0002751_929_1333 120
942 3300045051 Ga0451576_0345050 Ga0451576_0345050_1092_1487 120
943 3300045836 Ga0466958_0033971 Ga0466958_0033971_2066_2470 120
944 3300046453 Ga0495627_002397 Ga0495627_002397_6749_7159 120
945 3300046460 Ga0495638_0114742 Ga0495638_0114742_292_696 120
946 3300046462 Ga0495651_0447595 Ga0495651_0447595_407_811 120
947 3300046462 Ga0495651_0714589 Ga0495651_0714589_84_488 120
948 3300046463 Ga0495653_0828790 Ga0495653_0828790_16_420 120
949 3300046472 Ga0495580_0135454 Ga0495580_0135454_52_456 120
950 3300046472 Ga0495580_0337634 Ga0495580_0337634_567_974 120
951 3300046517 Ga0495630_0189077 Ga0495630_0189077_1108_1512 120
952 3300046519 Ga0495632_0148631 Ga0495632_0148631_297_707 120
953 3300046519 Ga0495632_0324580 Ga0495632_0324580_92_493 120
954 3300046524 Ga0495648_0265597 Ga0495648_0265597_187_591 120
955 3300046539 Ga0495621_0478100 Ga0495621_0478100_54_458 120
956 3300046543 Ga0495645_0732894 Ga0495645_0732894_173_577 120
957 3300046558 Ga0495633_0000058 Ga0495633_0000058_53527_53937 120
958 3300046558 Ga0495633_0028198 Ga0495633_0028198_230_634 120
959 3300046559 Ga0495667_0673626 Ga0495667_0673626_46_450 120
960 3300046648 Ga0495611_0000883 Ga0495611_0000883_4868_5272 120
961 3300046681 Ga0495647_0091463 Ga0495647_0091463_499_903 120
962 3300046691 Ga0495670_0070067 Ga0495670_0070067_692_1096 120
963 3300046694 Ga0495649_0153742 Ga0495649_0153742_602_1006 120
964 3300046694 Ga0495649_0245781 Ga0495649_0245781_461_865 120
965 3300047319 Ga0495674_0429891 Ga0495674_0429891_561_965 120
966 3300047319 Ga0495674_0443521 Ga0495674_0443521_132_536 120
967 3300047320 Ga0495672_0015969 Ga0495672_0015969_1045_1449 120
968 3300047320 Ga0495672_0172061 Ga0495672_0172061_211_615 120
969 3300047322 Ga0495680_0454391 Ga0495680_0454391_259_663 120
970 3300047443 Ga0495687_000014 Ga0495687_000014_141499_141903 120
971 3300047472 Ga0495686_0000034 Ga0495686_0000034_219126_219530 120
972 3300048088 Ga0495602_0334819 Ga0495602_0334819_647_1051 120
973 3300048905 Ga0496102_0791356 Ga0496102_0791356_368_772 120
974 3300048911 Ga0496108_0642207 Ga0496108_0642207_200_604 120
975 3300048924 Ga0496121_0000343 Ga0496121_0000343_59503_59919 120
976 3300048929 Ga0496126_0015334 Ga0496126_0015334_2542_2952 120
977 3300049569 Ga0501032_0520407 Ga0501032_0520407_172_567 120
978 3300049570 Ga0501033_0569298 Ga0501033_0569298_40_435 120
979 3300049571 Ga0501034_0076420 Ga0501034_0076420_1098_1493 120
980 3300049571 Ga0501034_0127733 Ga0501034_0127733_1269_1673 120
981 3300049571 Ga0501034_0556429 Ga0501034_0556429_437_838 120
982 3300049572 Ga0501036_1119338 Ga0501036_1119338_112_507 120
983 3300049573 Ga0501037_0101058 Ga0501037_0101058_858_1253 120
984 3300049574 Ga0501038_1057760 Ga0501038_1057760_84_488 120
985 3300049579 Ga0501043_0163965 Ga0501043_0163965_11_412 120
986 3300049579 Ga0501043_0169642 Ga0501043_0169642_626_1027 120
987 3300049579 Ga0501043_0481483 Ga0501043_0481483_82_477 120
988 3300049580 Ga0501046_0253019 Ga0501046_0253019_599_1003 120
989 3300049581 Ga0501047_0013459 Ga0501047_0013459_6731_7132 120
990 3300049581 Ga0501047_0034117 Ga0501047_0034117_3790_4191 120
991 3300049581 Ga0501047_0318956 Ga0501047_0318956_144_539 120
