F491154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 611 | 2340 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300046615|Ga0495656_0192502|Ga0495656_0192502_73_807 |
| Length | 234 |
| Sequence | MIVLYGFGAGFGLPEKSPFVTKTEVQLKMAGLAYRKDRAMPPASPKGQLPYIVDEAETIADSTFIRAHLEGKYGFDFDAPLSLQQRAQAWAFERMIEHHVYWALIGARWVDAENFARGPAHFFDHVDAQFRVAENYLLSGLGRHAPDEDIDLAMRSLFALSVQLGDKRYLMGEEPCGTDATAFGALAGILTPFFDSSLRERAEKFDNLTAYVERMMRQYYPEFAWKRVQEAEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 84 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 116 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 117 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 118 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 372 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 373 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 374 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 375 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 378 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 379 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 380 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 407 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 414 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 415 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 416 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 420 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 421 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 424 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053112 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere | Metagenome | Endosphere |
| 426 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 428 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 430 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 431 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 433 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 437 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 438 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 442 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 444 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 446 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 448 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 449 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 450 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 451 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 452 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 453 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 454 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 455 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 456 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 457 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 458 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 459 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 460 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 461 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 462 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 463 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 464 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 465 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 466 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 467 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 468 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 469 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 470 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 471 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 472 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 473 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 474 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 475 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 476 | 2791355199 | |||
| 477 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 478 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 479 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 480 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 481 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 482 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 483 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 484 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 485 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 486 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 487 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 488 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 489 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 490 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 491 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 492 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 493 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 494 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 495 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 496 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 497 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 498 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 499 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 500 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 501 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 502 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 503 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 504 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 505 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 506 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 507 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 508 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 509 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 510 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 511 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 512 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 513 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 514 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 515 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 516 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 517 | 2904699407 | |||
| 518 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 519 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 520 | 2906610324 | |||
| 521 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 522 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 523 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 524 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 525 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 526 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 527 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 528 | 2922368715 | |||
| 529 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 530 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 531 | 2922425934 | |||
| 532 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 533 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 534 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 535 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 536 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 537 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 538 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 539 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 540 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 541 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 542 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 543 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 544 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 545 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 546 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 547 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 548 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 549 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 550 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 551 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 552 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 553 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 554 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 555 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 556 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 557 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 558 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 559 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 560 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 561 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 562 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 563 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 564 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 565 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 566 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 567 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 568 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 569 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 570 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 571 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 572 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 573 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 574 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 575 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 576 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 577 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 578 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 579 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 580 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 581 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 582 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 583 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 584 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 585 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 586 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 587 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 588 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 589 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 590 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 591 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 592 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 593 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 594 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 595 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 596 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 597 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 598 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 599 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 600 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 601 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 602 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 603 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 604 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 605 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 606 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 607 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 608 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 609 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 610 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 611 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.78 |
| Metatranscriptomes | 0.09 |
| Isolates | 13.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.34 |
| Nodule | 10.6 |
| Rhizoplane | 5.64 |
| Rhizosphere | 63.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495656_0192502 | 3300046615 | Bacteria | 1008 |
| 2 | JGI25153J46596_10013389 | 3300003215 | Bacteria | 3465 |
| 3 | JGI25153J46596_10013655 | 3300003215 | Bacteria | 3420 |
| 4 | JGI25153J46596_10040464 | 3300003215 | Bacteria | 1444 |
| 5 | JGI25153J46596_10045812 | 3300003215 | Bacteria | 1301 |
| 6 | JGI25153J46596_10076198 | 3300003215 | Bacteria | 850 |
| 7 | rootL2_10122041 | 3300003322 | Bacteria | 1513 |
| 8 | JGI25160J50197_1002871 | 3300003354 | Bacteria | 7885 |
| 9 | JGI25404J52841_10019494 | 3300003659 | Bacteria | 1470 |
| 10 | Ga0055525_1002489 | 3300003759 | Bacteria | 1861 |
| 11 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 12 | Ga0070690_100162447 | 3300005330 | Bacteria | 1532 |
| 13 | Ga0068869_100030464 | 3300005334 | Bacteria | 3787 |
| 14 | Ga0068869_100042868 | 3300005334 | Bacteria | 3247 |
| 15 | Ga0070680_100013830 | 3300005336 | Bacteria | 6296 |
| 16 | Ga0070680_100017794 | 3300005336 | Bacteria | 5606 |
| 17 | Ga0070680_100032348 | 3300005336 | Bacteria | 4210 |
| 18 | Ga0070680_100228026 | 3300005336 | Bacteria | 1573 |
| 19 | Ga0070682_100023695 | 3300005337 | Bacteria | 3646 |
| 20 | Ga0070682_100027255 | 3300005337 | Bacteria | 3428 |
| 21 | Ga0070682_100414809 | 3300005337 | Bacteria | 1022 |
| 22 | Ga0068868_100050101 | 3300005338 | Bacteria | 3278 |
| 23 | Ga0068868_100077577 | 3300005338 | Bacteria | 2658 |
| 24 | Ga0068868_100358432 | 3300005338 | Bacteria | 1250 |
| 25 | Ga0070660_100003692 | 3300005339 | Bacteria | 10562 |
| 26 | Ga0070691_10062410 | 3300005341 | Bacteria | 1794 |
| 27 | Ga0070691_10207719 | 3300005341 | Bacteria | 1032 |
| 28 | Ga0070661_100095335 | 3300005344 | Bacteria | 2207 |
| 29 | Ga0070661_100097802 | 3300005344 | Bacteria | 2180 |
| 30 | Ga0070661_100114667 | 3300005344 | Bacteria | 2014 |
| 31 | Ga0070692_10152887 | 3300005345 | Bacteria | 1316 |
| 32 | Ga0070668_100096703 | 3300005347 | Bacteria | 2334 |
| 33 | Ga0070669_100105002 | 3300005353 | Bacteria | 2136 |
| 34 | Ga0070671_100450820 | 3300005355 | Bacteria | 1104 |
| 35 | Ga0070659_100077774 | 3300005366 | Bacteria | 2646 |
| 36 | Ga0070659_100348156 | 3300005366 | Bacteria | 1242 |
| 37 | Ga0070709_10001773 | 3300005434 | Bacteria | 11730 |
| 38 | Ga0070709_10003406 | 3300005434 | Bacteria | 8539 |
| 39 | Ga0070709_10028284 | 3300005434 | Bacteria | 3342 |
| 40 | Ga0070709_10398656 | 3300005434 | Bacteria | 1027 |
| 41 | Ga0070714_100004471 | 3300005435 | Bacteria | 10536 |
| 42 | Ga0070714_100005064 | 3300005435 | Bacteria | 10027 |
| 43 | Ga0070714_100005907 | 3300005435 | Bacteria | 9391 |
| 44 | Ga0070714_100181026 | 3300005435 | Bacteria | 1918 |
| 45 | Ga0070713_100010463 | 3300005436 | Bacteria | 6700 |
| 46 | Ga0070713_100025937 | 3300005436 | Bacteria | 4592 |
| 47 | Ga0070713_100054896 | 3300005436 | Bacteria | 3308 |
| 48 | Ga0070713_100218156 | 3300005436 | Bacteria | 1730 |
| 49 | Ga0070713_100269513 | 3300005436 | Bacteria | 1559 |
| 50 | Ga0070710_10000733 | 3300005437 | Bacteria | 15629 |
| 51 | Ga0070710_10002547 | 3300005437 | Bacteria | 8649 |
| 52 | Ga0070710_10394655 | 3300005437 | Bacteria | 926 |
| 53 | Ga0070711_100002277 | 3300005439 | Bacteria | 10885 |
| 54 | Ga0070711_100005722 | 3300005439 | Bacteria | 7454 |
| 55 | Ga0070711_100017022 | 3300005439 | Bacteria | 4623 |
