F491151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1170 | 505 | 1058 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0004642|Ga0495651_0004642_4108_5352 |
| Length | 409 |
| Sequence | MDRADRAWPAKNKQAGLFLLCPPGRLADMSFVEPEERVALRQAVRDLAKRYGPDYVRRQAKAGLKSTELWDEVGRAGYLGVSLPEEYGIADLAAVGEELARAGCPLLLIVVSPAICGTIISRFGTEAQKRKWLPGIADGSFTMAFGITEPDAGSNSHQITTTVRRDGDEWVLSGQKVFISGVDEADAVLVVSRTKDGATGNLKPALMVVPTDAPGFTRTMIDMEIAGPEKQFQLFFDDVRLPADALIGDEDAGLLQLFAGLNPERIMASAFAIGTAKYALDRAAEYAKTRTVWRDRPIGTHQGVAHPLAQAAIHVELAKVMTQKAAWLYDSGDDFAAGEAANMAKFASADAAVEAVDQAIQTHGGNGLATEYGLAPLLAATRVTRIAPVSREMILNFVAQHTLGLPKSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 4 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 5 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 6 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 7 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 8 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 9 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 10 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 14 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 15 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 16 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 17 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 18 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 19 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 20 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 21 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 22 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 23 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 24 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 25 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 26 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 27 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 28 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 29 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 30 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 31 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 32 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 33 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 34 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 35 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 36 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 37 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 38 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 39 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 40 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 41 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 42 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 43 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 44 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 45 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 46 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 47 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 48 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 49 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 50 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 51 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 52 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 53 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 54 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 55 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 56 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 57 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 58 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 59 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 60 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 61 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 62 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 63 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 64 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 65 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 66 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 67 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 68 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 69 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 70 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 71 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 72 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 73 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 74 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 75 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 76 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 77 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 78 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 79 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 80 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 81 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 82 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 83 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 84 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 85 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 86 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 87 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 88 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 89 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 90 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 91 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 92 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 93 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 94 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 95 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 96 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 97 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 98 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 100 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 134 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 142 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 143 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 145 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 146 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 149 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 150 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 151 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 152 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 153 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 154 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 156 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 157 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 158 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 162 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 163 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 164 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 165 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 166 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 167 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 168 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 169 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 170 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 171 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 192 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 196 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 197 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 198 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 199 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 200 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 201 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 263 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 265 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 266 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 267 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 268 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 269 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 272 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 280 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 281 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 282 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 299 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 308 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 309 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 310 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 311 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 312 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 313 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 314 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 315 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 316 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 318 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 319 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 320 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 321 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 322 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 323 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 324 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 325 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 326 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 327 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 328 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 329 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 330 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 331 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 332 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 333 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 334 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 335 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 336 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 337 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 338 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 339 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 340 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 341 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 342 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 343 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 344 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 345 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 346 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 413 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 414 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 415 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 418 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 421 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 426 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 469 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 470 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 471 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 474 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 476 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 488 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 489 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 490 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 491 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 492 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 493 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 494 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 495 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 496 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 497 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 498 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 499 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 500 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 501 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 502 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 503 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 504 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 505 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.89 |
| Metatranscriptomes | 1.54 |
| Isolates | 9.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 2.91 |
| Nodule | 1.03 |
| Rhizoplane | 5.13 |
| Rhizosphere | 80.26 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 10.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1001085 | 3300000545 | Bacteria | 1795 |
| 2 | JGI24738J21930_10009989 | 3300002075 | Bacteria | 2123 |
| 3 | rootH2_10022528 | 3300003320 | Bacteria | 3270 |
| 4 | rootH2_10150640 | 3300003320 | Bacteria | 1419 |
| 5 | JGI25160J50197_1016270 | 3300003354 | Bacteria | 2402 |
| 6 | Ga0006562J51391_1051951 | 3300003578 | Bacteria | 9000 |
| 7 | Ga0006562J51391_1051956 | 3300003578 | Bacteria | 2700 |
| 8 | Ga0006562J51391_1116078 | 3300003578 | Bacteria | 12055 |
| 9 | Ga0006562J51391_1116083 | 3300003578 | Bacteria | 4900 |
| 10 | JGI25404J52841_10009330 | 3300003659 | Bacteria | 2097 |
| 11 | Ga0055540_1000022 | 3300003792 | Bacteria | 201257 |
| 12 | Ga0055540_1000060 | 3300003792 | Bacteria | 131775 |
| 13 | Ga0070658_10005788 | 3300005327 | Bacteria | 10025 |
| 14 | Ga0070658_10114254 | 3300005327 | Bacteria | 2238 |
| 15 | Ga0070658_10121263 | 3300005327 | Bacteria | 2173 |
| 16 | Ga0070683_100011058 | 3300005329 | Bacteria | 7780 |
| 17 | Ga0070683_100016218 | 3300005329 | Bacteria | 6564 |
| 18 | Ga0070683_100019998 | 3300005329 | Bacteria | 5952 |
| 19 | Ga0070683_100069913 | 3300005329 | Bacteria | 3274 |
| 20 | Ga0070683_100090665 | 3300005329 | Bacteria | 2870 |
| 21 | Ga0070670_100094393 | 3300005331 | Bacteria | 2573 |
| 22 | Ga0070680_100074698 | 3300005336 | Bacteria | 2789 |
| 23 | Ga0070680_100225827 | 3300005336 | Bacteria | 1581 |
| 24 | Ga0070682_100010596 | 3300005337 | Bacteria | 5235 |
| 25 | Ga0070682_100068936 | 3300005337 | Unclassified | 2257 |
| 26 | Ga0070660_100039774 | 3300005339 | Bacteria | 3575 |
| 27 | Ga0070660_100059112 | 3300005339 | Bacteria | 2973 |
| 28 | Ga0070660_100074360 | 3300005339 | Bacteria | 2658 |
| 29 | Ga0070660_100243378 | 3300005339 | Bacteria | 1466 |
| 30 | Ga0070687_100093523 | 3300005343 | Bacteria | 1668 |
| 31 | Ga0070661_100022430 | 3300005344 | Bacteria | 4520 |
| 32 | Ga0070692_10024089 | 3300005345 | Bacteria | 2989 |
| 33 | Ga0070668_100094399 | 3300005347 | Bacteria | 2361 |
| 34 | Ga0070675_100190681 | 3300005354 | Bacteria | 1776 |
| 35 | Ga0070671_100000399 | 3300005355 | Bacteria | 29938 |
| 36 | Ga0070671_100118890 | 3300005355 | Bacteria | 2223 |
| 37 | Ga0070673_100127747 | 3300005364 | Bacteria | 2129 |
| 38 | Ga0070673_100304409 | 3300005364 | Bacteria | 1404 |
| 39 | Ga0070659_100178516 | 3300005366 | Bacteria | 1742 |
| 40 | Ga0070667_100002542 | 3300005367 | Bacteria | 15875 |
| 41 | Ga0070667_100179936 | 3300005367 | Bacteria | 1869 |
| 42 | Ga0070709_10002604 | 3300005434 | Bacteria | 9744 |
| 43 | Ga0070709_10002855 | 3300005434 | Bacteria | 9343 |
| 44 | Ga0070709_10025009 | 3300005434 | Bacteria | 3523 |
| 45 | Ga0070714_100000192 | 3300005435 | Bacteria | 49531 |
| 46 | Ga0070714_100001420 | 3300005435 | Bacteria | 17388 |
| 47 | Ga0070714_100080416 | 3300005435 | Bacteria | 2836 |
| 48 | Ga0070714_100111955 | 3300005435 | Bacteria | 2418 |
| 49 | Ga0070713_100143620 | 3300005436 | Bacteria | 2116 |
| 50 | Ga0070713_100155913 | 3300005436 | Bacteria | 2035 |
| 51 | Ga0070710_10000119 | 3300005437 | Bacteria | 37136 |
| 52 | Ga0070710_10007794 | 3300005437 | Bacteria | 5197 |
| 53 | Ga0070701_10010173 | 3300005438 | Bacteria | 4148 |
| 54 | Ga0070711_100041461 | 3300005439 | Bacteria | 3109 |
| 55 | Ga0070711_100049614 | 3300005439 | Bacteria | 2874 |
| 56 | Ga0070711_100071711 | 3300005439 | Bacteria | 2442 |
| 57 | Ga0070711_100186327 | 3300005439 | Bacteria | 1591 |
| 58 | Ga0070711_100231411 | 3300005439 | Bacteria | 1441 |
| 59 | Ga0070700_100000033 | 3300005441 | Bacteria | 114863 |
| 60 | Ga0070700_100000681 | 3300005441 | Bacteria | 16777 |
| 61 | Ga0070700_100001719 | 3300005441 | Bacteria | 10986 |
| 62 | Ga0070694_100132577 | 3300005444 | Bacteria | 1802 |
| 63 | Ga0070708_100058155 | 3300005445 | Bacteria | 3444 |
| 64 | Ga0070708_100065007 | 3300005445 | Bacteria | 3270 |
| 65 | Ga0070708_100102844 | 3300005445 | Bacteria | 2618 |
| 66 | Ga0070708_100116712 | 3300005445 | Bacteria | 2458 |
| 67 | Ga0070708_100129663 | 3300005445 | Bacteria | 2333 |
| 68 | Ga0070663_100009372 | 3300005455 | Bacteria | 6060 |
| 69 | Ga0070663_100061733 | 3300005455 | Bacteria | 2700 |
| 70 | Ga0070663_100073466 | 3300005455 | Bacteria | 2494 |
| 71 | Ga0070678_100083931 | 3300005456 | Bacteria | 2423 |
| 72 | Ga0070681_10011047 | 3300005458 | Bacteria | 8927 |
| 73 | Ga0070685_10024594 | 3300005466 | Bacteria | 3309 |
| 74 | Ga0070706_100029291 | 3300005467 | Bacteria | 5073 |
| 75 | Ga0070706_100048489 | 3300005467 | Bacteria | 3920 |
| 76 | Ga0070706_100115508 | 3300005467 | Bacteria | 2499 |
| 77 | Ga0070706_100253873 | 3300005467 | Bacteria | 1642 |
| 78 | Ga0070698_100000387 | 3300005471 | Bacteria | 46238 |
| 79 | Ga0070698_100001963 | 3300005471 | Bacteria | 22848 |
| 80 | Ga0070698_100002657 | 3300005471 | Bacteria | 19715 |
| 81 | Ga0070698_100005449 | 3300005471 | Bacteria | 13900 |
| 82 | Ga0070698_100008703 | 3300005471 | Bacteria | 10933 |
| 83 | Ga0070698_100015358 | 3300005471 | Bacteria | 8092 |
| 84 | Ga0070699_100001693 | 3300005518 | Bacteria | 20068 |
| 85 | Ga0070684_100025696 | 3300005535 | Bacteria | 4953 |
| 86 | Ga0070684_100246365 | 3300005535 | Bacteria | 1633 |
| 87 | Ga0070697_100002299 | 3300005536 | Bacteria | 14671 |
| 88 | Ga0068853_100113216 | 3300005539 | Bacteria | 2412 |
| 89 | Ga0070672_100151294 | 3300005543 | Bacteria | 1920 |
| 90 | Ga0070686_100026870 | 3300005544 | Bacteria | 3478 |
| 91 | Ga0070686_100038936 | 3300005544 | Bacteria | 2959 |
| 92 | Ga0070695_100164235 | 3300005545 | Bacteria | 1561 |
| 93 | Ga0070693_100096105 | 3300005547 | Bacteria | 1795 |
| 94 | Ga0070665_100130765 | 3300005548 | Bacteria | 2512 |
| 95 | Ga0068855_100039642 | 3300005563 | Bacteria | 5591 |
| 96 | Ga0068855_100108506 | 3300005563 | Bacteria | 3188 |
| 97 | Ga0070664_100066221 | 3300005564 | Bacteria | 3084 |
| 98 | Ga0068857_100052746 | 3300005577 | Bacteria | 3607 |
| 99 | Ga0068857_100145327 | 3300005577 | Bacteria | 2146 |
| 100 | Ga0068856_100026991 | 3300005614 | Bacteria | 5602 |
| 101 | Ga0068856_100132178 | 3300005614 | Bacteria | 2501 |
| 102 | Ga0068856_100446439 | 3300005614 | Bacteria | 1314 |
| 103 | Ga0070702_100002173 | 3300005615 | Bacteria | 8351 |
| 104 | Ga0070702_100132068 | 3300005615 | Bacteria | 1578 |
| 105 | Ga0068852_100033058 | 3300005616 | Bacteria | 4290 |
| 106 | Ga0068852_100327673 | 3300005616 | Bacteria | 1489 |
| 107 | Ga0068864_100021017 | 3300005618 | Bacteria | 5465 |
| 108 | Ga0068864_100024230 | 3300005618 | Bacteria | 5103 |
| 109 | Ga0068864_100118475 | 3300005618 | Bacteria | 2364 |
| 110 | Ga0068851_10070312 | 3300005834 | Bacteria | 1810 |
| 111 | Ga0068863_100076234 | 3300005841 | Bacteria | 3172 |
| 112 | Ga0068863_100142424 | 3300005841 | Bacteria | 2292 |
| 113 | Ga0068858_100008064 | 3300005842 | Bacteria | 10142 |
| 114 | Ga0068858_100386285 | 3300005842 | Bacteria | 1344 |
| 115 | Ga0068860_100035062 | 3300005843 | Bacteria | 4814 |
| 116 | Ga0068860_100212008 | 3300005843 | Bacteria | 1879 |
| 117 | Ga0068862_100142200 | 3300005844 | Bacteria | 2130 |
| 118 | Ga0081455_10000273 | 3300005937 | Bacteria | 68345 |
| 119 | Ga0081455_10000480 | 3300005937 | Bacteria | 51756 |
| 120 | Ga0081455_10010997 | 3300005937 | Bacteria | 9119 |
| 121 | Ga0081455_10162152 | 3300005937 | Bacteria | 1712 |
| 122 | Ga0081540_1000251 | 3300005983 | Bacteria | 56572 |
| 123 | Ga0081540_1004108 | 3300005983 | Bacteria | 11236 |