992 3300049581 Ga0501047_0847117 Ga0501047_0847117_123_527 120
993 3300049582 Ga0501048_0393024 Ga0501048_0393024_207_608 120
994 3300049582 Ga0501048_0481198 Ga0501048_0481198_280_684 120
995 3300049583 Ga0501067_0020451 Ga0501067_0020451_515_919 120
996 3300049584 Ga0501068_0158276 Ga0501068_0158276_346_750 120
997 3300049585 Ga0501069_0071502 Ga0501069_0071502_1320_1724 120
998 3300049586 Ga0501070_0350320 Ga0501070_0350320_491_895 120
999 3300049587 Ga0501071_0427149 Ga0501071_0427149_452_856 120
1000 3300049589 Ga0501073_0032565 Ga0501073_0032565_489_893 120
1001 3300049590 Ga0501074_0393963 Ga0501074_0393963_413_817 120
1002 3300049591 Ga0501075_0443545 Ga0501075_0443545_314_718 120
1003 3300049592 Ga0501076_1319878 Ga0501076_1319878_76_480 120
1004 3300049653 Ga0501206_015621 Ga0501206_015621_315_716 120
1005 3300049686 Ga0501257_005850 Ga0501257_005850_688_1089 120
1006 3300049705 Ga0501225_0000104 Ga0501225_0000104_3926_4327 120
1007 3300049705 Ga0501225_0268064 Ga0501225_0268064_89_490 120
1008 3300049741 Ga0501079_0239449 Ga0501079_0239449_737_1141 120
1009 3300049742 Ga0501080_0166988 Ga0501080_0166988_1316_1720 120
1010 3300049742 Ga0501080_0173150 Ga0501080_0173150_210_614 120
1011 3300049744 Ga0501083_0324308 Ga0501083_0324308_501_905 120
1012 3300049744 Ga0501083_0494973 Ga0501083_0494973_225_629 120
1013 3300049758 Ga0501241_001363 Ga0501241_001363_2468_2878 120
1014 3300049822 Ga0501035_0287587 Ga0501035_0287587_149_553 120
1015 3300049822 Ga0501035_0735828 Ga0501035_0735828_279_680 120
1016 3300049823 Ga0501044_0008528 Ga0501044_0008528_9353_9754 120
1017 3300049823 Ga0501044_0119948 Ga0501044_0119948_1080_1484 120
1018 3300049823 Ga0501044_0468793 Ga0501044_0468793_160_561 120
1019 3300050493 nmdc:mga0k408_129423_c1 nmdc:mga0k408_129423_c1_209_610 120
1020 3300050507 nmdc:mga05p37_1165314_c1 nmdc:mga05p37_1165314_c1_72_476 120
1021 3300050507 nmdc:mga05p37_19037_c1 nmdc:mga05p37_19037_c1_1668_2069 120
1022 3300050507 nmdc:mga05p37_85001_c1 nmdc:mga05p37_85001_c1_1865_2272 120
1023 3300050508 nmdc:mga09592_19444_c1 nmdc:mga09592_19444_c1_1159_1566 120
1024 3300050508 nmdc:mga09592_320115_c1 nmdc:mga09592_320115_c1_204_608 120
1025 3300050509 nmdc:mga0qj67_117394_c1 nmdc:mga0qj67_117394_c1_1707_2111 120
1026 3300050509 nmdc:mga0qj67_220327_c1 nmdc:mga0qj67_220327_c1_520_927 120
1027 3300050510 nmdc:mga06r32_87315_c1 nmdc:mga06r32_87315_c1_32_436 120
1028 3300050511 nmdc:mga08y16_1891338_c1 nmdc:mga08y16_1891338_c1_92_496 120
1029 3300050511 nmdc:mga08y16_295496_c1 nmdc:mga08y16_295496_c1_309_710 120
1030 3300050512 nmdc:mga0n895_1405155_c1 nmdc:mga0n895_1405155_c1_241_648 120
1031 3300053085 Ga0495619_1084585 Ga0495619_1084585_75_479 120
1032 3300053086 Ga0500578_0000155 Ga0500578_0000155_55376_55777 120
1033 3300053086 Ga0500578_0025346 Ga0500578_0025346_445_846 120
1034 3300053086 Ga0500578_0476921 Ga0500578_0476921_99_500 120
1035 3300053088 Ga0500644_0104298 Ga0500644_0104298_558_962 120
1036 3300053089 Ga0500581_347230 Ga0500581_347230_29_430 120
1037 3300053090 Ga0500646_0008848 Ga0500646_0008848_94_504 120
1038 3300053090 Ga0500646_0015297 Ga0500646_0015297_1198_1599 120
1039 3300053090 Ga0500646_0065725 Ga0500646_0065725_278_679 120