| 56 | Ga0070694_100163094 | 3300005444 | Bacteria | 1637 |
| 57 | Ga0070708_100105209 | 3300005445 | Bacteria | 2589 |
| 58 | Ga0070663_100056890 | 3300005455 | Bacteria | 2804 |
| 59 | Ga0070663_100086623 | 3300005455 | Bacteria | 2313 |
| 60 | Ga0070678_100122527 | 3300005456 | Bacteria | 2053 |
| 61 | Ga0070678_100293761 | 3300005456 | Bacteria | 1379 |
| 62 | Ga0070662_100102062 | 3300005457 | Bacteria | 2172 |
| 63 | Ga0070662_100349195 | 3300005457 | Bacteria | 1212 |
| 64 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 65 | Ga0070681_10007888 | 3300005458 | Bacteria | 10418 |
| 66 | Ga0070681_10209066 | 3300005458 | Bacteria | 1868 |
| 67 | Ga0070681_10379274 | 3300005458 | Bacteria | 1325 |
| 68 | Ga0068867_100068488 | 3300005459 | Bacteria | 2648 |
| 69 | Ga0070685_10079531 | 3300005466 | Bacteria | 1962 |
| 70 | Ga0070707_100131877 | 3300005468 | Bacteria | 2430 |
| 71 | Ga0070698_100428292 | 3300005471 | Bacteria | 1258 |
| 72 | Ga0070679_100084060 | 3300005530 | Bacteria | 3171 |
| 73 | Ga0070679_100117260 | 3300005530 | Bacteria | 2647 |
| 74 | Ga0070679_100166544 | 3300005530 | Bacteria | 2177 |
| 75 | Ga0070679_100348053 | 3300005530 | Bacteria | 1430 |
| 76 | Ga0070684_100001671 | 3300005535 | Bacteria | 16123 |
| 77 | Ga0070684_100003951 | 3300005535 | Bacteria | 11230 |
| 78 | Ga0070684_100027263 | 3300005535 | Bacteria | 4819 |
| 79 | Ga0070697_100054323 | 3300005536 | Bacteria | 3256 |
| 80 | Ga0070697_100286595 | 3300005536 | Bacteria | 1414 |
| 81 | Ga0068853_100009612 | 3300005539 | Bacteria | 7791 |
| 82 | Ga0068853_100073793 | 3300005539 | Bacteria | 2975 |
| 83 | Ga0068853_100112298 | 3300005539 | Bacteria | 2422 |
| 84 | Ga0068853_100304088 | 3300005539 | Bacteria | 1475 |
| 85 | Ga0068853_100616768 | 3300005539 | Bacteria | 1031 |
| 86 | Ga0070672_100154936 | 3300005543 | Bacteria | 1897 |
| 87 | Ga0070672_100188111 | 3300005543 | Bacteria | 1723 |
| 88 | Ga0070686_100157948 | 3300005544 | Bacteria | 1594 |
| 89 | Ga0070696_100431094 | 3300005546 | Bacteria | 1037 |
| 90 | Ga0070693_100094519 | 3300005547 | Bacteria | 1809 |
| 91 | Ga0070665_100006775 | 3300005548 | Bacteria | 11646 |
| 92 | Ga0070665_100117081 | 3300005548 | Bacteria | 2667 |
| 93 | Ga0070665_100213675 | 3300005548 | Bacteria | 1929 |
| 94 | Ga0070665_100383785 | 3300005548 | Bacteria | 1412 |
| 95 | Ga0068855_100027307 | 3300005563 | Bacteria | 6830 |
| 96 | Ga0068855_100090289 | 3300005563 | Bacteria | 3536 |
| 97 | Ga0068855_100249115 | 3300005563 | Bacteria | 1982 |
| 98 | Ga0068855_100479688 | 3300005563 | Bacteria | 1354 |
| 99 | Ga0068855_100503047 | 3300005563 | Bacteria | 1316 |
| 100 | Ga0070664_100097000 | 3300005564 | Bacteria | 2559 |
| 101 | Ga0070664_100494768 | 3300005564 | Bacteria | 1126 |
| 102 | Ga0068857_100013087 | 3300005577 | Bacteria | 7230 |
| 103 | Ga0068857_100118930 | 3300005577 | Bacteria | 2378 |
| 104 | Ga0068857_100154049 | 3300005577 | Bacteria | 2083 |
| 105 | Ga0068857_100918523 | 3300005577 | Bacteria | 840 |
| 106 | Ga0068854_100114761 | 3300005578 | Bacteria | 2037 |
| 107 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 108 | Ga0068856_100164748 | 3300005614 | Bacteria | 2228 |
| 109 | Ga0068856_100450497 | 3300005614 | Bacteria | 1308 |
| 110 | Ga0068856_100697101 | 3300005614 | Bacteria | 1036 |
| 111 | Ga0070702_100263453 | 3300005615 | Bacteria | 1175 |
| 112 | Ga0070702_100327108 | 3300005615 | Bacteria | 1070 |
| 113 | Ga0068852_100045438 | 3300005616 | Bacteria | 3735 |
| 114 | Ga0068852_100114236 | 3300005616 | Bacteria | 2460 |
| 115 | Ga0068852_100249598 | 3300005616 | Bacteria | 1700 |
| 116 | Ga0068852_100366379 | 3300005616 | Bacteria | 1411 |
| 117 | Ga0068852_100893838 | 3300005616 | Bacteria | 905 |
| 118 | Ga0068859_100036471 | 3300005617 | Bacteria | 4936 |
| 119 | Ga0068859_100332314 | 3300005617 | Bacteria | 1614 |
| 120 | Ga0068864_100116857 | 3300005618 | Bacteria | 2380 |
| 121 | Ga0068866_10178752 | 3300005718 | Bacteria | 1252 |
| 122 | Ga0068866_10255926 | 3300005718 | Bacteria | 1073 |
| 123 | Ga0068861_100122230 | 3300005719 | Bacteria | 2102 |
| 124 | Ga0068861_100193960 | 3300005719 | Bacteria | 1700 |
| 125 | Ga0068861_100274716 | 3300005719 | Bacteria | 1448 |
| 126 | Ga0068861_100558045 | 3300005719 | Bacteria | 1045 |
| 127 | Ga0068851_10024349 | 3300005834 | Bacteria | 2963 |
| 128 | Ga0068863_100862291 | 3300005841 | Bacteria | 905 |
| 129 | Ga0068863_100931089 | 3300005841 | Bacteria | 870 |
| 130 | Ga0068858_100173646 | 3300005842 | Bacteria | 2033 |
| 131 | Ga0068858_100347889 | 3300005842 | Bacteria | 1419 |
| 132 | Ga0068858_100372466 | 3300005842 | Bacteria | 1370 |
| 133 | Ga0068858_100894872 | 3300005842 | Bacteria | 868 |
| 134 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 135 | Ga0068860_100071594 | 3300005843 | Bacteria | 3294 |
| 136 | Ga0068860_100464475 | 3300005843 | Bacteria | 1260 |
| 137 | Ga0068862_100088428 | 3300005844 | Bacteria | 2695 |
| 138 | Ga0081455_10005731 | 3300005937 | Bacteria | 13539 |
| 139 | Ga0081455_10006340 | 3300005937 | Bacteria | 12701 |
| 140 | Ga0081455_10070353 | 3300005937 | Bacteria | 2906 |
| 141 | Ga0081455_10109419 | 3300005937 | Bacteria | 2199 |
| 142 | Ga0081540_1007566 | 3300005983 | Bacteria | 7722 |
| 143 | Ga0081540_1008557 | 3300005983 | Bacteria | 7138 |
| 144 | Ga0081540_1015476 | 3300005983 | Bacteria | 4830 |
| 145 | Ga0081540_1016697 | 3300005983 | Bacteria | 4578 |
| 146 | Ga0081540_1018292 | 3300005983 | Bacteria | 4305 |
| 147 | Ga0081540_1028527 | 3300005983 | Bacteria | 3132 |
| 148 | Ga0081540_1030961 | 3300005983 | Bacteria | 2953 |
| 149 | Ga0081540_1120200 | 3300005983 | Bacteria | 1092 |
| 150 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 151 | Ga0081539_10024999 | 3300005985 | Bacteria | 3859 |
| 152 | Ga0081539_10035737 | 3300005985 | Bacteria | 2981 |
| 153 | Ga0081539_10037759 | 3300005985 | Bacteria | 2872 |
| 154 | Ga0070717_10034976 | 3300006028 | Bacteria | 4063 |
| 155 | Ga0070717_10105473 | 3300006028 | Bacteria | 2399 |
| 156 | Ga0070717_10521886 | 3300006028 | Bacteria | 1074 |
| 157 | Ga0075365_10005412 | 3300006038 | Bacteria | 6880 |
| 158 | Ga0075365_10025948 | 3300006038 | Bacteria | 3714 |
| 159 | Ga0075365_10068327 | 3300006038 | Bacteria | 2387 |
| 160 | Ga0075365_10154101 | 3300006038 | Bacteria | 1599 |
| 161 | Ga0075368_10026619 | 3300006042 | Bacteria | 2225 |
| 162 | Ga0075363_100003641 | 3300006048 | Bacteria | 6610 |
| 163 | Ga0075364_10216327 | 3300006051 | Bacteria | 1299 |
| 164 | Ga0070715_10001356 | 3300006163 | Bacteria | 7059 |
| 165 | Ga0070716_100109303 | 3300006173 | Bacteria | 1710 |
| 166 | Ga0070712_100009263 | 3300006175 | Bacteria | 6203 |
| 167 | Ga0070712_100020237 | 3300006175 | Bacteria | 4353 |
| 168 | Ga0070712_100063060 | 3300006175 | Bacteria | 2623 |
| 169 | Ga0070712_100124838 | 3300006175 | Bacteria | 1942 |
| 170 | Ga0075362_10079646 | 3300006177 | Bacteria | 1508 |
| 171 | Ga0075362_10088491 | 3300006177 | Bacteria | 1435 |
| 172 | Ga0075367_10008296 | 3300006178 | Bacteria | 5379 |
| 173 | Ga0075367_10097764 | 3300006178 | Bacteria | 1791 |
| 174 | Ga0075367_10254551 | 3300006178 | Bacteria | 1101 |
| 175 | Ga0075369_10039347 | 3300006186 | Bacteria | 2019 |
| 176 | Ga0075369_10128677 | 3300006186 | Bacteria | 1149 |
| 177 | Ga0075366_10170955 | 3300006195 | Bacteria | 1318 |
| 178 | Ga0097621_100061585 | 3300006237 | Bacteria | 3078 |
| 179 | Ga0097621_100273596 | 3300006237 | Bacteria | 1485 |
| 180 | Ga0075370_10010672 | 3300006353 | Bacteria | 4812 |
| 181 | Ga0068871_100099894 | 3300006358 | Bacteria | 2430 |
| 182 | Ga0068871_100218361 | 3300006358 | Bacteria | 1651 |
| 183 | Ga0068871_100235431 | 3300006358 | Bacteria | 1590 |
| 184 | Ga0068871_100323971 | 3300006358 | Bacteria | 1358 |
| 185 | Ga0068871_100829049 | 3300006358 | Bacteria | 854 |
| 186 | Ga0075428_100299912 | 3300006844 | Bacteria | 1727 |
| 187 | Ga0075434_100023401 | 3300006871 | Bacteria | 6020 |
| 188 | Ga0075434_100492591 | 3300006871 | Bacteria | 1246 |
| 189 | Ga0068865_100051173 | 3300006881 | Bacteria | 2858 |
| 190 | Ga0068865_100122873 | 3300006881 | Bacteria | 1933 |
| 191 | Ga0068865_100523729 | 3300006881 | Bacteria | 992 |
| 192 | Ga0097620_100036468 | 3300006931 | Bacteria | 4936 |
| 193 | Ga0097620_100332311 | 3300006931 | Bacteria | 1614 |
| 194 | Ga0099824_1009019 | 3300006942 | Bacteria | 12482 |
| 195 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 196 | Ga0075435_100477968 | 3300007076 | Bacteria | 1076 |
| 197 | Ga0075435_100607995 | 3300007076 | Bacteria | 948 |
| 198 | Ga0099794_10026556 | 3300007265 | Bacteria | 2678 |
| 199 | Ga0099794_10190702 | 3300007265 | Bacteria | 1048 |
| 200 | Ga0099795_10049266 | 3300007788 | Bacteria | 1528 |
| 201 | Ga0099795_10051868 | 3300007788 | Bacteria | 1497 |
| 202 | Ga0105240_10019828 | 3300009093 | Bacteria | 8981 |
| 203 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 204 | Ga0105240_10071475 | 3300009093 | Bacteria | 4291 |
| 205 | Ga0105240_10214410 | 3300009093 | Bacteria | 2247 |
| 206 | Ga0105240_10303050 | 3300009093 | Bacteria | 1827 |
| 207 | Ga0105245_10355395 | 3300009098 | Bacteria | 1453 |
| 208 | Ga0105245_10417284 | 3300009098 | Bacteria | 1344 |
| 209 | Ga0105247_10043425 | 3300009101 | Bacteria | 2754 |
| 210 | Ga0105247_10387975 | 3300009101 | Bacteria | 992 |
| 211 | Ga0114129_10329738 | 3300009147 | Bacteria | 2027 |
| 212 | Ga0114129_10701257 | 3300009147 | Bacteria | 1301 |
| 213 | Ga0105243_10193154 | 3300009148 | Bacteria | 1779 |
| 214 | Ga0105243_10274392 | 3300009148 | Bacteria | 1516 |
| 215 | Ga0105243_10500355 | 3300009148 | Bacteria | 1151 |
| 216 | Ga0105243_10579946 | 3300009148 | Bacteria | 1076 |
| 217 | Ga0105241_10004267 | 3300009174 | Bacteria | 10572 |
| 218 | Ga0105241_10112623 | 3300009174 | Bacteria | 2180 |
| 219 | Ga0105241_10121417 | 3300009174 | Bacteria | 2104 |
| 220 | Ga0105241_10204243 | 3300009174 | Bacteria | 1652 |
| 221 | Ga0105242_10176970 | 3300009176 | Bacteria | 1879 |
| 222 | Ga0105242_10184447 | 3300009176 | Bacteria | 1843 |
| 223 | Ga0105242_10531000 | 3300009176 | Bacteria | 1124 |
| 224 | Ga0105248_10042051 | 3300009177 | Bacteria | 5125 |
| 225 | Ga0105248_10386405 | 3300009177 | Bacteria | 1576 |
| 226 | Ga0105248_10566361 | 3300009177 | Bacteria | 1282 |
| 227 | Ga0105248_10577091 | 3300009177 | Bacteria | 1269 |
| 228 | Ga0105237_10053748 | 3300009545 | Bacteria | 4039 |
| 229 | Ga0105237_10054084 | 3300009545 | Bacteria | 4023 |
| 230 | Ga0105237_10207229 | 3300009545 | Bacteria | 1961 |
| 231 | Ga0105238_10006268 | 3300009551 | Bacteria | 11820 |
| 232 | Ga0105238_10007999 | 3300009551 | Bacteria | 10578 |
| 233 | Ga0105238_10022426 | 3300009551 | Bacteria | 6435 |
| 234 | Ga0105238_10165407 | 3300009551 | Bacteria | 2188 |
| 235 | Ga0105238_10480958 | 3300009551 | Bacteria | 1241 |
| 236 | Ga0105249_10431191 | 3300009553 | Bacteria | 1354 |
| 237 | Ga0105249_10980212 | 3300009553 | Bacteria | 914 |
| 238 | Ga0099796_10105880 | 3300010159 | Bacteria | 1065 |
| 239 | Ga0105239_10016677 | 3300010375 | Bacteria | 8120 |
| 240 | Ga0105239_10017503 | 3300010375 | Bacteria | 7926 |
| 241 | Ga0105239_10023011 | 3300010375 | Bacteria | 6870 |
| 242 | Ga0105239_10064415 | 3300010375 | Bacteria | 4024 |
| 243 | Ga0105239_10066921 | 3300010375 | Bacteria | 3946 |
| 244 | Ga0105239_10091046 | 3300010375 | Bacteria | 3366 |
| 245 | Ga0105239_10416118 | 3300010375 | Bacteria | 1522 |
| 246 | Ga0105246_10011987 | 3300011119 | Bacteria | 5397 |
| 247 | Ga0157370_10075424 | 3300013104 | Bacteria | 3179 |
| 248 | Ga0157370_10293990 | 3300013104 | Bacteria | 1500 |
| 249 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 250 | Ga0157369_10021614 | 3300013105 | Bacteria | 7195 |
| 251 | Ga0157369_10053822 | 3300013105 | Bacteria | 4348 |
| 252 | Ga0157369_10170660 | 3300013105 | Bacteria | 2292 |
| 253 | Ga0157369_10379588 | 3300013105 | Bacteria | 1467 |
| 254 | Ga0157374_10030777 | 3300013296 | Bacteria | 4875 |
| 255 | Ga0157374_10337655 | 3300013296 | Bacteria | 1495 |
| 256 | Ga0157378_10008170 | 3300013297 | Bacteria | 9132 |
| 257 | Ga0163162_10031643 | 3300013306 | Bacteria | 5248 |
| 258 | Ga0163162_10064118 | 3300013306 | Bacteria | 3719 |
| 259 | Ga0157372_10030290 | 3300013307 | Bacteria | 5919 |
| 260 | Ga0157372_10254842 | 3300013307 | Bacteria | 2037 |
| 261 | Ga0157375_10087093 | 3300013308 | Bacteria | 3175 |
| 262 | Ga0157375_10336598 | 3300013308 | Bacteria | 1674 |
| 263 | Ga0157375_10683897 | 3300013308 | Bacteria | 1180 |
| 264 | Ga0157375_10959867 | 3300013308 | Bacteria | 996 |
| 265 | Ga0157375_11356039 | 3300013308 | Bacteria | 837 |
| 266 | Ga0163163_10007500 | 3300014325 | Bacteria | 9629 |
| 267 | Ga0163163_10074865 | 3300014325 | Bacteria | 3379 |
| 268 | Ga0163163_10875493 | 3300014325 | Bacteria | 961 |
| 269 | Ga0163163_10930358 | 3300014325 | Bacteria | 933 |
| 270 | Ga0157380_10179994 | 3300014326 | Bacteria | 1856 |
| 271 | Ga0157377_10060788 | 3300014745 | Bacteria | 2158 |
| 272 | Ga0157379_10045832 | 3300014968 | Bacteria | 3903 |
| 273 | Ga0157379_10426865 | 3300014968 | Bacteria | 1221 |
| 274 | Ga0157376_10007382 | 3300014969 | Bacteria | 7842 |
| 275 | Ga0157376_10209994 | 3300014969 | Bacteria | 1797 |
| 276 | Ga0163161_10170489 | 3300017792 | Bacteria | 1664 |
| 277 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 278 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 279 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 280 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 281 | Ga0213876_10007200 | 3300021384 | Bacteria | 6064 |
| 282 | Ga0213876_10030756 | 3300021384 | Bacteria | 2833 |
| 283 | Ga0213876_10184716 | 3300021384 | Bacteria | 1109 |
| 284 | Ga0224712_10012900 | 3300022467 | Bacteria | 2646 |
| 285 | Ga0209563_104383 | 3300025230 | Bacteria | 2710 |
| 286 | Ga0209677_102422 | 3300025253 | Bacteria | 7047 |
| 287 | Ga0209677_106686 | 3300025253 | Bacteria | 2661 |
| 288 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 289 | Ga0209148_1012691 | 3300025254 | Bacteria | 1533 |
| 290 | Ga0209233_1002344 | 3300025261 | Bacteria | 7057 |
| 291 | Ga0209233_1030433 | 3300025261 | Bacteria | 1272 |
| 292 | Ga0209455_1002785 | 3300025272 | Bacteria | 6531 |
| 293 | Ga0209455_1019316 | 3300025272 | Bacteria | 1380 |
| 294 | Ga0209673_1016536 | 3300025273 | Bacteria | 2753 |
| 295 | Ga0209564_1011905 | 3300025295 | Bacteria | 3847 |
| 296 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 297 | Ga0209758_1006280 | 3300025297 | Bacteria | 8638 |
| 298 | Ga0209758_1011473 | 3300025297 | Bacteria | 5124 |
| 299 | Ga0209758_1025149 | 3300025297 | Bacteria | 2621 |
| 300 | Ga0209758_1045048 | 3300025297 | Bacteria | 1605 |
| 301 | Ga0209758_1066470 | 3300025297 | Bacteria | 1158 |
| 302 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 303 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 304 | Ga0207426_1021420 | 3300025302 | Bacteria | 2236 |
| 305 | Ga0209257_1035558 | 3300025304 | Bacteria | 1540 |
| 306 | Ga0207697_10103064 | 3300025315 | Bacteria | 1217 |