| 124 | Ga0081539_10015563 | 3300005985 | Bacteria | 5518 |
| 125 | Ga0070717_10004480 | 3300006028 | Bacteria | 10091 |
| 126 | Ga0070717_10019840 | 3300006028 | Bacteria | 5278 |
| 127 | Ga0075365_10062234 | 3300006038 | Bacteria | 2495 |
| 128 | Ga0075365_10062984 | 3300006038 | Bacteria | 2482 |
| 129 | Ga0075365_10097606 | 3300006038 | Bacteria | 2009 |
| 130 | Ga0075365_10139772 | 3300006038 | Bacteria | 1681 |
| 131 | Ga0075363_100000236 | 3300006048 | Bacteria | 15495 |
| 132 | Ga0075363_100021242 | 3300006048 | Bacteria | 3266 |
| 133 | Ga0075363_100112970 | 3300006048 | Bacteria | 1511 |
| 134 | Ga0075364_10000270 | 3300006051 | Bacteria | 25296 |
| 135 | Ga0075364_10111026 | 3300006051 | Bacteria | 1830 |
| 136 | Ga0070715_10002088 | 3300006163 | Bacteria | 6040 |
| 137 | Ga0070715_10084394 | 3300006163 | Bacteria | 1448 |
| 138 | Ga0070716_100001616 | 3300006173 | Bacteria | 10157 |
| 139 | Ga0070716_100004393 | 3300006173 | Bacteria | 6738 |
| 140 | Ga0070712_100001096 | 3300006175 | Bacteria | 16300 |
| 141 | Ga0070712_100010761 | 3300006175 | Bacteria | 5783 |
| 142 | Ga0070712_100067807 | 3300006175 | Bacteria | 2540 |
| 143 | Ga0075362_10085424 | 3300006177 | Bacteria | 1459 |
| 144 | Ga0075369_10041175 | 3300006186 | Bacteria | 1977 |
| 145 | Ga0075370_10043626 | 3300006353 | Bacteria | 2534 |
| 146 | Ga0068871_100169919 | 3300006358 | Bacteria | 1868 |
| 147 | Ga0075428_100002078 | 3300006844 | Bacteria | 21607 |
| 148 | Ga0075428_100009631 | 3300006844 | Bacteria | 10726 |
| 149 | Ga0075428_100032010 | 3300006844 | Bacteria | 5810 |
| 150 | Ga0075428_100052109 | 3300006844 | Bacteria | 4487 |
| 151 | Ga0075428_100085800 | 3300006844 | Bacteria | 3434 |
| 152 | Ga0075428_100270273 | 3300006844 | Bacteria | 1829 |
| 153 | Ga0075430_100000279 | 3300006846 | Bacteria | 35927 |
| 154 | Ga0075430_100010653 | 3300006846 | Bacteria | 7791 |
| 155 | Ga0075430_100014467 | 3300006846 | Bacteria | 6722 |
| 156 | Ga0075430_100016395 | 3300006846 | Bacteria | 6309 |
| 157 | Ga0075430_100037166 | 3300006846 | Bacteria | 4128 |
| 158 | Ga0075430_100088387 | 3300006846 | Bacteria | 2593 |
| 159 | Ga0075430_100137042 | 3300006846 | Bacteria | 2039 |
| 160 | Ga0075431_100082966 | 3300006847 | Bacteria | 3309 |
| 161 | Ga0075431_100096916 | 3300006847 | Bacteria | 3045 |
| 162 | Ga0075431_100101797 | 3300006847 | Bacteria | 2964 |
| 163 | Ga0075431_100102607 | 3300006847 | Bacteria | 2952 |
| 164 | Ga0075431_100163216 | 3300006847 | Bacteria | 2290 |
| 165 | Ga0075431_100230562 | 3300006847 | Bacteria | 1887 |
| 166 | Ga0075429_100044816 | 3300006880 | Bacteria | 3848 |
| 167 | Ga0075429_100062205 | 3300006880 | Bacteria | 3252 |
| 168 | Ga0075429_100090988 | 3300006880 | Bacteria | 2661 |
| 169 | Ga0068865_100011636 | 3300006881 | Bacteria | 5513 |
| 170 | Ga0068865_100170251 | 3300006881 | Bacteria | 1669 |
| 171 | Ga0075436_100076442 | 3300006914 | Bacteria | 2318 |
| 172 | Ga0105251_10007408 | 3300009011 | Bacteria | 6764 |
| 173 | Ga0105240_10036032 | 3300009093 | Bacteria | 6371 |
| 174 | Ga0105240_10096255 | 3300009093 | Bacteria | 3608 |
| 175 | Ga0111539_10532486 | 3300009094 | Bacteria | 1369 |
| 176 | Ga0111539_10582360 | 3300009094 | Bacteria | 1303 |
| 177 | Ga0105245_10009265 | 3300009098 | Bacteria | 8587 |
| 178 | Ga0105245_10026851 | 3300009098 | Bacteria | 5070 |
| 179 | Ga0105245_10042060 | 3300009098 | Bacteria | 4076 |
| 180 | Ga0114129_10000184 | 3300009147 | Bacteria | 69831 |
| 181 | Ga0114129_10083453 | 3300009147 | Bacteria | 4438 |
| 182 | Ga0114129_10140886 | 3300009147 | Bacteria | 3306 |
| 183 | Ga0114129_10211324 | 3300009147 | Bacteria | 2623 |
| 184 | Ga0114129_10325631 | 3300009147 | Bacteria | 2042 |
| 185 | Ga0114129_10343298 | 3300009147 | Bacteria | 1980 |
| 186 | Ga0105241_10002543 | 3300009174 | Bacteria | 13688 |
| 187 | Ga0105241_10227964 | 3300009174 | Bacteria | 1569 |
| 188 | Ga0105242_10190723 | 3300009176 | Bacteria | 1814 |
| 189 | Ga0105248_10022567 | 3300009177 | Bacteria | 6984 |
| 190 | Ga0105248_10077006 | 3300009177 | Bacteria | 3749 |
| 191 | Ga0105248_10190455 | 3300009177 | Bacteria | 2311 |
| 192 | Ga0105248_10525356 | 3300009177 | Bacteria | 1335 |
| 193 | Ga0105237_10000385 | 3300009545 | Bacteria | 62800 |
| 194 | Ga0105237_10001712 | 3300009545 | Bacteria | 28358 |
| 195 | Ga0105237_10003886 | 3300009545 | Bacteria | 17538 |
| 196 | Ga0105237_10016595 | 3300009545 | Bacteria | 7648 |
| 197 | Ga0105237_10142149 | 3300009545 | Bacteria | 2394 |
| 198 | Ga0105237_10236455 | 3300009545 | Bacteria | 1828 |
| 199 | Ga0105238_10181196 | 3300009551 | Bacteria | 2083 |
| 200 | Ga0105249_10036751 | 3300009553 | Bacteria | 4443 |
| 201 | Ga0105249_10104615 | 3300009553 | Bacteria | 2667 |
| 202 | Ga0105239_10004355 | 3300010375 | Bacteria | 16960 |
| 203 | Ga0105239_10021851 | 3300010375 | Bacteria | 7054 |
| 204 | Ga0105239_10117212 | 3300010375 | Bacteria | 2956 |
| 205 | Ga0105239_10127640 | 3300010375 | Bacteria | 2828 |
| 206 | Ga0105239_10154865 | 3300010375 | Bacteria | 2559 |
| 207 | Ga0105239_10245862 | 3300010375 | Bacteria | 2009 |
| 208 | Ga0105239_10387897 | 3300010375 | Bacteria | 1580 |
| 209 | Ga0105246_10022684 | 3300011119 | Bacteria | 4053 |
| 210 | Ga0157370_10019049 | 3300013104 | Bacteria | 6898 |
| 211 | Ga0157369_10098639 | 3300013105 | Bacteria | 3115 |
| 212 | Ga0157374_10030832 | 3300013296 | Bacteria | 4870 |
| 213 | Ga0157374_10155370 | 3300013296 | Bacteria | 2226 |
| 214 | Ga0157372_10000004 | 3300013307 | Bacteria | 435659 |
| 215 | Ga0157375_10023922 | 3300013308 | Bacteria | 5644 |
| 216 | Ga0157375_10122181 | 3300013308 | Bacteria | 2715 |
| 217 | Ga0157375_10136271 | 3300013308 | Bacteria | 2579 |
| 218 | Ga0157375_10306763 | 3300013308 | Bacteria | 1751 |
| 219 | Ga0163163_10065892 | 3300014325 | Bacteria | 3596 |
| 220 | Ga0163163_10097671 | 3300014325 | Bacteria | 2958 |
| 221 | Ga0163163_10109287 | 3300014325 | Bacteria | 2792 |
| 222 | Ga0157380_10074641 | 3300014326 | Bacteria | 2753 |
| 223 | Ga0157380_10154227 | 3300014326 | Bacteria | 1989 |
| 224 | Ga0182008_10003431 | 3300014497 | Bacteria | 9569 |
| 225 | Ga0182008_10044341 | 3300014497 | Bacteria | 2211 |
| 226 | Ga0157377_10023955 | 3300014745 | Bacteria | 3242 |
| 227 | Ga0157377_10120847 | 3300014745 | Bacteria | 1587 |
| 228 | Ga0157379_10128818 | 3300014968 | Bacteria | 2277 |
| 229 | Ga0157379_10135958 | 3300014968 | Bacteria | 2215 |
| 230 | Ga0157376_10294314 | 3300014969 | Bacteria | 1534 |
| 231 | Ga0182006_1008344 | 3300015261 | Bacteria | 4695 |
| 232 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 233 | Ga0206354_11292861 | 3300020081 | Bacteria | 1237 |
| 234 | Ga0206353_10485089 | 3300020082 | Bacteria | 3861 |
| 235 | Ga0206353_10727382 | 3300020082 | Bacteria | 1351 |
| 236 | Ga0206353_11429297 | 3300020082 | Bacteria | 2374 |
| 237 | Ga0213876_10027796 | 3300021384 | Bacteria | 2983 |
| 238 | Ga0213875_10000341 | 3300021388 | Bacteria | 44027 |
| 239 | Ga0213875_10000443 | 3300021388 | Bacteria | 36140 |
| 240 | Ga0213875_10004207 | 3300021388 | Bacteria | 7950 |
| 241 | Ga0213875_10014440 | 3300021388 | Bacteria | 3854 |
| 242 | Ga0213875_10022735 | 3300021388 | Bacteria | 2998 |
| 243 | Ga0213875_10025198 | 3300021388 | Bacteria | 2835 |
| 244 | Ga0213875_10026873 | 3300021388 | Bacteria | 2738 |
| 245 | Ga0213875_10032702 | 3300021388 | Bacteria | 2457 |
| 246 | Ga0224712_10002142 | 3300022467 | Bacteria | 4804 |
| 247 | Ga0207426_1002193 | 3300025302 | Bacteria | 13159 |
| 248 | Ga0207426_1005887 | 3300025302 | Bacteria | 5458 |
| 249 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 250 | Ga0209051_1000149 | 3300025303 | Bacteria | 132185 |
| 251 | Ga0209051_1026594 | 3300025303 | Bacteria | 2328 |
| 252 | Ga0207697_10022659 | 3300025315 | Bacteria | 2572 |
| 253 | Ga0207713_1040811 | 3300025735 | Bacteria | 1943 |
| 254 | Ga0207653_10021501 | 3300025885 | Bacteria | 2046 |
| 255 | Ga0207692_10000731 | 3300025898 | Bacteria | 11587 |
| 256 | Ga0207688_10001198 | 3300025901 | Bacteria | 13408 |
| 257 | Ga0207688_10031595 | 3300025901 | Bacteria | 2924 |
| 258 | Ga0207647_10009986 | 3300025904 | Bacteria | 6723 |
| 259 | Ga0207647_10036803 | 3300025904 | Bacteria | 3107 |
| 260 | Ga0207685_10000827 | 3300025905 | Bacteria | 5759 |
| 261 | Ga0207699_10003262 | 3300025906 | Bacteria | 7728 |
| 262 | Ga0207699_10005748 | 3300025906 | Bacteria | 5967 |
| 263 | Ga0207699_10186244 | 3300025906 | Bacteria | 1398 |
| 264 | Ga0207643_10002654 | 3300025908 | Bacteria | 9672 |
| 265 | Ga0207705_10042992 | 3300025909 | Bacteria | 3245 |
| 266 | Ga0207705_10093491 | 3300025909 | Bacteria | 2204 |
| 267 | Ga0207705_10164411 | 3300025909 | Bacteria | 1668 |
| 268 | Ga0207684_10037530 | 3300025910 | Bacteria | 4111 |
| 269 | Ga0207684_10186380 | 3300025910 | Bacteria | 1789 |
| 270 | Ga0207684_10235209 | 3300025910 | Bacteria | 1581 |
| 271 | Ga0207684_10264070 | 3300025910 | Bacteria | 1485 |
| 272 | Ga0207654_10048124 | 3300025911 | Bacteria | 2439 |
| 273 | Ga0207695_10008695 | 3300025913 | Bacteria | 12665 |
| 274 | Ga0207695_10049275 | 3300025913 | Bacteria | 4442 |
| 275 | Ga0207671_10002091 | 3300025914 | Bacteria | 21853 |
| 276 | Ga0207671_10004746 | 3300025914 | Bacteria | 12826 |
| 277 | Ga0207671_10006836 | 3300025914 | Bacteria | 10070 |
| 278 | Ga0207671_10018178 | 3300025914 | Bacteria | 5401 |
| 279 | Ga0207671_10072609 | 3300025914 | Bacteria | 2568 |
| 280 | Ga0207693_10000911 | 3300025915 | Bacteria | 26527 |
| 281 | Ga0207693_10023553 | 3300025915 | Bacteria | 4888 |
| 282 | Ga0207693_10036848 | 3300025915 | Bacteria | 3857 |
| 283 | Ga0207693_10061517 | 3300025915 | Bacteria | 2941 |
| 284 | Ga0207693_10137513 | 3300025915 | Bacteria | 1921 |
| 285 | Ga0207693_10174266 | 3300025915 | Bacteria | 1693 |
| 286 | Ga0207663_10000286 | 3300025916 | Bacteria | 22144 |
| 287 | Ga0207663_10069316 | 3300025916 | Bacteria | 2268 |
| 288 | Ga0207663_10111126 | 3300025916 | Bacteria | 1860 |
| 289 | Ga0207660_10170236 | 3300025917 | Bacteria | 1685 |
| 290 | Ga0207662_10006419 | 3300025918 | Bacteria | 6344 |
| 291 | Ga0207657_10027499 | 3300025919 | Bacteria | 5208 |
| 292 | Ga0207657_10061614 | 3300025919 | Bacteria | 3215 |
| 293 | Ga0207646_10016205 | 3300025922 | Bacteria | 7003 |
| 294 | Ga0207694_10006958 | 3300025924 | Bacteria | 8588 |
| 295 | Ga0207694_10034238 | 3300025924 | Bacteria | 3895 |
| 296 | Ga0207650_10036629 | 3300025925 | Bacteria | 3570 |
| 297 | Ga0207650_10250162 | 3300025925 | Bacteria | 1435 |
| 298 | Ga0207659_10245249 | 3300025926 | Bacteria | 1451 |
| 299 | Ga0207687_10015059 | 3300025927 | Bacteria | 5065 |
| 300 | Ga0207700_10043803 | 3300025928 | Bacteria | 3290 |
| 301 | Ga0207664_10000028 | 3300025929 | Bacteria | 188245 |
| 302 | Ga0207664_10004412 | 3300025929 | Bacteria | 9527 |
| 303 | Ga0207664_10013195 | 3300025929 | Bacteria | 5920 |
| 304 | Ga0207664_10016850 | 3300025929 | Bacteria | 5342 |
| 305 | Ga0207664_10029351 | 3300025929 | Bacteria | 4188 |
| 306 | Ga0207664_10045694 | 3300025929 | Bacteria | 3435 |
| 307 | Ga0207664_10054994 | 3300025929 | Bacteria | 3156 |
| 308 | Ga0207664_10306092 | 3300025929 | Bacteria | 1399 |
| 309 | Ga0207644_10001153 | 3300025931 | Bacteria | 16935 |
| 310 | Ga0207644_10068549 | 3300025931 | Bacteria | 2588 |
| 311 | Ga0207690_10269930 | 3300025932 | Bacteria | 1321 |
| 312 | Ga0207686_10034246 | 3300025934 | Bacteria | 3039 |
| 313 | Ga0207709_10138697 | 3300025935 | Bacteria | 1669 |
| 314 | Ga0207670_10050823 | 3300025936 | Bacteria | 2780 |
| 315 | Ga0207669_10145992 | 3300025937 | Bacteria | 1650 |
| 316 | Ga0207665_10001704 | 3300025939 | Bacteria | 14776 |
| 317 | Ga0207665_10002796 | 3300025939 | Bacteria | 11696 |
| 318 | Ga0207665_10064935 | 3300025939 | Bacteria | 2481 |
| 319 | Ga0207691_10225211 | 3300025940 | Bacteria | 1625 |
| 320 | Ga0207711_10111646 | 3300025941 | Bacteria | 2432 |
| 321 | Ga0207711_10114808 | 3300025941 | Bacteria | 2399 |
| 322 | Ga0207711_10276961 | 3300025941 | Bacteria | 1544 |
| 323 | Ga0207689_10005326 | 3300025942 | Bacteria | 11532 |
| 324 | Ga0207661_10001544 | 3300025944 | Bacteria | 15656 |
| 325 | Ga0207661_10008204 | 3300025944 | Bacteria | 7454 |
| 326 | Ga0207661_10148400 | 3300025944 | Bacteria | 2025 |
| 327 | Ga0207661_10164640 | 3300025944 | Bacteria | 1926 |
| 328 | Ga0207661_10274438 | 3300025944 | Bacteria | 1505 |
| 329 | Ga0207679_10096164 | 3300025945 | Bacteria | 2304 |
| 330 | Ga0207679_10144663 | 3300025945 | Bacteria | 1926 |
| 331 | Ga0207651_10255558 | 3300025960 | Bacteria | 1436 |
| 332 | Ga0207712_10055949 | 3300025961 | Bacteria | 2778 |
| 333 | Ga0207640_10124025 | 3300025981 | Bacteria | 1856 |
| 334 | Ga0207658_10006962 | 3300025986 | Bacteria | 7698 |
| 335 | Ga0207658_10027583 | 3300025986 | Bacteria | 3991 |
| 336 | Ga0207677_10116564 | 3300026023 | Bacteria | 2000 |
| 337 | Ga0207703_10005581 | 3300026035 | Bacteria | 10098 |
| 338 | Ga0207703_10145264 | 3300026035 | Bacteria | 2062 |
| 339 | Ga0207639_10327121 | 3300026041 | Bacteria | 1363 |
| 340 | Ga0207708_10000004 | 3300026075 | Bacteria | 293087 |
| 341 | Ga0207708_10000511 | 3300026075 | Bacteria | 29928 |
| 342 | Ga0207708_10010498 | 3300026075 | Bacteria | 6875 |
| 343 | Ga0207702_10076268 | 3300026078 | Bacteria | 2898 |
| 344 | Ga0207702_10121393 | 3300026078 | Bacteria | 2339 |
| 345 | Ga0207702_10122071 | 3300026078 | Bacteria | 2333 |
| 346 | Ga0207641_10181629 | 3300026088 | Bacteria | 1927 |
| 347 | Ga0207641_10239164 | 3300026088 | Bacteria | 1691 |
| 348 | Ga0207648_10018964 | 3300026089 | Bacteria | 6213 |
| 349 | Ga0207676_10092276 | 3300026095 | Bacteria | 2490 |
| 350 | Ga0207676_10096247 | 3300026095 | Bacteria | 2443 |
| 351 | Ga0207676_10289779 | 3300026095 | Bacteria | 1490 |
| 352 | Ga0207674_10061251 | 3300026116 | Bacteria | 3803 |
| 353 | Ga0207674_10175584 | 3300026116 | Bacteria | 2095 |
| 354 | Ga0207674_10209722 | 3300026116 | Bacteria | 1897 |
| 355 | Ga0207675_100002095 | 3300026118 | Bacteria | 19806 |
| 356 | Ga0207683_10000264 | 3300026121 | Bacteria | 46774 |
| 357 | Ga0207683_10010950 | 3300026121 | Bacteria | 7735 |
| 358 | Ga0207698_10078047 | 3300026142 | Bacteria | 2657 |
| 359 | Ga0207698_10213861 | 3300026142 | Bacteria | 1736 |
| 360 | Ga0268266_10000297 | 3300028379 | Bacteria | 80133 |
| 361 | Ga0268266_10004062 | 3300028379 | Bacteria | 14146 |
| 362 | Ga0268266_10055947 | 3300028379 | Bacteria | 3393 |
| 363 | Ga0268266_10097157 | 3300028379 | Bacteria | 2590 |
| 364 | Ga0268266_10181253 | 3300028379 | Bacteria | 1918 |
| 365 | Ga0268265_10051630 | 3300028380 | Bacteria | 3105 |
| 366 | Ga0268264_10245417 | 3300028381 | Bacteria | 1661 |
| 367 | Ga0265336_10014160 | 3300028666 | Bacteria | 2646 |
| 368 | Ga0265336_10030675 | 3300028666 | Bacteria | 1674 |
| 369 | Ga0307515_10232096 | 3300028794 | Bacteria | 1635 |
| 370 | Ga0265338_10003557 | 3300028800 | Bacteria | 21782 |
| 371 | Ga0316177_1078543 | 3300030731 | Bacteria | 7048 |
| 372 | Ga0316176_1182197 | 3300030732 | Bacteria | 2247 |
| 373 | Ga0265320_10076281 | 3300031240 | Bacteria | 1571 |
| 374 | Ga0265327_10000274 | 3300031251 | Bacteria | 101723 |
| 375 | Ga0265327_10000566 | 3300031251 | Bacteria | 62909 |
| 376 | Ga0265327_10005854 | 3300031251 | Bacteria | 10058 |
| 377 | Ga0265327_10007949 | 3300031251 | Bacteria | 8026 |
| 378 | Ga0265327_10012472 | 3300031251 | Bacteria | 5730 |
| 379 | Ga0307513_10001629 | 3300031456 | Bacteria | 32145 |
| 380 | Ga0307513_10013188 | 3300031456 | Bacteria | 10152 |
| 381 | Ga0307513_10031541 | 3300031456 | Bacteria | 5999 |
| 382 | Ga0307513_10046377 | 3300031456 | Bacteria | 4738 |
| 383 | Ga0307513_10115253 | 3300031456 | Bacteria | 2670 |
| 384 | Ga0307513_10124907 | 3300031456 | Bacteria | 2531 |
| 385 | Ga0307509_10130256 | 3300031507 | Bacteria | 2473 |
| 386 | Ga0307508_10029541 | 3300031616 | Bacteria | 4954 |
| 387 | Ga0316578_10040140 | 3300031728 | Bacteria | 2704 |
| 388 | Ga0307405_10007322 | 3300031731 | Bacteria | 5505 |
| 389 | Ga0307413_10020555 | 3300031824 | Bacteria | 3515 |
| 390 | Ga0307518_10019364 | 3300031838 | Bacteria | 4889 |
| 391 | Ga0307406_10055468 | 3300031901 | Bacteria | 2533 |
| 392 | Ga0307412_10101159 | 3300031911 | Bacteria | 2039 |
| 393 | Ga0307409_100038568 | 3300031995 | Bacteria | 3535 |
| 394 | Ga0307416_100002333 | 3300032002 | Bacteria | 10849 |
| 395 | Ga0307416_100112187 | 3300032002 | Bacteria | 2406 |
| 396 | Ga0307414_10182368 | 3300032004 | Bacteria | 1690 |
| 397 | Ga0307415_100000334 | 3300032126 | Bacteria | 20322 |
| 398 | Ga0307415_100027877 | 3300032126 | Bacteria | 3585 |
| 399 | Ga0307415_100058151 | 3300032126 | Bacteria | 2661 |
| 400 | Ga0307415_100104352 | 3300032126 | Bacteria | 2088 |
| 401 | Ga0307507_10043371 | 3300033179 | Bacteria | 4464 |
| 402 | Ga0307507_10050890 | 3300033179 | Bacteria | 3993 |
| 403 | Ga0373959_0007164 | 3300034820 | Bacteria | 1871 |
| 404 | Ga0373926_0000994 | 3300035083 | Bacteria | 8263 |
| 405 | Ga0373926_0001597 | 3300035083 | Bacteria | 6974 |
| 406 | Ga0373934_0000021 | 3300035086 | Bacteria | 53680 |
| 407 | Ga0373934_0014480 | 3300035086 | Bacteria | 2989 |
| 408 | Ga0373934_0014619 | 3300035086 | Bacteria | 2974 |
| 409 | Ga0373944_0000931 | 3300035089 | Bacteria | 7250 |
| 410 | Ga0373944_0019099 | 3300035089 | Bacteria | 1964 |
| 411 | Ga0373923_0006087 | 3300035111 | Bacteria | 4145 |
| 412 | Ga0373923_0046191 | 3300035111 | Bacteria | 1811 |
| 413 | Ga0373936_0001598 | 3300035113 | Bacteria | 8273 |
| 414 | Ga0373936_0006015 | 3300035113 | Bacteria | 4573 |
| 415 | Ga0373945_0000887 | 3300035116 | Bacteria | 8843 |
| 416 | Ga0373953_0000208 | 3300035117 | Bacteria | 15869 |
| 417 | Ga0373953_0010112 | 3300035117 | Bacteria | 3271 |
| 418 | Ga0373954_0003993 | 3300035118 | Bacteria | 6308 |
| 419 | Ga0373954_0016140 | 3300035118 | Bacteria | 3341 |
| 420 | Ga0373956_0001684 | 3300035119 | Bacteria | 9104 |
| 421 | Ga0373957_0000240 | 3300035120 | Bacteria | 13672 |
| 422 | Ga0373957_0004970 | 3300035120 | Bacteria | 4095 |
| 423 | Ga0373943_0000433 | 3300035170 | Bacteria | 17675 |
| 424 | Ga0373943_0000668 | 3300035170 | Bacteria | 14898 |
| 425 | Ga0373943_0106056 | 3300035170 | Bacteria | 1476 |
| 426 | Ga0373946_0001834 | 3300035171 | Bacteria | 7425 |
| 427 | Ga0373946_0007641 | 3300035171 | Bacteria | 3959 |
| 428 | Ga0373955_0000092 | 3300035172 | Bacteria | 36115 |
| 429 | Ga0373955_0039034 | 3300035172 | Bacteria | 2532 |
| 430 | Ga0373955_0156313 | 3300035172 | Bacteria | 1343 |
| 431 | Ga0373942_0001767 | 3300035207 | Bacteria | 5470 |
| 432 | Ga0373942_0028635 | 3300035207 | Bacteria | 1457 |
| 433 | Ga0373961_0007699 | 3300035241 | Bacteria | 2610 |
| 434 | Ga0316574_0067887 | 3300035398 | Bacteria | 2248 |
| 435 | Ga0316574_0107546 | 3300035398 | Bacteria | 1787 |
| 436 | Ga0373924_0001270 | 3300035410 | Bacteria | 8095 |
| 437 | Ga0373924_0004310 | 3300035410 | Bacteria | 4965 |
| 438 | Ga0373924_0101325 | 3300035410 | Bacteria | 1239 |
| 439 | Ga0373927_0000850 | 3300035695 | Bacteria | 23303 |
| 440 | Ga0373927_0065892 | 3300035695 | Bacteria | 2342 |
| 441 | Ga0373933_0000366 | 3300035724 | Bacteria | 28850 |
| 442 | Ga0373933_0047490 | 3300035724 | Bacteria | 2553 |
| 443 | Ga0373933_0145104 | 3300035724 | Bacteria | 1500 |
| 444 | Ga0373933_0229000 | 3300035724 | Bacteria | 1193 |
| 445 | Ga0373947_0006092 | 3300035725 | Bacteria | 7024 |
| 446 | Ga0373937_0000169 | 3300036401 | Bacteria | 63595 |
| 447 | Ga0373937_0037668 | 3300036401 | Bacteria | 4407 |
| 448 | Ga0373937_0053289 | 3300036401 | Bacteria | 3711 |
| 449 | Ga0373937_0128154 | 3300036401 | Bacteria | 2369 |
| 450 | Ga0373937_0289444 | 3300036401 | Bacteria | 1547 |
| 451 | Ga0373937_0296786 | 3300036401 | Bacteria | 1527 |
| 452 | Ga0373937_0413086 | 3300036401 | Bacteria | 1280 |
| 453 | Ga0373925_0002970 | 3300037068 | Bacteria | 13390 |
| 454 | Ga0373925_0149580 | 3300037068 | Bacteria | 1832 |
| 455 | Ga0373925_0228546 | 3300037068 | Bacteria | 1487 |
| 456 | Ga0395900_0008528 | 3300037418 | Bacteria | 10534 |