1040 3300053092 Ga0500583_0000043 Ga0500583_0000043_18179_18580 120
1041 3300053092 Ga0500583_0000936 Ga0500583_0000936_1560_1961 120
1042 3300053092 Ga0500583_0012195 Ga0500583_0012195_1378_1782 120
1043 3300053093 Ga0500651_0102482 Ga0500651_0102482_21_431 120
1044 3300053093 Ga0500651_0132295 Ga0500651_0132295_443_853 120
1045 3300053093 Ga0500651_0409219 Ga0500651_0409219_343_744 120
1046 3300053102 Ga0500554_023107 Ga0500554_023107_291_692 120
1047 3300053116 Ga0500592_003352 Ga0500592_003352_1251_1655 120
1048 3300053130 Ga0500642_0051616 Ga0500642_0051616_1155_1559 120
1049 3300053131 Ga0500652_002832 Ga0500652_002832_1499_1909 120
1050 3300053133 Ga0500655_044110 Ga0500655_044110_223_624 120
1051 3300053134 Ga0500658_0000550 Ga0500658_0000550_7339_7749 120
1052 3300053134 Ga0500658_0204766 Ga0500658_0204766_32_433 120
1053 3300053140 Ga0500573_0391559 Ga0500573_0391559_151_552 120
1054 3300053142 Ga0500577_0005752 Ga0500577_0005752_775_1185 120
1055 3300053147 Ga0500589_021847 Ga0500589_021847_112_513 120
1056 3300053153 Ga0500616_0023882 Ga0500616_0023882_2262_2672 120
1057 3300053153 Ga0500616_0058494 Ga0500616_0058494_294_695 120
1058 3300053153 Ga0500616_0146079 Ga0500616_0146079_355_759 120
1059 3300053156 Ga0500622_0007178 Ga0500622_0007178_3639_4040 120
1060 3300053156 Ga0500622_0029703 Ga0500622_0029703_1288_1692 120
1061 3300053156 Ga0500622_0099070 Ga0500622_0099070_693_1094 120
1062 3300053156 Ga0500622_0198805 Ga0500622_0198805_485_886 120
1063 3300053177 Ga0500636_0070130 Ga0500636_0070130_178_579 120
1064 3300053178 Ga0500637_0257405 Ga0500637_0257405_296_697 120
1065 3300053178 Ga0500637_0434532 Ga0500637_0434532_29_433 120
1066 3300053732 Ga0500656_070997 Ga0500656_070997_109_519 120
1067 3300053739 Ga0500587_011321 Ga0500587_011321_307_708 120
1068 3300054114 Ga0501084_0000686 Ga0501084_0000686_24039_24443 120
1069 3300055283 Ga0500661_008389 Ga0500661_008389_81_494 120
1070 3300060353 Ga0501082_0046764 Ga0501082_0046764_896_1300 120
1071 3300061719 Ga0466962_0402373 Ga0466962_0402373_65_466 120
1072 2162886007 SwRhRL2b_contig_2906961 SwRhRL2b_0428.00003550 121
1073 3300003323 rootH1_10320624 rootH1_103206243 121
1074 3300003578 Ga0006562J51391_1005593 Ga0006562J51391_10055932 121
1075 3300005288 Ga0065714_10005480 Ga0065714_100054804 121
1076 3300005288 Ga0065714_10006409 Ga0065714_100064091 121
1077 3300005288 Ga0065714_10042358 Ga0065714_100423582 121
1078 3300005288 Ga0065714_10163191 Ga0065714_101631911 121
1079 3300005288 Ga0065714_10169009 Ga0065714_101690092 121
1080 3300005288 Ga0065714_10307876 Ga0065714_103078762 121
1081 3300005289 Ga0065704_10074946 Ga0065704_100749464 121
1082 3300005289 Ga0065704_10093374 Ga0065704_100933744 121
1083 3300005293 Ga0065715_10032010 Ga0065715_100320102 121
1084 3300005293 Ga0065715_10135501 Ga0065715_101355011 121
1085 3300005293 Ga0065715_10154190 Ga0065715_101541901 121
1086 3300005293 Ga0065715_10228433 Ga0065715_102284332 121
1087 3300005293 Ga0065715_10236192 Ga0065715_102361922 121
1088 3300005293 Ga0065715_10238518 Ga0065715_102385182 121
1089 3300005293 Ga0065715_10359911 Ga0065715_103599112 121
1090 3300005293 Ga0065715_10501322 Ga0065715_105013222 121
1091 3300005337 Ga0070682_100058559 Ga0070682_1000585592 121