| 307 | Ga0207656_10018079 | 3300025321 | Bacteria | 2769 |
| 308 | Ga0207656_10238650 | 3300025321 | Bacteria | 888 |
| 309 | Ga0207692_10008533 | 3300025898 | Bacteria | 4243 |
| 310 | Ga0207692_10038421 | 3300025898 | Bacteria | 2348 |
| 311 | Ga0207710_10071478 | 3300025900 | Bacteria | 1592 |
| 312 | Ga0207688_10092165 | 3300025901 | Bacteria | 1741 |
| 313 | Ga0207688_10222077 | 3300025901 | Bacteria | 1138 |
| 314 | Ga0207647_10149608 | 3300025904 | Bacteria | 1365 |
| 315 | Ga0207685_10003797 | 3300025905 | Bacteria | 3734 |
| 316 | Ga0207685_10043745 | 3300025905 | Bacteria | 1689 |
| 317 | Ga0207699_10002066 | 3300025906 | Bacteria | 9488 |
| 318 | Ga0207699_10062902 | 3300025906 | Bacteria | 2239 |
| 319 | Ga0207699_10173191 | 3300025906 | Bacteria | 1445 |
| 320 | Ga0207645_10063010 | 3300025907 | Bacteria | 2369 |
| 321 | Ga0207643_10140630 | 3300025908 | Bacteria | 1441 |
| 322 | Ga0207643_10144685 | 3300025908 | Bacteria | 1422 |
| 323 | Ga0207705_10124141 | 3300025909 | Bacteria | 1918 |
| 324 | Ga0207654_10011023 | 3300025911 | Bacteria | 4600 |
| 325 | Ga0207654_10074360 | 3300025911 | Bacteria | 2028 |
| 326 | Ga0207654_10172097 | 3300025911 | Bacteria | 1407 |
| 327 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 328 | Ga0207707_10008151 | 3300025912 | Bacteria | 9091 |
| 329 | Ga0207707_10014431 | 3300025912 | Bacteria | 6882 |
| 330 | Ga0207707_10032951 | 3300025912 | Bacteria | 4536 |
| 331 | Ga0207707_10138915 | 3300025912 | Bacteria | 2124 |
| 332 | Ga0207695_10179409 | 3300025913 | Bacteria | 2039 |
| 333 | Ga0207695_10249358 | 3300025913 | Bacteria | 1675 |
| 334 | Ga0207671_10013578 | 3300025914 | Bacteria | 6481 |
| 335 | Ga0207671_10029351 | 3300025914 | Bacteria | 4106 |
| 336 | Ga0207671_10042941 | 3300025914 | Bacteria | 3344 |
| 337 | Ga0207671_10072605 | 3300025914 | Bacteria | 2569 |
| 338 | Ga0207671_10130576 | 3300025914 | Bacteria | 1928 |
| 339 | Ga0207671_10416426 | 3300025914 | Bacteria | 1069 |
| 340 | Ga0207693_10057437 | 3300025915 | Bacteria | 3050 |
| 341 | Ga0207693_10068508 | 3300025915 | Bacteria | 2777 |
| 342 | Ga0207693_10103169 | 3300025915 | Bacteria | 2236 |
| 343 | Ga0207663_10001825 | 3300025916 | Bacteria | 10042 |
| 344 | Ga0207663_10501237 | 3300025916 | Bacteria | 943 |
| 345 | Ga0207660_10007904 | 3300025917 | Bacteria | 6882 |
| 346 | Ga0207660_10060084 | 3300025917 | Bacteria | 2731 |
| 347 | Ga0207660_10079943 | 3300025917 | Bacteria | 2399 |
| 348 | Ga0207660_10101512 | 3300025917 | Bacteria | 2150 |
| 349 | Ga0207660_10195322 | 3300025917 | Bacteria | 1578 |
| 350 | Ga0207662_10289944 | 3300025918 | Bacteria | 1085 |
| 351 | Ga0207657_10005482 | 3300025919 | Bacteria | 13248 |
| 352 | Ga0207657_10165247 | 3300025919 | Bacteria | 1796 |
| 353 | Ga0207649_10453583 | 3300025920 | Bacteria | 968 |
| 354 | Ga0207652_10024703 | 3300025921 | Bacteria | 4987 |
| 355 | Ga0207652_10045150 | 3300025921 | Bacteria | 3755 |
| 356 | Ga0207652_10143817 | 3300025921 | Bacteria | 2133 |
| 357 | Ga0207652_10302301 | 3300025921 | Bacteria | 1444 |
| 358 | Ga0207646_10099096 | 3300025922 | Bacteria | 2612 |
| 359 | Ga0207694_10027217 | 3300025924 | Bacteria | 4353 |
| 360 | Ga0207694_10050027 | 3300025924 | Bacteria | 3235 |
| 361 | Ga0207694_10110472 | 3300025924 | Bacteria | 2187 |
| 362 | Ga0207694_10198901 | 3300025924 | Bacteria | 1630 |
| 363 | Ga0207687_10300220 | 3300025927 | Bacteria | 1293 |
| 364 | Ga0207700_10034094 | 3300025928 | Bacteria | 3650 |
| 365 | Ga0207700_10082300 | 3300025928 | Bacteria | 2517 |
| 366 | Ga0207700_10104229 | 3300025928 | Bacteria | 2269 |
| 367 | Ga0207700_10206963 | 3300025928 | Bacteria | 1656 |
| 368 | Ga0207700_10396391 | 3300025928 | Bacteria | 1209 |
| 369 | Ga0207664_10016865 | 3300025929 | Bacteria | 5340 |
| 370 | Ga0207664_10033578 | 3300025929 | Bacteria | 3943 |
| 371 | Ga0207664_10042803 | 3300025929 | Bacteria | 3537 |
| 372 | Ga0207664_10114792 | 3300025929 | Bacteria | 2245 |
| 373 | Ga0207664_10122380 | 3300025929 | Bacteria | 2179 |
| 374 | Ga0207690_10312419 | 3300025932 | Bacteria | 1233 |
| 375 | Ga0207690_10448949 | 3300025932 | Bacteria | 1036 |
| 376 | Ga0207706_10107908 | 3300025933 | Bacteria | 2450 |
| 377 | Ga0207706_10294140 | 3300025933 | Bacteria | 1415 |
| 378 | Ga0207686_10057091 | 3300025934 | Bacteria | 2456 |
| 379 | Ga0207686_10194652 | 3300025934 | Bacteria | 1448 |
| 380 | Ga0207686_10262562 | 3300025934 | Bacteria | 1267 |
| 381 | Ga0207709_10010853 | 3300025935 | Bacteria | 5018 |
| 382 | Ga0207709_10236931 | 3300025935 | Bacteria | 1325 |
| 383 | Ga0207669_10108252 | 3300025937 | Bacteria | 1856 |
| 384 | Ga0207669_10174051 | 3300025937 | Bacteria | 1535 |
| 385 | Ga0207704_10032142 | 3300025938 | Bacteria | 2966 |
| 386 | Ga0207704_10123187 | 3300025938 | Bacteria | 1779 |
| 387 | Ga0207665_10009939 | 3300025939 | Bacteria | 6244 |
| 388 | Ga0207665_10342051 | 3300025939 | Bacteria | 1128 |
| 389 | Ga0207665_10352517 | 3300025939 | Bacteria | 1111 |
| 390 | Ga0207691_10041683 | 3300025940 | Bacteria | 4237 |
| 391 | Ga0207691_10195230 | 3300025940 | Bacteria | 1764 |
| 392 | Ga0207691_10324196 | 3300025940 | Bacteria | 1320 |
| 393 | Ga0207691_10345098 | 3300025940 | Bacteria | 1274 |
| 394 | Ga0207711_10030129 | 3300025941 | Bacteria | 4577 |
| 395 | Ga0207711_10120999 | 3300025941 | Bacteria | 2337 |
| 396 | Ga0207711_10370197 | 3300025941 | Bacteria | 1329 |
| 397 | Ga0207711_10712262 | 3300025941 | Bacteria | 936 |
| 398 | Ga0207689_10041822 | 3300025942 | Bacteria | 3791 |
| 399 | Ga0207661_10007632 | 3300025944 | Bacteria | 7691 |
| 400 | Ga0207661_10068018 | 3300025944 | Bacteria | 2899 |
| 401 | Ga0207661_10532797 | 3300025944 | Bacteria | 1075 |
| 402 | Ga0207679_10384849 | 3300025945 | Bacteria | 1230 |
| 403 | Ga0207679_10659440 | 3300025945 | Bacteria | 947 |
| 404 | Ga0207679_10786184 | 3300025945 | Bacteria | 867 |
| 405 | Ga0207667_10020014 | 3300025949 | Bacteria | 7455 |
| 406 | Ga0207667_10020505 | 3300025949 | Bacteria | 7348 |
| 407 | Ga0207667_10158850 | 3300025949 | Bacteria | 2326 |
| 408 | Ga0207667_10267630 | 3300025949 | Bacteria | 1747 |
| 409 | Ga0207667_10605857 | 3300025949 | Bacteria | 1104 |
| 410 | Ga0207667_10963564 | 3300025949 | Bacteria | 842 |
| 411 | Ga0207712_10039860 | 3300025961 | Bacteria | 3221 |
| 412 | Ga0207668_10060515 | 3300025972 | Bacteria | 2658 |
| 413 | Ga0207668_10104520 | 3300025972 | Bacteria | 2111 |
| 414 | Ga0207668_10401135 | 3300025972 | Bacteria | 1159 |
| 415 | Ga0207640_10027323 | 3300025981 | Bacteria | 3475 |
| 416 | Ga0207640_10041490 | 3300025981 | Bacteria | 2927 |
| 417 | Ga0207640_10114422 | 3300025981 | Bacteria | 1920 |
| 418 | Ga0207640_10160171 | 3300025981 | Bacteria | 1664 |
| 419 | Ga0207640_10225390 | 3300025981 | Bacteria | 1438 |
| 420 | Ga0207677_10236789 | 3300026023 | Bacteria | 1474 |
| 421 | Ga0207677_10264893 | 3300026023 | Bacteria | 1403 |
| 422 | Ga0207703_10045007 | 3300026035 | Bacteria | 3549 |
| 423 | Ga0207703_10381486 | 3300026035 | Bacteria | 1304 |
| 424 | Ga0207703_10534336 | 3300026035 | Bacteria | 1104 |
| 425 | Ga0207639_10043716 | 3300026041 | Bacteria | 3365 |
| 426 | Ga0207639_10076603 | 3300026041 | Bacteria | 2634 |
| 427 | Ga0207639_10087416 | 3300026041 | Bacteria | 2485 |
| 428 | Ga0207639_10103285 | 3300026041 | Bacteria | 2309 |
| 429 | Ga0207639_10551404 | 3300026041 | Bacteria | 1058 |
| 430 | Ga0207678_10135493 | 3300026067 | Bacteria | 2101 |
| 431 | Ga0207678_10141568 | 3300026067 | Bacteria | 2053 |
| 432 | Ga0207678_10258360 | 3300026067 | Bacteria | 1493 |
| 433 | Ga0207708_10215331 | 3300026075 | Bacteria | 1537 |
| 434 | Ga0207708_10253201 | 3300026075 | Bacteria | 1420 |
| 435 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 436 | Ga0207702_10066463 | 3300026078 | Bacteria | 3090 |
| 437 | Ga0207702_10195942 | 3300026078 | Bacteria | 1870 |
| 438 | Ga0207702_10313810 | 3300026078 | Bacteria | 1491 |
| 439 | Ga0207702_10452113 | 3300026078 | Bacteria | 1246 |
| 440 | Ga0207641_10112713 | 3300026088 | Bacteria | 2414 |
| 441 | Ga0207641_10555710 | 3300026088 | Bacteria | 1120 |
| 442 | Ga0207641_10865732 | 3300026088 | Bacteria | 896 |
| 443 | Ga0207648_10082120 | 3300026089 | Bacteria | 2810 |
| 444 | Ga0207648_10335943 | 3300026089 | Bacteria | 1360 |
| 445 | Ga0207676_10384453 | 3300026095 | Bacteria | 1307 |
| 446 | Ga0207674_10018135 | 3300026116 | Bacteria | 7658 |
| 447 | Ga0207674_10078405 | 3300026116 | Bacteria | 3308 |
| 448 | Ga0207674_10180637 | 3300026116 | Bacteria | 2061 |
| 449 | Ga0207675_100391680 | 3300026118 | Bacteria | 1368 |
| 450 | Ga0207683_10007406 | 3300026121 | Bacteria | 9411 |
| 451 | Ga0207683_10051080 | 3300026121 | Bacteria | 3622 |
| 452 | Ga0207683_10096043 | 3300026121 | Bacteria | 2643 |
| 453 | Ga0207683_10432197 | 3300026121 | Bacteria | 1213 |
| 454 | Ga0207683_10675232 | 3300026121 | Bacteria | 957 |
| 455 | Ga0207698_10068132 | 3300026142 | Bacteria | 2809 |
| 456 | Ga0207698_10192999 | 3300026142 | Bacteria | 1816 |
| 457 | Ga0207698_10230995 | 3300026142 | Bacteria | 1679 |
| 458 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 459 | Ga0209389_1000069 | 3300027296 | Bacteria | 98063 |
| 460 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 461 | Ga0209589_1000077 | 3300027357 | Bacteria | 98063 |
| 462 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 463 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 464 | Ga0209489_100020 | 3300027361 | Bacteria | 207541 |
| 465 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 466 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 467 | Ga0209179_1015554 | 3300027512 | Bacteria | 1415 |
| 468 | Ga0265356_1005297 | 3300028017 | Bacteria | 1543 |
| 469 | Ga0268266_10003191 | 3300028379 | Bacteria | 16594 |
| 470 | Ga0268266_10046869 | 3300028379 | Bacteria | 3700 |
| 471 | Ga0268266_10053850 | 3300028379 | Bacteria | 3457 |
| 472 | Ga0268266_10098228 | 3300028379 | Bacteria | 2576 |
| 473 | Ga0268266_10247314 | 3300028379 | Bacteria | 1648 |
| 474 | Ga0268266_10508193 | 3300028379 | Bacteria | 1151 |
| 475 | Ga0268266_10566989 | 3300028379 | Bacteria | 1089 |
| 476 | Ga0268265_10092782 | 3300028380 | Bacteria | 2417 |
| 477 | Ga0268265_10437281 | 3300028380 | Bacteria | 1218 |
| 478 | Ga0268265_10566791 | 3300028380 | Bacteria | 1080 |
| 479 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 480 | Ga0268264_10264157 | 3300028381 | Bacteria | 1605 |
| 481 | Ga0268264_10713960 | 3300028381 | Bacteria | 996 |
| 482 | Ga0265337_1011271 | 3300028556 | Bacteria | 3089 |
| 483 | Ga0265326_10006827 | 3300028558 | Bacteria | 3524 |
| 484 | Ga0265334_10020212 | 3300028573 | Bacteria | 2729 |
| 485 | Ga0265323_10017148 | 3300028653 | Bacteria | 2817 |
| 486 | Ga0265322_10013237 | 3300028654 | Bacteria | 2388 |
| 487 | Ga0265336_10000850 | 3300028666 | Bacteria | 15908 |
| 488 | Ga0307517_10010277 | 3300028786 | Bacteria | 13120 |
| 489 | Ga0307517_10092412 | 3300028786 | Bacteria | 2462 |
| 490 | Ga0265338_10000417 | 3300028800 | Bacteria | 76249 |
| 491 | Ga0265324_10003779 | 3300029957 | Bacteria | 7073 |
| 492 | Ga0307511_10034380 | 3300030521 | Bacteria | 4450 |
| 493 | Ga0307512_10244188 | 3300030522 | Bacteria | 904 |
| 494 | Ga0265330_10010731 | 3300031235 | Bacteria | 4310 |
| 495 | Ga0265330_10050026 | 3300031235 | Bacteria | 1834 |
| 496 | Ga0265328_10027348 | 3300031239 | Bacteria | 2139 |
| 497 | Ga0265340_10016299 | 3300031247 | Bacteria | 3849 |
| 498 | Ga0265339_10036098 | 3300031249 | Bacteria | 2768 |
| 499 | Ga0265331_10032239 | 3300031250 | Bacteria | 2598 |
| 500 | Ga0265316_10045394 | 3300031344 | Bacteria | 3489 |
| 501 | Ga0307513_10149453 | 3300031456 | Bacteria | 2248 |
| 502 | Ga0307513_10168277 | 3300031456 | Bacteria | 2072 |
| 503 | Ga0307509_10009216 | 3300031507 | Bacteria | 12388 |
| 504 | Ga0307509_10192327 | 3300031507 | Bacteria | 1889 |
| 505 | Ga0307509_10305456 | 3300031507 | Bacteria | 1336 |
| 506 | Ga0265313_10052803 | 3300031595 | Bacteria | 1938 |
| 507 | Ga0307508_10000715 | 3300031616 | Bacteria | 39415 |
| 508 | Ga0307508_10033881 | 3300031616 | Bacteria | 4605 |
| 509 | Ga0307508_10162644 | 3300031616 | Bacteria | 1836 |
| 510 | Ga0265314_10071962 | 3300031711 | Bacteria | 2311 |
| 511 | Ga0265314_10073784 | 3300031711 | Bacteria | 2274 |
| 512 | Ga0265314_10163340 | 3300031711 | Bacteria | 1353 |
| 513 | Ga0265342_10003269 | 3300031712 | Bacteria | 13437 |
| 514 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 515 | Ga0307516_10009786 | 3300031730 | Bacteria | 10635 |
| 516 | Ga0307516_10032872 | 3300031730 | Bacteria | 5224 |
| 517 | Ga0307516_10068945 | 3300031730 | Bacteria | 3403 |
| 518 | Ga0307516_10325424 | 3300031730 | Bacteria | 1207 |
| 519 | Ga0307413_10377958 | 3300031824 | Bacteria | 1103 |
| 520 | Ga0307406_10521848 | 3300031901 | Bacteria | 967 |
| 521 | Ga0307416_100953460 | 3300032002 | Bacteria | 960 |
| 522 | Ga0307411_10249618 | 3300032005 | Bacteria | 1394 |
| 523 | Ga0307415_100025456 | 3300032126 | Bacteria | 3714 |
| 524 | Ga0307507_10045602 | 3300033179 | Bacteria | 4310 |
| 525 | Ga0307510_10075614 | 3300033180 | Bacteria | 3319 |
| 526 | Ga0307510_10078920 | 3300033180 | Bacteria | 3215 |
| 527 | Ga0307510_10103437 | 3300033180 | Bacteria | 2625 |
| 528 | Ga0307510_10274451 | 3300033180 | Bacteria | 1160 |
| 529 | Ga0315911_1000021 | 3300033442 | Bacteria | 124874 |
| 530 | Ga0373958_0038786 | 3300034819 | Bacteria | 966 |
| 531 | Ga0373938_0023985 | 3300034957 | Bacteria | 1258 |
| 532 | Ga0373928_0025131 | 3300035084 | Bacteria | 1282 |
| 533 | Ga0373934_0009001 | 3300035086 | Bacteria | 3733 |
| 534 | Ga0373934_0092315 | 3300035086 | Bacteria | 1221 |
| 535 | Ga0373940_0069843 | 3300035088 | Bacteria | 1021 |
| 536 | Ga0373949_0034217 | 3300035090 | Bacteria | 1224 |
| 537 | Ga0373923_0240466 | 3300035111 | Bacteria | 845 |
| 538 | Ga0373936_0049679 | 3300035113 | Bacteria | 1695 |
| 539 | Ga0373936_0147179 | 3300035113 | Bacteria | 1019 |
| 540 | Ga0373945_0004291 | 3300035116 | Bacteria | 4526 |
| 541 | Ga0373945_0125704 | 3300035116 | Bacteria | 1023 |
| 542 | Ga0373953_0066378 | 3300035117 | Bacteria | 1482 |
| 543 | Ga0373954_0001886 | 3300035118 | Bacteria | 8659 |
| 544 | Ga0373954_0021857 | 3300035118 | Bacteria | 2898 |
| 545 | Ga0373954_0066781 | 3300035118 | Bacteria | 1703 |
| 546 | Ga0373956_0000376 | 3300035119 | Bacteria | 18268 |
| 547 | Ga0373957_0000575 | 3300035120 | Bacteria | 9302 |
| 548 | Ga0373957_0019213 | 3300035120 | Bacteria | 2402 |
| 549 | Ga0373957_0074268 | 3300035120 | Bacteria | 1334 |
| 550 | Ga0373943_0055380 | 3300035170 | Bacteria | 1964 |
| 551 | Ga0373946_0011656 | 3300035171 | Bacteria | 3286 |
| 552 | Ga0373955_0000325 | 3300035172 | Bacteria | 19823 |
| 553 | Ga0373942_0089282 | 3300035207 | Bacteria | 927 |
| 554 | Ga0373962_0059177 | 3300035242 | Bacteria | 1122 |
| 555 | Ga0373924_0000567 | 3300035410 | Bacteria | 11368 |
| 556 | Ga0373924_0111432 | 3300035410 | Bacteria | 1183 |
| 557 | Ga0373931_0031715 | 3300035691 | Bacteria | 2729 |
| 558 | Ga0373935_0001812 | 3300035692 | Bacteria | 11998 |