| 457 | Ga0395900_0013835 | 3300037418 | Bacteria | 8234 |
| 458 | Ga0395900_0041531 | 3300037418 | Bacteria | 4741 |
| 459 | Ga0395900_0074250 | 3300037418 | Bacteria | 3497 |
| 460 | Ga0395900_0106822 | 3300037418 | Bacteria | 2876 |
| 461 | Ga0395900_0141460 | 3300037418 | Bacteria | 2464 |
| 462 | Ga0395900_0310219 | 3300037418 | Bacteria | 1561 |
| 463 | Ga0395898_0004050 | 3300037466 | Bacteria | 16108 |
| 464 | Ga0395898_0006827 | 3300037466 | Bacteria | 12140 |
| 465 | Ga0395898_0125014 | 3300037466 | Bacteria | 2464 |
| 466 | Ga0395898_0136157 | 3300037466 | Bacteria | 2352 |
| 467 | Ga0395898_0426969 | 3300037466 | Bacteria | 1263 |
| 468 | Ga0395905_0017993 | 3300037471 | Bacteria | 6709 |
| 469 | Ga0436364_0070962 | 3300037853 | Bacteria | 23054 |
| 470 | Ga0436364_0141518 | 3300037853 | Bacteria | 7713 |
| 471 | Ga0436364_0201210 | 3300037853 | Bacteria | 60188 |
| 472 | Ga0436364_0816924 | 3300037853 | Bacteria | 15997 |
| 473 | Ga0436364_0936746 | 3300037853 | Bacteria | 31021 |
| 474 | Ga0436364_1206830 | 3300037853 | Bacteria | 4070 |
| 475 | Ga0436364_1563654 | 3300037853 | Bacteria | 5080 |
| 476 | Ga0395901_0031390 | 3300038443 | Bacteria | 5479 |
| 477 | Ga0395901_0054448 | 3300038443 | Bacteria | 4158 |
| 478 | Ga0395901_0081432 | 3300038443 | Bacteria | 3381 |
| 479 | Ga0395901_0096903 | 3300038443 | Bacteria | 3091 |
| 480 | Ga0400483_006444 | 3300039062 | Bacteria | 13556 |
| 481 | Ga0436365_0346317 | 3300039437 | Bacteria | 1664 |
| 482 | Ga0436365_0556984 | 3300039437 | Bacteria | 2297 |
| 483 | Ga0436363_1096919 | 3300039450 | Bacteria | 4613 |
| 484 | Ga0436362_0815789 | 3300039453 | Bacteria | 1653 |
| 485 | Ga0439436_0001972 | 3300041404 | Bacteria | 6084 |
| 486 | Ga0439465_0008224 | 3300041413 | Bacteria | 3293 |
| 487 | Ga0439465_0026681 | 3300041413 | Bacteria | 1828 |
| 488 | Ga0451797_1175257 | 3300041453 | Bacteria | 1277 |
| 489 | Ga0451833_0347183 | 3300041491 | Bacteria | 11313 |
| 490 | Ga0451833_0579776 | 3300041491 | Bacteria | 14024 |
| 491 | Ga0451837_0453617 | 3300041494 | Bacteria | 5236 |
| 492 | Ga0451837_1227407 | 3300041494 | Bacteria | 1830 |
| 493 | Ga0451837_1855256 | 3300041494 | Bacteria | 1295 |
| 494 | Ga0451839_1348762 | 3300041496 | Bacteria | 3609 |
| 495 | Ga0451841_0636182 | 3300041498 | Bacteria | 1697 |
| 496 | Ga0451853_0096484 | 3300041512 | Bacteria | 7363 |
| 497 | Ga0451853_0520998 | 3300041512 | Bacteria | 3444 |
| 498 | Ga0451853_2105047 | 3300041512 | Bacteria | 3341 |
| 499 | Ga0451853_3575533 | 3300041512 | Bacteria | 8991 |
| 500 | Ga0439433_0000517 | 3300041999 | Bacteria | 7246 |
| 501 | Ga0439448_0004601 | 3300042005 | Bacteria | 3902 |
| 502 | Ga0439432_027315 | 3300042006 | Bacteria | 1864 |
| 503 | Ga0439457_001264 | 3300042014 | Bacteria | 7581 |
| 504 | Ga0439457_006917 | 3300042014 | Bacteria | 2744 |
| 505 | Ga0439462_0000793 | 3300042015 | Bacteria | 6567 |
| 506 | Ga0450894_000158 | 3300042131 | Bacteria | 11965 |
| 507 | Ga0450896_002075 | 3300042133 | Bacteria | 2553 |
| 508 | Ga0450898_000485 | 3300042134 | Bacteria | 4630 |
| 509 | Ga0450899_000424 | 3300042135 | Bacteria | 4715 |
| 510 | Ga0450906_004270 | 3300042145 | Bacteria | 3001 |
| 511 | Ga0450908_010034 | 3300042184 | Bacteria | 1752 |
| 512 | Ga0439434_0016740 | 3300042435 | Bacteria | 2191 |
| 513 | Ga0466969_0079676 | 3300044656 | Bacteria | 1565 |
| 514 | Ga0466972_0005263 | 3300044658 | Bacteria | 6477 |
| 515 | Ga0466972_0029503 | 3300044658 | Bacteria | 2700 |
| 516 | Ga0466972_0064138 | 3300044658 | Bacteria | 1759 |
| 517 | Ga0466965_0000282 | 3300044683 | Bacteria | 16749 |
| 518 | Ga0466965_0014556 | 3300044683 | Bacteria | 3725 |
| 519 | Ga0466965_0022450 | 3300044683 | Bacteria | 3042 |
| 520 | Ga0466965_0034221 | 3300044683 | Bacteria | 2485 |
| 521 | Ga0466965_0043620 | 3300044683 | Bacteria | 2215 |
| 522 | Ga0466965_0043867 | 3300044683 | Bacteria | 2209 |
| 523 | Ga0466965_0048192 | 3300044683 | Bacteria | 2110 |
| 524 | Ga0466966_0004077 | 3300044684 | Bacteria | 9646 |
| 525 | Ga0466966_0011511 | 3300044684 | Bacteria | 5868 |
| 526 | Ga0466966_0021414 | 3300044684 | Bacteria | 4245 |
| 527 | Ga0466966_0037031 | 3300044684 | Bacteria | 3148 |
| 528 | Ga0466966_0280613 | 3300044684 | Bacteria | 1002 |
| 529 | Ga0466961_0008226 | 3300044693 | Bacteria | 6642 |
| 530 | Ga0466961_0012530 | 3300044693 | Bacteria | 5427 |
| 531 | Ga0466961_0014531 | 3300044693 | Bacteria | 5059 |
| 532 | Ga0466961_0030609 | 3300044693 | Bacteria | 3459 |
| 533 | Ga0466961_0047652 | 3300044693 | Bacteria | 2740 |
| 534 | Ga0466961_0071435 | 3300044693 | Bacteria | 2202 |
| 535 | Ga0466961_0083796 | 3300044693 | Bacteria | 2017 |
| 536 | Ga0466961_0088258 | 3300044693 | Bacteria | 1959 |
| 537 | Ga0466961_0107490 | 3300044693 | Bacteria | 1756 |
| 538 | Ga0466961_0144609 | 3300044693 | Bacteria | 1487 |
| 539 | Ga0466963_0004036 | 3300044694 | Bacteria | 8493 |
| 540 | Ga0466963_0004428 | 3300044694 | Bacteria | 8162 |
| 541 | Ga0466963_0020953 | 3300044694 | Bacteria | 4119 |
| 542 | Ga0466963_0032600 | 3300044694 | Bacteria | 3375 |
| 543 | Ga0466963_0032883 | 3300044694 | Bacteria | 3362 |
| 544 | Ga0466963_0045398 | 3300044694 | Bacteria | 2894 |
| 545 | Ga0466963_0103365 | 3300044694 | Bacteria | 1952 |
| 546 | Ga0466963_0131756 | 3300044694 | Bacteria | 1728 |
| 547 | Ga0466963_0138807 | 3300044694 | Bacteria | 1683 |
| 548 | Ga0466963_0164051 | 3300044694 | Bacteria | 1547 |
| 549 | Ga0466964_0004070 | 3300044706 | Bacteria | 5380 |
| 550 | Ga0466964_0013734 | 3300044706 | Bacteria | 3074 |
| 551 | Ga0466964_0015273 | 3300044706 | Bacteria | 2922 |
| 552 | Ga0466964_0018329 | 3300044706 | Bacteria | 2686 |
| 553 | Ga0466971_0009420 | 3300044719 | Bacteria | 4264 |
| 554 | Ga0466971_0019399 | 3300044719 | Bacteria | 3019 |
| 555 | Ga0466971_0021415 | 3300044719 | Bacteria | 2877 |
| 556 | Ga0466971_0084465 | 3300044719 | Bacteria | 1450 |
| 557 | Ga0466971_0153351 | 3300044719 | Bacteria | 1076 |
| 558 | Ga0466968_0015159 | 3300044735 | Bacteria | 3053 |
| 559 | Ga0466970_0000600 | 3300044765 | Bacteria | 17664 |
| 560 | Ga0466970_0014063 | 3300044765 | Bacteria | 4104 |
| 561 | Ga0466970_0015762 | 3300044765 | Bacteria | 3891 |
| 562 | Ga0466970_0033587 | 3300044765 | Bacteria | 2711 |
| 563 | Ga0466970_0053211 | 3300044765 | Bacteria | 2162 |
| 564 | Ga0466970_0054439 | 3300044765 | Bacteria | 2136 |
| 565 | Ga0466970_0086939 | 3300044765 | Bacteria | 1695 |
| 566 | Ga0466970_0088787 | 3300044765 | Bacteria | 1676 |
| 567 | Ga0466970_0101908 | 3300044765 | Bacteria | 1564 |
| 568 | Ga0466970_0107705 | 3300044765 | Bacteria | 1521 |
| 569 | Ga0466957_0001424 | 3300044842 | Bacteria | 12485 |
| 570 | Ga0466957_0010202 | 3300044842 | Bacteria | 5380 |
| 571 | Ga0466957_0026802 | 3300044842 | Bacteria | 3421 |
| 572 | Ga0466957_0029857 | 3300044842 | Bacteria | 3253 |
| 573 | Ga0466957_0031279 | 3300044842 | Bacteria | 3180 |
| 574 | Ga0466957_0036938 | 3300044842 | Bacteria | 2939 |
| 575 | Ga0466957_0056816 | 3300044842 | Bacteria | 2394 |
| 576 | Ga0466957_0082198 | 3300044842 | Bacteria | 2007 |
| 577 | Ga0466957_0118406 | 3300044842 | Bacteria | 1686 |
| 578 | Ga0466960_0000512 | 3300044901 | Bacteria | 13309 |
| 579 | Ga0466960_0003036 | 3300044901 | Bacteria | 6409 |
| 580 | Ga0466960_0010489 | 3300044901 | Bacteria | 3850 |
| 581 | Ga0466960_0017687 | 3300044901 | Bacteria | 3114 |
| 582 | Ga0466960_0059460 | 3300044901 | Bacteria | 1870 |
| 583 | Ga0466960_0258362 | 3300044901 | Bacteria | 970 |
| 584 | Ga0466959_0000556 | 3300045049 | Bacteria | 21663 |
| 585 | Ga0466959_0010190 | 3300045049 | Bacteria | 6710 |
| 586 | Ga0466959_0059397 | 3300045049 | Bacteria | 2784 |
| 587 | Ga0466959_0066847 | 3300045049 | Bacteria | 2607 |
| 588 | Ga0466959_0068503 | 3300045049 | Bacteria | 2571 |
| 589 | Ga0466959_0104564 | 3300045049 | Bacteria | 2025 |
| 590 | Ga0466959_0178175 | 3300045049 | Bacteria | 1488 |
| 591 | Ga0466958_0001433 | 3300045836 | Bacteria | 11303 |
| 592 | Ga0466958_0005084 | 3300045836 | Bacteria | 7028 |
| 593 | Ga0466958_0007686 | 3300045836 | Bacteria | 5945 |
| 594 | Ga0466958_0015028 | 3300045836 | Bacteria | 4428 |
| 595 | Ga0466958_0028932 | 3300045836 | Bacteria | 3287 |
| 596 | Ga0466958_0031299 | 3300045836 | Bacteria | 3162 |
| 597 | Ga0466958_0067962 | 3300045836 | Bacteria | 2178 |
| 598 | Ga0466958_0080183 | 3300045836 | Bacteria | 2008 |
| 599 | Ga0466958_0098283 | 3300045836 | Bacteria | 1817 |
| 600 | Ga0466967_0004195 | 3300045976 | Bacteria | 9658 |
| 601 | Ga0466967_0009093 | 3300045976 | Bacteria | 7348 |
| 602 | Ga0466967_0019133 | 3300045976 | Bacteria | 5499 |
| 603 | Ga0466967_0025149 | 3300045976 | Bacteria | 4906 |
| 604 | Ga0466967_0048632 | 3300045976 | Bacteria | 3705 |
| 605 | Ga0466967_0052996 | 3300045976 | Bacteria | 3564 |
| 606 | Ga0466967_0062368 | 3300045976 | Bacteria | 3309 |
| 607 | Ga0466967_0125828 | 3300045976 | Bacteria | 2374 |
| 608 | Ga0466967_0156915 | 3300045976 | Bacteria | 2132 |
| 609 | Ga0466967_0204268 | 3300045976 | Bacteria | 1872 |
| 610 | Ga0466967_0235245 | 3300045976 | Bacteria | 1745 |
| 611 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 612 | Ga0495592_0003761 | 3300046454 | Bacteria | 10953 |
| 613 | Ga0495592_0019076 | 3300046454 | Bacteria | 5220 |
| 614 | Ga0495592_0054001 | 3300046454 | Bacteria | 2978 |
| 615 | Ga0495592_0075543 | 3300046454 | Bacteria | 2447 |
| 616 | Ga0495603_0001078 | 3300046455 | Bacteria | 15811 |
| 617 | Ga0495603_0029572 | 3300046455 | Bacteria | 3303 |
| 618 | Ga0495603_0042945 | 3300046455 | Bacteria | 2701 |
| 619 | Ga0495603_0140210 | 3300046455 | Bacteria | 1406 |
| 620 | Ga0495629_0033578 | 3300046459 | Bacteria | 3629 |
| 621 | Ga0495629_0038574 | 3300046459 | Bacteria | 3364 |
| 622 | Ga0495629_0068708 | 3300046459 | Bacteria | 2473 |
| 623 | Ga0495629_0102359 | 3300046459 | Bacteria | 1998 |
| 624 | Ga0495629_0118484 | 3300046459 | Bacteria | 1845 |
| 625 | Ga0495629_0137347 | 3300046459 | Bacteria | 1702 |
| 626 | Ga0495638_0002768 | 3300046460 | Bacteria | 14093 |
| 627 | Ga0495638_0013391 | 3300046460 | Bacteria | 5584 |
| 628 | Ga0495641_0007988 | 3300046461 | Bacteria | 6521 |
| 629 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 630 | Ga0495651_0001340 | 3300046462 | Bacteria | 19069 |
| 631 | Ga0495651_0004043 | 3300046462 | Bacteria | 11213 |
| 632 | Ga0495651_0004642 | 3300046462 | Bacteria | 10508 |
| 633 | Ga0495651_0005285 | 3300046462 | Bacteria | 9843 |
| 634 | Ga0495651_0011356 | 3300046462 | Bacteria | 6844 |
| 635 | Ga0495653_0004255 | 3300046463 | Bacteria | 11599 |
| 636 | Ga0495653_0004341 | 3300046463 | Bacteria | 11467 |
| 637 | Ga0495653_0007576 | 3300046463 | Bacteria | 8876 |
| 638 | Ga0495653_0033959 | 3300046463 | Bacteria | 4038 |
| 639 | Ga0495653_0073109 | 3300046463 | Bacteria | 2559 |
| 640 | Ga0495653_0104079 | 3300046463 | Bacteria | 2051 |
| 641 | Ga0495653_0190790 | 3300046463 | Bacteria | 1398 |
| 642 | Ga0495650_0009549 | 3300046471 | Bacteria | 5509 |
| 643 | Ga0495580_0005682 | 3300046472 | Bacteria | 10259 |
| 644 | Ga0495582_0009339 | 3300046473 | Bacteria | 5402 |
| 645 | Ga0495582_0049238 | 3300046473 | Bacteria | 2320 |
| 646 | Ga0495582_0163062 | 3300046473 | Bacteria | 1268 |
| 647 | Ga0495639_0002234 | 3300046475 | Bacteria | 8511 |
| 648 | Ga0495639_0005243 | 3300046475 | Bacteria | 5571 |
| 649 | Ga0495639_0076021 | 3300046475 | Bacteria | 1557 |
| 650 | Ga0495662_0005674 | 3300046476 | Bacteria | 6237 |
| 651 | Ga0495662_0047963 | 3300046476 | Bacteria | 2062 |
| 652 | Ga0495664_0002240 | 3300046477 | Bacteria | 10355 |
| 653 | Ga0495664_0020949 | 3300046477 | Bacteria | 3774 |
| 654 | Ga0495664_0058993 | 3300046477 | Bacteria | 2284 |
| 655 | Ga0495584_0088049 | 3300046491 | Bacteria | 1565 |
| 656 | Ga0495585_0057795 | 3300046492 | Bacteria | 2140 |
| 657 | Ga0495594_0008847 | 3300046499 | Bacteria | 5191 |
| 658 | Ga0495594_0044866 | 3300046499 | Bacteria | 2426 |
| 659 | Ga0495594_0056745 | 3300046499 | Bacteria | 2162 |
| 660 | Ga0495594_0063609 | 3300046499 | Bacteria | 2044 |
| 661 | Ga0495606_0016107 | 3300046507 | Bacteria | 5721 |
| 662 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 663 | Ga0495608_0001336 | 3300046511 | Bacteria | 17579 |
| 664 | Ga0495608_0017004 | 3300046511 | Bacteria | 5032 |
| 665 | Ga0495608_0029635 | 3300046511 | Bacteria | 3710 |
| 666 | Ga0495618_0030747 | 3300046514 | Bacteria | 3355 |
| 667 | Ga0495618_0031013 | 3300046514 | Bacteria | 3342 |
| 668 | Ga0495618_0200496 | 3300046514 | Bacteria | 1263 |
| 669 | Ga0495628_0000106 | 3300046516 | Bacteria | 67965 |
| 670 | Ga0495628_0003697 | 3300046516 | Bacteria | 13636 |
| 671 | Ga0495628_0006638 | 3300046516 | Bacteria | 10091 |
| 672 | Ga0495628_0023177 | 3300046516 | Bacteria | 5098 |
| 673 | Ga0495628_0029558 | 3300046516 | Bacteria | 4441 |
| 674 | Ga0495628_0048568 | 3300046516 | Bacteria | 3363 |
| 675 | Ga0495628_0057402 | 3300046516 | Bacteria | 3062 |
| 676 | Ga0495628_0146392 | 3300046516 | Bacteria | 1801 |
| 677 | Ga0495630_0001894 | 3300046517 | Bacteria | 14558 |
| 678 | Ga0495630_0016231 | 3300046517 | Bacteria | 5440 |
| 679 | Ga0495630_0026681 | 3300046517 | Bacteria | 4279 |
| 680 | Ga0495630_0032403 | 3300046517 | Bacteria | 3894 |
| 681 | Ga0495631_0086630 | 3300046518 | Bacteria | 1349 |
| 682 | Ga0495666_0024816 | 3300046526 | Bacteria | 2961 |
| 683 | Ga0495652_0000119 | 3300046529 | Bacteria | 85582 |
| 684 | Ga0495652_0000962 | 3300046529 | Bacteria | 32990 |
| 685 | Ga0495652_0002560 | 3300046529 | Bacteria | 18621 |
| 686 | Ga0495652_0020277 | 3300046529 | Bacteria | 5910 |
| 687 | Ga0495652_0039120 | 3300046529 | Bacteria | 4102 |
| 688 | Ga0495652_0044200 | 3300046529 | Bacteria | 3837 |
| 689 | Ga0495652_0073854 | 3300046529 | Bacteria | 2838 |
| 690 | Ga0495652_0083865 | 3300046529 | Bacteria | 2622 |
| 691 | Ga0495665_0001352 | 3300046531 | Bacteria | 13106 |
| 692 | Ga0495665_0048891 | 3300046531 | Bacteria | 2242 |
| 693 | Ga0495640_0014615 | 3300046533 | Bacteria | 5932 |
| 694 | Ga0495640_0015422 | 3300046533 | Bacteria | 5750 |
| 695 | Ga0495640_0020297 | 3300046533 | Bacteria | 4894 |
| 696 | Ga0495640_0059033 | 3300046533 | Bacteria | 2615 |
| 697 | Ga0495640_0067625 | 3300046533 | Bacteria | 2406 |
| 698 | Ga0495640_0138922 | 3300046533 | Bacteria | 1567 |
| 699 | Ga0495586_0015987 | 3300046535 | Bacteria | 3993 |
| 700 | Ga0495586_0086626 | 3300046535 | Bacteria | 1726 |
| 701 | Ga0495587_0000119 | 3300046536 | Bacteria | 60244 |
| 702 | Ga0495587_0004723 | 3300046536 | Bacteria | 8939 |
| 703 | Ga0495587_0013279 | 3300046536 | Bacteria | 5177 |
| 704 | Ga0495587_0055200 | 3300046536 | Bacteria | 2340 |
| 705 | Ga0495645_0036471 | 3300046543 | Bacteria | 3584 |
| 706 | Ga0495645_0045633 | 3300046543 | Bacteria | 3198 |
| 707 | Ga0495645_0051614 | 3300046543 | Bacteria | 2992 |
| 708 | Ga0495645_0086313 | 3300046543 | Bacteria | 2246 |
| 709 | Ga0495645_0090177 | 3300046543 | Bacteria | 2191 |
| 710 | Ga0495645_0120160 | 3300046543 | Bacteria | 1850 |
| 711 | Ga0495645_0134109 | 3300046543 | Bacteria | 1733 |
| 712 | Ga0495645_0156060 | 3300046543 | Bacteria | 1581 |
| 713 | Ga0495645_0230733 | 3300046543 | Bacteria | 1240 |
| 714 | Ga0495622_0027746 | 3300046557 | Bacteria | 2642 |
| 715 | Ga0495667_0000114 | 3300046559 | Bacteria | 58520 |
| 716 | Ga0495667_0003986 | 3300046559 | Bacteria | 9912 |
| 717 | Ga0495667_0020524 | 3300046559 | Bacteria | 4456 |
| 718 | Ga0495667_0039390 | 3300046559 | Bacteria | 3142 |
| 719 | Ga0495667_0057369 | 3300046559 | Bacteria | 2559 |
| 720 | Ga0495667_0102519 | 3300046559 | Bacteria | 1850 |
| 721 | Ga0495667_0114283 | 3300046559 | Bacteria | 1744 |
| 722 | Ga0495667_0118811 | 3300046559 | Bacteria | 1707 |
| 723 | Ga0495634_0005589 | 3300046642 | Bacteria | 9645 |
| 724 | Ga0495634_0015214 | 3300046642 | Bacteria | 5531 |
| 725 | Ga0495634_0065783 | 3300046642 | Bacteria | 2401 |
| 726 | Ga0495634_0102555 | 3300046642 | Bacteria | 1848 |
| 727 | Ga0495625_0083268 | 3300046660 | Bacteria | 2224 |
| 728 | Ga0495635_0000410 | 3300046663 | Bacteria | 27259 |
| 729 | Ga0495635_0004670 | 3300046663 | Bacteria | 9512 |
| 730 | Ga0495635_0014535 | 3300046663 | Bacteria | 5506 |
| 731 | Ga0495635_0023234 | 3300046663 | Bacteria | 4321 |
| 732 | Ga0495635_0026174 | 3300046663 | Bacteria | 4062 |
| 733 | Ga0495635_0034337 | 3300046663 | Bacteria | 3517 |
| 734 | Ga0495635_0211567 | 3300046663 | Bacteria | 1313 |
| 735 | Ga0495588_0005715 | 3300046674 | Bacteria | 5548 |
| 736 | Ga0495588_0024140 | 3300046674 | Bacteria | 3018 |
| 737 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 738 | Ga0495657_0015104 | 3300046675 | Bacteria | 5659 |
| 739 | Ga0495657_0026413 | 3300046675 | Bacteria | 4111 |
| 740 | Ga0495657_0027454 | 3300046675 | Bacteria | 4016 |
| 741 | Ga0495657_0032809 | 3300046675 | Bacteria | 3620 |
| 742 | Ga0495657_0062497 | 3300046675 | Bacteria | 2460 |
| 743 | Ga0495657_0079194 | 3300046675 | Bacteria | 2128 |
| 744 | Ga0495657_0109277 | 3300046675 | Bacteria | 1753 |
| 745 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 746 | Ga0495599_0003359 | 3300046678 | Bacteria | 9349 |
| 747 | Ga0495599_0057963 | 3300046678 | Bacteria | 2423 |
| 748 | Ga0495599_0065362 | 3300046678 | Bacteria | 2272 |
| 749 | Ga0495623_0002839 | 3300046679 | Bacteria | 11421 |
| 750 | Ga0495623_0015065 | 3300046679 | Bacteria | 4998 |
| 751 | Ga0495623_0036803 | 3300046679 | Bacteria | 3135 |
| 752 | Ga0495646_0008843 | 3300046680 | Bacteria | 6395 |
| 753 | Ga0495646_0009579 | 3300046680 | Bacteria | 6149 |
| 754 | Ga0495646_0087206 | 3300046680 | Bacteria | 1809 |
| 755 | Ga0495646_0116672 | 3300046680 | Bacteria | 1514 |
| 756 | Ga0495658_0011380 | 3300046683 | Bacteria | 4473 |
| 757 | Ga0495658_0024875 | 3300046683 | Bacteria | 3195 |
| 758 | Ga0495658_0165922 | 3300046683 | Bacteria | 1364 |
| 759 | Ga0495613_0012310 | 3300046689 | Bacteria | 6354 |
| 760 | Ga0495613_0023097 | 3300046689 | Bacteria | 4635 |
| 761 | Ga0495613_0026890 | 3300046689 | Bacteria | 4283 |
| 762 | Ga0495624_0007418 | 3300046690 | Bacteria | 7693 |
| 763 | Ga0495624_0024215 | 3300046690 | Bacteria | 3997 |
| 764 | Ga0495624_0036400 | 3300046690 | Bacteria | 3173 |
| 765 | Ga0495670_0044445 | 3300046691 | Bacteria | 2218 |
| 766 | Ga0495589_0042177 | 3300046794 | Bacteria | 2274 |
| 767 | Ga0495600_0003923 | 3300046809 | Bacteria | 8837 |
| 768 | Ga0495600_0022970 | 3300046809 | Bacteria | 4010 |
| 769 | Ga0495600_0025737 | 3300046809 | Bacteria | 3792 |
| 770 | Ga0495600_0030735 | 3300046809 | Bacteria | 3478 |
| 771 | Ga0495581_0000844 | 3300047315 | Bacteria | 16332 |
| 772 | Ga0495581_0108469 | 3300047315 | Bacteria | 1614 |
| 773 | Ga0495604_0000121 | 3300047317 | Bacteria | 65991 |
| 774 | Ga0495604_0015027 | 3300047317 | Bacteria | 6176 |
| 775 | Ga0495604_0030089 | 3300047317 | Bacteria | 4316 |
| 776 | Ga0495604_0058706 | 3300047317 | Bacteria | 2953 |
| 777 | Ga0495604_0070928 | 3300047317 | Bacteria | 2637 |
| 778 | Ga0495604_0112127 | 3300047317 | Bacteria | 1987 |
| 779 | Ga0495636_0075127 | 3300047318 | Bacteria | 1448 |
| 780 | Ga0495674_0013463 | 3300047319 | Bacteria | 7692 |
| 781 | Ga0495674_0048622 | 3300047319 | Bacteria | 3752 |
| 782 | Ga0495674_0051826 | 3300047319 | Bacteria | 3616 |
| 783 | Ga0495674_0103594 | 3300047319 | Bacteria | 2419 |
| 784 | Ga0495674_0166701 | 3300047319 | Bacteria | 1840 |
| 785 | Ga0495676_0027812 | 3300047321 | Bacteria | 4844 |
| 786 | Ga0495676_0036181 | 3300047321 | Bacteria | 4125 |
| 787 | Ga0495676_0054455 | 3300047321 | Bacteria | 3180 |
| 788 | Ga0495676_0064593 | 3300047321 | Bacteria | 2844 |
| 789 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 790 | Ga0495680_0003673 | 3300047322 | Bacteria | 14986 |
| 791 | Ga0495680_0003752 | 3300047322 | Bacteria | 14802 |
| 792 | Ga0495680_0005407 | 3300047322 | Bacteria | 12028 |
| 793 | Ga0495680_0013023 | 3300047322 | Bacteria | 7275 |
| 794 | Ga0495680_0032607 | 3300047322 | Bacteria | 4225 |