1092 3300005345 Ga0070692_11349284 Ga0070692_113492841 121
1093 3300005564 Ga0070664_100769485 Ga0070664_1007694852 121
1094 3300006946 Ga0079104_1000421 Ga0079104_100042137 121
1095 3300006948 Ga0099826_10000257 Ga0099826_1000025718 121
1096 3300009036 Ga0105244_10000057 Ga0105244_1000005742 121
1097 3300009092 Ga0105250_10086884 Ga0105250_100868841 121
1098 3300012505 Ga0157339_1058933 Ga0157339_10589331 121
1099 3300013100 Ga0157373_10012575 Ga0157373_100125757 121
1100 3300013102 Ga0157371_10248894 Ga0157371_102488942 121
1101 3300013104 Ga0157370_10017951 Ga0157370_100179517 121
1102 3300013104 Ga0157370_10027462 Ga0157370_100274625 121
1103 3300013104 Ga0157370_10042874 Ga0157370_100428743 121
1104 3300013104 Ga0157370_10105482 Ga0157370_101054822 121
1105 3300013104 Ga0157370_10121614 Ga0157370_101216143 121
1106 3300013105 Ga0157369_10004901 Ga0157369_100049013 121
1107 3300015261 Ga0182006_1016995 Ga0182006_10169952 121
1108 3300015261 Ga0182006_1022981 Ga0182006_10229812 121
1109 3300015261 Ga0182006_1030285 Ga0182006_10302853 121
1110 3300015261 Ga0182006_1039993 Ga0182006_10399932 121
1111 3300017792 Ga0163161_10027586 Ga0163161_100275865 121
1112 3300022467 Ga0224712_10579150 Ga0224712_105791502 121
1113 3300025711 Ga0207696_1111166 Ga0207696_11111662 121
1114 3300025728 Ga0207655_1000038 Ga0207655_1000038294 121
1115 3300025945 Ga0207679_10689972 Ga0207679_106899722 121
1116 3300027111 Ga0209281_1000570 Ga0209281_10005703 121
1117 3300027526 Ga0209968_1001511 Ga0209968_10015114 121
1118 3300027543 Ga0209999_1029439 Ga0209999_10294391 121
1119 3300027666 Ga0209282_1010717 Ga0209282_10107174 121
1120 3300027682 Ga0209971_1168392 Ga0209971_11683921 121
1121 3300027876 Ga0209974_10055137 Ga0209974_100551371 121
1122 3300028794 Ga0307515_10102798 Ga0307515_101027983 121
1123 3300030734 Ga0316179_1081379 Ga0316179_10813793 121
1124 3300031548 Ga0307408_100002005 Ga0307408_1000020057 121
1125 3300031731 Ga0307405_11624296 Ga0307405_116242961 121
1126 3300031824 Ga0307413_10000274 Ga0307413_1000027417 121
1127 3300031824 Ga0307413_10212917 Ga0307413_102129173 121
1128 3300031824 Ga0307413_11632368 Ga0307413_116323681 121
1129 3300031852 Ga0307410_10000048 Ga0307410_100000484 121
1130 3300031852 Ga0307410_10366619 Ga0307410_103666192 121
1131 3300031901 Ga0307406_10000004 Ga0307406_1000000443 121
1132 3300031901 Ga0307406_10207111 Ga0307406_102071112 121
1133 3300031903 Ga0307407_10084970 Ga0307407_100849702 121
1134 3300032002 Ga0307416_100003753 Ga0307416_10000375310 121
1135 3300032004 Ga0307414_10000051 Ga0307414_1000005133 121
1136 3300032004 Ga0307414_10045305 Ga0307414_100453053 121
1137 3300032004 Ga0307414_10836380 Ga0307414_108363801 121
1138 3300032004 Ga0307414_11773549 Ga0307414_117735491 121
1139 3300032005 Ga0307411_10000020 Ga0307411_1000002033 121
1140 3300032005 Ga0307411_10025263 Ga0307411_100252632 121
1141 3300033180 Ga0307510_10047929 Ga0307510_100479292 121
1142 3300041407 Ga0439447_001368 Ga0439447_001368_7003_7398 121
1143 3300041411 Ga0439466_0001833 Ga0439466_0001833_7169_7564 121
1144 3300041411 Ga0439466_0015264 Ga0439466_0015264_2197_2592 121
1145 3300041494 Ga0451837_1190987 Ga0451837_1190987_110_505 121