| 559 | Ga0373935_0005959 | 3300035692 | Bacteria | 7231 |
| 560 | Ga0373935_0061189 | 3300035692 | Bacteria | 2410 |
| 561 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 562 | Ga0373927_0002991 | 3300035695 | Bacteria | 12261 |
| 563 | Ga0373927_0005646 | 3300035695 | Bacteria | 8601 |
| 564 | Ga0373927_0014399 | 3300035695 | Bacteria | 5236 |
| 565 | Ga0373927_0031557 | 3300035695 | Bacteria | 3453 |
| 566 | Ga0373927_0049450 | 3300035695 | Bacteria | 2718 |
| 567 | Ga0373927_0535212 | 3300035695 | Bacteria | 774 |
| 568 | Ga0373933_0002337 | 3300035724 | Bacteria | 10758 |
| 569 | Ga0373933_0133824 | 3300035724 | Bacteria | 1560 |
| 570 | Ga0373947_0003829 | 3300035725 | Bacteria | 8862 |
| 571 | Ga0373947_0038698 | 3300035725 | Bacteria | 2835 |
| 572 | Ga0373947_0040983 | 3300035725 | Bacteria | 2760 |
| 573 | Ga0373947_0066433 | 3300035725 | Bacteria | 2201 |
| 574 | Ga0373947_0297885 | 3300035725 | Bacteria | 1075 |
| 575 | Ga0373937_0021625 | 3300036401 | Bacteria | 5773 |
| 576 | Ga0373937_0047940 | 3300036401 | Bacteria | 3909 |
| 577 | Ga0373937_0105868 | 3300036401 | Bacteria | 2614 |
| 578 | Ga0373925_0008084 | 3300037068 | Bacteria | 7662 |
| 579 | Ga0373925_0034633 | 3300037068 | Bacteria | 3722 |
| 580 | Ga0373925_0518149 | 3300037068 | Bacteria | 980 |
| 581 | Ga0395899_0196775 | 3300037312 | Bacteria | 1408 |
| 582 | Ga0395900_0010102 | 3300037418 | Bacteria | 9655 |
| 583 | Ga0395900_0129021 | 3300037418 | Bacteria | 2592 |
| 584 | Ga0395900_0227548 | 3300037418 | Bacteria | 1877 |
| 585 | Ga0395898_0308902 | 3300037466 | Bacteria | 1508 |
| 586 | Ga0395898_0671920 | 3300037466 | Bacteria | 978 |
| 587 | Ga0395905_0136017 | 3300037471 | Bacteria | 2312 |
| 588 | Ga0436364_0654283 | 3300037853 | Bacteria | 1556 |
| 589 | Ga0436364_1520197 | 3300037853 | Bacteria | 2904 |
| 590 | Ga0395901_0029430 | 3300038443 | Bacteria | 5656 |
| 591 | Ga0395901_0110928 | 3300038443 | Bacteria | 2881 |
| 592 | Ga0395901_0280022 | 3300038443 | Bacteria | 1733 |
| 593 | Ga0436365_0485329 | 3300039437 | Bacteria | 17672 |
| 594 | Ga0436365_0503144 | 3300039437 | Bacteria | 3811 |
| 595 | Ga0436365_0824582 | 3300039437 | Bacteria | 990 |
| 596 | Ga0436365_1160562 | 3300039437 | Bacteria | 1540 |
| 597 | Ga0436365_1210665 | 3300039437 | Bacteria | 1267 |
| 598 | Ga0436365_1552511 | 3300039437 | Bacteria | 1408 |
| 599 | Ga0436365_1565796 | 3300039437 | Bacteria | 1989 |
| 600 | Ga0436363_0207072 | 3300039450 | Bacteria | 1501 |
| 601 | Ga0436363_1685596 | 3300039450 | Bacteria | 1646 |
| 602 | Ga0436362_0591733 | 3300039453 | Bacteria | 1962 |
| 603 | Ga0439465_0038800 | 3300041413 | Bacteria | 1535 |
| 604 | Ga0451793_0152413 | 3300041452 | Bacteria | 840 |
| 605 | Ga0451807_1667387 | 3300041486 | Bacteria | 929 |
| 606 | Ga0451835_0378223 | 3300041492 | Bacteria | 890 |
| 607 | Ga0466969_0050676 | 3300044656 | Bacteria | 2046 |
| 608 | Ga0466969_0230916 | 3300044656 | Bacteria | 840 |
| 609 | Ga0466969_0263782 | 3300044656 | Bacteria | 780 |
| 610 | Ga0466972_0000100 | 3300044658 | Bacteria | 76018 |
| 611 | Ga0466965_0153822 | 3300044683 | Bacteria | 1203 |
| 612 | Ga0466966_0001463 | 3300044684 | Bacteria | 15199 |
| 613 | Ga0466966_0034352 | 3300044684 | Bacteria | 3279 |
| 614 | Ga0466966_0073682 | 3300044684 | Bacteria | 2135 |
| 615 | Ga0466961_0000601 | 3300044693 | Bacteria | 22652 |
| 616 | Ga0466963_0065181 | 3300044694 | Bacteria | 2442 |
| 617 | Ga0466964_0329916 | 3300044706 | Bacteria | 778 |
| 618 | Ga0466968_0008001 | 3300044735 | Bacteria | 4039 |
| 619 | Ga0466968_0083378 | 3300044735 | Bacteria | 1408 |
| 620 | Ga0466957_0100105 | 3300044842 | Bacteria | 1826 |
| 621 | Ga0466957_0294029 | 3300044842 | Bacteria | 1090 |
| 622 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 623 | Ga0466959_0063987 | 3300045049 | Bacteria | 2671 |
| 624 | Ga0466958_0025141 | 3300045836 | Bacteria | 3509 |
| 625 | Ga0466967_0054112 | 3300045976 | Bacteria | 3530 |
| 626 | Ga0466967_0199929 | 3300045976 | Bacteria | 1892 |
| 627 | Ga0466967_0671821 | 3300045976 | Bacteria | 1025 |
| 628 | Ga0495617_026277 | 3300046452 | Bacteria | 1960 |
| 629 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 630 | Ga0495592_0072757 | 3300046454 | Bacteria | 2500 |
| 631 | Ga0495592_0120602 | 3300046454 | Bacteria | 1845 |
| 632 | Ga0495603_0000029 | 3300046455 | Bacteria | 60872 |
| 633 | Ga0495603_0004729 | 3300046455 | Bacteria | 8133 |
| 634 | Ga0495603_0039376 | 3300046455 | Bacteria | 2832 |
| 635 | Ga0495603_0124400 | 3300046455 | Bacteria | 1503 |
| 636 | Ga0495603_0128079 | 3300046455 | Bacteria | 1479 |
| 637 | Ga0495603_0237067 | 3300046455 | Bacteria | 1051 |
| 638 | Ga0495590_0039833 | 3300046457 | Bacteria | 1639 |
| 639 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 640 | Ga0495629_0001483 | 3300046459 | Bacteria | 18494 |
| 641 | Ga0495629_0043140 | 3300046459 | Bacteria | 3168 |
| 642 | Ga0495638_0048119 | 3300046460 | Bacteria | 2670 |
| 643 | Ga0495638_0109463 | 3300046460 | Bacteria | 1642 |
| 644 | Ga0495638_0125742 | 3300046460 | Bacteria | 1511 |
| 645 | Ga0495638_0145320 | 3300046460 | Bacteria | 1380 |
| 646 | Ga0495638_0329591 | 3300046460 | Bacteria | 813 |
| 647 | Ga0495641_0004254 | 3300046461 | Bacteria | 10233 |
| 648 | Ga0495651_0022220 | 3300046462 | Bacteria | 4932 |
| 649 | Ga0495651_0025349 | 3300046462 | Bacteria | 4615 |
| 650 | Ga0495651_0034091 | 3300046462 | Bacteria | 3969 |
| 651 | Ga0495653_0001063 | 3300046463 | Bacteria | 21155 |
| 652 | Ga0495653_0156443 | 3300046463 | Bacteria | 1587 |
| 653 | Ga0495653_0160665 | 3300046463 | Bacteria | 1560 |
| 654 | Ga0495650_0047269 | 3300046471 | Bacteria | 1801 |
| 655 | Ga0495580_0000321 | 3300046472 | Bacteria | 39093 |
| 656 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 657 | Ga0495582_0380522 | 3300046473 | Bacteria | 813 |
| 658 | Ga0495605_0104137 | 3300046474 | Bacteria | 1301 |
| 659 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 660 | Ga0495639_0059902 | 3300046475 | Bacteria | 1743 |
| 661 | Ga0495662_0000068 | 3300046476 | Bacteria | 36559 |
| 662 | Ga0495662_0163187 | 3300046476 | Bacteria | 1098 |
| 663 | Ga0495664_0007034 | 3300046477 | Bacteria | 6232 |
| 664 | Ga0495664_0045327 | 3300046477 | Bacteria | 2608 |
| 665 | Ga0495664_0078530 | 3300046477 | Bacteria | 1977 |
| 666 | Ga0495594_0000170 | 3300046499 | Bacteria | 31295 |
| 667 | Ga0495594_0159480 | 3300046499 | Bacteria | 1282 |
| 668 | Ga0495596_0027178 | 3300046500 | Bacteria | 2303 |
| 669 | Ga0495596_0029477 | 3300046500 | Bacteria | 2200 |
| 670 | Ga0495596_0042656 | 3300046500 | Bacteria | 1788 |
| 671 | Ga0495596_0088297 | 3300046500 | Bacteria | 1203 |
| 672 | Ga0495596_0099369 | 3300046500 | Bacteria | 1130 |
| 673 | Ga0495606_0013516 | 3300046507 | Bacteria | 6440 |
| 674 | Ga0495606_0237238 | 3300046507 | Bacteria | 1019 |
| 675 | Ga0495608_0009012 | 3300046511 | Bacteria | 6978 |
| 676 | Ga0495610_0118567 | 3300046512 | Bacteria | 1163 |
| 677 | Ga0495616_0157523 | 3300046513 | Bacteria | 1023 |
| 678 | Ga0495618_0015222 | 3300046514 | Bacteria | 4693 |
| 679 | Ga0495618_0244416 | 3300046514 | Bacteria | 1127 |
| 680 | Ga0495620_0070634 | 3300046515 | Bacteria | 1430 |
| 681 | Ga0495628_0001554 | 3300046516 | Bacteria | 21033 |
| 682 | Ga0495628_0014226 | 3300046516 | Bacteria | 6678 |
| 683 | Ga0495628_0051848 | 3300046516 | Bacteria | 3242 |
| 684 | Ga0495628_0079529 | 3300046516 | Bacteria | 2549 |
| 685 | Ga0495628_0251082 | 3300046516 | Bacteria | 1321 |
| 686 | Ga0495630_0018888 | 3300046517 | Bacteria | 5067 |
| 687 | Ga0495631_0068996 | 3300046518 | Bacteria | 1529 |
| 688 | Ga0495632_0125884 | 3300046519 | Bacteria | 1195 |
| 689 | Ga0495643_0206251 | 3300046522 | Bacteria | 941 |
| 690 | Ga0495643_0267354 | 3300046522 | Bacteria | 792 |
| 691 | Ga0495644_0047261 | 3300046523 | Bacteria | 1617 |
| 692 | Ga0495648_0019778 | 3300046524 | Bacteria | 4718 |
| 693 | Ga0495666_0003580 | 3300046526 | Bacteria | 7855 |
| 694 | Ga0495652_0005882 | 3300046529 | Bacteria | 11474 |
| 695 | Ga0495652_0007546 | 3300046529 | Bacteria | 10022 |
| 696 | Ga0495652_0364035 | 3300046529 | Bacteria | 1032 |
| 697 | Ga0495665_0000158 | 3300046531 | Bacteria | 33789 |
| 698 | Ga0495665_0067607 | 3300046531 | Bacteria | 1885 |
| 699 | Ga0495640_0015043 | 3300046533 | Bacteria | 5830 |
| 700 | Ga0495640_0016249 | 3300046533 | Bacteria | 5572 |
| 701 | Ga0495640_0022850 | 3300046533 | Bacteria | 4566 |
| 702 | Ga0495640_0068770 | 3300046533 | Bacteria | 2382 |
| 703 | Ga0495640_0321408 | 3300046533 | Bacteria | 958 |
| 704 | Ga0495640_0366517 | 3300046533 | Bacteria | 888 |
| 705 | Ga0495587_0006630 | 3300046536 | Bacteria | 7541 |
| 706 | Ga0495587_0008157 | 3300046536 | Bacteria | 6752 |
| 707 | Ga0495587_0307525 | 3300046536 | Bacteria | 886 |
| 708 | Ga0495598_0017810 | 3300046537 | Bacteria | 1837 |
| 709 | Ga0495598_0076497 | 3300046537 | Bacteria | 1065 |
| 710 | Ga0495621_0063096 | 3300046539 | Bacteria | 1349 |
| 711 | Ga0495645_0003892 | 3300046543 | Bacteria | 10173 |
| 712 | Ga0495645_0077757 | 3300046543 | Bacteria | 2385 |
| 713 | Ga0495622_0005431 | 3300046557 | Bacteria | 5915 |
| 714 | Ga0495622_0018938 | 3300046557 | Bacteria | 3208 |
| 715 | Ga0495667_0003075 | 3300046559 | Bacteria | 11195 |
| 716 | Ga0495667_0008458 | 3300046559 | Bacteria | 6985 |
| 717 | Ga0495667_0033191 | 3300046559 | Bacteria | 3454 |
| 718 | Ga0495667_0038553 | 3300046559 | Bacteria | 3181 |
| 719 | Ga0495656_0058931 | 3300046615 | Bacteria | 1668 |
| 720 | Ga0495668_0052040 | 3300046616 | Bacteria | 2267 |
| 721 | Ga0495634_0000354 | 3300046642 | Bacteria | 44714 |
| 722 | Ga0495634_0005678 | 3300046642 | Bacteria | 9546 |
| 723 | Ga0495634_0033779 | 3300046642 | Bacteria | 3513 |
| 724 | Ga0495625_0030852 | 3300046660 | Bacteria | 3994 |
| 725 | Ga0495625_0251050 | 3300046660 | Bacteria | 1148 |
| 726 | Ga0495625_0295861 | 3300046660 | Bacteria | 1037 |
| 727 | Ga0495635_0000179 | 3300046663 | Bacteria | 40014 |
| 728 | Ga0495635_0000917 | 3300046663 | Bacteria | 19365 |
| 729 | Ga0495635_0002291 | 3300046663 | Bacteria | 13017 |
| 730 | Ga0495635_0018638 | 3300046663 | Bacteria | 4842 |
| 731 | Ga0495659_0132444 | 3300046664 | Bacteria | 989 |
| 732 | Ga0495659_0138586 | 3300046664 | Bacteria | 969 |
| 733 | Ga0495661_0099140 | 3300046665 | Bacteria | 1643 |
| 734 | Ga0495588_0001137 | 3300046674 | Bacteria | 11460 |
| 735 | Ga0495588_0040929 | 3300046674 | Bacteria | 2365 |
| 736 | Ga0495588_0070450 | 3300046674 | Bacteria | 1817 |
| 737 | Ga0495657_0005133 | 3300046675 | Bacteria | 10381 |
| 738 | Ga0495657_0009727 | 3300046675 | Bacteria | 7262 |
| 739 | Ga0495657_0013656 | 3300046675 | Bacteria | 5983 |
| 740 | Ga0495599_0001780 | 3300046678 | Bacteria | 12490 |
| 741 | Ga0495599_0038886 | 3300046678 | Bacteria | 2990 |
| 742 | Ga0495623_0010483 | 3300046679 | Bacteria | 5998 |
| 743 | Ga0495623_0112900 | 3300046679 | Bacteria | 1645 |
| 744 | Ga0495623_0113792 | 3300046679 | Bacteria | 1636 |
| 745 | Ga0495646_0003762 | 3300046680 | Bacteria | 9487 |
| 746 | Ga0495646_0003865 | 3300046680 | Bacteria | 9362 |
| 747 | Ga0495646_0009381 | 3300046680 | Bacteria | 6207 |
| 748 | Ga0495646_0012426 | 3300046680 | Bacteria | 5414 |
| 749 | Ga0495646_0046640 | 3300046680 | Bacteria | 2641 |
| 750 | Ga0495647_0000068 | 3300046681 | Bacteria | 25521 |
| 751 | Ga0495658_0000428 | 3300046683 | Bacteria | 23516 |
| 752 | Ga0495669_0012020 | 3300046684 | Bacteria | 3682 |
| 753 | Ga0495669_0094182 | 3300046684 | Bacteria | 1386 |
| 754 | Ga0495613_0003569 | 3300046689 | Bacteria | 11661 |
| 755 | Ga0495613_0056042 | 3300046689 | Bacteria | 2895 |
| 756 | Ga0495613_0067784 | 3300046689 | Bacteria | 2604 |
| 757 | Ga0495613_0194263 | 3300046689 | Bacteria | 1433 |
| 758 | Ga0495613_0228080 | 3300046689 | Bacteria | 1306 |
| 759 | Ga0495624_0010213 | 3300046690 | Bacteria | 6471 |
| 760 | Ga0495670_0013643 | 3300046691 | Bacteria | 3995 |
| 761 | Ga0495649_0146826 | 3300046694 | Bacteria | 1240 |
| 762 | Ga0495600_0005669 | 3300046809 | Bacteria | 7541 |
| 763 | Ga0495600_0006367 | 3300046809 | Bacteria | 7183 |
| 764 | Ga0495600_0220799 | 3300046809 | Bacteria | 1212 |
| 765 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 766 | Ga0495581_0074323 | 3300047315 | Bacteria | 1967 |
| 767 | Ga0495581_0132278 | 3300047315 | Bacteria | 1454 |
| 768 | Ga0495581_0406097 | 3300047315 | Bacteria | 794 |
| 769 | Ga0495604_0000678 | 3300047317 | Bacteria | 28877 |
| 770 | Ga0495604_0017687 | 3300047317 | Bacteria | 5705 |
| 771 | Ga0495604_0301715 | 3300047317 | Bacteria | 1075 |
| 772 | Ga0495674_0000415 | 3300047319 | Bacteria | 38235 |
| 773 | Ga0495674_0026281 | 3300047319 | Bacteria | 5328 |
| 774 | Ga0495674_0037829 | 3300047319 | Bacteria | 4335 |
| 775 | Ga0495674_0163154 | 3300047319 | Bacteria | 1863 |
| 776 | Ga0495674_0501179 | 3300047319 | Bacteria | 971 |
| 777 | Ga0495672_0025023 | 3300047320 | Bacteria | 3830 |
| 778 | Ga0495672_0034348 | 3300047320 | Bacteria | 3134 |
| 779 | Ga0495676_0037764 | 3300047321 | Bacteria | 4016 |
| 780 | Ga0495676_0054205 | 3300047321 | Bacteria | 3189 |
| 781 | Ga0495676_0288023 | 3300047321 | Bacteria | 1110 |
| 782 | Ga0495680_0001065 | 3300047322 | Bacteria | 30372 |
| 783 | Ga0495680_0001164 | 3300047322 | Bacteria | 28965 |
| 784 | Ga0495680_0011443 | 3300047322 | Bacteria | 7855 |
| 785 | Ga0495680_0190505 | 3300047322 | Bacteria | 1476 |
| 786 | Ga0495683_0125833 | 3300047323 | Bacteria | 1213 |
| 787 | Ga0495687_079046 | 3300047443 | Bacteria | 1294 |
| 788 | Ga0495675_0000901 | 3300047444 | Bacteria | 18140 |
| 789 | Ga0495675_0012017 | 3300047444 | Bacteria | 5442 |
| 790 | Ga0495675_0047111 | 3300047444 | Bacteria | 2743 |
| 791 | Ga0495677_0189774 | 3300047445 | Bacteria | 798 |
| 792 | Ga0495673_0006914 | 3300047469 | Bacteria | 6607 |
| 793 | Ga0495673_0035197 | 3300047469 | Bacteria | 2310 |
| 794 | Ga0495684_0000721 | 3300047471 | Bacteria | 26637 |
| 795 | Ga0495684_0043390 | 3300047471 | Bacteria | 3443 |
| 796 | Ga0495686_0078664 | 3300047472 | Bacteria | 2018 |
| 797 | Ga0495686_0109802 | 3300047472 | Bacteria | 1655 |
| 798 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 799 | Ga0495593_0003054 | 3300047673 | Bacteria | 10089 |
| 800 | Ga0495593_0012359 | 3300047673 | Bacteria | 4879 |
| 801 | Ga0495602_0007817 | 3300048088 | Bacteria | 11179 |
| 802 | Ga0495602_0028529 | 3300048088 | Bacteria | 5338 |
| 803 | Ga0495602_0240422 | 3300048088 | Bacteria | 1355 |
| 804 | Ga0495614_0012824 | 3300048089 | Bacteria | 3678 |
| 805 | Ga0496100_0129237 | 3300048903 | Bacteria | 1777 |
| 806 | Ga0496100_0192923 | 3300048903 | Bacteria | 1480 |
| 807 | Ga0496100_0396805 | 3300048903 | Bacteria | 1050 |
| 808 | Ga0496100_0439929 | 3300048903 | Bacteria | 998 |
| 809 | Ga0496101_0081944 | 3300048904 | Bacteria | 2387 |
| 810 | Ga0496101_0087577 | 3300048904 | Bacteria | 2312 |
| 811 | Ga0496101_0112623 | 3300048904 | Bacteria | 2050 |
| 812 | Ga0496101_0185154 | 3300048904 | Bacteria | 1605 |
| 813 | Ga0496102_0010634 | 3300048905 | Bacteria | 7927 |