| 795 | Ga0495680_0033747 | 3300047322 | Bacteria | 4140 |
| 796 | Ga0495680_0092880 | 3300047322 | Bacteria | 2259 |
| 797 | Ga0495683_0000585 | 3300047323 | Bacteria | 27495 |
| 798 | Ga0495687_019515 | 3300047443 | Bacteria | 3324 |
| 799 | Ga0495675_0000176 | 3300047444 | Bacteria | 46587 |
| 800 | Ga0495675_0023505 | 3300047444 | Bacteria | 3927 |
| 801 | Ga0495675_0033598 | 3300047444 | Bacteria | 3274 |
| 802 | Ga0495675_0079930 | 3300047444 | Bacteria | 2059 |
| 803 | Ga0495675_0241486 | 3300047444 | Bacteria | 1087 |
| 804 | Ga0495684_0001955 | 3300047471 | Bacteria | 16551 |
| 805 | Ga0495684_0003123 | 3300047471 | Bacteria | 12985 |
| 806 | Ga0495684_0003656 | 3300047471 | Bacteria | 11982 |
| 807 | Ga0495684_0009313 | 3300047471 | Bacteria | 7581 |
| 808 | Ga0495684_0013396 | 3300047471 | Bacteria | 6312 |
| 809 | Ga0495684_0087413 | 3300047471 | Bacteria | 2362 |
| 810 | Ga0495686_0019765 | 3300047472 | Bacteria | 4497 |
| 811 | Ga0495593_0000862 | 3300047673 | Bacteria | 17564 |
| 812 | Ga0495593_0057885 | 3300047673 | Bacteria | 2034 |
| 813 | Ga0495593_0096202 | 3300047673 | Bacteria | 1522 |
| 814 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 815 | Ga0495602_0019576 | 3300048088 | Bacteria | 6716 |
| 816 | Ga0495602_0036862 | 3300048088 | Bacteria | 4545 |
| 817 | Ga0495602_0052846 | 3300048088 | Bacteria | 3604 |
| 818 | Ga0495614_0002807 | 3300048089 | Bacteria | 7749 |
| 819 | Ga0496100_0013250 | 3300048903 | Bacteria | 4748 |
| 820 | Ga0496100_0057190 | 3300048903 | Bacteria | 2554 |
| 821 | Ga0496101_0114612 | 3300048904 | Bacteria | 2032 |
| 822 | Ga0496101_0121509 | 3300048904 | Bacteria | 1975 |
| 823 | Ga0496101_0148113 | 3300048904 | Bacteria | 1794 |
| 824 | Ga0496101_0186990 | 3300048904 | Bacteria | 1597 |
| 825 | Ga0496102_0000263 | 3300048905 | Bacteria | 67095 |
| 826 | Ga0496102_0018543 | 3300048905 | Bacteria | 6117 |
| 827 | Ga0496102_0096331 | 3300048905 | Bacteria | 2743 |
| 828 | Ga0496102_0121639 | 3300048905 | Bacteria | 2438 |
| 829 | Ga0496102_0145751 | 3300048905 | Bacteria | 2222 |
| 830 | Ga0496102_0219377 | 3300048905 | Bacteria | 1792 |
| 831 | Ga0496102_0406771 | 3300048905 | Bacteria | 1279 |
| 832 | Ga0496104_0002025 | 3300048907 | Bacteria | 17601 |
| 833 | Ga0496104_0008359 | 3300048907 | Bacteria | 9198 |
| 834 | Ga0496104_0031076 | 3300048907 | Bacteria | 4965 |
| 835 | Ga0496104_0048446 | 3300048907 | Bacteria | 4006 |
| 836 | Ga0496104_0063449 | 3300048907 | Bacteria | 3504 |
| 837 | Ga0496104_0277753 | 3300048907 | Bacteria | 1588 |
| 838 | Ga0496105_0017243 | 3300048908 | Bacteria | 5784 |
| 839 | Ga0496105_0047247 | 3300048908 | Bacteria | 3552 |
| 840 | Ga0496105_0060507 | 3300048908 | Bacteria | 3125 |
| 841 | Ga0496105_0074525 | 3300048908 | Bacteria | 2804 |
| 842 | Ga0496105_0112794 | 3300048908 | Bacteria | 2244 |
| 843 | Ga0496105_0220998 | 3300048908 | Bacteria | 1542 |
| 844 | Ga0496105_0270906 | 3300048908 | Bacteria | 1371 |
| 845 | Ga0496106_0097744 | 3300048909 | Bacteria | 2273 |
| 846 | Ga0496107_0017857 | 3300048910 | Bacteria | 4993 |
| 847 | Ga0496107_0037547 | 3300048910 | Bacteria | 3476 |
| 848 | Ga0496107_0040353 | 3300048910 | Bacteria | 3350 |
| 849 | Ga0496108_0041662 | 3300048911 | Bacteria | 3834 |
| 850 | Ga0496108_0108639 | 3300048911 | Bacteria | 2370 |
| 851 | Ga0496109_0018389 | 3300048912 | Bacteria | 6141 |
| 852 | Ga0496109_0021669 | 3300048912 | Bacteria | 5686 |
| 853 | Ga0496109_0084625 | 3300048912 | Bacteria | 2926 |
| 854 | Ga0496109_0085370 | 3300048912 | Bacteria | 2913 |
| 855 | Ga0496109_0121134 | 3300048912 | Bacteria | 2437 |
| 856 | Ga0496109_0196419 | 3300048912 | Bacteria | 1896 |
| 857 | Ga0496110_0037673 | 3300048913 | Bacteria | 4204 |
| 858 | Ga0496110_0040580 | 3300048913 | Bacteria | 4056 |
| 859 | Ga0496111_0021088 | 3300048914 | Bacteria | 4545 |
| 860 | Ga0496111_0022063 | 3300048914 | Bacteria | 4453 |
| 861 | Ga0496112_0002456 | 3300048915 | Bacteria | 14946 |
| 862 | Ga0496112_0002788 | 3300048915 | Bacteria | 14185 |
| 863 | Ga0496112_0121966 | 3300048915 | Bacteria | 2577 |
| 864 | Ga0496112_0173958 | 3300048915 | Bacteria | 2118 |
| 865 | Ga0496112_0182609 | 3300048915 | Bacteria | 2061 |
| 866 | Ga0496113_0000626 | 3300048916 | Bacteria | 17778 |
| 867 | Ga0496113_0005086 | 3300048916 | Bacteria | 8169 |
| 868 | Ga0496113_0014532 | 3300048916 | Bacteria | 5374 |
| 869 | Ga0496113_0030602 | 3300048916 | Bacteria | 3898 |
| 870 | Ga0496113_0091797 | 3300048916 | Bacteria | 2341 |
| 871 | Ga0496113_0103800 | 3300048916 | Bacteria | 2205 |
| 872 | Ga0496114_0022382 | 3300048917 | Bacteria | 5151 |
| 873 | Ga0496114_0063435 | 3300048917 | Bacteria | 3094 |
| 874 | Ga0496114_0125698 | 3300048917 | Bacteria | 2210 |
| 875 | Ga0496114_0209494 | 3300048917 | Bacteria | 1709 |
| 876 | Ga0496115_0014024 | 3300048918 | Bacteria | 6066 |
| 877 | Ga0496119_0015582 | 3300048922 | Bacteria | 5839 |
| 878 | Ga0496123_0021932 | 3300048926 | Bacteria | 4943 |
| 879 | Ga0496126_0000036 | 3300048929 | Bacteria | 354901 |
| 880 | Ga0496126_0013957 | 3300048929 | Bacteria | 8146 |
| 881 | Ga0496126_0018493 | 3300048929 | Bacteria | 6901 |
| 882 | Ga0496126_0096202 | 3300048929 | Bacteria | 2596 |
| 883 | Ga0496126_0142193 | 3300048929 | Bacteria | 2064 |
| 884 | Ga0501031_0003245 | 3300049568 | Bacteria | 10454 |
| 885 | Ga0501031_0095617 | 3300049568 | Bacteria | 1938 |
| 886 | Ga0501031_0105563 | 3300049568 | Bacteria | 1838 |
| 887 | Ga0501032_0025500 | 3300049569 | Bacteria | 4075 |
| 888 | Ga0501032_0110917 | 3300049569 | Bacteria | 1815 |
| 889 | Ga0501032_0124489 | 3300049569 | Bacteria | 1703 |
| 890 | Ga0501033_0001361 | 3300049570 | Bacteria | 21789 |
| 891 | Ga0501033_0001790 | 3300049570 | Bacteria | 18761 |
| 892 | Ga0501033_0005042 | 3300049570 | Bacteria | 10517 |
| 893 | Ga0501033_0101095 | 3300049570 | Bacteria | 2103 |
| 894 | Ga0501033_0204059 | 3300049570 | Bacteria | 1411 |
| 895 | Ga0501034_0017417 | 3300049571 | Bacteria | 7368 |
| 896 | Ga0501034_0026995 | 3300049571 | Bacteria | 5841 |
| 897 | Ga0501034_0027076 | 3300049571 | Bacteria | 5833 |
| 898 | Ga0501034_0097799 | 3300049571 | Bacteria | 2931 |
| 899 | Ga0501034_0159396 | 3300049571 | Bacteria | 2228 |
| 900 | Ga0501036_0007027 | 3300049572 | Bacteria | 9165 |
| 901 | Ga0501036_0009260 | 3300049572 | Bacteria | 8093 |
| 902 | Ga0501036_0032192 | 3300049572 | Bacteria | 4430 |
| 903 | Ga0501036_0084244 | 3300049572 | Bacteria | 2688 |
| 904 | Ga0501036_0094749 | 3300049572 | Bacteria | 2523 |
| 905 | Ga0501036_0119005 | 3300049572 | Bacteria | 2230 |
| 906 | Ga0501037_0029643 | 3300049573 | Bacteria | 4043 |
| 907 | Ga0501037_0216543 | 3300049573 | Bacteria | 1349 |
| 908 | Ga0501038_0001063 | 3300049574 | Bacteria | 24793 |
| 909 | Ga0501038_0002102 | 3300049574 | Bacteria | 18461 |
| 910 | Ga0501038_0115015 | 3300049574 | Bacteria | 2224 |
| 911 | Ga0501039_0073375 | 3300049575 | Bacteria | 2659 |
| 912 | Ga0501043_0050608 | 3300049579 | Bacteria | 3265 |
| 913 | Ga0501043_0075950 | 3300049579 | Bacteria | 2639 |
| 914 | Ga0501046_0085768 | 3300049580 | Bacteria | 2427 |
| 915 | Ga0501046_0087836 | 3300049580 | Bacteria | 2395 |
| 916 | Ga0501046_0172247 | 3300049580 | Bacteria | 1624 |
| 917 | Ga0501047_0000088 | 3300049581 | Bacteria | 117495 |
| 918 | Ga0501047_0000354 | 3300049581 | Bacteria | 52008 |
| 919 | Ga0501047_0004122 | 3300049581 | Bacteria | 13676 |
| 920 | Ga0501047_0019106 | 3300049581 | Bacteria | 6575 |
| 921 | Ga0501047_0033092 | 3300049581 | Bacteria | 4991 |
| 922 | Ga0501047_0039386 | 3300049581 | Bacteria | 4571 |
| 923 | Ga0501047_0057065 | 3300049581 | Bacteria | 3776 |
| 924 | Ga0501047_0061266 | 3300049581 | Bacteria | 3630 |
| 925 | Ga0501047_0117172 | 3300049581 | Bacteria | 2545 |
| 926 | Ga0501047_0193336 | 3300049581 | Bacteria | 1898 |
| 927 | Ga0501047_0244542 | 3300049581 | Bacteria | 1644 |
| 928 | Ga0501048_0056423 | 3300049582 | Bacteria | 2787 |
| 929 | Ga0501048_0057917 | 3300049582 | Bacteria | 2747 |
| 930 | Ga0501048_0135992 | 3300049582 | Bacteria | 1737 |
| 931 | Ga0501067_0007301 | 3300049583 | Bacteria | 6136 |
| 932 | Ga0501067_0008669 | 3300049583 | Bacteria | 5637 |
| 933 | Ga0501067_0022825 | 3300049583 | Bacteria | 3464 |
| 934 | Ga0501067_0024913 | 3300049583 | Bacteria | 3318 |
| 935 | Ga0501068_0009431 | 3300049584 | Bacteria | 5462 |
| 936 | Ga0501068_0017127 | 3300049584 | Bacteria | 4188 |
| 937 | Ga0501068_0057881 | 3300049584 | Bacteria | 2351 |
| 938 | Ga0501068_0140266 | 3300049584 | Bacteria | 1515 |
| 939 | Ga0501069_0093690 | 3300049585 | Bacteria | 1700 |
| 940 | Ga0501069_0108393 | 3300049585 | Bacteria | 1580 |
| 941 | Ga0501070_0009187 | 3300049586 | Bacteria | 8356 |
| 942 | Ga0501070_0018520 | 3300049586 | Bacteria | 5842 |
| 943 | Ga0501070_0026400 | 3300049586 | Bacteria | 4871 |
| 944 | Ga0501070_0140698 | 3300049586 | Bacteria | 1992 |
| 945 | Ga0501070_0283390 | 3300049586 | Bacteria | 1352 |
| 946 | Ga0501071_0035304 | 3300049587 | Bacteria | 3561 |
| 947 | Ga0501071_0043872 | 3300049587 | Bacteria | 3207 |
| 948 | Ga0501072_0010591 | 3300049588 | Bacteria | 7023 |
| 949 | Ga0501072_0016492 | 3300049588 | Bacteria | 5674 |
| 950 | Ga0501072_0039107 | 3300049588 | Bacteria | 3725 |
| 951 | Ga0501072_0080501 | 3300049588 | Bacteria | 2581 |
| 952 | Ga0501073_0009470 | 3300049589 | Bacteria | 7190 |
| 953 | Ga0501073_0017123 | 3300049589 | Bacteria | 5249 |
| 954 | Ga0501073_0021675 | 3300049589 | Bacteria | 4629 |
| 955 | Ga0501073_0049014 | 3300049589 | Bacteria | 2962 |
| 956 | Ga0501074_0002005 | 3300049590 | Bacteria | 14031 |
| 957 | Ga0501074_0017346 | 3300049590 | Bacteria | 5222 |
| 958 | Ga0501074_0089726 | 3300049590 | Bacteria | 2201 |
| 959 | Ga0501075_0016388 | 3300049591 | Bacteria | 5338 |
| 960 | Ga0501075_0280150 | 3300049591 | Bacteria | 1270 |
| 961 | Ga0501076_0052576 | 3300049592 | Bacteria | 3227 |
| 962 | Ga0501076_0062608 | 3300049592 | Bacteria | 2963 |
| 963 | Ga0501076_0073402 | 3300049592 | Bacteria | 2740 |
| 964 | Ga0501076_0295197 | 3300049592 | Bacteria | 1328 |
| 965 | Ga0501077_0020720 | 3300049593 | Bacteria | 4163 |
| 966 | Ga0501077_0045303 | 3300049593 | Bacteria | 2794 |
| 967 | Ga0501077_0097904 | 3300049593 | Bacteria | 1859 |
| 968 | Ga0501077_0146462 | 3300049593 | Bacteria | 1498 |
| 969 | Ga0501079_0038976 | 3300049741 | Bacteria | 3665 |
| 970 | Ga0501080_0022611 | 3300049742 | Bacteria | 5824 |
| 971 | Ga0501080_0022862 | 3300049742 | Bacteria | 5796 |
| 972 | Ga0501080_0027211 | 3300049742 | Bacteria | 5318 |
| 973 | Ga0501081_0023218 | 3300049743 | Bacteria | 4156 |
| 974 | Ga0501083_0002982 | 3300049744 | Bacteria | 11752 |
| 975 | Ga0501083_0033908 | 3300049744 | Bacteria | 3493 |
| 976 | Ga0501083_0094960 | 3300049744 | Bacteria | 1968 |
| 977 | Ga0501035_0003607 | 3300049822 | Bacteria | 14775 |
| 978 | Ga0501035_0005740 | 3300049822 | Bacteria | 11709 |
| 979 | Ga0501035_0024418 | 3300049822 | Bacteria | 5544 |
| 980 | Ga0501035_0031854 | 3300049822 | Bacteria | 4802 |
| 981 | Ga0501035_0044728 | 3300049822 | Bacteria | 3985 |
| 982 | Ga0501035_0048503 | 3300049822 | Bacteria | 3808 |
| 983 | Ga0501035_0057252 | 3300049822 | Bacteria | 3475 |
| 984 | Ga0501035_0058997 | 3300049822 | Bacteria | 3418 |
| 985 | Ga0501035_0076635 | 3300049822 | Bacteria | 2957 |
| 986 | Ga0501035_0118695 | 3300049822 | Bacteria | 2314 |
| 987 | Ga0501035_0285472 | 3300049822 | Bacteria | 1394 |
| 988 | Ga0501044_0004033 | 3300049823 | Bacteria | 16468 |
| 989 | Ga0501044_0013775 | 3300049823 | Bacteria | 8739 |
| 990 | Ga0501044_0026079 | 3300049823 | Bacteria | 6190 |
| 991 | Ga0501044_0033301 | 3300049823 | Bacteria | 5416 |
| 992 | Ga0501044_0035691 | 3300049823 | Bacteria | 5205 |
| 993 | Ga0501044_0051989 | 3300049823 | Bacteria | 4224 |
| 994 | Ga0501044_0062687 | 3300049823 | Bacteria | 3800 |
| 995 | Ga0501044_0118396 | 3300049823 | Bacteria | 2652 |
| 996 | Ga0501045_0001364 | 3300049824 | Bacteria | 16238 |
| 997 | Ga0501045_0035483 | 3300049824 | Bacteria | 3621 |
| 998 | nmdc:mga03683_62862_c1 | 3300050489 | Bacteria | 1573 |
| 999 | nmdc:mga00v17_26489_c1 | 3300050491 | Bacteria | 3380 |
| 1000 | nmdc:mga0yw44_195209_c1 | 3300050492 | Bacteria | 1336 |
| 1001 | nmdc:mga06z11_76044_c1 | 3300050494 | Bacteria | 1790 |
| 1002 | nmdc:mga09592_12762_c1 | 3300050508 | Bacteria | 6847 |
| 1003 | nmdc:mga09592_177_c1 | 3300050508 | Bacteria | 45265 |
| 1004 | nmdc:mga09592_232602_c1 | 3300050508 | Bacteria | 1597 |
| 1005 | nmdc:mga0qj67_1247_c1 | 3300050509 | Bacteria | 17793 |
| 1006 | nmdc:mga0qj67_26683_c1 | 3300050509 | Bacteria | 4472 |
| 1007 | nmdc:mga0qj67_36_c3 | 3300050509 | Bacteria | 71496 |
| 1008 | nmdc:mga06r32_181565_c1 | 3300050510 | Bacteria | 2090 |
| 1009 | nmdc:mga06r32_218963_c1 | 3300050510 | Bacteria | 1892 |
| 1010 | nmdc:mga06r32_29461_c1 | 3300050510 | Bacteria | 5145 |
| 1011 | nmdc:mga06r32_35394_c1 | 3300050510 | Bacteria | 4712 |
| 1012 | nmdc:mga06r32_9191_c1 | 3300050510 | Bacteria | 8910 |
| 1013 | nmdc:mga08x19_71015_c1 | 3300050514 | Bacteria | 2269 |
| 1014 | Ga0495601_0011038 | 3300053077 | Bacteria | 5395 |
| 1015 | Ga0495601_0024892 | 3300053077 | Bacteria | 3688 |
| 1016 | Ga0495612_0001711 | 3300053078 | Bacteria | 9001 |
| 1017 | Ga0495595_0000341 | 3300053084 | Bacteria | 17842 |
| 1018 | Ga0495595_0011202 | 3300053084 | Bacteria | 3746 |
| 1019 | Ga0495595_0012296 | 3300053084 | Bacteria | 3595 |
| 1020 | Ga0495595_0012347 | 3300053084 | Bacteria | 3589 |
| 1021 | Ga0495619_0002180 | 3300053085 | Bacteria | 12975 |
| 1022 | Ga0495619_0008175 | 3300053085 | Bacteria | 6618 |
| 1023 | Ga0495619_0069135 | 3300053085 | Bacteria | 2360 |
| 1024 | Ga0495619_0106288 | 3300053085 | Bacteria | 1914 |
| 1025 | Ga0495619_0149057 | 3300053085 | Bacteria | 1613 |
| 1026 | Ga0500643_000290 | 3300053087 | Bacteria | 43109 |
| 1027 | Ga0500646_0000613 | 3300053090 | Bacteria | 10196 |
| 1028 | Ga0500566_0000593 | 3300053094 | Bacteria | 20272 |
| 1029 | Ga0500556_0001524 | 3300053104 | Bacteria | 9519 |
| 1030 | Ga0500556_0003518 | 3300053104 | Bacteria | 4590 |
| 1031 | Ga0500559_0003009 | 3300053136 | Bacteria | 8439 |
| 1032 | Ga0500573_0094999 | 3300053140 | Bacteria | 1681 |
| 1033 | Ga0500616_0036868 | 3300053153 | Bacteria | 2651 |
| 1034 | Ga0500616_0069850 | 3300053153 | Bacteria | 1794 |
| 1035 | Ga0500627_0019123 | 3300053158 | Bacteria | 2723 |
| 1036 | Ga0501084_0000772 | 3300054114 | Bacteria | 24335 |
| 1037 | Ga0501084_0003411 | 3300054114 | Bacteria | 12887 |
| 1038 | Ga0501084_0020426 | 3300054114 | Bacteria | 5522 |
| 1039 | Ga0501084_0154328 | 3300054114 | Bacteria | 1936 |
| 1040 | Ga0587073_0000923 | 3300059492 | Bacteria | 3111 |
| 1041 | Ga0587082_007356 | 3300059504 | Bacteria | 1500 |
| 1042 | Ga0587088_000572 | 3300059508 | Bacteria | 3155 |
| 1043 | Ga0587091_002082 | 3300059511 | Bacteria | 2308 |
| 1044 | Ga0587113_000431 | 3300059625 | Bacteria | 2200 |
| 1045 | Ga0587067_000648 | 3300059640 | Bacteria | 3225 |
| 1046 | Ga0587072_010902 | 3300059643 | Bacteria | 1476 |
| 1047 | Ga0587079_008019 | 3300059647 | Bacteria | 1600 |
| 1048 | Ga0587071_012313 | 3300060344 | Bacteria | 1457 |
| 1049 | Ga0501082_0026489 | 3300060353 | Bacteria | 4997 |
| 1050 | Ga0501082_0051265 | 3300060353 | Bacteria | 3557 |
| 1051 | Ga0501082_0070952 | 3300060353 | Bacteria | 2999 |
| 1052 | Ga0501082_0246171 | 3300060353 | Bacteria | 1556 |
| 1053 | Ga0466962_0000057 | 3300061719 | Bacteria | 46351 |
| 1054 | Ga0466962_0003856 | 3300061719 | Bacteria | 7164 |
| 1055 | Ga0466962_0060835 | 3300061719 | Bacteria | 1803 |
| 1056 | Ga0466962_0069651 | 3300061719 | Bacteria | 1680 |
| 1057 | Ga0466962_0081198 | 3300061719 | Bacteria | 1550 |
| 1058 | Ga0530510_0132898 | 3300061734 | Bacteria | 1831 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044901 | Ga0466960_0258362 | Ga0466960_0258362_43_948 | 287 |
| 2 | 3300046680 | Ga0495646_0087206 | Ga0495646_0087206_877_1779 | 289 |
| 3 | 3300047444 | Ga0495675_0241486 | Ga0495675_0241486_53_955 | 289 |
| 4 | 3300048908 | Ga0496105_0112794 | Ga0496105_0112794_876_1910 | 303 |
| 5 | 3300044684 | Ga0466966_0280613 | Ga0466966_0280613_44_988 | 306 |
| 6 | 3300048929 | Ga0496126_0142193 | Ga0496126_0142193_1099_2052 | 309 |
| 7 | 3300044719 | Ga0466971_0153351 | Ga0466971_0153351_29_991 | 310 |
| 8 | 3300031456 | Ga0307513_10115253 | Ga0307513_101152531 | 312 |
| 9 | 3300049586 | Ga0501070_0283390 | Ga0501070_0283390_15_983 | 313 |
| 10 | 3300044706 | Ga0466964_0018329 | Ga0466964_0018329_322_1476 | 326 |
| 11 | 3300045836 | Ga0466958_0080183 | Ga0466958_0080183_59_1213 | 326 |
| 12 | 3300045976 | Ga0466967_0019133 | Ga0466967_0019133_1525_2673 | 326 |
| 13 | 3300046459 | Ga0495629_0118484 | Ga0495629_0118484_676_1830 | 327 |
| 14 | 3300046499 | Ga0495594_0044866 | Ga0495594_0044866_1002_2156 | 327 |
| 15 | 3300049581 | Ga0501047_0000088 | Ga0501047_0000088_61339_62493 | 327 |
| 16 | 3300005329 | Ga0070683_100069913 | Ga0070683_1000699131 | 330 |
| 17 | 3300005336 | Ga0070680_100074698 | Ga0070680_1000746982 | 330 |
| 18 | 3300005339 | Ga0070660_100074360 | Ga0070660_1000743602 | 330 |
| 19 | 3300005355 | Ga0070671_100118890 | Ga0070671_1001188902 | 330 |
| 20 | 3300005364 | Ga0070673_100127747 | Ga0070673_1001277472 | 330 |
| 21 | 3300005444 | Ga0070694_100132577 | Ga0070694_1001325772 | 330 |
| 22 | 3300005455 | Ga0070663_100073466 | Ga0070663_1000734663 | 330 |
| 23 | 3300005467 | Ga0070706_100029291 | Ga0070706_1000292913 | 330 |
| 24 | 3300005518 | Ga0070699_100001693 | Ga0070699_10000169316 | 330 |
| 25 | 3300005535 | Ga0070684_100025696 | Ga0070684_1000256963 | 330 |
| 26 | 3300005536 | Ga0070697_100002299 | Ga0070697_1000022995 | 330 |
| 27 | 3300005544 | Ga0070686_100038936 | Ga0070686_1000389362 | 330 |
| 28 | 3300005547 | Ga0070693_100096105 | Ga0070693_1000961052 | 330 |
| 29 | 3300005563 | Ga0068855_100108506 | Ga0068855_1001085062 | 330 |
| 30 | 3300005564 | Ga0070664_100066221 | Ga0070664_1000662212 | 330 |
| 31 | 3300005577 | Ga0068857_100052746 | Ga0068857_1000527462 | 330 |
| 32 | 3300005615 | Ga0070702_100132068 | Ga0070702_1001320682 | 330 |
| 33 | 3300005616 | Ga0068852_100033058 | Ga0068852_1000330582 | 330 |
| 34 | 3300005618 | Ga0068864_100118475 | Ga0068864_1001184752 | 330 |
| 35 | 3300005843 | Ga0068860_100035062 | Ga0068860_1000350622 | 330 |
| 36 | 3300006163 | Ga0070715_10084394 | Ga0070715_100843941 | 330 |
| 37 | 3300006358 | Ga0068871_100169919 | Ga0068871_1001699192 | 330 |
| 38 | 3300006846 | Ga0075430_100016395 | Ga0075430_1000163956 | 330 |
| 39 | 3300009177 | Ga0105248_10190455 | Ga0105248_101904552 | 330 |
| 40 | 3300009553 | Ga0105249_10104615 | Ga0105249_101046151 | 330 |
| 41 | 3300013308 | Ga0157375_10122181 | Ga0157375_101221812 | 330 |
| 42 | 3300020082 | Ga0206353_10727382 | Ga0206353_107273822 | 330 |
| 43 | 3300025917 | Ga0207660_10170236 | Ga0207660_101702361 | 330 |
| 44 | 3300025918 | Ga0207662_10006419 | Ga0207662_100064193 | 330 |
| 45 | 3300025919 | Ga0207657_10061614 | Ga0207657_100616142 | 330 |
| 46 | 3300025922 | Ga0207646_10016205 | Ga0207646_100162053 | 330 |
| 47 | 3300025926 | Ga0207659_10245249 | Ga0207659_102452492 | 330 |
| 48 | 3300025928 | Ga0207700_10043803 | Ga0207700_100438033 | 330 |
| 49 | 3300025931 | Ga0207644_10068549 | Ga0207644_100685493 | 330 |
| 50 | 3300025936 | Ga0207670_10050823 | Ga0207670_100508231 | 330 |
| 51 | 3300025939 | Ga0207665_10064935 | Ga0207665_100649352 | 330 |
| 52 | 3300025942 | Ga0207689_10005326 | Ga0207689_100053268 | 330 |
| 53 | 3300025944 | Ga0207661_10274438 | Ga0207661_102744382 | 330 |
| 54 | 3300025945 | Ga0207679_10144663 | Ga0207679_101446632 | 330 |
| 55 | 3300026075 | Ga0207708_10010498 | Ga0207708_100104983 | 330 |
| 56 | 3300026116 | Ga0207674_10061251 | Ga0207674_100612513 | 330 |
| 57 | 3300026121 | Ga0207683_10000264 | Ga0207683_1000026434 | 330 |
| 58 | 3300028380 | Ga0268265_10051630 | Ga0268265_100516302 | 330 |
| 59 | 3300034820 | Ga0373959_0007164 | Ga0373959_0007164_354_1502 | 330 |