1146 3300046512 Ga0495610_0068951 Ga0495610_0068951_902_1297 121
1147 3300046660 Ga0495625_0303361 Ga0495625_0303361_263_658 121
1148 3300046692 Ga0495671_0018522 Ga0495671_0018522_593_988 121
1149 3300048919 Ga0496116_0000024 Ga0496116_0000024_23475_23870 121
1150 3300048920 Ga0496117_0099196 Ga0496117_0099196_1404_1799 121
1151 3300048921 Ga0496118_0017695 Ga0496118_0017695_5409_5804 121
1152 3300048924 Ga0496121_0592952 Ga0496121_0592952_233_628 121
1153 3300048927 Ga0496124_0026742 Ga0496124_0026742_1276_1671 121
1154 3300048927 Ga0496124_0567710 Ga0496124_0567710_16_411 121
1155 3300048928 Ga0496125_0000018 Ga0496125_0000018_456676_457071 121
1156 3300048929 Ga0496126_0129830 Ga0496126_0129830_1732_2127 121
1157 3300048929 Ga0496126_0884120 Ga0496126_0884120_264_659 121
1158 3300049530 Ga0501314_004831 Ga0501314_004831_722_1117 121
1159 3300049539 Ga0501323_042247 Ga0501323_042247_178_573 121
1160 3300049664 Ga0501224_032948 Ga0501224_032948_46_441 121
1161 3300049671 Ga0501238_000137 Ga0501238_000137_4024_4419 121
1162 3300049679 Ga0501249_000008 Ga0501249_000008_123986_124381 121
1163 3300049679 Ga0501249_046621 Ga0501249_046621_258_653 121
1164 3300049758 Ga0501241_024987 Ga0501241_024987_515_910 121
1165 3300049763 Ga0501266_000002 Ga0501266_000002_423283_423678 121
1166 3300053088 Ga0500644_0433852 Ga0500644_0433852_54_449 121
1167 3300053090 Ga0500646_0005321 Ga0500646_0005321_1071_1466 121
1168 3300053091 Ga0500647_0349435 Ga0500647_0349435_132_527 121
1169 3300053096 Ga0500641_0000008 Ga0500641_0000008_103198_103593 121
1170 3300053096 Ga0500641_0108557 Ga0500641_0108557_321_716 121
1171 3300053134 Ga0500658_0000002 Ga0500658_0000002_104676_105071 121
1172 3300053136 Ga0500559_0022943 Ga0500559_0022943_1268_1663 121
1173 3300053140 Ga0500573_0191533 Ga0500573_0191533_550_945 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

23

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8893 49 117
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8351 49 117
2pfu-assembly1.cif.gz_A nmr structure determination of the periplasmic domain of exbd from e.coli 0.8106 48 121
1z26-assembly1.cif.gz_A structure of pyrococcus furiosus argonaute with bound tungstate 0.7783 69 119
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7566 48 120
ID Description Score Start End Superfamily
af_Q60357_1_228_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.889 90 121 3.75.10.10
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8467 49 115 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8051 49 115 3.30.420.270
1zejA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.799 86 121 3.40.50.720
af_Q8I1V9_11_208_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.767 70 119 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7Z9FA47-F1-model_v4 Protein TolR 0.9405 48 120 GO:0005886
GO:0015031
GO:0022857
AF-A0A3D6A0Z2-F1-model_v4 deleted 0.9009 48 121
AF-X1KHT6-F1-model_v4 Biopolymer transporter ExbD 0.8958 48 121 GO:0005886
GO:0022857
AF-A0A2D9BSU1-F1-model_v4 deleted 0.874 33 121
AF-A0A0R2UZN4-F1-model_v4 Biopolymer transporter ExbD 0.8705 33 121 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.1 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map