| 814 | Ga0496102_0020294 | 3300048905 | Bacteria | 5872 |
| 815 | Ga0496102_0287350 | 3300048905 | Bacteria | 1550 |
| 816 | Ga0496103_0146779 | 3300048906 | Bacteria | 1510 |
| 817 | Ga0496104_0014507 | 3300048907 | Bacteria | 7117 |
| 818 | Ga0496104_0088354 | 3300048907 | Bacteria | 2960 |
| 819 | Ga0496104_0093736 | 3300048907 | Bacteria | 2872 |
| 820 | Ga0496104_0116083 | 3300048907 | Bacteria | 2569 |
| 821 | Ga0496104_0142485 | 3300048907 | Bacteria | 2302 |
| 822 | Ga0496105_0007733 | 3300048908 | Bacteria | 8340 |
| 823 | Ga0496105_0058803 | 3300048908 | Bacteria | 3172 |
| 824 | Ga0496105_0165853 | 3300048908 | Bacteria | 1812 |
| 825 | Ga0496105_0173764 | 3300048908 | Bacteria | 1765 |
| 826 | Ga0496106_0001358 | 3300048909 | Bacteria | 18318 |
| 827 | Ga0496106_0013044 | 3300048909 | Bacteria | 6132 |
| 828 | Ga0496106_0370149 | 3300048909 | Bacteria | 1151 |
| 829 | Ga0496107_0010093 | 3300048910 | Bacteria | 6550 |
| 830 | Ga0496107_0044003 | 3300048910 | Bacteria | 3209 |
| 831 | Ga0496107_0077132 | 3300048910 | Bacteria | 2427 |
| 832 | Ga0496107_0435265 | 3300048910 | Bacteria | 975 |
| 833 | Ga0496107_0443683 | 3300048910 | Bacteria | 964 |
| 834 | Ga0496108_0243525 | 3300048911 | Bacteria | 1564 |
| 835 | Ga0496108_0320327 | 3300048911 | Bacteria | 1352 |
| 836 | Ga0496108_0343574 | 3300048911 | Bacteria | 1302 |
| 837 | Ga0496109_0019726 | 3300048912 | Bacteria | 5948 |
| 838 | Ga0496109_0134208 | 3300048912 | Bacteria | 2312 |
| 839 | Ga0496109_0154485 | 3300048912 | Bacteria | 2149 |
| 840 | Ga0496110_0051009 | 3300048913 | Bacteria | 3635 |
| 841 | Ga0496110_0106590 | 3300048913 | Bacteria | 2515 |
| 842 | Ga0496110_0134325 | 3300048913 | Bacteria | 2235 |
| 843 | Ga0496111_0041340 | 3300048914 | Bacteria | 3308 |
| 844 | Ga0496111_0562852 | 3300048914 | Bacteria | 836 |
| 845 | Ga0496112_0039379 | 3300048915 | Bacteria | 4619 |
| 846 | Ga0496112_0063507 | 3300048915 | Bacteria | 3643 |
| 847 | Ga0496112_0171885 | 3300048915 | Bacteria | 2132 |
| 848 | Ga0496112_0189424 | 3300048915 | Bacteria | 2019 |
| 849 | Ga0496112_0220173 | 3300048915 | Bacteria | 1854 |
| 850 | Ga0496112_0251153 | 3300048915 | Bacteria | 1719 |
| 851 | Ga0496112_0266018 | 3300048915 | Bacteria | 1664 |
| 852 | Ga0496113_0040245 | 3300048916 | Bacteria | 3443 |
| 853 | Ga0496113_0057239 | 3300048916 | Bacteria | 2929 |
| 854 | Ga0496113_0168681 | 3300048916 | Bacteria | 1733 |
| 855 | Ga0496113_0210725 | 3300048916 | Bacteria | 1547 |
| 856 | Ga0496114_0044398 | 3300048917 | Bacteria | 3687 |
| 857 | Ga0496114_0142517 | 3300048917 | Bacteria | 2076 |
| 858 | Ga0496114_0189221 | 3300048917 | Bacteria | 1800 |
| 859 | Ga0496114_0226605 | 3300048917 | Bacteria | 1641 |
| 860 | Ga0496114_0272774 | 3300048917 | Bacteria | 1491 |
| 861 | Ga0496114_0652052 | 3300048917 | Bacteria | 926 |
| 862 | Ga0496115_0009406 | 3300048918 | Bacteria | 7262 |
| 863 | Ga0496115_0017598 | 3300048918 | Bacteria | 5469 |
| 864 | Ga0496115_0022309 | 3300048918 | Bacteria | 4903 |
| 865 | Ga0496115_0042539 | 3300048918 | Bacteria | 3619 |
| 866 | Ga0496115_0342381 | 3300048918 | Bacteria | 1220 |
| 867 | Ga0496115_0624929 | 3300048918 | Bacteria | 854 |
| 868 | Ga0496116_0173770 | 3300048919 | Bacteria | 1163 |
| 869 | Ga0496116_0176508 | 3300048919 | Bacteria | 1150 |
| 870 | Ga0496117_0300518 | 3300048920 | Bacteria | 850 |
| 871 | Ga0496118_0003027 | 3300048921 | Bacteria | 21693 |
| 872 | Ga0496118_0020353 | 3300048921 | Bacteria | 5885 |
| 873 | Ga0496118_0069557 | 3300048921 | Bacteria | 2548 |
| 874 | Ga0496118_0106687 | 3300048921 | Bacteria | 1873 |
| 875 | Ga0496119_0213833 | 3300048922 | Bacteria | 990 |
| 876 | Ga0496120_0003365 | 3300048923 | Bacteria | 14668 |
| 877 | Ga0496120_0105837 | 3300048923 | Bacteria | 1478 |
| 878 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 879 | Ga0496121_0002689 | 3300048924 | Bacteria | 26584 |
| 880 | Ga0496121_0047888 | 3300048924 | Bacteria | 3642 |
| 881 | Ga0496121_0062499 | 3300048924 | Bacteria | 3049 |
| 882 | Ga0496121_0095725 | 3300048924 | Bacteria | 2306 |
| 883 | Ga0496121_0122983 | 3300048924 | Bacteria | 1956 |
| 884 | Ga0496121_0360027 | 3300048924 | Bacteria | 966 |
| 885 | Ga0496124_0002957 | 3300048927 | Bacteria | 21339 |
| 886 | Ga0496124_0354100 | 3300048927 | Bacteria | 1037 |
| 887 | Ga0496125_0076533 | 3300048928 | Bacteria | 2583 |
| 888 | Ga0496125_0083260 | 3300048928 | Bacteria | 2434 |
| 889 | Ga0496125_0089991 | 3300048928 | Bacteria | 2306 |
| 890 | Ga0496125_0094540 | 3300048928 | Bacteria | 2226 |
| 891 | Ga0496125_0213072 | 3300048928 | Bacteria | 1252 |
| 892 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 893 | Ga0496126_0003803 | 3300048929 | Bacteria | 18741 |
| 894 | Ga0496126_0022661 | 3300048929 | Bacteria | 6104 |
| 895 | Ga0496126_0047705 | 3300048929 | Bacteria | 3920 |
| 896 | Ga0496126_0062063 | 3300048929 | Bacteria | 3354 |
| 897 | Ga0496126_0081503 | 3300048929 | Bacteria | 2860 |
| 898 | Ga0496126_0128008 | 3300048929 | Bacteria | 2196 |
| 899 | Ga0496126_0138734 | 3300048929 | Bacteria | 2095 |
| 900 | Ga0496126_0179618 | 3300048929 | Bacteria | 1798 |
| 901 | Ga0496126_0180368 | 3300048929 | Bacteria | 1794 |
| 902 | Ga0501031_0066816 | 3300049568 | Bacteria | 2343 |
| 903 | Ga0501032_0051974 | 3300049569 | Bacteria | 2761 |
| 904 | Ga0501032_0261931 | 3300049569 | Bacteria | 1121 |
| 905 | Ga0501033_0026715 | 3300049570 | Bacteria | 4342 |
| 906 | Ga0501033_0109936 | 3300049570 | Bacteria | 2007 |
| 907 | Ga0501034_0134299 | 3300049571 | Bacteria | 2456 |
| 908 | Ga0501036_0139078 | 3300049572 | Bacteria | 2049 |
| 909 | Ga0501037_0217317 | 3300049573 | Bacteria | 1346 |
| 910 | Ga0501039_0490094 | 3300049575 | Bacteria | 965 |
| 911 | Ga0501046_0237739 | 3300049580 | Bacteria | 1344 |
| 912 | Ga0501047_0009870 | 3300049581 | Bacteria | 9023 |
| 913 | Ga0501047_0295582 | 3300049581 | Bacteria | 1463 |
| 914 | Ga0501067_0013941 | 3300049583 | Bacteria | 4452 |
| 915 | Ga0501069_0066434 | 3300049585 | Bacteria | 2017 |
| 916 | Ga0501070_0016072 | 3300049586 | Bacteria | 6291 |
| 917 | Ga0501080_0281563 | 3300049742 | Bacteria | 1512 |
| 918 | Ga0501035_0088777 | 3300049822 | Bacteria | 2723 |
| 919 | Ga0501035_0443138 | 3300049822 | Bacteria | 1075 |
| 920 | Ga0501044_0076769 | 3300049823 | Bacteria | 3389 |
| 921 | nmdc:mga03n38_6294_c1 | 3300050490 | Bacteria | 4112 |
| 922 | nmdc:mga00v17_31303_c1 | 3300050491 | Bacteria | 3137 |
| 923 | nmdc:mga0yw44_26173_c1 | 3300050492 | Bacteria | 3329 |
| 924 | nmdc:mga0yw44_286547_c1 | 3300050492 | Bacteria | 1102 |
| 925 | nmdc:mga06z11_627_c1 | 3300050494 | Bacteria | 12858 |
| 926 | nmdc:mga07m45_130556_c1 | 3300050496 | Bacteria | 1453 |
| 927 | nmdc:mga07m45_191248_c1 | 3300050496 | Bacteria | 1190 |
| 928 | nmdc:mga07m45_2231_c1 | 3300050496 | Bacteria | 9053 |
| 929 | nmdc:mga05p37_1050914_c1 | 3300050507 | Bacteria | 859 |
| 930 | nmdc:mga05p37_534440_c1 | 3300050507 | Bacteria | 1338 |
| 931 | nmdc:mga0n895_15181_c1 | 3300050512 | Bacteria | 7018 |
| 932 | nmdc:mga0n895_161206_c1 | 3300050512 | Bacteria | 2274 |
| 933 | nmdc:mga0rr50_88622_c1 | 3300050513 | Bacteria | 2404 |
| 934 | nmdc:mga0sz30_177024_c1 | 3300050516 | Bacteria | 946 |
| 935 | nmdc:mga0sz30_25042_c1 | 3300050516 | Bacteria | 2440 |
| 936 | nmdc:mga0sz30_32158_c1 | 3300050516 | Bacteria | 2175 |
| 937 | Ga0495601_0012219 | 3300053077 | Bacteria | 5148 |
| 938 | Ga0495601_0070960 | 3300053077 | Bacteria | 2224 |
| 939 | Ga0495612_0062043 | 3300053078 | Bacteria | 1549 |
| 940 | Ga0500635_0025642 | 3300053080 | Bacteria | 1859 |
| 941 | Ga0500635_0034819 | 3300053080 | Bacteria | 1651 |
| 942 | Ga0495655_0054386 | 3300053083 | Bacteria | 1071 |
| 943 | Ga0495595_0001490 | 3300053084 | Bacteria | 9146 |
| 944 | Ga0495595_0030722 | 3300053084 | Bacteria | 2411 |
| 945 | Ga0495595_0139750 | 3300053084 | Bacteria | 1188 |
| 946 | Ga0495619_0000912 | 3300053085 | Bacteria | 19381 |
| 947 | Ga0495619_0166821 | 3300053085 | Bacteria | 1522 |
| 948 | Ga0495619_0200985 | 3300053085 | Bacteria | 1379 |
| 949 | Ga0495619_0442753 | 3300053085 | Bacteria | 896 |
| 950 | Ga0500578_0084550 | 3300053086 | Bacteria | 2016 |
| 951 | Ga0500578_0185539 | 3300053086 | Bacteria | 1280 |
| 952 | Ga0500578_0362833 | 3300053086 | Bacteria | 844 |
| 953 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 954 | Ga0500644_0066945 | 3300053088 | Bacteria | 1283 |
| 955 | Ga0500647_0003150 | 3300053091 | Bacteria | 6361 |
| 956 | Ga0500583_0010766 | 3300053092 | Bacteria | 3412 |
| 957 | Ga0500651_0002004 | 3300053093 | Bacteria | 10570 |
| 958 | Ga0500566_0000126 | 3300053094 | Bacteria | 39286 |
| 959 | Ga0500566_0004965 | 3300053094 | Bacteria | 7920 |
| 960 | Ga0500640_003090 | 3300053095 | Bacteria | 5700 |
| 961 | Ga0500641_0005231 | 3300053096 | Bacteria | 4598 |
| 962 | Ga0500641_0008827 | 3300053096 | Bacteria | 3608 |
| 963 | Ga0500641_0088499 | 3300053096 | Bacteria | 1320 |
| 964 | Ga0500650_0265055 | 3300053098 | Bacteria | 767 |
| 965 | Ga0500554_056184 | 3300053102 | Bacteria | 1252 |
| 966 | Ga0500555_064552 | 3300053103 | Bacteria | 978 |
| 967 | Ga0500555_088821 | 3300053103 | Bacteria | 795 |
| 968 | Ga0500556_0167121 | 3300053104 | Bacteria | 869 |
| 969 | Ga0500557_000083 | 3300053105 | Bacteria | 32931 |
| 970 | Ga0500572_105638 | 3300053111 | Bacteria | 902 |
| 971 | Ga0500575_118948 | 3300053112 | Bacteria | 925 |
| 972 | Ga0500582_126282 | 3300053114 | Bacteria | 891 |
| 973 | Ga0500591_068085 | 3300053115 | Bacteria | 1621 |
| 974 | Ga0500594_0008171 | 3300053118 | Bacteria | 2380 |
| 975 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 976 | Ga0500595_010458 | 3300053119 | Bacteria | 3687 |
| 977 | Ga0500595_016706 | 3300053119 | Bacteria | 2727 |
| 978 | Ga0500614_001649 | 3300053123 | Bacteria | 5240 |
| 979 | Ga0500642_0000642 | 3300053130 | Bacteria | 10422 |
| 980 | Ga0500652_036390 | 3300053131 | Bacteria | 1960 |
| 981 | Ga0500658_0048518 | 3300053134 | Bacteria | 1726 |
| 982 | Ga0500658_0094869 | 3300053134 | Bacteria | 1295 |
| 983 | Ga0500559_0013656 | 3300053136 | Bacteria | 3436 |
| 984 | Ga0500559_0044587 | 3300053136 | Bacteria | 1940 |
| 985 | Ga0500568_0007618 | 3300053139 | Bacteria | 5292 |
| 986 | Ga0500573_0052282 | 3300053140 | Bacteria | 2348 |
| 987 | Ga0500577_0213873 | 3300053142 | Bacteria | 833 |
| 988 | Ga0500590_072438 | 3300053148 | Bacteria | 1710 |
| 989 | Ga0500590_080589 | 3300053148 | Bacteria | 1599 |
| 990 | Ga0500603_000304 | 3300053150 | Bacteria | 12869 |
| 991 | Ga0500603_000540 | 3300053150 | Bacteria | 9573 |
| 992 | Ga0500603_055931 | 3300053150 | Bacteria | 1092 |
| 993 | Ga0500616_0030013 | 3300053153 | Bacteria | 2988 |
| 994 | Ga0500622_0026896 | 3300053156 | Bacteria | 3033 |
| 995 | Ga0500627_0240593 | 3300053158 | Bacteria | 803 |
| 996 | Ga0500630_002602 | 3300053159 | Bacteria | 8690 |
| 997 | Ga0500638_005288 | 3300053162 | Bacteria | 5117 |
| 998 | Ga0500638_036876 | 3300053162 | Bacteria | 2371 |
| 999 | Ga0500639_000039 | 3300053163 | Bacteria | 65182 |
| 1000 | Ga0500639_060191 | 3300053163 | Bacteria | 1958 |
| 1001 | Ga0500636_0014674 | 3300053177 | Bacteria | 4608 |
| 1002 | Ga0500636_0050987 | 3300053177 | Bacteria | 2432 |
| 1003 | Ga0500636_0243085 | 3300053177 | Bacteria | 923 |
| 1004 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1005 | Ga0500637_0000131 | 3300053178 | Bacteria | 27270 |
| 1006 | Ga0500657_053632 | 3300053728 | Bacteria | 1829 |
| 1007 | Ga0500625_067921 | 3300053729 | Bacteria | 1596 |
| 1008 | Ga0500609_020937 | 3300053731 | Bacteria | 892 |
| 1009 | Ga0500596_001078 | 3300053735 | Bacteria | 5500 |
| 1010 | Ga0500596_001647 | 3300053735 | Bacteria | 4511 |
| 1011 | Ga0500601_009327 | 3300053737 | Bacteria | 1094 |
| 1012 | Ga0500661_001013 | 3300055283 | Bacteria | 5278 |
| 1013 | 2509151563 | 2508501128 | Bacteria | 8613869 |
| 1014 | 2511396626 | 2511231028 | Bacteria | 8046582 |
| 1015 | 2513627473 | 2513237092 | Bacteria | 8341956 |
| 1016 | 2513638787 | 2513237094 | Bacteria | 8789602 |
| 1017 | 2513649863 | 2513237095 | Bacteria | 8976980 |
| 1018 | 2513659792 | 2513237096 | Bacteria | 8722461 |
| 1019 | 2513676927 | 2513237098 | Bacteria | 9902361 |
| 1020 | 2513694715 | 2513237101 | Bacteria | 7952346 |
| 1021 | 2513857253 | 2513237137 | Bacteria | 9558895 |
| 1022 | 2513918868 | 2513237145 | Bacteria | 8979722 |
| 1023 | 2517105698 | 2517093001 | Bacteria | 9002274 |
| 1024 | 2517888193 | 2517572143 | Bacteria | 9484767 |
| 1025 | 2524435442 | 2524023205 | Bacteria | 8918781 |
| 1026 | 2524468647 | 2524023210 | Bacteria | 9029266 |
| 1027 | 2524533370 | 2524023228 | Bacteria | 10118060 |
| 1028 | 2528855129 | 2528768022 | Bacteria | 10457665 |
| 1029 | 2617374501 | 2617270741 | Bacteria | 8201522 |
| 1030 | 2671119348 | 2667528175 | Bacteria | 7532676 |
| 1031 | 2723842248 | 2721755755 | Bacteria | 8322773 |
| 1032 | 2728753850 | 2728368998 | Bacteria | 8720350 |
| 1033 | 2745081394 | 2744054633 | Bacteria | 8678936 |
| 1034 | 2793073872 | 2791355197 | Bacteria | 8420563 |
| 1035 | 2793077982 | |||
| 1036 | 2818240863 | 2816332527 | Bacteria | 8933356 |
| 1037 | 2824605532 | 2824600985 | Bacteria | 8488197 |
| 1038 | 2824610830 | 2824609381 | Bacteria | 8672835 |
| 1039 | 2824619366 | 2824617872 | Bacteria | 8814715 |
| 1040 | 2824627821 | 2824626560 | Bacteria | 8813858 |
| 1041 | 2824641887 | 2824635225 | Bacteria | 8785348 |
| 1042 | 2824651285 | 2824644064 | Bacteria | 8743947 |
| 1043 | 2824653882 | 2824653114 | Bacteria | 8493680 |
| 1044 | 2824663765 | 2824661429 | Bacteria | 9877870 |
| 1045 | 2824680230 | 2824679649 | Bacteria | 8248951 |
| 1046 | 2824706073 | 2824704595 | Bacteria | 9667483 |
| 1047 | 2824720079 | 2824714736 | Bacteria | 8717648 |
| 1048 | 2824729441 | 2824723954 | Bacteria | 8758240 |
| 1049 | 2824737482 | 2824732956 | Bacteria | 7810675 |
| 1050 | 2824748037 | 2824746037 | Bacteria | 7911610 |
| 1051 | 2824760294 | 2824753945 | Bacteria | 9787441 |
| 1052 | 2824771533 | 2824763712 | Bacteria | 9792355 |
| 1053 | 2841965299 | 2841957949 | Bacteria | 8652217 |
| 1054 | 2844321491 | 2844315083 | Bacteria | 8138177 |
| 1055 | 2847939476 | 2847930680 | Bacteria | 9342022 |
| 1056 | 2857513308 | 2857509624 | Bacteria | 7472071 |
| 1057 | 2874610163 | 2874604998 | Bacteria | 7834745 |
| 1058 | 2874620213 | 2874612657 | Bacteria | 8252029 |
| 1059 | 2876761698 | 2876761206 | Bacteria | 10111113 |
| 1060 | 2876815720 | 2876808645 | Bacteria | 8824342 |
| 1061 | 2879091082 | 2879083081 | Bacteria | 8587928 |
| 1062 | 2879106647 | 2879099564 | Bacteria | 10442239 |
| 1063 | 2879117039 | 2879110137 | Bacteria | 8907982 |
| 1064 | 2881369635 | 2881364244 | Bacteria | 7710352 |
| 1065 | 2881670158 | 2881665667 | Bacteria | 8175609 |
| 1066 | 2885380654 | 2885374607 | Bacteria | 8927485 |
| 1067 | 2885418256 | 2885409591 | Bacteria | 9235467 |
| 1068 | 2888387746 | 2888378607 | Bacteria | 9652610 |
| 1069 | 2888389965 | 2888388044 | Bacteria | 7304136 |
| 1070 | 2888421135 | 2888419890 | Bacteria | 7857137 |
| 1071 | 2889036364 | 2889033259 | Bacteria | 9099371 |