| 60 | 3300035083 | Ga0373926_0001597 | Ga0373926_0001597_4403_5551 | 330 |
| 61 | 3300035089 | Ga0373944_0000931 | Ga0373944_0000931_2941_4089 | 330 |
| 62 | 3300035111 | Ga0373923_0006087 | Ga0373923_0006087_446_1594 | 330 |
| 63 | 3300035113 | Ga0373936_0006015 | Ga0373936_0006015_3099_4247 | 330 |
| 64 | 3300035117 | Ga0373953_0010112 | Ga0373953_0010112_520_1668 | 330 |
| 65 | 3300035118 | Ga0373954_0016140 | Ga0373954_0016140_1971_3119 | 330 |
| 66 | 3300035170 | Ga0373943_0000433 | Ga0373943_0000433_16170_17318 | 330 |
| 67 | 3300035171 | Ga0373946_0007641 | Ga0373946_0007641_441_1589 | 330 |
| 68 | 3300035207 | Ga0373942_0028635 | Ga0373942_0028635_89_1237 | 330 |
| 69 | 3300035241 | Ga0373961_0007699 | Ga0373961_0007699_1280_2428 | 330 |
| 70 | 3300035410 | Ga0373924_0004310 | Ga0373924_0004310_1463_2611 | 330 |
| 71 | 3300035695 | Ga0373927_0065892 | Ga0373927_0065892_10_1158 | 330 |
| 72 | 3300035724 | Ga0373933_0229000 | Ga0373933_0229000_14_1162 | 330 |
| 73 | 3300036401 | Ga0373937_0289444 | Ga0373937_0289444_59_1207 | 330 |
| 74 | 3300046454 | Ga0495592_0003761 | Ga0495592_0003761_6072_7220 | 330 |
| 75 | 3300046462 | Ga0495651_0005285 | Ga0495651_0005285_1662_2810 | 330 |
| 76 | 3300046462 | Ga0495651_0011356 | Ga0495651_0011356_3307_4455 | 330 |
| 77 | 3300046463 | Ga0495653_0073109 | Ga0495653_0073109_1010_2158 | 330 |
| 78 | 3300046463 | Ga0495653_0104079 | Ga0495653_0104079_59_1207 | 330 |
| 79 | 3300046472 | Ga0495580_0005682 | Ga0495580_0005682_2379_3527 | 330 |
| 80 | 3300046473 | Ga0495582_0009339 | Ga0495582_0009339_252_1400 | 330 |
| 81 | 3300046475 | Ga0495639_0002234 | Ga0495639_0002234_2793_3941 | 330 |
| 82 | 3300046476 | Ga0495662_0005674 | Ga0495662_0005674_2491_3639 | 330 |
| 83 | 3300046499 | Ga0495594_0008847 | Ga0495594_0008847_3076_4224 | 330 |
| 84 | 3300046516 | Ga0495628_0029558 | Ga0495628_0029558_1322_2470 | 330 |
| 85 | 3300046517 | Ga0495630_0001894 | Ga0495630_0001894_7765_8913 | 330 |
| 86 | 3300046526 | Ga0495666_0024816 | Ga0495666_0024816_93_1241 | 330 |
| 87 | 3300046529 | Ga0495652_0039120 | Ga0495652_0039120_592_1740 | 330 |
| 88 | 3300046531 | Ga0495665_0001352 | Ga0495665_0001352_9581_10729 | 330 |
| 89 | 3300046533 | Ga0495640_0014615 | Ga0495640_0014615_2125_3273 | 330 |
| 90 | 3300046535 | Ga0495586_0086626 | Ga0495586_0086626_59_1207 | 330 |
| 91 | 3300046536 | Ga0495587_0013279 | Ga0495587_0013279_1941_3089 | 330 |
| 92 | 3300046536 | Ga0495587_0055200 | Ga0495587_0055200_1157_2305 | 330 |
| 93 | 3300046543 | Ga0495645_0120160 | Ga0495645_0120160_59_1207 | 330 |
| 94 | 3300046559 | Ga0495667_0039390 | Ga0495667_0039390_33_1181 | 330 |
| 95 | 3300046559 | Ga0495667_0102519 | Ga0495667_0102519_644_1792 | 330 |
| 96 | 3300046559 | Ga0495667_0114283 | Ga0495667_0114283_483_1631 | 330 |
| 97 | 3300046642 | Ga0495634_0065783 | Ga0495634_0065783_845_1993 | 330 |
| 98 | 3300046663 | Ga0495635_0026174 | Ga0495635_0026174_1883_3031 | 330 |
| 99 | 3300046675 | Ga0495657_0032809 | Ga0495657_0032809_1972_3120 | 330 |
| 100 | 3300046675 | Ga0495657_0079194 | Ga0495657_0079194_126_1274 | 330 |
| 101 | 3300046678 | Ga0495599_0065362 | Ga0495599_0065362_844_1992 | 330 |
| 102 | 3300046679 | Ga0495623_0015065 | Ga0495623_0015065_3728_4876 | 330 |
| 103 | 3300046683 | Ga0495658_0011380 | Ga0495658_0011380_140_1288 | 330 |
| 104 | 3300046689 | Ga0495613_0012310 | Ga0495613_0012310_714_1862 | 330 |
| 105 | 3300046690 | Ga0495624_0007418 | Ga0495624_0007418_4055_5203 | 330 |
| 106 | 3300046809 | Ga0495600_0025737 | Ga0495600_0025737_2125_3273 | 330 |
| 107 | 3300047315 | Ga0495581_0000844 | Ga0495581_0000844_14514_15662 | 330 |
| 108 | 3300047321 | Ga0495676_0027812 | Ga0495676_0027812_361_1509 | 330 |
| 109 | 3300047322 | Ga0495680_0003673 | Ga0495680_0003673_12789_13937 | 330 |
| 110 | 3300047322 | Ga0495680_0032607 | Ga0495680_0032607_815_1963 | 330 |
| 111 | 3300047471 | Ga0495684_0001955 | Ga0495684_0001955_2533_3681 | 330 |
| 112 | 3300047471 | Ga0495684_0087413 | Ga0495684_0087413_207_1355 | 330 |
| 113 | 3300047673 | Ga0495593_0000862 | Ga0495593_0000862_5662_6810 | 330 |
| 114 | 3300048088 | Ga0495602_0019576 | Ga0495602_0019576_3980_5128 | 330 |
| 115 | 3300048089 | Ga0495614_0002807 | Ga0495614_0002807_3480_4628 | 330 |
| 116 | 3300048905 | Ga0496102_0096331 | Ga0496102_0096331_706_1854 | 330 |
| 117 | 3300048909 | Ga0496106_0097744 | Ga0496106_0097744_502_1650 | 330 |
| 118 | 3300048910 | Ga0496107_0040353 | Ga0496107_0040353_2098_3246 | 330 |
| 119 | 3300048912 | Ga0496109_0085370 | Ga0496109_0085370_1197_2345 | 330 |
| 120 | 3300048913 | Ga0496110_0040580 | Ga0496110_0040580_2196_3344 | 330 |
| 121 | 3300048914 | Ga0496111_0022063 | Ga0496111_0022063_303_1451 | 330 |
| 122 | 3300050514 | nmdc:mga08x19_71015_c1 | nmdc:mga08x19_71015_c1_528_1676 | 330 |
| 123 | 3300053077 | Ga0495601_0011038 | Ga0495601_0011038_2276_3424 | 330 |
| 124 | 3300053084 | Ga0495595_0012296 | Ga0495595_0012296_2318_3466 | 330 |
| 125 | 3300053085 | Ga0495619_0002180 | Ga0495619_0002180_2561_3709 | 330 |
| 126 | 3300044694 | Ga0466963_0138807 | Ga0466963_0138807_471_1625 | 331 |
| 127 | 3300045836 | Ga0466958_0067962 | Ga0466958_0067962_581_1735 | 331 |
| 128 | 3300003659 | JGI25404J52841_10009330 | JGI25404J52841_100093302 | 332 |
| 129 | 3300005436 | Ga0070713_100155913 | Ga0070713_1001559132 | 332 |
| 130 | 3300005445 | Ga0070708_100102844 | Ga0070708_1001028443 | 332 |
| 131 | 3300005983 | Ga0081540_1000251 | Ga0081540_10002518 | 332 |
| 132 | 3300025906 | Ga0207699_10003262 | Ga0207699_100032622 | 332 |
| 133 | 3300049568 | Ga0501031_0095617 | Ga0501031_0095617_520_1587 | 333 |
| 134 | 3300025929 | Ga0207664_10306092 | Ga0207664_103060921 | 336 |
| 135 | 3300031456 | Ga0307513_10013188 | Ga0307513_100131884 | 336 |
| 136 | 3300031456 | Ga0307513_10046377 | Ga0307513_100463773 | 336 |
| 137 | 3300046663 | Ga0495635_0211567 | Ga0495635_0211567_131_1282 | 336 |
| 138 | 3300047318 | Ga0495636_0075127 | Ga0495636_0075127_146_1279 | 336 |
| 139 | 3300033179 | Ga0307507_10050890 | Ga0307507_100508903 | 337 |
| 140 | 3300046459 | Ga0495629_0068708 | Ga0495629_0068708_124_1278 | 338 |
| 141 | 3300049581 | Ga0501047_0019106 | Ga0501047_0019106_3469_4626 | 338 |
| 142 | 3300049823 | Ga0501044_0118396 | Ga0501044_0118396_1270_2427 | 338 |
| 143 | 3300048904 | Ga0496101_0148113 | Ga0496101_0148113_511_1668 | 339 |
| 144 | 3300003792 | Ga0055540_1000060 | Ga0055540_1000060113 | 340 |
| 145 | 3300005327 | Ga0070658_10005788 | Ga0070658_100057887 | 340 |
| 146 | 3300005336 | Ga0070680_100225827 | Ga0070680_1002258271 | 340 |
| 147 | 3300005339 | Ga0070660_100059112 | Ga0070660_1000591123 | 340 |
| 148 | 3300005344 | Ga0070661_100022430 | Ga0070661_1000224302 | 340 |
| 149 | 3300005548 | Ga0070665_100130765 | Ga0070665_1001307651 | 340 |
| 150 | 3300005841 | Ga0068863_100142424 | Ga0068863_1001424242 | 340 |
| 151 | 3300006846 | Ga0075430_100014467 | Ga0075430_1000144678 | 340 |
| 152 | 3300010375 | Ga0105239_10387897 | Ga0105239_103878972 | 340 |
| 153 | 3300011119 | Ga0105246_10022684 | Ga0105246_100226845 | 340 |
| 154 | 3300013105 | Ga0157369_10098639 | Ga0157369_100986392 | 340 |
| 155 | 3300020082 | Ga0206353_10485089 | Ga0206353_104850893 | 340 |
| 156 | 3300021388 | Ga0213875_10025198 | Ga0213875_100251983 | 340 |
| 157 | 3300025303 | Ga0209051_1000149 | Ga0209051_100014926 | 340 |
| 158 | 3300025909 | Ga0207705_10164411 | Ga0207705_101644111 | 340 |
| 159 | 3300025941 | Ga0207711_10276961 | Ga0207711_102769611 | 340 |
| 160 | 3300025944 | Ga0207661_10008204 | Ga0207661_100082043 | 340 |
| 161 | 3300026088 | Ga0207641_10181629 | Ga0207641_101816292 | 340 |
| 162 | 3300026095 | Ga0207676_10289779 | Ga0207676_102897791 | 340 |
| 163 | 3300026116 | Ga0207674_10175584 | Ga0207674_101755842 | 340 |
| 164 | 3300028379 | Ga0268266_10055947 | Ga0268266_100559471 | 340 |
| 165 | 3300035086 | Ga0373934_0014619 | Ga0373934_0014619_495_1643 | 340 |
| 166 | 3300037853 | Ga0436364_1206830 | Ga0436364_1206830_1236_2384 | 340 |
| 167 | 3300039437 | Ga0436365_0346317 | Ga0436365_0346317_343_1491 | 340 |
| 168 | 3300046463 | Ga0495653_0004341 | Ga0495653_0004341_4394_5551 | 340 |
| 169 | 3300046473 | Ga0495582_0049238 | Ga0495582_0049238_1037_2194 | 340 |
| 170 | 3300046514 | Ga0495618_0030747 | Ga0495618_0030747_1024_2181 | 340 |
| 171 | 3300046516 | Ga0495628_0006638 | Ga0495628_0006638_2766_3923 | 340 |
| 172 | 3300046557 | Ga0495622_0027746 | Ga0495622_0027746_747_1904 | 340 |
| 173 | 3300046559 | Ga0495667_0057369 | Ga0495667_0057369_815_1972 | 340 |
| 174 | 3300046642 | Ga0495634_0102555 | Ga0495634_0102555_405_1562 | 340 |
| 175 | 3300046675 | Ga0495657_0062497 | Ga0495657_0062497_606_1763 | 340 |
| 176 | 3300046683 | Ga0495658_0024875 | Ga0495658_0024875_280_1437 | 340 |
| 177 | 3300048908 | Ga0496105_0074525 | Ga0496105_0074525_1422_2579 | 340 |
| 178 | 3300048917 | Ga0496114_0063435 | Ga0496114_0063435_739_1905 | 340 |
| 179 | 3300050509 | nmdc:mga0qj67_26683_c1 | nmdc:mga0qj67_26683_c1_331_1512 | 340 |
| 180 | 3300035170 | Ga0373943_0106056 | Ga0373943_0106056_270_1418 | 341 |
| 181 | 3300037068 | Ga0373925_0228546 | Ga0373925_0228546_183_1331 | 341 |
| 182 | 3300041413 | Ga0439465_0008224 | Ga0439465_0008224_1625_2782 | 341 |
| 183 | 3300044765 | Ga0466970_0101908 | Ga0466970_0101908_55_1224 | 341 |
| 184 | 3300044842 | Ga0466957_0029857 | Ga0466957_0029857_107_1345 | 341 |
| 185 | 3300045049 | Ga0466959_0066847 | Ga0466959_0066847_1335_2573 | 341 |
| 186 | 3300045836 | Ga0466958_0028932 | Ga0466958_0028932_33_1271 | 341 |
| 187 | 3300046543 | Ga0495645_0134109 | Ga0495645_0134109_17_1093 | 341 |
| 188 | 3300005329 | Ga0070683_100011058 | Ga0070683_1000110583 | 342 |
| 189 | 3300009545 | Ga0105237_10001712 | Ga0105237_1000171223 | 342 |
| 190 | 3300009545 | Ga0105237_10142149 | Ga0105237_101421492 | 342 |
| 191 | 3300010375 | Ga0105239_10127640 | Ga0105239_101276403 | 342 |
| 192 | 3300025914 | Ga0207671_10018178 | Ga0207671_100181781 | 342 |
| 193 | 3300025914 | Ga0207671_10072609 | Ga0207671_100726092 | 342 |
| 194 | 3300025944 | Ga0207661_10001544 | Ga0207661_100015442 | 342 |
| 195 | 3300031456 | Ga0307513_10001629 | Ga0307513_1000162917 | 342 |
| 196 | 3300037853 | Ga0436364_1563654 | Ga0436364_1563654_1628_2806 | 342 |
| 197 | 3300049586 | Ga0501070_0140698 | Ga0501070_0140698_724_1887 | 342 |
| 198 | 3300021388 | Ga0213875_10026873 | Ga0213875_100268731 | 343 |
| 199 | 3300037418 | Ga0395900_0008528 | Ga0395900_0008528_8148_9314 | 343 |
| 200 | 3300037853 | Ga0436364_0141518 | Ga0436364_0141518_3061_4227 | 343 |
| 201 | 3300044693 | Ga0466961_0107490 | Ga0466961_0107490_167_1330 | 343 |
| 202 | 3300044719 | Ga0466971_0084465 | Ga0466971_0084465_122_1285 | 343 |
| 203 | 3300044765 | Ga0466970_0014063 | Ga0466970_0014063_1665_2828 | 343 |
| 204 | 3300046514 | Ga0495618_0200496 | Ga0495618_0200496_54_1211 | 343 |
| 205 | 3300046517 | Ga0495630_0032403 | Ga0495630_0032403_153_1310 | 343 |
| 206 | 3300046533 | Ga0495640_0015422 | Ga0495640_0015422_2508_3665 | 343 |
| 207 | 3300046535 | Ga0495586_0015987 | Ga0495586_0015987_656_1813 | 343 |
| 208 | 3300046559 | Ga0495667_0118811 | Ga0495667_0118811_399_1556 | 343 |
| 209 | 3300047317 | Ga0495604_0030089 | Ga0495604_0030089_3146_4303 | 343 |
| 210 | 3300047319 | Ga0495674_0166701 | Ga0495674_0166701_350_1507 | 343 |
| 211 | 3300053084 | Ga0495595_0012347 | Ga0495595_0012347_1267_2424 | 343 |
| 212 | 3300053085 | Ga0495619_0008175 | Ga0495619_0008175_4018_5175 | 343 |
| 213 | 3300005445 | Ga0070708_100116712 | Ga0070708_1001167122 | 344 |
| 214 | 3300006048 | Ga0075363_100112970 | Ga0075363_1001129702 | 344 |
| 215 | 3300006177 | Ga0075362_10085424 | Ga0075362_100854242 | 344 |
| 216 | 3300032004 | Ga0307414_10182368 | Ga0307414_101823682 | 344 |
| 217 | 3300037466 | Ga0395898_0136157 | Ga0395898_0136157_82_1251 | 344 |
| 218 | 3300041494 | Ga0451837_1855256 | Ga0451837_1855256_50_1216 | 344 |
| 219 | 3300042435 | Ga0439434_0016740 | Ga0439434_0016740_496_1662 | 344 |
| 220 | 3300044683 | Ga0466965_0014556 | Ga0466965_0014556_28_1197 | 344 |
| 221 | 3300044901 | Ga0466960_0017687 | Ga0466960_0017687_211_1383 | 344 |
| 222 | 3300045976 | Ga0466967_0048632 | Ga0466967_0048632_1563_2735 | 344 |
| 223 | 3300045976 | Ga0466967_0204268 | Ga0466967_0204268_330_1499 | 344 |
| 224 | 3300049570 | Ga0501033_0001361 | Ga0501033_0001361_824_1984 | 344 |
| 225 | 3300049581 | Ga0501047_0193336 | Ga0501047_0193336_144_1304 | 344 |
| 226 | 3300049581 | Ga0501047_0244542 | Ga0501047_0244542_56_1210 | 344 |
| 227 | 3300049823 | Ga0501044_0035691 | Ga0501044_0035691_811_1971 | 344 |
| 228 | 3300050489 | nmdc:mga03683_62862_c1 | nmdc:mga03683_62862_c1_115_1281 | 344 |
| 229 | 3300003578 | Ga0006562J51391_1116078 | Ga0006562J51391_11160789 | 345 |
| 230 | 3300003578 | Ga0006562J51391_1116083 | Ga0006562J51391_11160833 | 345 |
| 231 | 3300005441 | Ga0070700_100000033 | Ga0070700_100000033118 | 345 |
| 232 | 3300005471 | Ga0070698_100001963 | Ga0070698_10000196312 | 345 |
| 233 | 3300006038 | Ga0075365_10062234 | Ga0075365_100622342 | 345 |
| 234 | 3300006847 | Ga0075431_100082966 | Ga0075431_1000829662 | 345 |
| 235 | 3300006880 | Ga0075429_100062205 | Ga0075429_1000622052 | 345 |
| 236 | 3300009147 | Ga0114129_10343298 | Ga0114129_103432982 | 345 |
| 237 | 3300026075 | Ga0207708_10000004 | Ga0207708_10000004111 | 345 |
| 238 | 3300044765 | Ga0466970_0054439 | Ga0466970_0054439_644_1810 | 345 |
| 239 | 3300046499 | Ga0495594_0056745 | Ga0495594_0056745_140_1300 | 345 |
| 240 | 3300048908 | Ga0496105_0220998 | Ga0496105_0220998_63_1220 | 345 |
| 241 | 3300048917 | Ga0496114_0125698 | Ga0496114_0125698_1035_2192 | 345 |
| 242 | 3300049581 | Ga0501047_0000354 | Ga0501047_0000354_16873_18027 | 345 |
| 243 | 3300050508 | nmdc:mga09592_232602_c1 | nmdc:mga09592_232602_c1_24_1181 | 345 |
| 244 | 3300053094 | Ga0500566_0000593 | Ga0500566_0000593_13524_14699 | 345 |
| 245 | 3300005983 | Ga0081540_1004108 | Ga0081540_10041083 | 346 |
| 246 | 3300006844 | Ga0075428_100052109 | Ga0075428_1000521092 | 346 |
| 247 | 3300009177 | Ga0105248_10525356 | Ga0105248_105253561 | 346 |
| 248 | 3300013308 | Ga0157375_10306763 | Ga0157375_103067632 | 346 |
| 249 | 3300037418 | Ga0395900_0013835 | Ga0395900_0013835_4125_5294 | 346 |
| 250 | 3300044683 | Ga0466965_0043620 | Ga0466965_0043620_416_1585 | 346 |
| 251 | 3300044694 | Ga0466963_0032883 | Ga0466963_0032883_753_1907 | 346 |
| 252 | 3300044719 | Ga0466971_0021415 | Ga0466971_0021415_1547_2701 | 346 |
| 253 | 3300045976 | Ga0466967_0062368 | Ga0466967_0062368_1275_2429 | 346 |
| 254 | 3300049571 | Ga0501034_0026995 | Ga0501034_0026995_82_1254 | 346 |
| 255 | 3300049572 | Ga0501036_0084244 | Ga0501036_0084244_1206_2378 | 346 |
| 256 | 3300005327 | Ga0070658_10114254 | Ga0070658_101142542 | 347 |
| 257 | 3300005339 | Ga0070660_100243378 | Ga0070660_1002433782 | 347 |
| 258 | 3300005354 | Ga0070675_100190681 | Ga0070675_1001906811 | 347 |
| 259 | 3300005364 | Ga0070673_100304409 | Ga0070673_1003044091 | 347 |
| 260 | 3300005366 | Ga0070659_100178516 | Ga0070659_1001785162 | 347 |
| 261 | 3300005543 | Ga0070672_100151294 | Ga0070672_1001512942 | 347 |
| 262 | 3300006844 | Ga0075428_100002078 | Ga0075428_10000207814 | 347 |
| 263 | 3300006844 | Ga0075428_100085800 | Ga0075428_1000858002 | 347 |
| 264 | 3300006846 | Ga0075430_100037166 | Ga0075430_1000371662 | 347 |
| 265 | 3300006847 | Ga0075431_100101797 | Ga0075431_1001017973 | 347 |
| 266 | 3300006880 | Ga0075429_100090988 | Ga0075429_1000909882 | 347 |
| 267 | 3300009147 | Ga0114129_10000184 | Ga0114129_1000018416 | 347 |
| 268 | 3300009147 | Ga0114129_10140886 | Ga0114129_101408864 | 347 |
| 269 | 3300009551 | Ga0105238_10181196 | Ga0105238_101811962 | 347 |
| 270 | 3300025937 | Ga0207669_10145992 | Ga0207669_101459922 | 347 |
| 271 | 3300025940 | Ga0207691_10225211 | Ga0207691_102252112 | 347 |
| 272 | 3300025960 | Ga0207651_10255558 | Ga0207651_102555581 | 347 |
| 273 | 3300037418 | Ga0395900_0106822 | Ga0395900_0106822_1671_2837 | 347 |
| 274 | 3300038443 | Ga0395901_0096903 | Ga0395901_0096903_234_1400 | 347 |
| 275 | 3300045976 | Ga0466967_0052996 | Ga0466967_0052996_1487_2653 | 347 |
| 276 | 3300046507 | Ga0495606_0016107 | Ga0495606_0016107_2490_3650 | 347 |
| 277 | 3300050508 | nmdc:mga09592_177_c1 | nmdc:mga09592_177_c1_38713_39885 | 347 |
| 278 | 3300050509 | nmdc:mga0qj67_36_c3 | nmdc:mga0qj67_36_c3_31612_32784 | 347 |
| 279 | 3300050510 | nmdc:mga06r32_9191_c1 | nmdc:mga06r32_9191_c1_7601_8773 | 347 |
| 280 | 3300053136 | Ga0500559_0003009 | Ga0500559_0003009_1521_2714 | 347 |
| 281 | 3300059492 | Ga0587073_0000923 | Ga0587073_0000923_176_1333 | 347 |
| 282 | 3300059504 | Ga0587082_007356 | Ga0587082_007356_122_1279 | 347 |
| 283 | 3300059508 | Ga0587088_000572 | Ga0587088_000572_1785_2942 | 347 |
| 284 | 3300059511 | Ga0587091_002082 | Ga0587091_002082_932_2089 | 347 |
| 285 | 3300059625 | Ga0587113_000431 | Ga0587113_000431_34_1188 | 347 |
| 286 | 3300059640 | Ga0587067_000648 | Ga0587067_000648_1945_3102 | 347 |
| 287 | 3300059643 | Ga0587072_010902 | Ga0587072_010902_111_1268 | 347 |
| 288 | 3300059647 | Ga0587079_008019 | Ga0587079_008019_220_1377 | 347 |
| 289 | 3300060344 | Ga0587071_012313 | Ga0587071_012313_98_1255 | 347 |
| 290 | 3300005618 | Ga0068864_100021017 | Ga0068864_1000210173 | 348 |
| 291 | 3300006844 | Ga0075428_100009631 | Ga0075428_1000096316 | 348 |
| 292 | 3300006846 | Ga0075430_100010653 | Ga0075430_1000106532 | 348 |
| 293 | 3300009147 | Ga0114129_10083453 | Ga0114129_100834533 | 348 |
| 294 | 3300025945 | Ga0207679_10096164 | Ga0207679_100961642 | 348 |
| 295 | 3300026095 | Ga0207676_10092276 | Ga0207676_100922761 | 348 |
| 296 | 3300050508 | nmdc:mga09592_12762_c1 | nmdc:mga09592_12762_c1_1548_2708 | 348 |
| 297 | 3300005467 | Ga0070706_100048489 | Ga0070706_1000484895 | 349 |
| 298 | 3300014497 | Ga0182008_10044341 | Ga0182008_100443412 | 349 |
| 299 | 3300025910 | Ga0207684_10037530 | Ga0207684_100375305 | 349 |
| 300 | 3300032002 | Ga0307416_100112187 | Ga0307416_1001121872 | 349 |
| 301 | 3300032126 | Ga0307415_100027877 | Ga0307415_1000278773 | 349 |
| 302 | 3300037418 | Ga0395900_0041531 | Ga0395900_0041531_570_1739 | 349 |
| 303 | 3300037466 | Ga0395898_0006827 | Ga0395898_0006827_8322_9491 | 349 |
| 304 | 3300037471 | Ga0395905_0017993 | Ga0395905_0017993_3054_4223 | 349 |
| 305 | 3300038443 | Ga0395901_0081432 | Ga0395901_0081432_1656_2825 | 349 |
| 306 | 3300037418 | Ga0395900_0074250 | Ga0395900_0074250_755_1939 | 350 |
| 307 | 3300037466 | Ga0395898_0125014 | Ga0395898_0125014_1035_2219 | 350 |
| 308 | 3300038443 | Ga0395901_0031390 | Ga0395901_0031390_2957_4141 | 350 |
| 309 | 3300041491 | Ga0451833_0347183 | Ga0451833_0347183_9842_11017 | 350 |
| 310 | 3300041494 | Ga0451837_0453617 | Ga0451837_0453617_3765_4940 | 350 |
| 311 | 3300041496 | Ga0451839_1348762 | Ga0451839_1348762_1271_2446 | 350 |
| 312 | 3300041498 | Ga0451841_0636182 | Ga0451841_0636182_49_1224 | 350 |
| 313 | 3300044693 | Ga0466961_0083796 | Ga0466961_0083796_138_1304 | 350 |
| 314 | 3300044694 | Ga0466963_0032600 | Ga0466963_0032600_1490_2650 | 350 |
| 315 | 3300045049 | Ga0466959_0059397 | Ga0466959_0059397_1158_2318 | 350 |
| 316 | 3300049571 | Ga0501034_0027076 | Ga0501034_0027076_2540_3700 | 350 |
| 317 | 3300049581 | Ga0501047_0117172 | Ga0501047_0117172_606_1766 | 350 |
| 318 | 3300049583 | Ga0501067_0007301 | Ga0501067_0007301_2222_3382 | 350 |
| 319 | 3300049583 | Ga0501067_0008669 | Ga0501067_0008669_3981_5147 | 350 |
| 320 | 3300049584 | Ga0501068_0009431 | Ga0501068_0009431_2207_3367 | 350 |
| 321 | 3300049584 | Ga0501068_0140266 | Ga0501068_0140266_112_1278 | 350 |
| 322 | 3300049586 | Ga0501070_0018520 | Ga0501070_0018520_2222_3382 | 350 |
| 323 | 3300049587 | Ga0501071_0035304 | Ga0501071_0035304_450_1610 | 350 |
| 324 | 3300049588 | Ga0501072_0016492 | Ga0501072_0016492_2363_3523 | 350 |
| 325 | 3300049589 | Ga0501073_0009470 | Ga0501073_0009470_2180_3340 | 350 |
| 326 | 3300049590 | Ga0501074_0017346 | Ga0501074_0017346_2529_3689 | 350 |
| 327 | 3300049592 | Ga0501076_0073402 | Ga0501076_0073402_923_2101 | 350 |
| 328 | 3300049593 | Ga0501077_0045303 | Ga0501077_0045303_465_1625 | 350 |
| 329 | 3300049742 | Ga0501080_0022611 | Ga0501080_0022611_2450_3610 | 350 |
| 330 | 3300049742 | Ga0501080_0022862 | Ga0501080_0022862_3721_4911 | 350 |
| 331 | 3300049744 | Ga0501083_0033908 | Ga0501083_0033908_2148_3308 | 350 |
| 332 | 3300054114 | Ga0501084_0020426 | Ga0501084_0020426_1113_2273 | 350 |
| 333 | 3300060353 | Ga0501082_0070952 | Ga0501082_0070952_1348_2508 | 350 |
| 334 | 3300061734 | Ga0530510_0132898 | Ga0530510_0132898_219_1385 | 350 |
| 335 | 3300049592 | Ga0501076_0295197 | Ga0501076_0295197_32_1207 | 351 |
| 336 | 3300053158 | Ga0500627_0019123 | Ga0500627_0019123_1236_2396 | 351 |
| 337 | 3300005329 | Ga0070683_100016218 | Ga0070683_1000162182 | 352 |
| 338 | 3300025944 | Ga0207661_10148400 | Ga0207661_101484002 | 352 |
| 339 | 3300031240 | Ga0265320_10076281 | Ga0265320_100762811 | 352 |
| 340 | 3300031251 | Ga0265327_10005854 | Ga0265327_100058544 | 352 |
| 341 | 3300047673 | Ga0495593_0096202 | Ga0495593_0096202_32_1138 | 352 |
| 342 | 3300049572 | Ga0501036_0119005 | Ga0501036_0119005_29_1195 | 352 |
| 343 | 3300049573 | Ga0501037_0216543 | Ga0501037_0216543_145_1311 | 352 |
| 344 | 3300049587 | Ga0501071_0043872 | Ga0501071_0043872_1783_2949 | 352 |
| 345 | 3300049588 | Ga0501072_0039107 | Ga0501072_0039107_1165_2331 | 352 |
| 346 | 3300049591 | Ga0501075_0280150 | Ga0501075_0280150_16_1182 | 352 |
| 347 | 3300049592 | Ga0501076_0052576 | Ga0501076_0052576_1137_2303 | 352 |
| 348 | 3300049593 | Ga0501077_0020720 | Ga0501077_0020720_1007_2173 | 352 |
| 349 | 3300005439 | Ga0070711_100049614 | Ga0070711_1000496142 | 353 |
| 350 | 3300005937 | Ga0081455_10000480 | Ga0081455_1000048062 | 353 |
| 351 | 3300005985 | Ga0081539_10015563 | Ga0081539_100155633 | 353 |
| 352 | 3300025929 | Ga0207664_10045694 | Ga0207664_100456941 | 353 |
| 353 | 3300035083 | Ga0373926_0000994 | Ga0373926_0000994_1150_2298 | 353 |
| 354 | 3300035089 | Ga0373944_0019099 | Ga0373944_0019099_99_1247 | 353 |
| 355 | 3300035113 | Ga0373936_0001598 | Ga0373936_0001598_5099_6247 | 353 |
| 356 | 3300035116 | Ga0373945_0000887 | Ga0373945_0000887_5172_6320 | 353 |
| 357 | 3300035170 | Ga0373943_0000668 | Ga0373943_0000668_472_1620 | 353 |
| 358 | 3300035171 | Ga0373946_0001834 | Ga0373946_0001834_5971_7119 | 353 |
| 359 | 3300035695 | Ga0373927_0000850 | Ga0373927_0000850_6467_7615 | 353 |
| 360 | 3300035725 | Ga0373947_0006092 | Ga0373947_0006092_2735_3883 | 353 |
| 361 | 3300036401 | Ga0373937_0296786 | Ga0373937_0296786_133_1281 | 353 |
| 362 | 3300037068 | Ga0373925_0149580 | Ga0373925_0149580_53_1201 | 353 |
| 363 | 3300039437 | Ga0436365_0556984 | Ga0436365_0556984_409_1557 | 353 |
| 364 | 3300044694 | Ga0466963_0131756 | Ga0466963_0131756_219_1367 | 353 |
| 365 | 3300046461 | Ga0495641_0007988 | Ga0495641_0007988_4738_5886 | 353 |
| 366 | 3300046463 | Ga0495653_0007576 | Ga0495653_0007576_6042_7190 | 353 |
| 367 | 3300046473 | Ga0495582_0163062 | Ga0495582_0163062_26_1174 | 353 |
| 368 | 3300046476 | Ga0495662_0047963 | Ga0495662_0047963_854_2002 | 353 |
| 369 | 3300046477 | Ga0495664_0020949 | Ga0495664_0020949_2217_3365 | 353 |
| 370 | 3300046517 | Ga0495630_0016231 | Ga0495630_0016231_4044_5192 | 353 |
| 371 | 3300046529 | Ga0495652_0044200 | Ga0495652_0044200_1872_3020 | 353 |
| 372 | 3300046531 | Ga0495665_0048891 | Ga0495665_0048891_698_1846 | 353 |
| 373 | 3300046533 | Ga0495640_0059033 | Ga0495640_0059033_759_1907 | 353 |
| 374 | 3300046543 | Ga0495645_0156060 | Ga0495645_0156060_265_1413 | 353 |
| 375 | 3300046559 | Ga0495667_0020524 | Ga0495667_0020524_2650_3798 | 353 |
| 376 | 3300046642 | Ga0495634_0005589 | Ga0495634_0005589_5813_6961 | 353 |
| 377 | 3300046663 | Ga0495635_0034337 | Ga0495635_0034337_1894_3042 | 353 |
| 378 | 3300046690 | Ga0495624_0024215 | Ga0495624_0024215_2764_3912 | 353 |
| 379 | 3300047319 | Ga0495674_0103594 | Ga0495674_0103594_640_1788 | 353 |
| 380 | 3300047321 | Ga0495676_0054455 | Ga0495676_0054455_1971_3119 | 353 |
| 381 | 3300047322 | Ga0495680_0013023 | Ga0495680_0013023_38_1186 | 353 |
| 382 | 3300047471 | Ga0495684_0003123 | Ga0495684_0003123_5644_6792 | 353 |
| 383 | 3300047673 | Ga0495593_0057885 | Ga0495593_0057885_165_1313 | 353 |
| 384 | 3300048907 | Ga0496104_0031076 | Ga0496104_0031076_3109_4266 | 353 |
| 385 | 3300048908 | Ga0496105_0060507 | Ga0496105_0060507_1558_2715 | 353 |
| 386 | 3300048911 | Ga0496108_0108639 | Ga0496108_0108639_825_1973 | 353 |
| 387 | 3300005434 | Ga0070709_10025009 | Ga0070709_100250093 | 354 |
| 388 | 3300005535 | Ga0070684_100246365 | Ga0070684_1002463652 | 354 |
| 389 | 3300021388 | Ga0213875_10014440 | Ga0213875_100144401 | 354 |
| 390 | 3300025302 | Ga0207426_1005887 | Ga0207426_10058873 | 354 |
| 391 | 3300025906 | Ga0207699_10186244 | Ga0207699_101862442 | 354 |
| 392 | 3300025915 | Ga0207693_10061517 | Ga0207693_100615172 | 354 |
| 393 | 3300025916 | Ga0207663_10069316 | Ga0207663_100693163 | 354 |
| 394 | 3300026078 | Ga0207702_10122071 | Ga0207702_101220711 | 354 |
| 395 | 3300035724 | Ga0373933_0047490 | Ga0373933_0047490_115_1272 | 354 |
| 396 | 3300036401 | Ga0373937_0037668 | Ga0373937_0037668_1470_2627 | 354 |
| 397 | 3300046462 | Ga0495651_0004043 | Ga0495651_0004043_2112_3269 | 354 |
| 398 | 3300046463 | Ga0495653_0033959 | Ga0495653_0033959_1091_2248 | 354 |
| 399 | 3300046477 | Ga0495664_0002240 | Ga0495664_0002240_1661_2818 | 354 |
| 400 | 3300046529 | Ga0495652_0020277 | Ga0495652_0020277_3182_4339 | 354 |
| 401 | 3300046543 | Ga0495645_0045633 | Ga0495645_0045633_1059_2216 | 354 |
| 402 | 3300046663 | Ga0495635_0014535 | Ga0495635_0014535_2759_3916 | 354 |
| 403 | 3300046675 | Ga0495657_0027454 | Ga0495657_0027454_1884_3041 | 354 |
| 404 | 3300047317 | Ga0495604_0112127 | Ga0495604_0112127_223_1380 | 354 |
| 405 | 3300047319 | Ga0495674_0051826 | Ga0495674_0051826_1790_2947 | 354 |
| 406 | 3300047322 | Ga0495680_0033747 | Ga0495680_0033747_2098_3255 | 354 |
| 407 | 3300047444 | Ga0495675_0033598 | Ga0495675_0033598_736_1893 | 354 |
| 408 | 3300047471 | Ga0495684_0009313 | Ga0495684_0009313_5377_6534 | 354 |
| 409 | 3300048088 | Ga0495602_0036862 | Ga0495602_0036862_1819_2976 | 354 |
| 410 | 3300053084 | Ga0495595_0011202 | Ga0495595_0011202_647_1804 | 354 |
| 411 | 3300006846 | Ga0075430_100000279 | Ga0075430_10000027911 | 355 |
| 412 | 3300035086 | Ga0373934_0014480 | Ga0373934_0014480_156_1313 | 355 |
| 413 | 3300035120 | Ga0373957_0004970 | Ga0373957_0004970_1393_2541 | 355 |
| 414 | 3300035172 | Ga0373955_0039034 | Ga0373955_0039034_524_1681 | 355 |
| 415 | 3300036401 | Ga0373937_0413086 | Ga0373937_0413086_34_1191 | 355 |
| 416 | 3300046463 | Ga0495653_0190790 | Ga0495653_0190790_203_1360 | 355 |
| 417 | 3300046511 | Ga0495608_0017004 | Ga0495608_0017004_1055_2212 | 355 |
| 418 | 3300046663 | Ga0495635_0023234 | Ga0495635_0023234_3140_4297 | 355 |
| 419 | 3300046675 | Ga0495657_0109277 | Ga0495657_0109277_67_1224 | 355 |
| 420 | 3300046679 | Ga0495623_0036803 | Ga0495623_0036803_1602_2759 | 355 |
| 421 | 3300046683 | Ga0495658_0165922 | Ga0495658_0165922_136_1284 | 355 |
| 422 | 3300047322 | Ga0495680_0092880 | Ga0495680_0092880_1035_2192 | 355 |
| 423 | 3300047471 | Ga0495684_0013396 | Ga0495684_0013396_21_1178 | 355 |
| 424 | 3300050491 | nmdc:mga00v17_26489_c1 | nmdc:mga00v17_26489_c1_2076_3233 | 355 |
| 425 | 3300050509 | nmdc:mga0qj67_1247_c1 | nmdc:mga0qj67_1247_c1_11751_12911 | 355 |
| 426 | 3300005331 | Ga0070670_100094393 | Ga0070670_1000943932 | 356 |
| 427 | 3300005337 | Ga0070682_100068936 | Ga0070682_1000689362 | 356 |
| 428 | 3300005347 | Ga0070668_100094399 | Ga0070668_1000943992 | 356 |
| 429 | 3300005455 | Ga0070663_100009372 | Ga0070663_1000093725 | 356 |
| 430 | 3300005471 | Ga0070698_100000387 | Ga0070698_10000038731 | 356 |
| 431 | 3300005544 | Ga0070686_100026870 | Ga0070686_1000268702 | 356 |
| 432 | 3300005841 | Ga0068863_100076234 | Ga0068863_1000762342 | 356 |
| 433 | 3300005844 | Ga0068862_100142200 | Ga0068862_1001422002 | 356 |
| 434 | 3300006038 | Ga0075365_10097606 | Ga0075365_100976062 | 356 |
| 435 | 3300006051 | Ga0075364_10000270 | Ga0075364_100002705 | 356 |
| 436 | 3300006186 | Ga0075369_10041175 | Ga0075369_100411752 | 356 |
| 437 | 3300006353 | Ga0075370_10043626 | Ga0075370_100436262 | 356 |
| 438 | 3300009177 | Ga0105248_10077006 | Ga0105248_100770062 | 356 |
| 439 | 3300009545 | Ga0105237_10003886 | Ga0105237_1000388610 | 356 |
| 440 | 3300010375 | Ga0105239_10117212 | Ga0105239_101172122 | 356 |
| 441 | 3300014968 | Ga0157379_10135958 | Ga0157379_101359582 | 356 |
| 442 | 3300025914 | Ga0207671_10004746 | Ga0207671_100047466 | 356 |
| 443 | 3300025925 | Ga0207650_10036629 | Ga0207650_100366292 | 356 |
| 444 | 3300025986 | Ga0207658_10027583 | Ga0207658_100275832 | 356 |
| 445 | 3300028379 | Ga0268266_10004062 | Ga0268266_100040626 | 356 |
| 446 | 3300035086 | Ga0373934_0000021 | Ga0373934_0000021_39802_40956 | 356 |
| 447 | 3300035117 | Ga0373953_0000208 | Ga0373953_0000208_10694_11848 | 356 |
| 448 | 3300035118 | Ga0373954_0003993 | Ga0373954_0003993_1585_2739 | 356 |
| 449 | 3300035119 | Ga0373956_0001684 | Ga0373956_0001684_6609_7763 | 356 |
| 450 | 3300035120 | Ga0373957_0000240 | Ga0373957_0000240_8061_9215 | 356 |
| 451 | 3300035172 | Ga0373955_0000092 | Ga0373955_0000092_22612_23766 | 356 |
| 452 | 3300035410 | Ga0373924_0001270 | Ga0373924_0001270_2900_4054 | 356 |
| 453 | 3300035724 | Ga0373933_0000366 | Ga0373933_0000366_1444_2598 | 356 |
| 454 | 3300036401 | Ga0373937_0000169 | Ga0373937_0000169_22612_23766 | 356 |
| 455 | 3300046454 | Ga0495592_0000070 | Ga0495592_0000070_39830_40984 | 356 |
| 456 | 3300046462 | Ga0495651_0000042 | Ga0495651_0000042_52272_53426 | 356 |
| 457 | 3300046463 | Ga0495653_0004255 | Ga0495653_0004255_3591_4745 | 356 |
| 458 | 3300046471 | Ga0495650_0009549 | Ga0495650_0009549_3129_4286 | 356 |
| 459 | 3300046511 | Ga0495608_0000054 | Ga0495608_0000054_52272_53426 | 356 |
| 460 | 3300046516 | Ga0495628_0000106 | Ga0495628_0000106_49518_50672 | 356 |
| 461 | 3300046529 | Ga0495652_0000119 | Ga0495652_0000119_39815_40969 | 356 |
| 462 | 3300046529 | Ga0495652_0073854 | Ga0495652_0073854_1550_2710 | 356 |
| 463 | 3300046536 | Ga0495587_0000119 | Ga0495587_0000119_52272_53426 | 356 |
| 464 | 3300046543 | Ga0495645_0051614 | Ga0495645_0051614_1291_2445 | 356 |
| 465 | 3300046559 | Ga0495667_0000114 | Ga0495667_0000114_39830_40984 | 356 |
| 466 | 3300046675 | Ga0495657_0000067 | Ga0495657_0000067_52272_53426 | 356 |
| 467 | 3300046678 | Ga0495599_0000042 | Ga0495599_0000042_41487_42641 | 356 |
| 468 | 3300046679 | Ga0495623_0002839 | Ga0495623_0002839_6620_7774 | 356 |
| 469 | 3300046680 | Ga0495646_0008843 | Ga0495646_0008843_4841_5995 | 356 |
| 470 | 3300047317 | Ga0495604_0000121 | Ga0495604_0000121_39830_40984 | 356 |
| 471 | 3300047322 | Ga0495680_0000054 | Ga0495680_0000054_52261_53415 | 356 |
| 472 | 3300047444 | Ga0495675_0000176 | Ga0495675_0000176_45414_46568 | 356 |
| 473 | 3300048088 | Ga0495602_0000083 | Ga0495602_0000083_52272_53426 | 356 |
| 474 | 3300048904 | Ga0496101_0114612 | Ga0496101_0114612_193_1350 | 356 |
| 475 | 3300048905 | Ga0496102_0219377 | Ga0496102_0219377_531_1688 | 356 |
| 476 | 3300048908 | Ga0496105_0047247 | Ga0496105_0047247_2140_3297 | 356 |
| 477 | 3300048912 | Ga0496109_0196419 | Ga0496109_0196419_34_1191 | 356 |
| 478 | 3300048916 | Ga0496113_0103800 | Ga0496113_0103800_432_1589 | 356 |
| 479 | 3300048922 | Ga0496119_0015582 | Ga0496119_0015582_3395_4555 | 356 |
| 480 | 3300050492 | nmdc:mga0yw44_195209_c1 | nmdc:mga0yw44_195209_c1_148_1305 | 356 |
| 481 | 3300050494 | nmdc:mga06z11_76044_c1 | nmdc:mga06z11_76044_c1_353_1510 | 356 |
| 482 | 3300053077 | Ga0495601_0024892 | Ga0495601_0024892_994_2154 | 356 |
| 483 | 3300053078 | Ga0495612_0001711 | Ga0495612_0001711_6949_8109 | 356 |
| 484 | 3300053084 | Ga0495595_0000341 | Ga0495595_0000341_283_1437 | 356 |
| 485 | 3300053085 | Ga0495619_0069135 | Ga0495619_0069135_41_1195 | 356 |
| 486 | 3300053085 | Ga0495619_0149057 | Ga0495619_0149057_308_1468 | 356 |
| 487 | 3300005355 | Ga0070671_100000399 | Ga0070671_10000039914 | 357 |
| 488 | 3300005842 | Ga0068858_100008064 | Ga0068858_1000080642 | 357 |
| 489 | 3300006038 | Ga0075365_10139772 | Ga0075365_101397722 | 357 |
| 490 | 3300006048 | Ga0075363_100000236 | Ga0075363_1000002367 | 357 |
| 491 | 3300006051 | Ga0075364_10111026 | Ga0075364_101110262 | 357 |
| 492 | 3300006844 | Ga0075428_100032010 | Ga0075428_1000320104 | 357 |
| 493 | 3300006844 | Ga0075428_100270273 | Ga0075428_1002702732 | 357 |
| 494 | 3300006846 | Ga0075430_100088387 | Ga0075430_1000883872 | 357 |
| 495 | 3300021388 | Ga0213875_10032702 | Ga0213875_100327022 | 357 |
| 496 | 3300025931 | Ga0207644_10001153 | Ga0207644_1000115315 | 357 |
| 497 | 3300026035 | Ga0207703_10005581 | Ga0207703_100055819 | 357 |
| 498 | 3300037853 | Ga0436364_0070962 | Ga0436364_0070962_3728_4897 | 357 |
| 499 | 3300049583 | Ga0501067_0022825 | Ga0501067_0022825_1548_2708 | 357 |
| 500 | 3300049584 | Ga0501068_0017127 | Ga0501068_0017127_2058_3218 | 357 |
| 501 | 3300049585 | Ga0501069_0108393 | Ga0501069_0108393_272_1432 | 357 |
| 502 | 3300049586 | Ga0501070_0026400 | Ga0501070_0026400_45_1205 | 357 |
| 503 | 3300049588 | Ga0501072_0010591 | Ga0501072_0010591_122_1282 | 357 |
| 504 | 3300049589 | Ga0501073_0049014 | Ga0501073_0049014_1548_2708 | 357 |
| 505 | 3300049590 | Ga0501074_0089726 | Ga0501074_0089726_789_1949 | 357 |
| 506 | 3300049741 | Ga0501079_0038976 | Ga0501079_0038976_160_1320 | 357 |
| 507 | 3300049742 | Ga0501080_0027211 | Ga0501080_0027211_2136_3296 | 357 |
| 508 | 3300060353 | Ga0501082_0051265 | Ga0501082_0051265_747_1907 | 357 |
| 509 | 3300005327 | Ga0070658_10121263 | Ga0070658_101212632 | 358 |
| 510 | 3300005434 | Ga0070709_10002855 | Ga0070709_100028553 | 358 |
| 511 | 3300006028 | Ga0070717_10004480 | Ga0070717_100044807 | 358 |
| 512 | 3300006173 | Ga0070716_100004393 | Ga0070716_1000043934 | 358 |
| 513 | 3300015688 | Ga0183367_1005 | Ga0183367_1005239 | 358 |
| 514 | 3300025906 | Ga0207699_10005748 | Ga0207699_100057483 | 358 |
| 515 | 3300025909 | Ga0207705_10093491 | Ga0207705_100934912 | 358 |
| 516 | 3300025915 | Ga0207693_10000911 | Ga0207693_100009117 | 358 |
| 517 | 3300025916 | Ga0207663_10000286 | Ga0207663_100002864 | 358 |
| 518 | 3300025929 | Ga0207664_10004412 | Ga0207664_100044126 | 358 |
| 519 | 3300025939 | Ga0207665_10001704 | Ga0207665_1000170410 | 358 |
| 520 | 3300031251 | Ga0265327_10012472 | Ga0265327_100124722 | 358 |
| 521 | 3300044683 | Ga0466965_0022450 | Ga0466965_0022450_1621_2751 | 358 |
| 522 | 3300044693 | Ga0466961_0030609 | Ga0466961_0030609_2283_3413 | 358 |
| 523 | 3300046460 | Ga0495638_0002768 | Ga0495638_0002768_4955_6115 | 358 |
| 524 | 3300053104 | Ga0500556_0003518 | Ga0500556_0003518_243_1403 | 358 |
| 525 | 3300005439 | Ga0070711_100231411 | Ga0070711_1002314111 | 359 |
| 526 | 3300005445 | Ga0070708_100058155 | Ga0070708_1000581553 | 359 |
| 527 | 3300005445 | Ga0070708_100129663 | Ga0070708_1001296632 | 359 |
| 528 | 3300005467 | Ga0070706_100253873 | Ga0070706_1002538731 | 359 |
| 529 | 3300025303 | Ga0209051_1026594 | Ga0209051_10265942 | 359 |
| 530 | 3300025910 | Ga0207684_10264070 | Ga0207684_102640701 | 359 |
| 531 | 3300025929 | Ga0207664_10029351 | Ga0207664_100293512 | 359 |
| 532 | 3300028381 | Ga0268264_10245417 | Ga0268264_102454172 | 359 |
| 533 | 3300041512 | Ga0451853_2105047 | Ga0451853_2105047_1255_2388 | 359 |
| 534 | 3300042006 | Ga0439432_027315 | Ga0439432_027315_285_1454 | 359 |
| 535 | 3300048929 | Ga0496126_0096202 | Ga0496126_0096202_1414_2571 | 359 |
| 536 | 3300049581 | Ga0501047_0004122 | Ga0501047_0004122_7522_8676 | 359 |
| 537 | 3300049585 | Ga0501069_0093690 | Ga0501069_0093690_418_1572 | 359 |
| 538 | 3300049586 | Ga0501070_0009187 | Ga0501070_0009187_4084_5238 | 359 |
| 539 | 3300049822 | Ga0501035_0044728 | Ga0501035_0044728_668_1804 | 359 |
| 540 | iso_pu_bacteria | 2811994879 | 2812358103 | 359 |
| 541 | iso_pu_bacteria | 2852635781 | 2852636669 | 359 |
| 542 | iso_pu_bacteria | 2946064051 | 2946067740 | 359 |
| 543 | iso_pu_bacteria | 8056447290 | 8056451073 | 359 |
| 544 | 3300002075 | JGI24738J21930_10009989 | JGI24738J21930_100099892 | 360 |
| 545 | 3300005345 | Ga0070692_10024089 | Ga0070692_100240892 | 360 |
| 546 | 3300005438 | Ga0070701_10010173 | Ga0070701_100101732 | 360 |
| 547 | 3300005441 | Ga0070700_100000681 | Ga0070700_1000006818 | 360 |
| 548 | 3300005615 | Ga0070702_100002173 | Ga0070702_1000021734 | 360 |
| 549 | 3300005834 | Ga0068851_10070312 | Ga0068851_100703122 | 360 |
| 550 | 3300006175 | Ga0070712_100001096 | Ga0070712_10000109612 | 360 |
| 551 | 3300006881 | Ga0068865_100011636 | Ga0068865_1000116363 | 360 |
| 552 | 3300009545 | Ga0105237_10236455 | Ga0105237_102364552 | 360 |
| 553 | 3300009553 | Ga0105249_10036751 | Ga0105249_100367514 | 360 |
| 554 | 3300025315 | Ga0207697_10022659 | Ga0207697_100226592 | 360 |
| 555 | 3300025934 | Ga0207686_10034246 | Ga0207686_100342463 | 360 |
| 556 | 3300025935 | Ga0207709_10138697 | Ga0207709_101386971 | 360 |
| 557 | 3300026023 | Ga0207677_10116564 | Ga0207677_101165641 | 360 |
| 558 | 3300026075 | Ga0207708_10000511 | Ga0207708_1000051115 | 360 |
| 559 | 3300026089 | Ga0207648_10018964 | Ga0207648_100189643 | 360 |
| 560 | 3300026118 | Ga0207675_100002095 | Ga0207675_1000020953 | 360 |
| 561 | 3300031616 | Ga0307508_10029541 | Ga0307508_100295412 | 360 |
| 562 | 3300037418 | Ga0395900_0141460 | Ga0395900_0141460_677_1837 | 360 |
| 563 | 3300038443 | Ga0395901_0054448 | Ga0395901_0054448_2368_3528 | 360 |
| 564 | 3300041494 | Ga0451837_1227407 | Ga0451837_1227407_379_1548 | 360 |
| 565 | 3300041512 | Ga0451853_3575533 | Ga0451853_3575533_6261_7430 | 360 |
| 566 | 3300044693 | Ga0466961_0144609 | Ga0466961_0144609_255_1415 | 360 |
| 567 | 3300044694 | Ga0466963_0045398 | Ga0466963_0045398_1511_2662 | 360 |
| 568 | 3300045049 | Ga0466959_0178175 | Ga0466959_0178175_224_1384 | 360 |
| 569 | 3300045976 | Ga0466967_0009093 | Ga0466967_0009093_1931_3082 | 360 |
| 570 | 3300048903 | Ga0496100_0057190 | Ga0496100_0057190_101_1267 | 360 |
| 571 | 3300048916 | Ga0496113_0091797 | Ga0496113_0091797_859_2025 | 360 |
| 572 | 3300048929 | Ga0496126_0018493 | Ga0496126_0018493_4880_6046 | 360 |
| 573 | iso_pu_bacteria | 2643221714 | 2644628907 | 360 |
| 574 | iso_pu_bacteria | 2912715099 | 2912719953 | 360 |
| 575 | 3300003320 | rootH2_10150640 | rootH2_101506401 | 361 |
| 576 | 3300005563 | Ga0068855_100039642 | Ga0068855_1000396424 | 361 |
| 577 | 3300006048 | Ga0075363_100021242 | Ga0075363_1000212423 | 361 |
| 578 | 3300009093 | Ga0105240_10096255 | Ga0105240_100962551 | 361 |
| 579 | 3300009174 | Ga0105241_10002543 | Ga0105241_100025437 | 361 |
| 580 | 3300010375 | Ga0105239_10245862 | Ga0105239_102458622 | 361 |
| 581 | 3300013296 | Ga0157374_10030832 | Ga0157374_100308323 | 361 |
| 582 | 3300014497 | Ga0182008_10003431 | Ga0182008_100034317 | 361 |
| 583 | 3300015261 | Ga0182006_1008344 | Ga0182006_10083444 | 361 |
| 584 | 3300025904 | Ga0207647_10009986 | Ga0207647_100099866 | 361 |
| 585 | 3300025911 | Ga0207654_10048124 | Ga0207654_100481241 | 361 |
| 586 | 3300025913 | Ga0207695_10008695 | Ga0207695_100086958 | 361 |
| 587 | 3300025914 | Ga0207671_10006836 | Ga0207671_100068367 | 361 |
| 588 | 3300025924 | Ga0207694_10006958 | Ga0207694_100069582 | 361 |
| 589 | 3300025981 | Ga0207640_10124025 | Ga0207640_101240251 | 361 |
| 590 | 3300028379 | Ga0268266_10097157 | Ga0268266_100971571 | 361 |
| 591 | 3300031838 | Ga0307518_10019364 | Ga0307518_100193641 | 361 |
| 592 | 3300035207 | Ga0373942_0001767 | Ga0373942_0001767_1899_3059 | 361 |
| 593 | 3300041404 | Ga0439436_0001972 | Ga0439436_0001972_1813_2943 | 361 |
| 594 | 3300041999 | Ga0439433_0000517 | Ga0439433_0000517_5781_6911 | 361 |
| 595 | 3300042014 | Ga0439457_001264 | Ga0439457_001264_4632_5762 | 361 |