| 1072 | 2903727930 | 2903727486 | Bacteria | 8281579 |
| 1073 | 2903752681 | 2903748898 | Bacteria | 9972761 |
| 1074 | 2903772255 | 2903768456 | Bacteria | 9749579 |
| 1075 | 2904695768 | 2904690495 | Bacteria | 9412302 |
| 1076 | 2904709889 | |||
| 1077 | 2904718100 | 2904711408 | Bacteria | 9771557 |
| 1078 | 2906602586 | 2906602504 | Bacteria | 8295279 |
| 1079 | 2906614450 | |||
| 1080 | 2906643427 | 2906635258 | Bacteria | 8601019 |
| 1081 | 2906648658 | 2906643746 | Bacteria | 8722424 |
| 1082 | 2906666619 | 2906660503 | Bacteria | 8595048 |
| 1083 | 2908746721 | 2908739725 | Bacteria | 8628932 |
| 1084 | 2908764284 | 2908756301 | Bacteria | 8864324 |
| 1085 | 2908776980 | 2908775508 | Bacteria | 8092255 |
| 1086 | 2922366753 | 2922361189 | Bacteria | 7436256 |
| 1087 | 2922377451 | |||
| 1088 | 2922389344 | 2922386360 | Bacteria | 7017218 |
| 1089 | 2922393374 | 2922393267 | Bacteria | 8285685 |
| 1090 | 2922426284 | |||
| 1091 | 2929622243 | 2929615660 | Bacteria | 9193770 |
| 1092 | 2929630110 | 2929624759 | Bacteria | 9339455 |
| 1093 | 2932787957 | 2932784394 | Bacteria | 9704911 |
| 1094 | 2932799509 | 2932794094 | Bacteria | 7915132 |
| 1095 | 2932805185 | 2932801729 | Bacteria | 7987968 |
| 1096 | 2932813332 | 2932809354 | Bacteria | 9135765 |
| 1097 | 2932820029 | 2932818245 | Bacteria | 9955613 |
| 1098 | 2932832907 | 2932828146 | Bacteria | 9745859 |
| 1099 | 2933584143 | 2933577622 | Bacteria | 9116884 |
| 1100 | 2935620392 | 2935616580 | Bacteria | 9032984 |
| 1101 | 2935632669 | 2935630451 | Bacteria | 8169952 |
| 1102 | 2935640716 | 2935638405 | Bacteria | 10015038 |
| 1103 | 2935668908 | 2935665750 | Bacteria | 9571747 |
| 1104 | 2935681366 | 2935675223 | Bacteria | 9928132 |
| 1105 | 2935687217 | 2935684952 | Bacteria | 9590419 |
| 1106 | 2935696812 | 2935694250 | Bacteria | 9291695 |
| 1107 | 2935709096 | 2935703347 | Bacteria | 10242284 |
| 1108 | 2935716905 | 2935713505 | Bacteria | 9608509 |
| 1109 | 2935722970 | 2935722832 | Bacteria | 9608746 |
| 1110 | 2935734527 | 2935732158 | Bacteria | 9706831 |
| 1111 | 2935744682 | 2935741537 | Bacteria | 9707219 |
| 1112 | 2935753183 | 2935750917 | Bacteria | 9590372 |
| 1113 | 2935767587 | 2935760218 | Bacteria | 9817913 |
| 1114 | 2935770181 | 2935769743 | Bacteria | 7878163 |
| 1115 | 2935777789 | 2935777560 | Bacteria | 8077691 |
| 1116 | 2935786765 | 2935785616 | Bacteria | 7962367 |
| 1117 | 2935794819 | 2935793552 | Bacteria | 8012592 |
| 1118 | 2935804826 | 2935801545 | Bacteria | 9301974 |
| 1119 | 2935815975 | 2935810662 | Bacteria | 9401221 |
| 1120 | 2935832223 | 2935827899 | Bacteria | 10038562 |
| 1121 | 2935840947 | 2935837841 | Bacteria | 9454360 |
| 1122 | 2935859278 | 2935855204 | Bacteria | 9035059 |
| 1123 | 2935864462 | 2935864058 | Bacteria | 9784707 |
| 1124 | 2935875186 | 2935873716 | Bacteria | 9632195 |
| 1125 | 2935887725 | 2935883170 | Bacteria | 7964738 |
| 1126 | 2935963885 | 2935959822 | Bacteria | 7869783 |
| 1127 | 2935995839 | 2935992306 | Bacteria | 9802711 |
| 1128 | 2936005750 | 2936002035 | Bacteria | 9362176 |
| 1129 | 2936041878 | 2936037263 | Bacteria | 9446081 |
| 1130 | 2940559096 | 2940556831 | Bacteria | 9590747 |
| 1131 | 2941508667 | 2941507105 | Bacteria | 8166816 |
| 1132 | 2941516497 | 2941515067 | Bacteria | 8166720 |
| 1133 | 2941524487 | 2941523033 | Bacteria | 8169134 |
| 1134 | 2941532071 | 2941531003 | Bacteria | 7653939 |
| 1135 | 2941541791 | 2941538514 | Bacteria | 9402094 |
| 1136 | 3005475648 | 3005474847 | Bacteria | 9259049 |
| 1137 | 3005485837 | 3005483717 | Bacteria | 7877331 |
| 1138 | 3005588827 | 3005587118 | Bacteria | 7794411 |
| 1139 | 3005601857 | 3005594810 | Bacteria | 8716512 |
| 1140 | 3005717596 | 3005710791 | Bacteria | 7622528 |
| 1141 | 3005724644 | 3005718088 | Bacteria | 8283608 |
| 1142 | 8006936981 | 8006933436 | Bacteria | 10410654 |
| 1143 | 8006966351 | 8006964411 | Bacteria | 8966052 |
| 1144 | 8006976949 | 8006973647 | Bacteria | 10679141 |
| 1145 | 8006993177 | 8006984368 | Bacteria | 9651211 |
| 1146 | 8006997016 | 8006994254 | Bacteria | 8309700 |
| 1147 | 8016517296 | 8016511872 | Bacteria | 9921665 |
| 1148 | 8016526938 | 8016522445 | Bacteria | 8156687 |
| 1149 | 8016545232 | 8016539877 | Bacteria | 8155419 |
| 1150 | 8016556856 | 8016548790 | Bacteria | 8155074 |
| 1151 | 8016582858 | 8016575299 | Bacteria | 8154085 |
| 1152 | 8016602852 | 8016595262 | Bacteria | 8149947 |
| 1153 | 8016605723 | 8016603502 | Bacteria | 8731218 |
| 1154 | 8016617629 | 8016613128 | Bacteria | 8794220 |
| 1155 | 8016623940 | 8016622563 | Bacteria | 7999408 |
| 1156 | 8017059301 | 8017057580 | Bacteria | 10023680 |
| 1157 | 8019531839 | 8019530166 | Bacteria | 8155624 |
| 1158 | 8019550958 | 8019547302 | Bacteria | 7996444 |
| 1159 | 8019571763 | 8019565922 | Bacteria | 9639779 |
| 1160 | 8019576328 | 8019576017 | Bacteria | 10049540 |
| 1161 | 8019594201 | 8019586578 | Bacteria | 10212056 |
| 1162 | 8019607362 | 8019597564 | Bacteria | 10041141 |
| 1163 | 8019611152 | 8019608314 | Bacteria | 10042931 |
| 1164 | 8019631321 | 8019629233 | Bacteria | 8687553 |
| 1165 | 8019651719 | 8019648815 | Bacteria | 10014479 |
| 1166 | 8055743508 | 8055742211 | Bacteria | 9226248 |
| 1167 | 8056678202 | 8056673599 | Bacteria | 7871253 |
| 1168 | 8056683453 | 8056681323 | Bacteria | 8472857 |
| 1169 | 8056690830 | 8056689827 | Bacteria | 6712655 |
| 1170 | 8056975367 | 8056967851 | Bacteria | 9038162 |
| 1171 | Ga0495656_0192502 | |||
| 1172 | JGI25153J46596_10013389 | |||
| 1173 | JGI25153J46596_10013655 | |||
| 1174 | JGI25153J46596_10040464 | |||
| 1175 | JGI25153J46596_10045812 | |||
| 1176 | JGI25153J46596_10076198 | |||
| 1177 | rootL2_10122041 | |||
| 1178 | JGI25160J50197_1002871 | |||
| 1179 | JGI25404J52841_10019494 | |||
| 1180 | Ga0055525_1002489 | |||
| 1181 | Ga0065165_1001167 | |||
| 1182 | Ga0070690_100162447 | |||
| 1183 | Ga0068869_100030464 | |||
| 1184 | Ga0068869_100042868 | |||
| 1185 | Ga0070680_100013830 | |||
| 1186 | Ga0070680_100017794 | |||
| 1187 | Ga0070680_100032348 | |||
| 1188 | Ga0070680_100228026 | |||
| 1189 | Ga0070682_100023695 | |||
| 1190 | Ga0070682_100027255 | |||
| 1191 | Ga0070682_100414809 | |||
| 1192 | Ga0068868_100050101 | |||
| 1193 | Ga0068868_100077577 | |||
| 1194 | Ga0068868_100358432 | |||
| 1195 | Ga0070660_100003692 | |||
| 1196 | Ga0070691_10062410 | |||
| 1197 | Ga0070691_10207719 | |||
| 1198 | Ga0070661_100095335 | |||
| 1199 | Ga0070661_100097802 | |||
| 1200 | Ga0070661_100114667 | |||
| 1201 | Ga0070692_10152887 | |||
| 1202 | Ga0070668_100096703 | |||
| 1203 | Ga0070669_100105002 | |||
| 1204 | Ga0070671_100450820 | |||
| 1205 | Ga0070659_100077774 | |||
| 1206 | Ga0070659_100348156 | |||
| 1207 | Ga0070709_10001773 | |||
| 1208 | Ga0070709_10003406 | |||
| 1209 | Ga0070709_10028284 | |||
| 1210 | Ga0070709_10398656 | |||
| 1211 | Ga0070714_100004471 | |||
| 1212 | Ga0070714_100005064 | |||
| 1213 | Ga0070714_100005907 | |||
| 1214 | Ga0070714_100181026 | |||
| 1215 | Ga0070713_100010463 | |||
| 1216 | Ga0070713_100025937 | |||
| 1217 | Ga0070713_100054896 | |||
| 1218 | Ga0070713_100218156 | |||
| 1219 | Ga0070713_100269513 | |||
| 1220 | Ga0070710_10000733 | |||
| 1221 | Ga0070710_10002547 | |||
| 1222 | Ga0070710_10394655 | |||
| 1223 | Ga0070711_100002277 | |||
| 1224 | Ga0070711_100005722 | |||
| 1225 | Ga0070711_100017022 | |||
| 1226 | Ga0070694_100163094 | |||
| 1227 | Ga0070708_100105209 | |||
| 1228 | Ga0070663_100056890 | |||
| 1229 | Ga0070663_100086623 | |||
| 1230 | Ga0070678_100122527 | |||
| 1231 | Ga0070678_100293761 | |||
| 1232 | Ga0070662_100102062 | |||
| 1233 | Ga0070662_100349195 | |||
| 1234 | Ga0070681_10006411 | |||
| 1235 | Ga0070681_10007888 | |||
| 1236 | Ga0070681_10209066 | |||
| 1237 | Ga0070681_10379274 | |||
| 1238 | Ga0068867_100068488 | |||
| 1239 | Ga0070685_10079531 | |||
| 1240 | Ga0070707_100131877 | |||
| 1241 | Ga0070698_100428292 | |||
| 1242 | Ga0070679_100084060 | |||
| 1243 | Ga0070679_100117260 | |||
| 1244 | Ga0070679_100166544 | |||
| 1245 | Ga0070679_100348053 | |||
| 1246 | Ga0070684_100001671 | |||
| 1247 | Ga0070684_100003951 | |||
| 1248 | Ga0070684_100027263 | |||
| 1249 | Ga0070697_100054323 | |||
| 1250 | Ga0070697_100286595 | |||
| 1251 | Ga0068853_100009612 | |||
| 1252 | Ga0068853_100073793 | |||
| 1253 | Ga0068853_100112298 | |||
| 1254 | Ga0068853_100304088 | |||
| 1255 | Ga0068853_100616768 | |||
| 1256 | Ga0070672_100154936 | |||
| 1257 | Ga0070672_100188111 | |||
| 1258 | Ga0070686_100157948 | |||
| 1259 | Ga0070696_100431094 | |||
| 1260 | Ga0070693_100094519 | |||
| 1261 | Ga0070665_100006775 | |||
| 1262 | Ga0070665_100117081 | |||
| 1263 | Ga0070665_100213675 | |||
| 1264 | Ga0070665_100383785 | |||
| 1265 | Ga0068855_100027307 | |||
| 1266 | Ga0068855_100090289 | |||
| 1267 | Ga0068855_100249115 | |||
| 1268 | Ga0068855_100479688 | |||
| 1269 | Ga0068855_100503047 | |||
| 1270 | Ga0070664_100097000 | |||
| 1271 | Ga0070664_100494768 | |||
| 1272 | Ga0068857_100013087 | |||
| 1273 | Ga0068857_100118930 | |||
| 1274 | Ga0068857_100154049 | |||
| 1275 | Ga0068857_100918523 | |||
| 1276 | Ga0068854_100114761 | |||
| 1277 | Ga0068856_100000137 | |||
| 1278 | Ga0068856_100164748 | |||
| 1279 | Ga0068856_100450497 | |||
| 1280 | Ga0068856_100697101 | |||
| 1281 | Ga0070702_100263453 | |||
| 1282 | Ga0070702_100327108 | |||
| 1283 | Ga0068852_100045438 | |||
| 1284 | Ga0068852_100114236 | |||
| 1285 | Ga0068852_100249598 | |||
| 1286 | Ga0068852_100366379 | |||
| 1287 | Ga0068852_100893838 | |||
| 1288 | Ga0068859_100036471 | |||
| 1289 | Ga0068859_100332314 | |||
| 1290 | Ga0068864_100116857 | |||
| 1291 | Ga0068866_10178752 | |||
| 1292 | Ga0068866_10255926 | |||
| 1293 | Ga0068861_100122230 | |||
| 1294 | Ga0068861_100193960 | |||
| 1295 | Ga0068861_100274716 | |||
| 1296 | Ga0068861_100558045 | |||
| 1297 | Ga0068851_10024349 | |||
| 1298 | Ga0068863_100862291 | |||
| 1299 | Ga0068863_100931089 | |||
| 1300 | Ga0068858_100173646 | |||
| 1301 | Ga0068858_100347889 | |||
| 1302 | Ga0068858_100372466 | |||
| 1303 | Ga0068858_100894872 | |||
| 1304 | Ga0068860_100000313 | |||
| 1305 | Ga0068860_100071594 | |||
| 1306 | Ga0068860_100464475 | |||
| 1307 | Ga0068862_100088428 | |||
| 1308 | Ga0081455_10005731 | |||
| 1309 | Ga0081455_10006340 | |||
| 1310 | Ga0081455_10070353 | |||
| 1311 | Ga0081455_10109419 | |||
| 1312 | Ga0081540_1007566 | |||
| 1313 | Ga0081540_1008557 | |||
| 1314 | Ga0081540_1015476 | |||
| 1315 | Ga0081540_1016697 | |||
| 1316 | Ga0081540_1018292 | |||
| 1317 | Ga0081540_1028527 | |||
| 1318 | Ga0081540_1030961 | |||
| 1319 | Ga0081540_1120200 | |||
| 1320 | Ga0081539_10000157 | |||
| 1321 | Ga0081539_10024999 | |||
| 1322 | Ga0081539_10035737 | |||
| 1323 | Ga0081539_10037759 | |||
| 1324 | Ga0070717_10034976 | |||
| 1325 | Ga0070717_10105473 | |||
| 1326 | Ga0070717_10521886 | |||
| 1327 | Ga0075365_10005412 | |||
| 1328 | Ga0075365_10025948 | |||
| 1329 | Ga0075365_10068327 | |||
| 1330 | Ga0075365_10154101 | |||
| 1331 | Ga0075368_10026619 | |||
| 1332 | Ga0075363_100003641 | |||
| 1333 | Ga0075364_10216327 | |||
| 1334 | Ga0070715_10001356 | |||
| 1335 | Ga0070716_100109303 | |||
| 1336 | Ga0070712_100009263 | |||
| 1337 | Ga0070712_100020237 | |||
| 1338 | Ga0070712_100063060 | |||
| 1339 | Ga0070712_100124838 | |||
| 1340 | Ga0075362_10079646 | |||
| 1341 | Ga0075362_10088491 | |||
| 1342 | Ga0075367_10008296 | |||
| 1343 | Ga0075367_10097764 | |||
| 1344 | Ga0075367_10254551 | |||
| 1345 | Ga0075369_10039347 | |||
| 1346 | Ga0075369_10128677 | |||
| 1347 | Ga0075366_10170955 | |||
| 1348 | Ga0097621_100061585 | |||
| 1349 | Ga0097621_100273596 | |||
| 1350 | Ga0075370_10010672 | |||
| 1351 | Ga0068871_100099894 | |||
| 1352 | Ga0068871_100218361 | |||
| 1353 | Ga0068871_100235431 | |||
| 1354 | Ga0068871_100323971 | |||
| 1355 | Ga0068871_100829049 | |||
| 1356 | Ga0075428_100299912 | |||
| 1357 | Ga0075434_100023401 | |||
| 1358 | Ga0075434_100492591 | |||
| 1359 | Ga0068865_100051173 | |||
| 1360 | Ga0068865_100122873 | |||
| 1361 | Ga0068865_100523729 | |||
| 1362 | Ga0097620_100036468 | |||
| 1363 | Ga0097620_100332311 | |||
| 1364 | Ga0099824_1009019 | |||
| 1365 | Ga0099822_1000541 | |||
| 1366 | Ga0075435_100477968 | |||
| 1367 | Ga0075435_100607995 | |||
| 1368 | Ga0099794_10026556 | |||
| 1369 | Ga0099794_10190702 | |||
| 1370 | Ga0099795_10049266 | |||
| 1371 | Ga0099795_10051868 | |||
| 1372 | Ga0105240_10019828 | |||
| 1373 | Ga0105240_10033307 | |||
| 1374 | Ga0105240_10071475 | |||
| 1375 | Ga0105240_10214410 | |||
| 1376 | Ga0105240_10303050 | |||
| 1377 | Ga0105245_10355395 | |||
| 1378 | Ga0105245_10417284 | |||
| 1379 | Ga0105247_10043425 | |||
| 1380 | Ga0105247_10387975 | |||
| 1381 | Ga0114129_10329738 | |||
| 1382 | Ga0114129_10701257 | |||
| 1383 | Ga0105243_10193154 | |||
| 1384 | Ga0105243_10274392 | |||
| 1385 | Ga0105243_10500355 | |||
| 1386 | Ga0105243_10579946 | |||
| 1387 | Ga0105241_10004267 | |||
| 1388 | Ga0105241_10112623 | |||
| 1389 | Ga0105241_10121417 | |||
| 1390 | Ga0105241_10204243 | |||
| 1391 | Ga0105242_10176970 | |||
| 1392 | Ga0105242_10184447 | |||
| 1393 | Ga0105242_10531000 | |||
| 1394 | Ga0105248_10042051 | |||
| 1395 | Ga0105248_10386405 | |||
| 1396 | Ga0105248_10566361 | |||
| 1397 | Ga0105248_10577091 | |||
| 1398 | Ga0105237_10053748 | |||
| 1399 | Ga0105237_10054084 | |||
| 1400 | Ga0105237_10207229 | |||
| 1401 | Ga0105238_10006268 | |||
| 1402 | Ga0105238_10007999 | |||
| 1403 | Ga0105238_10022426 | |||
| 1404 | Ga0105238_10165407 | |||
| 1405 | Ga0105238_10480958 | |||
| 1406 | Ga0105249_10431191 | |||
| 1407 | Ga0105249_10980212 | |||
| 1408 | Ga0099796_10105880 | |||
| 1409 | Ga0105239_10016677 | |||
| 1410 | Ga0105239_10017503 | |||
| 1411 | Ga0105239_10023011 | |||
| 1412 | Ga0105239_10064415 | |||
| 1413 | Ga0105239_10066921 | |||
| 1414 | Ga0105239_10091046 | |||
| 1415 | Ga0105239_10416118 | |||
| 1416 | Ga0105246_10011987 | |||
| 1417 | Ga0157370_10075424 | |||
| 1418 | Ga0157370_10293990 | |||
| 1419 | Ga0157369_10018692 | |||
| 1420 | Ga0157369_10021614 | |||
| 1421 | Ga0157369_10053822 | |||
| 1422 | Ga0157369_10170660 | |||
| 1423 | Ga0157369_10379588 | |||
| 1424 | Ga0157374_10030777 | |||
| 1425 | Ga0157374_10337655 | |||
| 1426 | Ga0157378_10008170 | |||
| 1427 | Ga0163162_10031643 | |||
| 1428 | Ga0163162_10064118 | |||
| 1429 | Ga0157372_10030290 | |||
| 1430 | Ga0157372_10254842 | |||
| 1431 | Ga0157375_10087093 | |||
| 1432 | Ga0157375_10336598 | |||
| 1433 | Ga0157375_10683897 | |||
| 1434 | Ga0157375_10959867 | |||
| 1435 | Ga0157375_11356039 | |||
| 1436 | Ga0163163_10007500 | |||
| 1437 | Ga0163163_10074865 | |||
| 1438 | Ga0163163_10875493 | |||
| 1439 | Ga0163163_10930358 | |||
| 1440 | Ga0157380_10179994 | |||
| 1441 | Ga0157377_10060788 | |||
| 1442 | Ga0157379_10045832 | |||
| 1443 | Ga0157379_10426865 | |||
| 1444 | Ga0157376_10007382 | |||
| 1445 | Ga0157376_10209994 | |||
| 1446 | Ga0163161_10170489 | |||
| 1447 | Ga0214544_1000003 | |||
| 1448 | Ga0214542_1000022 | |||
| 1449 | Ga0214545_1000010 | |||
| 1450 | Ga0214543_1000035 | |||