| 596 | 3300042015 | Ga0439462_0000793 | Ga0439462_0000793_873_2003 | 361 |
| 597 | 3300044694 | Ga0466963_0020953 | Ga0466963_0020953_1356_2519 | 361 |
| 598 | 3300044706 | Ga0466964_0013734 | Ga0466964_0013734_1184_2347 | 361 |
| 599 | 3300045976 | Ga0466967_0025149 | Ga0466967_0025149_114_1250 | 361 |
| 600 | 3300049589 | Ga0501073_0017123 | Ga0501073_0017123_2738_3892 | 361 |
| 601 | 3300049744 | Ga0501083_0002982 | Ga0501083_0002982_7155_8309 | 361 |
| 602 | 3300054114 | Ga0501084_0154328 | Ga0501084_0154328_320_1474 | 361 |
| 603 | 3300061719 | Ga0466962_0069651 | Ga0466962_0069651_58_1194 | 361 |
| 604 | iso_pu_bacteria | 2808606982 | 2811849050 | 361 |
| 605 | iso_pu_bacteria | 8048406513 | 8048412748 | 361 |
| 606 | 3300005343 | Ga0070687_100093523 | Ga0070687_1000935231 | 362 |
| 607 | 3300005437 | Ga0070710_10000119 | Ga0070710_1000011914 | 362 |
| 608 | 3300005458 | Ga0070681_10011047 | Ga0070681_100110478 | 362 |
| 609 | 3300005467 | Ga0070706_100115508 | Ga0070706_1001155082 | 362 |
| 610 | 3300005545 | Ga0070695_100164235 | Ga0070695_1001642351 | 362 |
| 611 | 3300005937 | Ga0081455_10000273 | Ga0081455_1000027313 | 362 |
| 612 | 3300006914 | Ga0075436_100076442 | Ga0075436_1000764422 | 362 |
| 613 | 3300025885 | Ga0207653_10021501 | Ga0207653_100215012 | 362 |
| 614 | 3300025898 | Ga0207692_10000731 | Ga0207692_1000073111 | 362 |
| 615 | 3300025910 | Ga0207684_10186380 | Ga0207684_101863801 | 362 |
| 616 | 3300030731 | Ga0316177_1078543 | Ga0316177_10785432 | 362 |
| 617 | 3300030732 | Ga0316176_1182197 | Ga0316176_11821972 | 362 |
| 618 | 3300031251 | Ga0265327_10000566 | Ga0265327_1000056643 | 362 |
| 619 | 3300031507 | Ga0307509_10130256 | Ga0307509_101302562 | 362 |
| 620 | 3300041413 | Ga0439465_0026681 | Ga0439465_0026681_79_1242 | 362 |
| 621 | 3300044658 | Ga0466972_0029503 | Ga0466972_0029503_1083_2222 | 362 |
| 622 | 3300044683 | Ga0466965_0034221 | Ga0466965_0034221_551_1690 | 362 |
| 623 | 3300044683 | Ga0466965_0048192 | Ga0466965_0048192_759_1898 | 362 |
| 624 | 3300044693 | Ga0466961_0012530 | Ga0466961_0012530_2617_3780 | 362 |
| 625 | 3300044765 | Ga0466970_0088787 | Ga0466970_0088787_33_1172 | 362 |
| 626 | 3300044901 | Ga0466960_0000512 | Ga0466960_0000512_3888_5027 | 362 |
| 627 | 3300044901 | Ga0466960_0003036 | Ga0466960_0003036_3196_4335 | 362 |
| 628 | 3300046491 | Ga0495584_0088049 | Ga0495584_0088049_234_1397 | 362 |
| 629 | 3300048929 | Ga0496126_0000036 | Ga0496126_0000036_25304_26455 | 362 |
| 630 | 3300049584 | Ga0501068_0057881 | Ga0501068_0057881_1120_2283 | 362 |
| 631 | 3300053140 | Ga0500573_0094999 | Ga0500573_0094999_31_1191 | 362 |
| 632 | iso_pu_bacteria | 2867428634 | 2867433298 | 362 |
| 633 | iso_pu_bacteria | 2877676314 | 2877681105 | 362 |
| 634 | iso_pu_bacteria | 2912757875 | 2912760790 | 362 |
| 635 | iso_pu_bacteria | 2954740390 | 2954745113 | 362 |
| 636 | iso_pu_bacteria | 2954759201 | 2954764087 | 362 |
| 637 | iso_pu_bacteria | 2997600082 | 2997600409 | 362 |
| 638 | iso_pu_bacteria | 8025530807 | 8025538031 | 362 |
| 639 | 3300005329 | Ga0070683_100090665 | Ga0070683_1000906653 | 363 |
| 640 | 3300025908 | Ga0207643_10002654 | Ga0207643_100026543 | 363 |
| 641 | 3300025944 | Ga0207661_10164640 | Ga0207661_101646402 | 363 |
| 642 | iso_pu_bacteria | 2643221587 | 2643942177 | 363 |
| 643 | iso_pu_bacteria | 2643221670 | 2644389848 | 363 |
| 644 | iso_pu_bacteria | 2643221677 | 2644429260 | 363 |
| 645 | iso_pu_bacteria | 2643221678 | 2644437169 | 363 |
| 646 | iso_pu_bacteria | 2919468124 | 2919469506 | 363 |
| 647 | iso_pu_bacteria | 3006493962 | 3006500765 | 363 |
| 648 | iso_pu_bacteria | 2862178590 | 2862180168 | 364 |
| 649 | 3300003354 | JGI25160J50197_1016270 | JGI25160J50197_10162701 | 365 |
| 650 | 3300025302 | Ga0207426_1002193 | Ga0207426_10021939 | 365 |
| 651 | 3300035398 | Ga0316574_0107546 | Ga0316574_0107546_11_1141 | 365 |
| 652 | iso_pu_bacteria | 2915358134 | 2915361325 | 365 |
| 653 | 3300013104 | Ga0157370_10019049 | Ga0157370_100190494 | 366 |
| 654 | 3300035172 | Ga0373955_0156313 | Ga0373955_0156313_36_1217 | 366 |
| 655 | 3300046454 | Ga0495592_0054001 | Ga0495592_0054001_23_1204 | 366 |
| 656 | 3300046462 | Ga0495651_0001340 | Ga0495651_0001340_1778_2959 | 366 |
| 657 | 3300046511 | Ga0495608_0001336 | Ga0495608_0001336_16383_17564 | 366 |
| 658 | 3300046514 | Ga0495618_0031013 | Ga0495618_0031013_693_1874 | 366 |
| 659 | 3300046516 | Ga0495628_0003697 | Ga0495628_0003697_107_1288 | 366 |
| 660 | 3300046529 | Ga0495652_0002560 | Ga0495652_0002560_1152_2333 | 366 |
| 661 | 3300046663 | Ga0495635_0000410 | Ga0495635_0000410_2381_3562 | 366 |
| 662 | 3300046678 | Ga0495599_0003359 | Ga0495599_0003359_8121_9302 | 366 |
| 663 | 3300046680 | Ga0495646_0009579 | Ga0495646_0009579_810_1991 | 366 |
| 664 | 3300047319 | Ga0495674_0013463 | Ga0495674_0013463_5128_6309 | 366 |
| 665 | 3300047322 | Ga0495680_0005407 | Ga0495680_0005407_3074_4255 | 366 |
| 666 | 3300048088 | Ga0495602_0052846 | Ga0495602_0052846_2363_3544 | 366 |
| 667 | 3300049590 | Ga0501074_0002005 | Ga0501074_0002005_10513_11667 | 366 |
| 668 | 3300049744 | Ga0501083_0094960 | Ga0501083_0094960_430_1584 | 366 |
| 669 | 3300049823 | Ga0501044_0004033 | Ga0501044_0004033_4273_5433 | 366 |
| 670 | 3300054114 | Ga0501084_0000772 | Ga0501084_0000772_19092_20246 | 366 |
| 671 | 3300005339 | Ga0070660_100039774 | Ga0070660_1000397742 | 367 |
| 672 | 3300005435 | Ga0070714_100111955 | Ga0070714_1001119552 | 367 |
| 673 | 3300025904 | Ga0207647_10036803 | Ga0207647_100368033 | 367 |
| 674 | 3300025909 | Ga0207705_10042992 | Ga0207705_100429923 | 367 |
| 675 | 3300025919 | Ga0207657_10027499 | Ga0207657_100274992 | 367 |
| 676 | 3300025929 | Ga0207664_10054994 | Ga0207664_100549942 | 367 |
| 677 | 3300037466 | Ga0395898_0004050 | Ga0395898_0004050_666_1820 | 367 |
| 678 | 3300044684 | Ga0466966_0011511 | Ga0466966_0011511_3196_4374 | 367 |
| 679 | 3300044693 | Ga0466961_0088258 | Ga0466961_0088258_767_1945 | 367 |
| 680 | 3300044765 | Ga0466970_0053211 | Ga0466970_0053211_884_2047 | 367 |
| 681 | 3300044765 | Ga0466970_0107705 | Ga0466970_0107705_258_1436 | 367 |
| 682 | 3300044842 | Ga0466957_0118406 | Ga0466957_0118406_444_1622 | 367 |
| 683 | 3300044901 | Ga0466960_0010489 | Ga0466960_0010489_186_1349 | 367 |
| 684 | 3300045976 | Ga0466967_0235245 | Ga0466967_0235245_444_1622 | 367 |
| 685 | 3300046660 | Ga0495625_0083268 | Ga0495625_0083268_796_1965 | 367 |
| 686 | 3300046691 | Ga0495670_0044445 | Ga0495670_0044445_855_2024 | 367 |
| 687 | 3300053090 | Ga0500646_0000613 | Ga0500646_0000613_2256_3434 | 367 |
| 688 | 3300060353 | Ga0501082_0246171 | Ga0501082_0246171_335_1498 | 367 |
| 689 | 3300061719 | Ga0466962_0081198 | Ga0466962_0081198_174_1352 | 367 |
| 690 | iso_pu_bacteria | 2554235005 | 2554257860 | 367 |
| 691 | iso_pu_bacteria | 8047710418 | 8047716740 | 367 |
| 692 | 3300003320 | rootH2_10022528 | rootH2_100225283 | 368 |
| 693 | 3300005434 | Ga0070709_10002604 | Ga0070709_100026043 | 368 |
| 694 | 3300005435 | Ga0070714_100001420 | Ga0070714_10000142012 | 368 |
| 695 | 3300005435 | Ga0070714_100080416 | Ga0070714_1000804162 | 368 |
| 696 | 3300005436 | Ga0070713_100143620 | Ga0070713_1001436202 | 368 |
| 697 | 3300005437 | Ga0070710_10007794 | Ga0070710_100077942 | 368 |
| 698 | 3300005439 | Ga0070711_100071711 | Ga0070711_1000717112 | 368 |
| 699 | 3300005471 | Ga0070698_100005449 | Ga0070698_1000054493 | 368 |
| 700 | 3300005471 | Ga0070698_100015358 | Ga0070698_1000153582 | 368 |
| 701 | 3300006028 | Ga0070717_10019840 | Ga0070717_100198402 | 368 |
| 702 | 3300006163 | Ga0070715_10002088 | Ga0070715_100020882 | 368 |
| 703 | 3300006173 | Ga0070716_100001616 | Ga0070716_1000016165 | 368 |
| 704 | 3300006847 | Ga0075431_100230562 | Ga0075431_1002305622 | 368 |
| 705 | 3300006880 | Ga0075429_100044816 | Ga0075429_1000448163 | 368 |
| 706 | 3300009011 | Ga0105251_10007408 | Ga0105251_100074083 | 368 |
| 707 | 3300009147 | Ga0114129_10325631 | Ga0114129_103256312 | 368 |
| 708 | 3300025735 | Ga0207713_1040811 | Ga0207713_10408112 | 368 |
| 709 | 3300025905 | Ga0207685_10000827 | Ga0207685_100008272 | 368 |
| 710 | 3300025910 | Ga0207684_10235209 | Ga0207684_102352092 | 368 |
| 711 | 3300025924 | Ga0207694_10034238 | Ga0207694_100342382 | 368 |
| 712 | 3300025925 | Ga0207650_10250162 | Ga0207650_102501621 | 368 |
| 713 | 3300025929 | Ga0207664_10013195 | Ga0207664_100131952 | 368 |
| 714 | 3300025939 | Ga0207665_10002796 | Ga0207665_100027965 | 368 |
| 715 | 3300025941 | Ga0207711_10114808 | Ga0207711_101148082 | 368 |
| 716 | 3300028666 | Ga0265336_10014160 | Ga0265336_100141602 | 368 |
| 717 | 3300028800 | Ga0265338_10003557 | Ga0265338_100035573 | 368 |
| 718 | 3300044658 | Ga0466972_0005263 | Ga0466972_0005263_200_1360 | 368 |
| 719 | 3300044683 | Ga0466965_0000282 | Ga0466965_0000282_1110_2270 | 368 |
| 720 | 3300044693 | Ga0466961_0008226 | Ga0466961_0008226_201_1361 | 368 |
| 721 | 3300044694 | Ga0466963_0004036 | Ga0466963_0004036_4887_6047 | 368 |
| 722 | 3300044706 | Ga0466964_0004070 | Ga0466964_0004070_2508_3668 | 368 |
| 723 | 3300044719 | Ga0466971_0019399 | Ga0466971_0019399_1015_2175 | 368 |
| 724 | 3300044765 | Ga0466970_0000600 | Ga0466970_0000600_5710_6870 | 368 |
| 725 | 3300044842 | Ga0466957_0001424 | Ga0466957_0001424_10331_11491 | 368 |
| 726 | 3300045049 | Ga0466959_0000556 | Ga0466959_0000556_9045_10205 | 368 |
| 727 | 3300045836 | Ga0466958_0015028 | Ga0466958_0015028_1015_2175 | 368 |
| 728 | 3300046455 | Ga0495603_0029572 | Ga0495603_0029572_1447_2607 | 368 |
| 729 | 3300046459 | Ga0495629_0033578 | Ga0495629_0033578_2426_3586 | 368 |
| 730 | 3300046475 | Ga0495639_0076021 | Ga0495639_0076021_359_1519 | 368 |
| 731 | 3300046499 | Ga0495594_0063609 | Ga0495594_0063609_217_1377 | 368 |
| 732 | 3300046517 | Ga0495630_0026681 | Ga0495630_0026681_795_1955 | 368 |
| 733 | 3300046674 | Ga0495588_0005715 | Ga0495588_0005715_3027_4187 | 368 |
| 734 | 3300046689 | Ga0495613_0023097 | Ga0495613_0023097_143_1303 | 368 |
| 735 | 3300046794 | Ga0495589_0042177 | Ga0495589_0042177_11_1171 | 368 |
| 736 | 3300047444 | Ga0495675_0023505 | Ga0495675_0023505_1762_2922 | 368 |
| 737 | 3300048904 | Ga0496101_0121509 | Ga0496101_0121509_410_1582 | 368 |
| 738 | 3300048905 | Ga0496102_0145751 | Ga0496102_0145751_512_1684 | 368 |
| 739 | 3300048907 | Ga0496104_0002025 | Ga0496104_0002025_13058_14230 | 368 |
| 740 | 3300048908 | Ga0496105_0017243 | Ga0496105_0017243_2647_3819 | 368 |
| 741 | 3300048912 | Ga0496109_0121134 | Ga0496109_0121134_805_1965 | 368 |
| 742 | 3300048913 | Ga0496110_0037673 | Ga0496110_0037673_1274_2446 | 368 |
| 743 | 3300048915 | Ga0496112_0002456 | Ga0496112_0002456_5378_6550 | 368 |
| 744 | 3300048916 | Ga0496113_0030602 | Ga0496113_0030602_791_1963 | 368 |
| 745 | 3300048917 | Ga0496114_0209494 | Ga0496114_0209494_168_1340 | 368 |
| 746 | 3300049570 | Ga0501033_0001790 | Ga0501033_0001790_17387_18547 | 368 |
| 747 | 3300050510 | nmdc:mga06r32_181565_c1 | nmdc:mga06r32_181565_c1_379_1536 | 368 |
| 748 | 3300061719 | Ga0466962_0000057 | Ga0466962_0000057_11198_12358 | 368 |
| 749 | iso_pu_bacteria | 2791355406 | 2793980058 | 368 |
| 750 | iso_pu_bacteria | 8047893842 | 8047898096 | 368 |
| 751 | iso_pu_bacteria | 8048127548 | 8048136800 | 368 |
| 752 | iso_pu_bacteria | 8048356638 | 8048360797 | 368 |
| 753 | iso_pu_bacteria | 8048369669 | 8048375059 | 368 |
| 754 | iso_pu_bacteria | 8048379754 | 8048383147 | 368 |
| 755 | 3300009147 | Ga0114129_10211324 | Ga0114129_102113242 | 369 |
| 756 | 3300014325 | Ga0163163_10065892 | Ga0163163_100658923 | 369 |
| 757 | 3300031251 | Ga0265327_10007949 | Ga0265327_100079496 | 369 |
| 758 | 3300037418 | Ga0395900_0310219 | Ga0395900_0310219_52_1212 | 369 |
| 759 | 3300041512 | Ga0451853_0520998 | Ga0451853_0520998_2126_3301 | 369 |
| 760 | 3300048907 | Ga0496104_0277753 | Ga0496104_0277753_378_1547 | 369 |
| 761 | 3300048915 | Ga0496112_0173958 | Ga0496112_0173958_825_2036 | 369 |
| 762 | 3300048916 | Ga0496113_0000626 | Ga0496113_0000626_12156_13367 | 369 |
| 763 | 3300049571 | Ga0501034_0017417 | Ga0501034_0017417_1955_3118 | 369 |
| 764 | 3300049574 | Ga0501038_0002102 | Ga0501038_0002102_1941_3104 | 369 |
| 765 | 3300049581 | Ga0501047_0057065 | Ga0501047_0057065_2099_3262 | 369 |
| 766 | 3300049582 | Ga0501048_0056423 | Ga0501048_0056423_1119_2282 | 369 |
| 767 | 3300049822 | Ga0501035_0005740 | Ga0501035_0005740_8979_10142 | 369 |
| 768 | 3300049822 | Ga0501035_0058997 | Ga0501035_0058997_660_1850 | 369 |
| 769 | 3300049823 | Ga0501044_0013775 | Ga0501044_0013775_7052_8242 | 369 |
| 770 | 3300049823 | Ga0501044_0026079 | Ga0501044_0026079_3681_4844 | 369 |
| 771 | 3300003578 | Ga0006562J51391_1051951 | Ga0006562J51391_10519517 | 370 |
| 772 | 3300003578 | Ga0006562J51391_1051956 | Ga0006562J51391_10519562 | 370 |
| 773 | 3300005439 | Ga0070711_100041461 | Ga0070711_1000414612 | 370 |
| 774 | 3300005614 | Ga0068856_100446439 | Ga0068856_1004464391 | 370 |
| 775 | 3300005618 | Ga0068864_100024230 | Ga0068864_1000242303 | 370 |
| 776 | 3300005842 | Ga0068858_100386285 | Ga0068858_1003862851 | 370 |
| 777 | 3300005843 | Ga0068860_100212008 | Ga0068860_1002120082 | 370 |
| 778 | 3300005937 | Ga0081455_10162152 | Ga0081455_101621522 | 370 |
| 779 | 3300006175 | Ga0070712_100010761 | Ga0070712_1000107614 | 370 |
| 780 | 3300009174 | Ga0105241_10227964 | Ga0105241_102279642 | 370 |
| 781 | 3300009177 | Ga0105248_10022567 | Ga0105248_100225672 | 370 |
| 782 | 3300010375 | Ga0105239_10154865 | Ga0105239_101548652 | 370 |
| 783 | 3300013308 | Ga0157375_10136271 | Ga0157375_101362712 | 370 |
| 784 | 3300014325 | Ga0163163_10109287 | Ga0163163_101092872 | 370 |
| 785 | 3300014745 | Ga0157377_10120847 | Ga0157377_101208472 | 370 |
| 786 | 3300014968 | Ga0157379_10128818 | Ga0157379_101288182 | 370 |
| 787 | 3300014969 | Ga0157376_10294314 | Ga0157376_102943142 | 370 |
| 788 | 3300021388 | Ga0213875_10022735 | Ga0213875_100227352 | 370 |
| 789 | 3300022467 | Ga0224712_10002142 | Ga0224712_100021423 | 370 |
| 790 | 3300025901 | Ga0207688_10031595 | Ga0207688_100315953 | 370 |
| 791 | 3300025915 | Ga0207693_10036848 | Ga0207693_100368483 | 370 |
| 792 | 3300025915 | Ga0207693_10174266 | Ga0207693_101742662 | 370 |
| 793 | 3300025916 | Ga0207663_10111126 | Ga0207663_101111262 | 370 |
| 794 | 3300025932 | Ga0207690_10269930 | Ga0207690_102699302 | 370 |
| 795 | 3300025941 | Ga0207711_10111646 | Ga0207711_101116462 | 370 |
| 796 | 3300026035 | Ga0207703_10145264 | Ga0207703_101452642 | 370 |
| 797 | 3300026088 | Ga0207641_10239164 | Ga0207641_102391641 | 370 |
| 798 | 3300026142 | Ga0207698_10213861 | Ga0207698_102138612 | 370 |
| 799 | 3300031456 | Ga0307513_10031541 | Ga0307513_100315413 | 370 |
| 800 | 3300032126 | Ga0307415_100104352 | Ga0307415_1001043523 | 370 |
| 801 | 3300036401 | Ga0373937_0128154 | Ga0373937_0128154_521_1681 | 370 |
| 802 | 3300037853 | Ga0436364_0816924 | Ga0436364_0816924_3205_4362 | 370 |
| 803 | 3300039062 | Ga0400483_006444 | Ga0400483_006444_9330_10511 | 370 |
| 804 | 3300041453 | Ga0451797_1175257 | Ga0451797_1175257_84_1244 | 370 |
| 805 | 3300044658 | Ga0466972_0064138 | Ga0466972_0064138_449_1612 | 370 |
| 806 | 3300044683 | Ga0466965_0043867 | Ga0466965_0043867_746_1906 | 370 |
| 807 | 3300044693 | Ga0466961_0047652 | Ga0466961_0047652_1441_2601 | 370 |
| 808 | 3300044694 | Ga0466963_0164051 | Ga0466963_0164051_166_1326 | 370 |
| 809 | 3300044706 | Ga0466964_0015273 | Ga0466964_0015273_1674_2834 | 370 |
| 810 | 3300044719 | Ga0466971_0009420 | Ga0466971_0009420_81_1241 | 370 |
| 811 | 3300044765 | Ga0466970_0033587 | Ga0466970_0033587_446_1606 | 370 |
| 812 | 3300044842 | Ga0466957_0031279 | Ga0466957_0031279_1769_2929 | 370 |
| 813 | 3300044901 | Ga0466960_0059460 | Ga0466960_0059460_553_1716 | 370 |
| 814 | 3300045836 | Ga0466958_0031299 | Ga0466958_0031299_37_1197 | 370 |
| 815 | 3300046454 | Ga0495592_0019076 | Ga0495592_0019076_4016_5206 | 370 |
| 816 | 3300046454 | Ga0495592_0075543 | Ga0495592_0075543_870_2030 | 370 |
| 817 | 3300046455 | Ga0495603_0042945 | Ga0495603_0042945_237_1427 | 370 |
| 818 | 3300046455 | Ga0495603_0140210 | Ga0495603_0140210_205_1374 | 370 |
| 819 | 3300046459 | Ga0495629_0038574 | Ga0495629_0038574_252_1442 | 370 |
| 820 | 3300046459 | Ga0495629_0102359 | Ga0495629_0102359_634_1824 | 370 |
| 821 | 3300046462 | Ga0495651_0004642 | Ga0495651_0004642_4108_5352 | 370 |
| 822 | 3300046477 | Ga0495664_0058993 | Ga0495664_0058993_825_2015 | 370 |
| 823 | 3300046492 | Ga0495585_0057795 | Ga0495585_0057795_234_1424 | 370 |
| 824 | 3300046516 | Ga0495628_0023177 | Ga0495628_0023177_2712_3956 | 370 |
| 825 | 3300046516 | Ga0495628_0057402 | Ga0495628_0057402_847_2037 | 370 |
| 826 | 3300046516 | Ga0495628_0146392 | Ga0495628_0146392_99_1289 | 370 |
| 827 | 3300046518 | Ga0495631_0086630 | Ga0495631_0086630_70_1239 | 370 |
| 828 | 3300046529 | Ga0495652_0000962 | Ga0495652_0000962_19865_21109 | 370 |
| 829 | 3300046529 | Ga0495652_0083865 | Ga0495652_0083865_971_2161 | 370 |
| 830 | 3300046533 | Ga0495640_0020297 | Ga0495640_0020297_1545_2735 | 370 |
| 831 | 3300046533 | Ga0495640_0138922 | Ga0495640_0138922_31_1221 | 370 |
| 832 | 3300046543 | Ga0495645_0230733 | Ga0495645_0230733_26_1186 | 370 |
| 833 | 3300046642 | Ga0495634_0015214 | Ga0495634_0015214_3042_4232 | 370 |
| 834 | 3300046675 | Ga0495657_0015104 | Ga0495657_0015104_3726_4916 | 370 |
| 835 | 3300046689 | Ga0495613_0026890 | Ga0495613_0026890_1515_2705 | 370 |
| 836 | 3300046690 | Ga0495624_0036400 | Ga0495624_0036400_455_1645 | 370 |
| 837 | 3300046809 | Ga0495600_0003923 | Ga0495600_0003923_1319_2563 | 370 |
| 838 | 3300046809 | Ga0495600_0022970 | Ga0495600_0022970_1311_2501 | 370 |
| 839 | 3300047317 | Ga0495604_0058706 | Ga0495604_0058706_97_1287 | 370 |
| 840 | 3300047317 | Ga0495604_0070928 | Ga0495604_0070928_221_1411 | 370 |
| 841 | 3300047321 | Ga0495676_0036181 | Ga0495676_0036181_1567_2757 | 370 |
| 842 | 3300047321 | Ga0495676_0064593 | Ga0495676_0064593_859_2028 | 370 |
| 843 | 3300047443 | Ga0495687_019515 | Ga0495687_019515_1567_2733 | 370 |
| 844 | 3300047472 | Ga0495686_0019765 | Ga0495686_0019765_1481_2644 | 370 |
| 845 | 3300048903 | Ga0496100_0013250 | Ga0496100_0013250_2951_4111 | 370 |
| 846 | 3300048905 | Ga0496102_0018543 | Ga0496102_0018543_3794_4954 | 370 |
| 847 | 3300048905 | Ga0496102_0406771 | Ga0496102_0406771_29_1201 | 370 |
| 848 | 3300048907 | Ga0496104_0048446 | Ga0496104_0048446_76_1236 | 370 |
| 849 | 3300048910 | Ga0496107_0037547 | Ga0496107_0037547_164_1324 | 370 |
| 850 | 3300048912 | Ga0496109_0084625 | Ga0496109_0084625_766_1926 | 370 |
| 851 | 3300048915 | Ga0496112_0182609 | Ga0496112_0182609_879_2039 | 370 |
| 852 | 3300048916 | Ga0496113_0005086 | Ga0496113_0005086_1968_3128 | 370 |
| 853 | 3300048917 | Ga0496114_0022382 | Ga0496114_0022382_3821_4981 | 370 |
| 854 | 3300048918 | Ga0496115_0014024 | Ga0496115_0014024_3629_4789 | 370 |
| 855 | 3300048926 | Ga0496123_0021932 | Ga0496123_0021932_133_1296 | 370 |
| 856 | 3300048929 | Ga0496126_0013957 | Ga0496126_0013957_2299_3459 | 370 |
| 857 | 3300049569 | Ga0501032_0110917 | Ga0501032_0110917_418_1581 | 370 |
| 858 | 3300049570 | Ga0501033_0005042 | Ga0501033_0005042_2062_3225 | 370 |
| 859 | 3300049570 | Ga0501033_0204059 | Ga0501033_0204059_90_1277 | 370 |
| 860 | 3300049571 | Ga0501034_0097799 | Ga0501034_0097799_1327_2487 | 370 |
| 861 | 3300049572 | Ga0501036_0007027 | Ga0501036_0007027_6670_7830 | 370 |
| 862 | 3300049572 | Ga0501036_0009260 | Ga0501036_0009260_365_1552 | 370 |
| 863 | 3300049575 | Ga0501039_0073375 | Ga0501039_0073375_349_1509 | 370 |
| 864 | 3300049580 | Ga0501046_0085768 | Ga0501046_0085768_706_1866 | 370 |
| 865 | 3300049580 | Ga0501046_0172247 | Ga0501046_0172247_95_1255 | 370 |
| 866 | 3300049581 | Ga0501047_0033092 | Ga0501047_0033092_2663_3823 | 370 |
| 867 | 3300049581 | Ga0501047_0039386 | Ga0501047_0039386_3207_4394 | 370 |
| 868 | 3300049581 | Ga0501047_0061266 | Ga0501047_0061266_1610_2773 | 370 |
| 869 | 3300049583 | Ga0501067_0024913 | Ga0501067_0024913_597_1760 | 370 |