| 1451 | Ga0213876_10007200 | |||
| 1452 | Ga0213876_10030756 | |||
| 1453 | Ga0213876_10184716 | |||
| 1454 | Ga0224712_10012900 | |||
| 1455 | Ga0209563_104383 | |||
| 1456 | Ga0209677_102422 | |||
| 1457 | Ga0209677_106686 | |||
| 1458 | Ga0209148_1000267 | |||
| 1459 | Ga0209148_1012691 | |||
| 1460 | Ga0209233_1002344 | |||
| 1461 | Ga0209233_1030433 | |||
| 1462 | Ga0209455_1002785 | |||
| 1463 | Ga0209455_1019316 | |||
| 1464 | Ga0209673_1016536 | |||
| 1465 | Ga0209564_1011905 | |||
| 1466 | Ga0209758_1000711 | |||
| 1467 | Ga0209758_1006280 | |||
| 1468 | Ga0209758_1011473 | |||
| 1469 | Ga0209758_1025149 | |||
| 1470 | Ga0209758_1045048 | |||
| 1471 | Ga0209758_1066470 | |||
| 1472 | Ga0207426_1000217 | |||
| 1473 | Ga0207426_1000368 | |||
| 1474 | Ga0207426_1021420 | |||
| 1475 | Ga0209257_1035558 | |||
| 1476 | Ga0207697_10103064 | |||
| 1477 | Ga0207656_10018079 | |||
| 1478 | Ga0207656_10238650 | |||
| 1479 | Ga0207692_10008533 | |||
| 1480 | Ga0207692_10038421 | |||
| 1481 | Ga0207710_10071478 | |||
| 1482 | Ga0207688_10092165 | |||
| 1483 | Ga0207688_10222077 | |||
| 1484 | Ga0207647_10149608 | |||
| 1485 | Ga0207685_10003797 | |||
| 1486 | Ga0207685_10043745 | |||
| 1487 | Ga0207699_10002066 | |||
| 1488 | Ga0207699_10062902 | |||
| 1489 | Ga0207699_10173191 | |||
| 1490 | Ga0207645_10063010 | |||
| 1491 | Ga0207643_10140630 | |||
| 1492 | Ga0207643_10144685 | |||
| 1493 | Ga0207705_10124141 | |||
| 1494 | Ga0207654_10011023 | |||
| 1495 | Ga0207654_10074360 | |||
| 1496 | Ga0207654_10172097 | |||
| 1497 | Ga0207707_10000143 | |||
| 1498 | Ga0207707_10008151 | |||
| 1499 | Ga0207707_10014431 | |||
| 1500 | Ga0207707_10032951 | |||
| 1501 | Ga0207707_10138915 | |||
| 1502 | Ga0207695_10179409 | |||
| 1503 | Ga0207695_10249358 | |||
| 1504 | Ga0207671_10013578 | |||
| 1505 | Ga0207671_10029351 | |||
| 1506 | Ga0207671_10042941 | |||
| 1507 | Ga0207671_10072605 | |||
| 1508 | Ga0207671_10130576 | |||
| 1509 | Ga0207671_10416426 | |||
| 1510 | Ga0207693_10057437 | |||
| 1511 | Ga0207693_10068508 | |||
| 1512 | Ga0207693_10103169 | |||
| 1513 | Ga0207663_10001825 | |||
| 1514 | Ga0207663_10501237 | |||
| 1515 | Ga0207660_10007904 | |||
| 1516 | Ga0207660_10060084 | |||
| 1517 | Ga0207660_10079943 | |||
| 1518 | Ga0207660_10101512 | |||
| 1519 | Ga0207660_10195322 | |||
| 1520 | Ga0207662_10289944 | |||
| 1521 | Ga0207657_10005482 | |||
| 1522 | Ga0207657_10165247 | |||
| 1523 | Ga0207649_10453583 | |||
| 1524 | Ga0207652_10024703 | |||
| 1525 | Ga0207652_10045150 | |||
| 1526 | Ga0207652_10143817 | |||
| 1527 | Ga0207652_10302301 | |||
| 1528 | Ga0207646_10099096 | |||
| 1529 | Ga0207694_10027217 | |||
| 1530 | Ga0207694_10050027 | |||
| 1531 | Ga0207694_10110472 | |||
| 1532 | Ga0207694_10198901 | |||
| 1533 | Ga0207687_10300220 | |||
| 1534 | Ga0207700_10034094 | |||
| 1535 | Ga0207700_10082300 | |||
| 1536 | Ga0207700_10104229 | |||
| 1537 | Ga0207700_10206963 | |||
| 1538 | Ga0207700_10396391 | |||
| 1539 | Ga0207664_10016865 | |||
| 1540 | Ga0207664_10033578 | |||
| 1541 | Ga0207664_10042803 | |||
| 1542 | Ga0207664_10114792 | |||
| 1543 | Ga0207664_10122380 | |||
| 1544 | Ga0207690_10312419 | |||
| 1545 | Ga0207690_10448949 | |||
| 1546 | Ga0207706_10107908 | |||
| 1547 | Ga0207706_10294140 | |||
| 1548 | Ga0207686_10057091 | |||
| 1549 | Ga0207686_10194652 | |||
| 1550 | Ga0207686_10262562 | |||
| 1551 | Ga0207709_10010853 | |||
| 1552 | Ga0207709_10236931 | |||
| 1553 | Ga0207669_10108252 | |||
| 1554 | Ga0207669_10174051 | |||
| 1555 | Ga0207704_10032142 | |||
| 1556 | Ga0207704_10123187 | |||
| 1557 | Ga0207665_10009939 | |||
| 1558 | Ga0207665_10342051 | |||
| 1559 | Ga0207665_10352517 | |||
| 1560 | Ga0207691_10041683 | |||
| 1561 | Ga0207691_10195230 | |||
| 1562 | Ga0207691_10324196 | |||
| 1563 | Ga0207691_10345098 | |||
| 1564 | Ga0207711_10030129 | |||
| 1565 | Ga0207711_10120999 | |||
| 1566 | Ga0207711_10370197 | |||
| 1567 | Ga0207711_10712262 | |||
| 1568 | Ga0207689_10041822 | |||
| 1569 | Ga0207661_10007632 | |||
| 1570 | Ga0207661_10068018 | |||
| 1571 | Ga0207661_10532797 | |||
| 1572 | Ga0207679_10384849 | |||
| 1573 | Ga0207679_10659440 | |||
| 1574 | Ga0207679_10786184 | |||
| 1575 | Ga0207667_10020014 | |||
| 1576 | Ga0207667_10020505 | |||
| 1577 | Ga0207667_10158850 | |||
| 1578 | Ga0207667_10267630 | |||
| 1579 | Ga0207667_10605857 | |||
| 1580 | Ga0207667_10963564 | |||
| 1581 | Ga0207712_10039860 | |||
| 1582 | Ga0207668_10060515 | |||
| 1583 | Ga0207668_10104520 | |||
| 1584 | Ga0207668_10401135 | |||
| 1585 | Ga0207640_10027323 | |||
| 1586 | Ga0207640_10041490 | |||
| 1587 | Ga0207640_10114422 | |||
| 1588 | Ga0207640_10160171 | |||
| 1589 | Ga0207640_10225390 | |||
| 1590 | Ga0207677_10236789 | |||
| 1591 | Ga0207677_10264893 | |||
| 1592 | Ga0207703_10045007 | |||
| 1593 | Ga0207703_10381486 | |||
| 1594 | Ga0207703_10534336 | |||
| 1595 | Ga0207639_10043716 | |||
| 1596 | Ga0207639_10076603 | |||
| 1597 | Ga0207639_10087416 | |||
| 1598 | Ga0207639_10103285 | |||
| 1599 | Ga0207639_10551404 | |||
| 1600 | Ga0207678_10135493 | |||
| 1601 | Ga0207678_10141568 | |||
| 1602 | Ga0207678_10258360 | |||
| 1603 | Ga0207708_10215331 | |||
| 1604 | Ga0207708_10253201 | |||
| 1605 | Ga0207702_10000063 | |||
| 1606 | Ga0207702_10066463 | |||
| 1607 | Ga0207702_10195942 | |||
| 1608 | Ga0207702_10313810 | |||
| 1609 | Ga0207702_10452113 | |||
| 1610 | Ga0207641_10112713 | |||
| 1611 | Ga0207641_10555710 | |||
| 1612 | Ga0207641_10865732 | |||
| 1613 | Ga0207648_10082120 | |||
| 1614 | Ga0207648_10335943 | |||
| 1615 | Ga0207676_10384453 | |||
| 1616 | Ga0207674_10018135 | |||
| 1617 | Ga0207674_10078405 | |||
| 1618 | Ga0207674_10180637 | |||
| 1619 | Ga0207675_100391680 | |||
| 1620 | Ga0207683_10007406 | |||
| 1621 | Ga0207683_10051080 | |||
| 1622 | Ga0207683_10096043 | |||
| 1623 | Ga0207683_10432197 | |||
| 1624 | Ga0207683_10675232 | |||
| 1625 | Ga0207698_10068132 | |||
| 1626 | Ga0207698_10192999 | |||
| 1627 | Ga0207698_10230995 | |||
| 1628 | Ga0209389_1000012 | |||
| 1629 | Ga0209389_1000069 | |||
| 1630 | Ga0209589_1000015 | |||
| 1631 | Ga0209589_1000077 | |||
| 1632 | Ga0209489_100015 | |||
| 1633 | Ga0209489_100019 | |||
| 1634 | Ga0209489_100020 | |||
| 1635 | Ga0209700_100018 | |||
| 1636 | Ga0209700_100025 | |||
| 1637 | Ga0209179_1015554 | |||
| 1638 | Ga0265356_1005297 | |||
| 1639 | Ga0268266_10003191 | |||
| 1640 | Ga0268266_10046869 | |||
| 1641 | Ga0268266_10053850 | |||
| 1642 | Ga0268266_10098228 | |||
| 1643 | Ga0268266_10247314 | |||
| 1644 | Ga0268266_10508193 | |||
| 1645 | Ga0268266_10566989 | |||
| 1646 | Ga0268265_10092782 | |||
| 1647 | Ga0268265_10437281 | |||
| 1648 | Ga0268265_10566791 | |||
| 1649 | Ga0268264_10000356 | |||
| 1650 | Ga0268264_10264157 | |||
| 1651 | Ga0268264_10713960 | |||
| 1652 | Ga0265337_1011271 | |||
| 1653 | Ga0265326_10006827 | |||
| 1654 | Ga0265334_10020212 | |||
| 1655 | Ga0265323_10017148 | |||
| 1656 | Ga0265322_10013237 | |||
| 1657 | Ga0265336_10000850 | |||
| 1658 | Ga0307517_10010277 | |||
| 1659 | Ga0307517_10092412 | |||
| 1660 | Ga0265338_10000417 | |||
| 1661 | Ga0265324_10003779 | |||
| 1662 | Ga0307511_10034380 | |||
| 1663 | Ga0307512_10244188 | |||
| 1664 | Ga0265330_10010731 | |||
| 1665 | Ga0265330_10050026 | |||
| 1666 | Ga0265328_10027348 | |||
| 1667 | Ga0265340_10016299 | |||
| 1668 | Ga0265339_10036098 | |||
| 1669 | Ga0265331_10032239 | |||
| 1670 | Ga0265316_10045394 | |||
| 1671 | Ga0307513_10149453 | |||
| 1672 | Ga0307513_10168277 | |||
| 1673 | Ga0307509_10009216 | |||
| 1674 | Ga0307509_10192327 | |||
| 1675 | Ga0307509_10305456 | |||
| 1676 | Ga0265313_10052803 | |||
| 1677 | Ga0307508_10000715 | |||
| 1678 | Ga0307508_10033881 | |||
| 1679 | Ga0307508_10162644 | |||
| 1680 | Ga0265314_10071962 | |||
| 1681 | Ga0265314_10073784 | |||
| 1682 | Ga0265314_10163340 | |||
| 1683 | Ga0265342_10003269 | |||
| 1684 | Ga0307516_10005305 | |||
| 1685 | Ga0307516_10009786 | |||
| 1686 | Ga0307516_10032872 | |||
| 1687 | Ga0307516_10068945 | |||
| 1688 | Ga0307516_10325424 | |||
| 1689 | Ga0307413_10377958 | |||
| 1690 | Ga0307406_10521848 | |||
| 1691 | Ga0307416_100953460 | |||
| 1692 | Ga0307411_10249618 | |||
| 1693 | Ga0307415_100025456 | |||
| 1694 | Ga0307507_10045602 | |||
| 1695 | Ga0307510_10075614 | |||
| 1696 | Ga0307510_10078920 | |||
| 1697 | Ga0307510_10103437 | |||
| 1698 | Ga0307510_10274451 | |||
| 1699 | Ga0315911_1000021 | |||
| 1700 | Ga0373958_0038786 | |||
| 1701 | Ga0373938_0023985 | |||
| 1702 | Ga0373928_0025131 | |||
| 1703 | Ga0373934_0009001 | |||
| 1704 | Ga0373934_0092315 | |||
| 1705 | Ga0373940_0069843 | |||
| 1706 | Ga0373949_0034217 | |||
| 1707 | Ga0373923_0240466 | |||
| 1708 | Ga0373936_0049679 | |||
| 1709 | Ga0373936_0147179 | |||
| 1710 | Ga0373945_0004291 | |||
| 1711 | Ga0373945_0125704 | |||
| 1712 | Ga0373953_0066378 | |||
| 1713 | Ga0373954_0001886 | |||
| 1714 | Ga0373954_0021857 | |||
| 1715 | Ga0373954_0066781 | |||
| 1716 | Ga0373956_0000376 | |||
| 1717 | Ga0373957_0000575 | |||
| 1718 | Ga0373957_0019213 | |||
| 1719 | Ga0373957_0074268 | |||
| 1720 | Ga0373943_0055380 | |||
| 1721 | Ga0373946_0011656 | |||
| 1722 | Ga0373955_0000325 | |||
| 1723 | Ga0373942_0089282 | |||
| 1724 | Ga0373962_0059177 | |||
| 1725 | Ga0373924_0000567 | |||
| 1726 | Ga0373924_0111432 | |||
| 1727 | Ga0373931_0031715 | |||
| 1728 | Ga0373935_0001812 | |||
| 1729 | Ga0373935_0005959 | |||
| 1730 | Ga0373935_0061189 | |||
| 1731 | Ga0373927_0000137 | |||
| 1732 | Ga0373927_0002991 | |||
| 1733 | Ga0373927_0005646 | |||
| 1734 | Ga0373927_0014399 | |||
| 1735 | Ga0373927_0031557 | |||
| 1736 | Ga0373927_0049450 | |||
| 1737 | Ga0373927_0535212 | |||
| 1738 | Ga0373933_0002337 | |||
| 1739 | Ga0373933_0133824 | |||
| 1740 | Ga0373947_0003829 | |||
| 1741 | Ga0373947_0038698 | |||
| 1742 | Ga0373947_0040983 | |||
| 1743 | Ga0373947_0066433 | |||
| 1744 | Ga0373947_0297885 | |||
| 1745 | Ga0373937_0021625 | |||
| 1746 | Ga0373937_0047940 | |||
| 1747 | Ga0373937_0105868 | |||
| 1748 | Ga0373925_0008084 | |||
| 1749 | Ga0373925_0034633 | |||
| 1750 | Ga0373925_0518149 | |||
| 1751 | Ga0395899_0196775 | |||
| 1752 | Ga0395900_0010102 | |||
| 1753 | Ga0395900_0129021 | |||
| 1754 | Ga0395900_0227548 | |||
| 1755 | Ga0395898_0308902 | |||
| 1756 | Ga0395898_0671920 | |||
| 1757 | Ga0395905_0136017 | |||
| 1758 | Ga0436364_0654283 | |||
| 1759 | Ga0436364_1520197 | |||
| 1760 | Ga0395901_0029430 | |||
| 1761 | Ga0395901_0110928 | |||
| 1762 | Ga0395901_0280022 | |||
| 1763 | Ga0436365_0485329 | |||
| 1764 | Ga0436365_0503144 | |||
| 1765 | Ga0436365_0824582 | |||
| 1766 | Ga0436365_1160562 | |||
| 1767 | Ga0436365_1210665 | |||
| 1768 | Ga0436365_1552511 | |||
| 1769 | Ga0436365_1565796 | |||
| 1770 | Ga0436363_0207072 | |||
| 1771 | Ga0436363_1685596 | |||
| 1772 | Ga0436362_0591733 | |||
| 1773 | Ga0439465_0038800 | |||
| 1774 | Ga0451793_0152413 | |||
| 1775 | Ga0451807_1667387 | |||
| 1776 | Ga0451835_0378223 | |||
| 1777 | Ga0466969_0050676 | |||
| 1778 | Ga0466969_0230916 | |||
| 1779 | Ga0466969_0263782 | |||
| 1780 | Ga0466972_0000100 | |||
| 1781 | Ga0466965_0153822 | |||
| 1782 | Ga0466966_0001463 | |||
| 1783 | Ga0466966_0034352 | |||
| 1784 | Ga0466966_0073682 | |||
| 1785 | Ga0466961_0000601 | |||
| 1786 | Ga0466963_0065181 | |||
| 1787 | Ga0466964_0329916 | |||
| 1788 | Ga0466968_0008001 | |||
| 1789 | Ga0466968_0083378 | |||
| 1790 | Ga0466957_0100105 | |||
| 1791 | Ga0466957_0294029 | |||
| 1792 | Ga0466959_0000634 | |||
| 1793 | Ga0466959_0063987 | |||
| 1794 | Ga0466958_0025141 | |||
| 1795 | Ga0466967_0054112 | |||
| 1796 | Ga0466967_0199929 | |||
| 1797 | Ga0466967_0671821 | |||
| 1798 | Ga0495617_026277 | |||
| 1799 | Ga0495592_0000339 | |||
| 1800 | Ga0495592_0072757 | |||
| 1801 | Ga0495592_0120602 | |||
| 1802 | Ga0495603_0000029 | |||
| 1803 | Ga0495603_0004729 | |||
| 1804 | Ga0495603_0039376 | |||
| 1805 | Ga0495603_0124400 | |||
| 1806 | Ga0495603_0128079 | |||
| 1807 | Ga0495603_0237067 | |||
| 1808 | Ga0495590_0039833 | |||
| 1809 | Ga0495629_0000029 | |||
| 1810 | Ga0495629_0001483 | |||
| 1811 | Ga0495629_0043140 | |||
| 1812 | Ga0495638_0048119 | |||
| 1813 | Ga0495638_0109463 | |||
| 1814 | Ga0495638_0125742 | |||
| 1815 | Ga0495638_0145320 | |||
| 1816 | Ga0495638_0329591 | |||
| 1817 | Ga0495641_0004254 | |||
| 1818 | Ga0495651_0022220 | |||
| 1819 | Ga0495651_0025349 | |||
| 1820 | Ga0495651_0034091 | |||
| 1821 | Ga0495653_0001063 | |||
| 1822 | Ga0495653_0156443 | |||
| 1823 | Ga0495653_0160665 | |||
| 1824 | Ga0495650_0047269 | |||
| 1825 | Ga0495580_0000321 | |||
| 1826 | Ga0495582_0000024 | |||
| 1827 | Ga0495582_0380522 | |||
| 1828 | Ga0495605_0104137 | |||
| 1829 | Ga0495639_0000006 | |||
| 1830 | Ga0495639_0059902 | |||
| 1831 | Ga0495662_0000068 | |||
| 1832 | Ga0495662_0163187 | |||
| 1833 | Ga0495664_0007034 | |||
| 1834 | Ga0495664_0045327 | |||
| 1835 | Ga0495664_0078530 | |||
| 1836 | Ga0495594_0000170 | |||
| 1837 | Ga0495594_0159480 | |||
| 1838 | Ga0495596_0027178 | |||
| 1839 | Ga0495596_0029477 | |||
| 1840 | Ga0495596_0042656 | |||
| 1841 | Ga0495596_0088297 | |||
| 1842 | Ga0495596_0099369 | |||
| 1843 | Ga0495606_0013516 | |||
| 1844 | Ga0495606_0237238 | |||
| 1845 | Ga0495608_0009012 | |||
| 1846 | Ga0495610_0118567 | |||
| 1847 | Ga0495616_0157523 | |||
| 1848 | Ga0495618_0015222 | |||
| 1849 | Ga0495618_0244416 | |||
| 1850 | Ga0495620_0070634 | |||
| 1851 | Ga0495628_0001554 | |||
| 1852 | Ga0495628_0014226 | |||
| 1853 | Ga0495628_0051848 | |||
| 1854 | Ga0495628_0079529 | |||
| 1855 | Ga0495628_0251082 | |||
| 1856 | Ga0495630_0018888 | |||
| 1857 | Ga0495631_0068996 | |||
| 1858 | Ga0495632_0125884 | |||
| 1859 | Ga0495643_0206251 | |||
| 1860 | Ga0495643_0267354 | |||
| 1861 | Ga0495644_0047261 | |||
| 1862 | Ga0495648_0019778 | |||
| 1863 | Ga0495666_0003580 | |||
| 1864 | Ga0495652_0005882 | |||
| 1865 | Ga0495652_0007546 | |||
| 1866 | Ga0495652_0364035 | |||
| 1867 | Ga0495665_0000158 | |||
| 1868 | Ga0495665_0067607 | |||
| 1869 | Ga0495640_0015043 | |||
| 1870 | Ga0495640_0016249 | |||
| 1871 | Ga0495640_0022850 | |||
| 1872 | Ga0495640_0068770 | |||
| 1873 | Ga0495640_0321408 | |||
| 1874 | Ga0495640_0366517 | |||
| 1875 | Ga0495587_0006630 | |||
| 1876 | Ga0495587_0008157 | |||
| 1877 | Ga0495587_0307525 | |||
| 1878 | Ga0495598_0017810 | |||
| 1879 | Ga0495598_0076497 | |||
| 1880 | Ga0495621_0063096 | |||
| 1881 | Ga0495645_0003892 | |||
| 1882 | Ga0495645_0077757 | |||
| 1883 | Ga0495622_0005431 | |||
| 1884 | Ga0495622_0018938 | |||
| 1885 | Ga0495667_0003075 | |||
| 1886 | Ga0495667_0008458 | |||
| 1887 | Ga0495667_0033191 | |||
| 1888 | Ga0495667_0038553 | |||
| 1889 | Ga0495656_0058931 | |||
| 1890 | Ga0495668_0052040 | |||
| 1891 | Ga0495634_0000354 | |||
| 1892 | Ga0495634_0005678 | |||
| 1893 | Ga0495634_0033779 | |||
| 1894 | Ga0495625_0030852 | |||
| 1895 | Ga0495625_0251050 | |||
| 1896 | Ga0495625_0295861 | |||
| 1897 | Ga0495635_0000179 | |||
| 1898 | Ga0495635_0000917 | |||
| 1899 | Ga0495635_0002291 | |||
| 1900 | Ga0495635_0018638 | |||
| 1901 | Ga0495659_0132444 | |||
| 1902 | Ga0495659_0138586 | |||
| 1903 | Ga0495661_0099140 | |||
| 1904 | Ga0495588_0001137 | |||
| 1905 | Ga0495588_0040929 | |||
| 1906 | Ga0495588_0070450 | |||
| 1907 | Ga0495657_0005133 | |||
| 1908 | Ga0495657_0009727 | |||
| 1909 | Ga0495657_0013656 | |||
| 1910 | Ga0495599_0001780 | |||
| 1911 | Ga0495599_0038886 | |||
| 1912 | Ga0495623_0010483 | |||
| 1913 | Ga0495623_0112900 | |||
| 1914 | Ga0495623_0113792 | |||
| 1915 | Ga0495646_0003762 | |||
| 1916 | Ga0495646_0003865 | |||
| 1917 | Ga0495646_0009381 | |||
| 1918 | Ga0495646_0012426 | |||
| 1919 | Ga0495646_0046640 | |||
| 1920 | Ga0495647_0000068 | |||
| 1921 | Ga0495658_0000428 | |||
| 1922 | Ga0495669_0012020 | |||
| 1923 | Ga0495669_0094182 | |||
| 1924 | Ga0495613_0003569 | |||
| 1925 | Ga0495613_0056042 | |||
| 1926 | Ga0495613_0067784 | |||
| 1927 | Ga0495613_0194263 | |||
| 1928 | Ga0495613_0228080 | |||
| 1929 | Ga0495624_0010213 | |||
| 1930 | Ga0495670_0013643 | |||
| 1931 | Ga0495649_0146826 | |||
| 1932 | Ga0495600_0005669 | |||
| 1933 | Ga0495600_0006367 | |||
| 1934 | Ga0495600_0220799 | |||
| 1935 | Ga0495581_0000004 | |||
| 1936 | Ga0495581_0074323 | |||
| 1937 | Ga0495581_0132278 | |||
| 1938 | Ga0495581_0406097 | |||
| 1939 | Ga0495604_0000678 | |||
| 1940 | Ga0495604_0017687 | |||
| 1941 | Ga0495604_0301715 | |||
| 1942 | Ga0495674_0000415 | |||
| 1943 | Ga0495674_0026281 | |||
| 1944 | Ga0495674_0037829 | |||
| 1945 | Ga0495674_0163154 | |||
| 1946 | Ga0495674_0501179 | |||
| 1947 | Ga0495672_0025023 | |||
| 1948 | Ga0495672_0034348 | |||
| 1949 | Ga0495676_0037764 | |||
| 1950 | Ga0495676_0054205 | |||
| 1951 | Ga0495676_0288023 | |||
| 1952 | Ga0495680_0001065 | |||
| 1953 | Ga0495680_0001164 | |||
| 1954 | Ga0495680_0011443 | |||
| 1955 | Ga0495680_0190505 | |||
| 1956 | Ga0495683_0125833 | |||
| 1957 | Ga0495687_079046 | |||
| 1958 | Ga0495675_0000901 | |||
| 1959 | Ga0495675_0012017 | |||
| 1960 | Ga0495675_0047111 | |||
| 1961 | Ga0495677_0189774 | |||
| 1962 | Ga0495673_0006914 | |||
| 1963 | Ga0495673_0035197 | |||
| 1964 | Ga0495684_0000721 | |||
| 1965 | Ga0495684_0043390 | |||
| 1966 | Ga0495686_0078664 | |||
| 1967 | Ga0495686_0109802 | |||
| 1968 | Ga0495593_0000198 | |||
| 1969 | Ga0495593_0003054 | |||
| 1970 | Ga0495593_0012359 | |||
| 1971 | Ga0495602_0007817 | |||
| 1972 | Ga0495602_0028529 | |||
| 1973 | Ga0495602_0240422 | |||
| 1974 | Ga0495614_0012824 | |||
| 1975 | Ga0496100_0129237 | |||
| 1976 | Ga0496100_0192923 | |||
| 1977 | Ga0496100_0396805 | |||
| 1978 | Ga0496100_0439929 | |||
| 1979 | Ga0496101_0081944 | |||
| 1980 | Ga0496101_0087577 | |||
| 1981 | Ga0496101_0112623 | |||
| 1982 | Ga0496101_0185154 | |||
| 1983 | Ga0496102_0010634 | |||
| 1984 | Ga0496102_0020294 | |||
| 1985 | Ga0496102_0287350 | |||
| 1986 | Ga0496103_0146779 | |||
| 1987 | Ga0496104_0014507 | |||
| 1988 | Ga0496104_0088354 | |||
| 1989 | Ga0496104_0093736 | |||
| 1990 | Ga0496104_0116083 | |||
| 1991 | Ga0496104_0142485 | |||
| 1992 | Ga0496105_0007733 | |||
| 1993 | Ga0496105_0058803 | |||
| 1994 | Ga0496105_0165853 | |||
| 1995 | Ga0496105_0173764 | |||
| 1996 | Ga0496106_0001358 | |||
| 1997 | Ga0496106_0013044 | |||
| 1998 | Ga0496106_0370149 | |||
| 1999 | Ga0496107_0010093 | |||
| 2000 | Ga0496107_0044003 | |||
| 2001 | Ga0496107_0077132 | |||
| 2002 | Ga0496107_0435265 | |||
| 2003 | Ga0496107_0443683 | |||
| 2004 | Ga0496108_0243525 | |||
| 2005 | Ga0496108_0320327 | |||
| 2006 | Ga0496108_0343574 | |||
| 2007 | Ga0496109_0019726 | |||
| 2008 | Ga0496109_0134208 | |||
| 2009 | Ga0496109_0154485 | |||
| 2010 | Ga0496110_0051009 | |||
| 2011 | Ga0496110_0106590 | |||
| 2012 | Ga0496110_0134325 | |||
| 2013 | Ga0496111_0041340 | |||
| 2014 | Ga0496111_0562852 | |||
| 2015 | Ga0496112_0039379 | |||
| 2016 | Ga0496112_0063507 | |||
| 2017 | Ga0496112_0171885 | |||
| 2018 | Ga0496112_0189424 | |||
| 2019 | Ga0496112_0220173 | |||
| 2020 | Ga0496112_0251153 | |||
| 2021 | Ga0496112_0266018 | |||
| 2022 | Ga0496113_0040245 | |||
| 2023 | Ga0496113_0057239 | |||
| 2024 | Ga0496113_0168681 | |||
| 2025 | Ga0496113_0210725 | |||
| 2026 | Ga0496114_0044398 | |||
| 2027 | Ga0496114_0142517 | |||
| 2028 | Ga0496114_0189221 | |||
| 2029 | Ga0496114_0226605 | |||
| 2030 | Ga0496114_0272774 | |||
| 2031 | Ga0496114_0652052 | |||
| 2032 | Ga0496115_0009406 | |||
| 2033 | Ga0496115_0017598 | |||
| 2034 | Ga0496115_0022309 | |||
| 2035 | Ga0496115_0042539 | |||
| 2036 | Ga0496115_0342381 | |||
| 2037 | Ga0496115_0624929 | |||
| 2038 | Ga0496116_0173770 | |||
| 2039 | Ga0496116_0176508 | |||
| 2040 | Ga0496117_0300518 | |||
| 2041 | Ga0496118_0003027 | |||
| 2042 | Ga0496118_0020353 | |||
| 2043 | Ga0496118_0069557 | |||
| 2044 | Ga0496118_0106687 | |||
| 2045 | Ga0496119_0213833 | |||
| 2046 | Ga0496120_0003365 | |||
| 2047 | Ga0496120_0105837 | |||
| 2048 | Ga0496121_0001622 | |||
| 2049 | Ga0496121_0002689 | |||
| 2050 | Ga0496121_0047888 | |||
| 2051 | Ga0496121_0062499 | |||
| 2052 | Ga0496121_0095725 | |||
| 2053 | Ga0496121_0122983 | |||
| 2054 | Ga0496121_0360027 | |||
| 2055 | Ga0496124_0002957 | |||
| 2056 | Ga0496124_0354100 | |||
| 2057 | Ga0496125_0076533 | |||
| 2058 | Ga0496125_0083260 | |||
| 2059 | Ga0496125_0089991 | |||
| 2060 | Ga0496125_0094540 | |||
| 2061 | Ga0496125_0213072 | |||
| 2062 | Ga0496126_0003472 | |||
| 2063 | Ga0496126_0003803 | |||
| 2064 | Ga0496126_0022661 | |||
| 2065 | Ga0496126_0047705 | |||
| 2066 | Ga0496126_0062063 | |||
| 2067 | Ga0496126_0081503 | |||
| 2068 | Ga0496126_0128008 | |||
| 2069 | Ga0496126_0138734 | |||
| 2070 | Ga0496126_0179618 | |||
| 2071 | Ga0496126_0180368 | |||
| 2072 | Ga0501031_0066816 | |||
| 2073 | Ga0501032_0051974 | |||
| 2074 | Ga0501032_0261931 | |||
| 2075 | Ga0501033_0026715 | |||
| 2076 | Ga0501033_0109936 | |||
| 2077 | Ga0501034_0134299 | |||
| 2078 | Ga0501036_0139078 | |||
| 2079 | Ga0501037_0217317 | |||
| 2080 | Ga0501039_0490094 | |||
| 2081 | Ga0501046_0237739 | |||
| 2082 | Ga0501047_0009870 | |||
| 2083 | Ga0501047_0295582 | |||
| 2084 | Ga0501067_0013941 | |||
| 2085 | Ga0501069_0066434 | |||
| 2086 | Ga0501070_0016072 | |||
| 2087 | Ga0501080_0281563 | |||
| 2088 | Ga0501035_0088777 | |||
| 2089 | Ga0501035_0443138 | |||
| 2090 | Ga0501044_0076769 | |||
| 2091 | nmdc:mga03n38_6294_c1 | |||
| 2092 | nmdc:mga00v17_31303_c1 | |||
| 2093 | nmdc:mga0yw44_26173_c1 | |||
| 2094 | nmdc:mga0yw44_286547_c1 | |||
| 2095 | nmdc:mga06z11_627_c1 | |||
| 2096 | nmdc:mga07m45_130556_c1 | |||
| 2097 | nmdc:mga07m45_191248_c1 | |||
| 2098 | nmdc:mga07m45_2231_c1 | |||
| 2099 | nmdc:mga05p37_1050914_c1 | |||
| 2100 | nmdc:mga05p37_534440_c1 | |||
| 2101 | nmdc:mga0n895_15181_c1 | |||
| 2102 | nmdc:mga0n895_161206_c1 | |||
| 2103 | nmdc:mga0rr50_88622_c1 | |||
| 2104 | nmdc:mga0sz30_177024_c1 | |||
| 2105 | nmdc:mga0sz30_25042_c1 | |||
| 2106 | nmdc:mga0sz30_32158_c1 | |||
| 2107 | Ga0495601_0012219 | |||
| 2108 | Ga0495601_0070960 | |||
| 2109 | Ga0495612_0062043 | |||
| 2110 | Ga0500635_0025642 | |||
| 2111 | Ga0500635_0034819 | |||
| 2112 | Ga0495655_0054386 | |||
| 2113 | Ga0495595_0001490 | |||
| 2114 | Ga0495595_0030722 | |||
| 2115 | Ga0495595_0139750 | |||
| 2116 | Ga0495619_0000912 | |||
| 2117 | Ga0495619_0166821 | |||
| 2118 | Ga0495619_0200985 | |||
| 2119 | Ga0495619_0442753 | |||
| 2120 | Ga0500578_0084550 | |||
| 2121 | Ga0500578_0185539 | |||
| 2122 | Ga0500578_0362833 | |||
| 2123 | Ga0500643_000048 | |||
| 2124 | Ga0500644_0066945 | |||
| 2125 | Ga0500647_0003150 | |||
| 2126 | Ga0500583_0010766 | |||
| 2127 | Ga0500651_0002004 | |||
| 2128 | Ga0500566_0000126 | |||
| 2129 | Ga0500566_0004965 | |||
| 2130 | Ga0500640_003090 | |||
| 2131 | Ga0500641_0005231 | |||
| 2132 | Ga0500641_0008827 | |||
| 2133 | Ga0500641_0088499 | |||
| 2134 | Ga0500650_0265055 | |||
| 2135 | Ga0500554_056184 | |||
| 2136 | Ga0500555_064552 | |||
| 2137 | Ga0500555_088821 | |||
| 2138 | Ga0500556_0167121 | |||
| 2139 | Ga0500557_000083 | |||
| 2140 | Ga0500572_105638 | |||
| 2141 | Ga0500575_118948 | |||
| 2142 | Ga0500582_126282 | |||
| 2143 | Ga0500591_068085 | |||
| 2144 | Ga0500594_0008171 | |||
| 2145 | Ga0500595_000333 | |||
| 2146 | Ga0500595_010458 | |||
| 2147 | Ga0500595_016706 | |||
| 2148 | Ga0500614_001649 | |||
| 2149 | Ga0500642_0000642 | |||
| 2150 | Ga0500652_036390 | |||
| 2151 | Ga0500658_0048518 | |||
| 2152 | Ga0500658_0094869 | |||
| 2153 | Ga0500559_0013656 | |||
| 2154 | Ga0500559_0044587 | |||
| 2155 | Ga0500568_0007618 | |||
| 2156 | Ga0500573_0052282 | |||
| 2157 | Ga0500577_0213873 | |||
| 2158 | Ga0500590_072438 | |||
| 2159 | Ga0500590_080589 | |||
| 2160 | Ga0500603_000304 | |||
| 2161 | Ga0500603_000540 | |||
| 2162 | Ga0500603_055931 | |||
| 2163 | Ga0500616_0030013 | |||
| 2164 | Ga0500622_0026896 | |||
| 2165 | Ga0500627_0240593 | |||
| 2166 | Ga0500630_002602 | |||
| 2167 | Ga0500638_005288 | |||
| 2168 | Ga0500638_036876 | |||
| 2169 | Ga0500639_000039 | |||
| 2170 | Ga0500639_060191 | |||
| 2171 | Ga0500636_0014674 | |||
| 2172 | Ga0500636_0050987 | |||
| 2173 | Ga0500636_0243085 | |||
| 2174 | Ga0500637_0000060 | |||
| 2175 | Ga0500637_0000131 | |||
| 2176 | Ga0500657_053632 | |||
| 2177 | Ga0500625_067921 | |||
| 2178 | Ga0500609_020937 | |||
| 2179 | Ga0500596_001078 | |||
| 2180 | Ga0500596_001647 | |||
| 2181 | Ga0500601_009327 | |||
| 2182 | Ga0500661_001013 | |||
| 2183 | 2509151563 | |||
| 2184 | 2511396626 | |||
| 2185 | 2513627473 | |||
| 2186 | 2513638787 | |||
| 2187 | 2513649863 | |||
| 2188 | 2513659792 | |||
| 2189 | 2513676927 | |||
| 2190 | 2513694715 | |||
| 2191 | 2513857253 | |||
| 2192 | 2513918868 | |||
| 2193 | 2517105698 | |||
| 2194 | 2517888193 | |||
| 2195 | 2524435442 | |||
| 2196 | 2524468647 | |||
| 2197 | 2524533370 | |||
| 2198 | 2528855129 | |||
| 2199 | 2617374501 | |||
| 2200 | 2671119348 | |||
| 2201 | 2723842248 | |||
| 2202 | 2728753850 | |||
| 2203 | 2745081394 | |||
| 2204 | 2793073872 | |||
| 2205 | 2793077982 | |||
| 2206 | 2818240863 | |||
| 2207 | 2824605532 | |||
| 2208 | 2824610830 | |||
| 2209 | 2824619366 | |||
| 2210 | 2824627821 | |||
| 2211 | 2824641887 | |||
| 2212 | 2824651285 | |||
| 2213 | 2824653882 | |||
| 2214 | 2824663765 | |||
| 2215 | 2824680230 | |||
| 2216 | 2824706073 | |||
| 2217 | 2824720079 | |||
| 2218 | 2824729441 | |||
| 2219 | 2824737482 | |||
| 2220 | 2824748037 | |||
| 2221 | 2824760294 | |||
| 2222 | 2824771533 | |||
| 2223 | 2841965299 | |||
| 2224 | 2844321491 | |||
| 2225 | 2847939476 | |||
| 2226 | 2857513308 | |||
| 2227 | 2874610163 | |||
| 2228 | 2874620213 | |||
| 2229 | 2876761698 | |||
| 2230 | 2876815720 | |||
| 2231 | 2879091082 | |||
| 2232 | 2879106647 | |||
| 2233 | 2879117039 | |||
| 2234 | 2881369635 | |||
| 2235 | 2881670158 | |||
| 2236 | 2885380654 | |||
| 2237 | 2885418256 | |||
| 2238 | 2888387746 | |||
| 2239 | 2888389965 | |||
| 2240 | 2888421135 | |||
| 2241 | 2889036364 | |||
| 2242 | 2903727930 | |||
| 2243 | 2903752681 | |||
| 2244 | 2903772255 | |||
| 2245 | 2904695768 | |||
| 2246 | 2904709889 | |||
| 2247 | 2904718100 | |||
| 2248 | 2906602586 | |||
| 2249 | 2906614450 | |||
| 2250 | 2906643427 | |||
| 2251 | 2906648658 | |||
| 2252 | 2906666619 | |||
| 2253 | 2908746721 | |||
| 2254 | 2908764284 | |||
| 2255 | 2908776980 | |||
| 2256 | 2922366753 | |||
| 2257 | 2922377451 | |||
| 2258 | 2922389344 | |||
| 2259 | 2922393374 | |||
| 2260 | 2922426284 | |||
| 2261 | 2929622243 | |||
| 2262 | 2929630110 | |||
| 2263 | 2932787957 | |||
| 2264 | 2932799509 | |||
| 2265 | 2932805185 | |||
| 2266 | 2932813332 | |||
| 2267 | 2932820029 | |||
| 2268 | 2932832907 | |||
| 2269 | 2933584143 | |||
| 2270 | 2935620392 | |||
| 2271 | 2935632669 | |||
| 2272 | 2935640716 | |||
| 2273 | 2935668908 | |||
| 2274 | 2935681366 | |||
| 2275 | 2935687217 | |||
| 2276 | 2935696812 | |||
| 2277 | 2935709096 | |||
| 2278 | 2935716905 | |||
| 2279 | 2935722970 | |||
| 2280 | 2935734527 | |||
| 2281 | 2935744682 | |||
| 2282 | 2935753183 | |||
| 2283 | 2935767587 | |||
| 2284 | 2935770181 | |||
| 2285 | 2935777789 | |||
| 2286 | 2935786765 | |||
| 2287 | 2935794819 | |||
| 2288 | 2935804826 | |||
| 2289 | 2935815975 | |||
| 2290 | 2935832223 | |||
| 2291 | 2935840947 | |||
| 2292 | 2935859278 | |||
| 2293 | 2935864462 | |||
| 2294 | 2935875186 | |||
| 2295 | 2935887725 | |||
| 2296 | 2935963885 | |||
| 2297 | 2935995839 | |||
| 2298 | 2936005750 | |||
| 2299 | 2936041878 | |||
| 2300 | 2940559096 | |||
| 2301 | 2941508667 | |||
| 2302 | 2941516497 | |||
| 2303 | 2941524487 | |||
| 2304 | 2941532071 | |||
| 2305 | 2941541791 | |||
| 2306 | 3005475648 | |||
| 2307 | 3005485837 | |||
| 2308 | 3005588827 | |||
| 2309 | 3005601857 | |||
| 2310 | 3005717596 | |||
| 2311 | 3005724644 | |||
| 2312 | 8006936981 | |||
| 2313 | 8006966351 | |||
| 2314 | 8006976949 | |||
| 2315 | 8006993177 | |||
| 2316 | 8006997016 | |||
| 2317 | 8016517296 | |||
| 2318 | 8016526938 | |||
| 2319 | 8016545232 | |||
| 2320 | 8016556856 | |||
| 2321 | 8016582858 | |||
| 2322 | 8016602852 | |||
| 2323 | 8016605723 | |||
| 2324 | 8016617629 | |||
| 2325 | 8016623940 | |||
| 2326 | 8017059301 | |||
| 2327 | 8019531839 | |||
| 2328 | 8019550958 | |||
| 2329 | 8019571763 | |||
| 2330 | 8019576328 | |||
| 2331 | 8019594201 | |||
| 2332 | 8019607362 | |||
| 2333 | 8019611152 | |||
| 2334 | 8019631321 | |||
| 2335 | 8019651719 | |||
| 2336 | 8055743508 | |||
| 2337 | 8056678202 | |||
| 2338 | 8056683453 | |||
| 2339 | 8056690830 | |||
| 2340 | 8056975367 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wuj-assembly1.cif.gz_C | mitochondrial sam complex - monomer in detergent | 0.7765 | 1 | 231 |
| 6wun-assembly1.cif.gz_C | mitochondrial sam complex - dimer 3 in detergent | 0.7523 | 1 | 232 |
| 6wut-assembly1.cif.gz_A | mitochondrial sam complex - high resolution monomer in detergent | 0.7455 | 1 | 232 |
| 3ubl-assembly1.cif.gz_A | crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound | 0.7437 | 1 | 226 |
| 6wuj-assembly1.cif.gz_A | mitochondrial sam complex - monomer in detergent | 0.741 | 1 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D4W9_85_180_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9487 | 18 | 97 | 3.40.30.10 |
| af_A0A2R8Q0H7_115_198_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9226 | 18 | 102 | 3.40.30.10 |
| af_E9QGX6_115_210_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9165 | 18 | 113 | 3.40.30.10 |
| af_Q95RI5_122_219_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.916 | 18 | 102 | 3.40.30.10 |
| af_Q8MQC1_57_153_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9142 | 18 | 97 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A315C5M2-F1-model_v4 | deleted | 0.939 | 111 | 232 |
|
| AF-B0C6Q9-F1-model_v4 | Glutathione S-transferase, putative | 0.9317 | 1 | 230 |
GO:0005737
GO:0016740 |
| AF-A0A150PMV8-F1-model_v4 | Glutathione S-transferase | 0.9287 | 1 | 231 |
GO:0016740
|
| AF-A0A345Y625-F1-model_v4 | Glutathione S-transferase family protein | 0.9268 | 1 | 231 |
GO:0016740
|
| AF-A0A2P5KUJ6-F1-model_v4 | Glutathione S-transferase | 0.9266 | 1 | 236 |
GO:0016740
|