| 870 | 3300049589 | Ga0501073_0021675 | Ga0501073_0021675_2381_3541 | 370 |
| 871 | 3300049822 | Ga0501035_0003607 | Ga0501035_0003607_10558_11718 | 370 |
| 872 | 3300049822 | Ga0501035_0024418 | Ga0501035_0024418_3011_4165 | 370 |
| 873 | 3300049822 | Ga0501035_0048503 | Ga0501035_0048503_1622_2785 | 370 |
| 874 | 3300049822 | Ga0501035_0118695 | Ga0501035_0118695_1036_2199 | 370 |
| 875 | 3300049823 | Ga0501044_0051989 | Ga0501044_0051989_1926_3089 | 370 |
| 876 | 3300053104 | Ga0500556_0001524 | Ga0500556_0001524_8031_9209 | 370 |
| 877 | 3300061719 | Ga0466962_0003856 | Ga0466962_0003856_278_1438 | 370 |
| 878 | iso_pu_bacteria | 2675903060 | 2676494046 | 370 |
| 879 | iso_pu_bacteria | 2887478801 | 2887485193 | 370 |
| 880 | iso_pu_bacteria | 2912723979 | 2912724340 | 370 |
| 881 | iso_pu_bacteria | 3002998708 | 3003005920 | 370 |
| 882 | 3300006847 | Ga0075431_100096916 | Ga0075431_1000969163 | 371 |
| 883 | 3300009093 | Ga0105240_10036032 | Ga0105240_100360323 | 371 |
| 884 | 3300009098 | Ga0105245_10042060 | Ga0105245_100420602 | 371 |
| 885 | 3300009545 | Ga0105237_10000385 | Ga0105237_1000038533 | 371 |
| 886 | 3300010375 | Ga0105239_10004355 | Ga0105239_1000435512 | 371 |
| 887 | 3300025913 | Ga0207695_10049275 | Ga0207695_100492753 | 371 |
| 888 | 3300025914 | Ga0207671_10002091 | Ga0207671_100020919 | 371 |
| 889 | 3300048915 | Ga0496112_0121966 | Ga0496112_0121966_395_1552 | 371 |
| 890 | 3300050510 | nmdc:mga06r32_218963_c1 | nmdc:mga06r32_218963_c1_273_1442 | 371 |
| 891 | iso_pu_bacteria | 2558860112 | 2558913178 | 371 |
| 892 | iso_pu_bacteria | 2643221696 | 2644533063 | 371 |
| 893 | iso_pu_bacteria | 2675903059 | 2676486104 | 371 |
| 894 | iso_pu_bacteria | 2738541264 | 2738668300 | 371 |
| 895 | iso_pu_bacteria | 2738541356 | 2739147370 | 371 |
| 896 | iso_pu_bacteria | 2744054611 | 2744954488 | 371 |
| 897 | iso_pu_bacteria | 2837183177 | 2837187308 | 371 |
| 898 | iso_pu_bacteria | 2842134933 | 2842137572 | 371 |
| 899 | iso_pu_bacteria | 2862382967 | 2862392843 | 371 |
| 900 | iso_pu_bacteria | 2866552031 | 2866552365 | 371 |
| 901 | iso_pu_bacteria | 2870782633 | 2870783852 | 371 |
| 902 | iso_pu_bacteria | 8003856774 | 8003857246 | 371 |
| 903 | iso_pu_bacteria | 8008558824 | 8008567303 | 371 |
| 904 | iso_pu_bacteria | 8033684223 | 8033684803 | 371 |
| 905 | 3300006175 | Ga0070712_100067807 | Ga0070712_1000678072 | 372 |
| 906 | iso_pu_bacteria | 2506783011 | 2506866632 | 372 |
| 907 | iso_pu_bacteria | 2616644941 | 2616902155 | 372 |
| 908 | iso_pu_bacteria | 2626541554 | 2626638749 | 372 |
| 909 | iso_pu_bacteria | 2643221578 | 2643902634 | 372 |
| 910 | iso_pu_bacteria | 2643221641 | 2644228138 | 372 |
| 911 | iso_pu_bacteria | 2643221673 | 2644404858 | 372 |
| 912 | iso_pu_bacteria | 2643221961 | 2645721326 | 372 |
| 913 | iso_pu_bacteria | 2643221962 | 2645724671 | 372 |
| 914 | iso_pu_bacteria | 2738541264 | 2738668905 | 372 |
| 915 | iso_pu_bacteria | 2738541274 | 2738705582 | 372 |
| 916 | iso_pu_bacteria | 2738541356 | 2739148197 | 372 |
| 917 | iso_pu_bacteria | 2738543028 | 2739332369 | 372 |
| 918 | iso_pu_bacteria | 2773857933 | 2774903061 | 372 |
| 919 | iso_pu_bacteria | 2795385470 | 2795786455 | 372 |
| 920 | iso_pu_bacteria | 2855386786 | 2855388644 | 372 |
| 921 | iso_pu_bacteria | 2863404153 | 2863404608 | 372 |
| 922 | iso_pu_bacteria | 2899370129 | 2899370254 | 372 |
| 923 | iso_pu_bacteria | 2902792274 | 2902799174 | 372 |
| 924 | iso_pu_bacteria | 2902810491 | 2902812630 | 372 |
| 925 | iso_pu_bacteria | 2946045630 | 2946048838 | 372 |
| 926 | iso_pu_bacteria | 2984592036 | 2984593178 | 372 |
| 927 | iso_pu_bacteria | 2990059506 | 2990066423 | 372 |
| 928 | iso_pu_bacteria | 3001889506 | 3001892377 | 372 |
| 929 | iso_pu_bacteria | 8002775197 | 8002776735 | 372 |
| 930 | iso_pu_bacteria | 8054609563 | 8054612089 | 372 |
| 931 | iso_pu_bacteria | 8054913762 | 8054915957 | 372 |
| 932 | 3300005439 | Ga0070711_100186327 | Ga0070711_1001863272 | 373 |
| 933 | 3300025915 | Ga0207693_10137513 | Ga0207693_101375132 | 373 |
| 934 | 3300046455 | Ga0495603_0001078 | Ga0495603_0001078_12400_13560 | 373 |
| 935 | 3300046475 | Ga0495639_0005243 | Ga0495639_0005243_2273_3433 | 373 |
| 936 | 3300046674 | Ga0495588_0024140 | Ga0495588_0024140_1063_2223 | 373 |
| 937 | 3300053087 | Ga0500643_000290 | Ga0500643_000290_14262_15416 | 373 |
| 938 | iso_pu_bacteria | 2643221615 | 2644092667 | 373 |
| 939 | iso_pu_bacteria | 2643221657 | 2644322280 | 373 |
| 940 | iso_pu_bacteria | 2643221681 | 2644455061 | 373 |
| 941 | iso_pu_bacteria | 2643221697 | 2644539489 | 373 |
| 942 | iso_pu_bacteria | 2739367898 | 2740165622 | 373 |
| 943 | iso_pu_bacteria | 2751185734 | 2753071332 | 373 |
| 944 | iso_pu_bacteria | 2811994874 | 2812330099 | 373 |
| 945 | iso_pu_bacteria | 2862574272 | 2862579247 | 373 |
| 946 | iso_pu_bacteria | 2867475112 | 2867480621 | 373 |
| 947 | iso_pu_bacteria | 2870721527 | 2870721863 | 373 |
| 948 | iso_pu_bacteria | 2891968417 | 2891973499 | 373 |
| 949 | iso_pu_bacteria | 2935390628 | 2935393410 | 373 |
| 950 | iso_pu_bacteria | 2984576629 | 2984578331 | 373 |
| 951 | iso_pu_bacteria | 2990256926 | 2990260810 | 373 |
| 952 | 3300005367 | Ga0070667_100002542 | Ga0070667_1000025428 | 374 |
| 953 | 3300005367 | Ga0070667_100179936 | Ga0070667_1001799361 | 374 |
| 954 | 3300014325 | Ga0163163_10097671 | Ga0163163_100976712 | 374 |
| 955 | 3300021384 | Ga0213876_10027796 | Ga0213876_100277962 | 374 |
| 956 | 3300025986 | Ga0207658_10006962 | Ga0207658_100069622 | 374 |
| 957 | 3300028379 | Ga0268266_10000297 | Ga0268266_1000029749 | 374 |
| 958 | 3300039453 | Ga0436362_0815789 | Ga0436362_0815789_211_1398 | 374 |
| 959 | 3300041512 | Ga0451853_0096484 | Ga0451853_0096484_2334_3497 | 374 |
| 960 | 3300042014 | Ga0439457_006917 | Ga0439457_006917_508_1671 | 374 |
| 961 | 3300042131 | Ga0450894_000158 | Ga0450894_000158_7152_8315 | 374 |
| 962 | 3300042133 | Ga0450896_002075 | Ga0450896_002075_395_1558 | 374 |
| 963 | 3300042134 | Ga0450898_000485 | Ga0450898_000485_552_1715 | 374 |
| 964 | 3300042135 | Ga0450899_000424 | Ga0450899_000424_3047_4210 | 374 |
| 965 | 3300042145 | Ga0450906_004270 | Ga0450906_004270_483_1646 | 374 |
| 966 | 3300042184 | Ga0450908_010034 | Ga0450908_010034_63_1226 | 374 |
| 967 | 3300044694 | Ga0466963_0103365 | Ga0466963_0103365_147_1316 | 374 |
| 968 | 3300044735 | Ga0466968_0015159 | Ga0466968_0015159_1849_3033 | 374 |
| 969 | 3300044765 | Ga0466970_0086939 | Ga0466970_0086939_250_1434 | 374 |
| 970 | 3300045049 | Ga0466959_0104564 | Ga0466959_0104564_674_1819 | 374 |
| 971 | 3300045836 | Ga0466958_0007686 | Ga0466958_0007686_1011_2195 | 374 |
| 972 | iso_pu_bacteria | 2643221617 | 2644101054 | 374 |
| 973 | iso_pu_bacteria | 2643221620 | 2644117935 | 374 |
| 974 | iso_pu_bacteria | 2738541305 | 2738868652 | 374 |
| 975 | iso_pu_bacteria | 2808606439 | 2809193999 | 374 |
| 976 | iso_pu_bacteria | 2808606522 | 2809588625 | 374 |
| 977 | iso_pu_bacteria | 2915768154 | 2915775326 | 374 |
| 978 | iso_pu_bacteria | 2932398195 | 2932401164 | 374 |
| 979 | iso_pu_bacteria | 8054472261 | 8054472414 | 374 |
| 980 | 3300003792 | Ga0055540_1000022 | Ga0055540_100002212 | 375 |
| 981 | 3300005435 | Ga0070714_100000192 | Ga0070714_10000019233 | 375 |
| 982 | 3300005539 | Ga0068853_100113216 | Ga0068853_1001132162 | 375 |
| 983 | 3300005614 | Ga0068856_100132178 | Ga0068856_1001321782 | 375 |
| 984 | 3300006038 | Ga0075365_10062984 | Ga0075365_100629842 | 375 |
| 985 | 3300006846 | Ga0075430_100137042 | Ga0075430_1001370422 | 375 |
| 986 | 3300006847 | Ga0075431_100163216 | Ga0075431_1001632162 | 375 |
| 987 | 3300009094 | Ga0111539_10582360 | Ga0111539_105823602 | 375 |
| 988 | 3300009098 | Ga0105245_10026851 | Ga0105245_100268515 | 375 |
| 989 | 3300009176 | Ga0105242_10190723 | Ga0105242_101907231 | 375 |
| 990 | 3300009545 | Ga0105237_10016595 | Ga0105237_100165953 | 375 |
| 991 | 3300013307 | Ga0157372_10000004 | Ga0157372_10000004259 | 375 |
| 992 | 3300020081 | Ga0206354_11292861 | Ga0206354_112928611 | 375 |
| 993 | 3300020082 | Ga0206353_11429297 | Ga0206353_114292972 | 375 |
| 994 | 3300021388 | Ga0213875_10000443 | Ga0213875_1000044313 | 375 |
| 995 | 3300021388 | Ga0213875_10004207 | Ga0213875_100042073 | 375 |
| 996 | 3300025303 | Ga0209051_1000033 | Ga0209051_100003312 | 375 |
| 997 | 3300025927 | Ga0207687_10015059 | Ga0207687_100150593 | 375 |
| 998 | 3300025929 | Ga0207664_10000028 | Ga0207664_10000028158 | 375 |
| 999 | 3300025929 | Ga0207664_10016850 | Ga0207664_100168505 | 375 |
| 1000 | 3300028379 | Ga0268266_10181253 | Ga0268266_101812532 | 375 |
| 1001 | 3300028666 | Ga0265336_10030675 | Ga0265336_100306752 | 375 |
| 1002 | 3300028794 | Ga0307515_10232096 | Ga0307515_102320961 | 375 |
| 1003 | 3300031456 | Ga0307513_10124907 | Ga0307513_101249071 | 375 |
| 1004 | 3300031728 | Ga0316578_10040140 | Ga0316578_100401403 | 375 |
| 1005 | 3300031731 | Ga0307405_10007322 | Ga0307405_100073222 | 375 |
| 1006 | 3300031824 | Ga0307413_10020555 | Ga0307413_100205553 | 375 |
| 1007 | 3300031901 | Ga0307406_10055468 | Ga0307406_100554682 | 375 |
| 1008 | 3300031911 | Ga0307412_10101159 | Ga0307412_101011592 | 375 |
| 1009 | 3300031995 | Ga0307409_100038568 | Ga0307409_1000385682 | 375 |
| 1010 | 3300032002 | Ga0307416_100002333 | Ga0307416_1000023338 | 375 |
| 1011 | 3300032126 | Ga0307415_100000334 | Ga0307415_1000003349 | 375 |
| 1012 | 3300033179 | Ga0307507_10043371 | Ga0307507_100433713 | 375 |
| 1013 | 3300035398 | Ga0316574_0067887 | Ga0316574_0067887_866_2026 | 375 |
| 1014 | 3300037466 | Ga0395898_0426969 | Ga0395898_0426969_15_1172 | 375 |
| 1015 | 3300037853 | Ga0436364_0936746 | Ga0436364_0936746_13289_14449 | 375 |
| 1016 | 3300041491 | Ga0451833_0579776 | Ga0451833_0579776_11788_12957 | 375 |
| 1017 | 3300042005 | Ga0439448_0004601 | Ga0439448_0004601_2085_3248 | 375 |
| 1018 | 3300044656 | Ga0466969_0079676 | Ga0466969_0079676_79_1236 | 375 |
| 1019 | 3300044684 | Ga0466966_0004077 | Ga0466966_0004077_1709_2851 | 375 |
| 1020 | 3300044684 | Ga0466966_0021414 | Ga0466966_0021414_1183_2340 | 375 |
| 1021 | 3300044684 | Ga0466966_0037031 | Ga0466966_0037031_1614_2771 | 375 |
| 1022 | 3300044693 | Ga0466961_0071435 | Ga0466961_0071435_373_1530 | 375 |
| 1023 | 3300044694 | Ga0466963_0004428 | Ga0466963_0004428_69_1226 | 375 |
| 1024 | 3300044842 | Ga0466957_0010202 | Ga0466957_0010202_3888_5030 | 375 |
| 1025 | 3300044842 | Ga0466957_0036938 | Ga0466957_0036938_826_1983 | 375 |
| 1026 | 3300044842 | Ga0466957_0056816 | Ga0466957_0056816_506_1663 | 375 |
| 1027 | 3300045049 | Ga0466959_0010190 | Ga0466959_0010190_1966_3123 | 375 |
| 1028 | 3300045049 | Ga0466959_0068503 | Ga0466959_0068503_397_1539 | 375 |
| 1029 | 3300045836 | Ga0466958_0001433 | Ga0466958_0001433_10100_11257 | 375 |
| 1030 | 3300045976 | Ga0466967_0004195 | Ga0466967_0004195_6491_7648 | 375 |
| 1031 | 3300045976 | Ga0466967_0125828 | Ga0466967_0125828_939_2102 | 375 |
| 1032 | 3300045976 | Ga0466967_0156915 | Ga0466967_0156915_64_1221 | 375 |
| 1033 | 3300046459 | Ga0495629_0137347 | Ga0495629_0137347_443_1603 | 375 |
| 1034 | 3300046543 | Ga0495645_0036471 | Ga0495645_0036471_234_1394 | 375 |
| 1035 | 3300047317 | Ga0495604_0015027 | Ga0495604_0015027_18_1199 | 375 |
| 1036 | 3300047323 | Ga0495683_0000585 | Ga0495683_0000585_7237_8400 | 375 |
| 1037 | 3300047444 | Ga0495675_0079930 | Ga0495675_0079930_230_1390 | 375 |
| 1038 | 3300048905 | Ga0496102_0000263 | Ga0496102_0000263_13788_14945 | 375 |
| 1039 | 3300048907 | Ga0496104_0063449 | Ga0496104_0063449_2025_3185 | 375 |
| 1040 | 3300048908 | Ga0496105_0270906 | Ga0496105_0270906_81_1241 | 375 |
| 1041 | 3300048911 | Ga0496108_0041662 | Ga0496108_0041662_653_1813 | 375 |
| 1042 | 3300048912 | Ga0496109_0018389 | Ga0496109_0018389_3264_4424 | 375 |
| 1043 | 3300048912 | Ga0496109_0021669 | Ga0496109_0021669_1039_2199 | 375 |
| 1044 | 3300048915 | Ga0496112_0002788 | Ga0496112_0002788_7682_8842 | 375 |
| 1045 | 3300049568 | Ga0501031_0003245 | Ga0501031_0003245_5631_6788 | 375 |
| 1046 | 3300049568 | Ga0501031_0105563 | Ga0501031_0105563_360_1553 | 375 |
| 1047 | 3300049569 | Ga0501032_0025500 | Ga0501032_0025500_2493_3650 | 375 |
| 1048 | 3300049569 | Ga0501032_0124489 | Ga0501032_0124489_415_1608 | 375 |
| 1049 | 3300049570 | Ga0501033_0101095 | Ga0501033_0101095_296_1489 | 375 |
| 1050 | 3300049571 | Ga0501034_0159396 | Ga0501034_0159396_869_2026 | 375 |
| 1051 | 3300049572 | Ga0501036_0094749 | Ga0501036_0094749_489_1682 | 375 |
| 1052 | 3300049573 | Ga0501037_0029643 | Ga0501037_0029643_616_1773 | 375 |
| 1053 | 3300049574 | Ga0501038_0001063 | Ga0501038_0001063_16984_18141 | 375 |
| 1054 | 3300049574 | Ga0501038_0115015 | Ga0501038_0115015_563_1756 | 375 |
| 1055 | 3300049579 | Ga0501043_0050608 | Ga0501043_0050608_1553_2746 | 375 |
| 1056 | 3300049579 | Ga0501043_0075950 | Ga0501043_0075950_839_1996 | 375 |
| 1057 | 3300049580 | Ga0501046_0087836 | Ga0501046_0087836_490_1647 | 375 |
| 1058 | 3300049582 | Ga0501048_0135992 | Ga0501048_0135992_116_1309 | 375 |
| 1059 | 3300049822 | Ga0501035_0031854 | Ga0501035_0031854_2378_3535 | 375 |
| 1060 | 3300049822 | Ga0501035_0057252 | Ga0501035_0057252_1764_2957 | 375 |
| 1061 | 3300049822 | Ga0501035_0285472 | Ga0501035_0285472_99_1256 | 375 |
| 1062 | 3300049823 | Ga0501044_0033301 | Ga0501044_0033301_3085_4242 | 375 |
| 1063 | 3300049823 | Ga0501044_0062687 | Ga0501044_0062687_443_1636 | 375 |
| 1064 | 3300049824 | Ga0501045_0035483 | Ga0501045_0035483_967_2160 | 375 |
| 1065 | 3300050510 | nmdc:mga06r32_29461_c1 | nmdc:mga06r32_29461_c1_1111_2262 | 375 |
| 1066 | 3300053153 | Ga0500616_0036868 | Ga0500616_0036868_565_1758 | 375 |
| 1067 | iso_pu_bacteria | 2579778521 | 2579856042 | 375 |
| 1068 | iso_pu_bacteria | 2619618881 | 2619857005 | 375 |
| 1069 | iso_pu_bacteria | 2619619003 | 2620352704 | 375 |
| 1070 | iso_pu_bacteria | 2643221561 | 2643824952 | 375 |
| 1071 | iso_pu_bacteria | 2643221576 | 2643891182 | 375 |
| 1072 | iso_pu_bacteria | 2643221590 | 2643960238 | 375 |
| 1073 | iso_pu_bacteria | 2643221604 | 2644034914 | 375 |
| 1074 | iso_pu_bacteria | 2643221696 | 2644532498 | 375 |
| 1075 | iso_pu_bacteria | 2773857762 | 2774395167 | 375 |
| 1076 | iso_pu_bacteria | 2811994878 | 2812348737 | 375 |
| 1077 | iso_pu_bacteria | 2857481737 | 2857484928 | 375 |
| 1078 | iso_pu_bacteria | 2875391855 | 2875395783 | 375 |
| 1079 | iso_pu_bacteria | 3006321560 | 3006328219 | 375 |
| 1080 | iso_pu_bacteria | 3006486233 | 3006488609 | 375 |
| 1081 | iso_pu_bacteria | 8054920844 | 8054922714 | 375 |
| 1082 | 3300005329 | Ga0070683_100019998 | Ga0070683_1000199988 | 376 |
| 1083 | 3300005337 | Ga0070682_100010596 | Ga0070682_1000105967 | 376 |
| 1084 | 3300005441 | Ga0070700_100001719 | Ga0070700_10000171913 | 376 |
| 1085 | 3300005445 | Ga0070708_100065007 | Ga0070708_1000650072 | 376 |
| 1086 | 3300005455 | Ga0070663_100061733 | Ga0070663_1000617332 | 376 |
| 1087 | 3300005456 | Ga0070678_100083931 | Ga0070678_1000839312 | 376 |
| 1088 | 3300005466 | Ga0070685_10024594 | Ga0070685_100245944 | 376 |
| 1089 | 3300005471 | Ga0070698_100002657 | Ga0070698_1000026577 | 376 |
| 1090 | 3300005471 | Ga0070698_100008703 | Ga0070698_1000087032 | 376 |
| 1091 | 3300005577 | Ga0068857_100145327 | Ga0068857_1001453271 | 376 |
| 1092 | 3300005614 | Ga0068856_100026991 | Ga0068856_1000269912 | 376 |
| 1093 | 3300005616 | Ga0068852_100327673 | Ga0068852_1003276732 | 376 |
| 1094 | 3300005937 | Ga0081455_10010997 | Ga0081455_100109972 | 376 |
| 1095 | 3300006847 | Ga0075431_100102607 | Ga0075431_1001026073 | 376 |
| 1096 | 3300006881 | Ga0068865_100170251 | Ga0068865_1001702512 | 376 |
| 1097 | 3300009094 | Ga0111539_10532486 | Ga0111539_105324862 | 376 |
| 1098 | 3300009098 | Ga0105245_10009265 | Ga0105245_100092658 | 376 |
| 1099 | 3300010375 | Ga0105239_10021851 | Ga0105239_100218513 | 376 |
| 1100 | 3300013296 | Ga0157374_10155370 | Ga0157374_101553703 | 376 |
| 1101 | 3300013308 | Ga0157375_10023922 | Ga0157375_100239228 | 376 |
| 1102 | 3300014326 | Ga0157380_10074641 | Ga0157380_100746412 | 376 |
| 1103 | 3300014326 | Ga0157380_10154227 | Ga0157380_101542272 | 376 |
| 1104 | 3300014745 | Ga0157377_10023955 | Ga0157377_100239552 | 376 |
| 1105 | 3300021388 | Ga0213875_10000341 | Ga0213875_1000034141 | 376 |
| 1106 | 3300025901 | Ga0207688_10001198 | Ga0207688_1000119810 | 376 |
| 1107 | 3300025915 | Ga0207693_10023553 | Ga0207693_100235536 | 376 |
| 1108 | 3300025961 | Ga0207712_10055949 | Ga0207712_100559492 | 376 |
| 1109 | 3300026041 | Ga0207639_10327121 | Ga0207639_103271211 | 376 |
| 1110 | 3300026078 | Ga0207702_10076268 | Ga0207702_100762682 | 376 |
| 1111 | 3300026078 | Ga0207702_10121393 | Ga0207702_101213931 | 376 |
| 1112 | 3300026095 | Ga0207676_10096247 | Ga0207676_100962473 | 376 |
| 1113 | 3300026116 | Ga0207674_10209722 | Ga0207674_102097221 | 376 |
| 1114 | 3300026121 | Ga0207683_10010950 | Ga0207683_100109505 | 376 |
| 1115 | 3300026142 | Ga0207698_10078047 | Ga0207698_100780473 | 376 |
| 1116 | 3300032126 | Ga0307415_100058151 | Ga0307415_1000581512 | 376 |
| 1117 | 3300035111 | Ga0373923_0046191 | Ga0373923_0046191_78_1232 | 376 |
| 1118 | 3300035410 | Ga0373924_0101325 | Ga0373924_0101325_58_1212 | 376 |
| 1119 | 3300035724 | Ga0373933_0145104 | Ga0373933_0145104_164_1318 | 376 |
| 1120 | 3300036401 | Ga0373937_0053289 | Ga0373937_0053289_2001_3161 | 376 |
| 1121 | 3300037068 | Ga0373925_0002970 | Ga0373925_0002970_7741_8895 | 376 |
| 1122 | 3300037853 | Ga0436364_0201210 | Ga0436364_0201210_17210_18391 | 376 |
| 1123 | 3300039450 | Ga0436363_1096919 | Ga0436363_1096919_1490_2644 | 376 |
| 1124 | 3300044765 | Ga0466970_0015762 | Ga0466970_0015762_660_1805 | 376 |
| 1125 | 3300044842 | Ga0466957_0026802 | Ga0466957_0026802_1737_2891 | 376 |
| 1126 | 3300044842 | Ga0466957_0082198 | Ga0466957_0082198_383_1537 | 376 |
| 1127 | 3300045836 | Ga0466958_0098283 | Ga0466958_0098283_103_1257 | 376 |
| 1128 | 3300046460 | Ga0495638_0013391 | Ga0495638_0013391_2217_3389 | 376 |
| 1129 | 3300046511 | Ga0495608_0029635 | Ga0495608_0029635_1009_2163 | 376 |
| 1130 | 3300046516 | Ga0495628_0048568 | Ga0495628_0048568_1021_2175 | 376 |
| 1131 | 3300046533 | Ga0495640_0067625 | Ga0495640_0067625_465_1625 | 376 |
| 1132 | 3300046536 | Ga0495587_0004723 | Ga0495587_0004723_3344_4498 | 376 |
| 1133 | 3300046543 | Ga0495645_0086313 | Ga0495645_0086313_29_1189 | 376 |
| 1134 | 3300046543 | Ga0495645_0090177 | Ga0495645_0090177_748_1902 | 376 |
| 1135 | 3300046559 | Ga0495667_0003986 | Ga0495667_0003986_999_2153 | 376 |
| 1136 | 3300046663 | Ga0495635_0004670 | Ga0495635_0004670_256_1410 | 376 |
| 1137 | 3300046675 | Ga0495657_0026413 | Ga0495657_0026413_652_1806 | 376 |
| 1138 | 3300046678 | Ga0495599_0057963 | Ga0495599_0057963_303_1457 | 376 |
| 1139 | 3300046680 | Ga0495646_0116672 | Ga0495646_0116672_291_1445 | 376 |
| 1140 | 3300046809 | Ga0495600_0030735 | Ga0495600_0030735_2022_3176 | 376 |
| 1141 | 3300047315 | Ga0495581_0108469 | Ga0495581_0108469_338_1495 | 376 |
| 1142 | 3300047319 | Ga0495674_0048622 | Ga0495674_0048622_473_1633 | 376 |
| 1143 | 3300047322 | Ga0495680_0003752 | Ga0495680_0003752_4048_5202 | 376 |
| 1144 | 3300047471 | Ga0495684_0003656 | Ga0495684_0003656_3642_4796 | 376 |
| 1145 | 3300048904 | Ga0496101_0186990 | Ga0496101_0186990_35_1222 | 376 |
| 1146 | 3300048905 | Ga0496102_0121639 | Ga0496102_0121639_1227_2414 | 376 |
| 1147 | 3300048907 | Ga0496104_0008359 | Ga0496104_0008359_897_2084 | 376 |
| 1148 | 3300048910 | Ga0496107_0017857 | Ga0496107_0017857_3220_4407 | 376 |
| 1149 | 3300048914 | Ga0496111_0021088 | Ga0496111_0021088_248_1435 | 376 |
| 1150 | 3300048916 | Ga0496113_0014532 | Ga0496113_0014532_3867_5054 | 376 |
| 1151 | 3300049572 | Ga0501036_0032192 | Ga0501036_0032192_3063_4220 | 376 |
| 1152 | 3300049582 | Ga0501048_0057917 | Ga0501048_0057917_670_1827 | 376 |
| 1153 | 3300049588 | Ga0501072_0080501 | Ga0501072_0080501_803_1960 | 376 |
| 1154 | 3300049591 | Ga0501075_0016388 | Ga0501075_0016388_3092_4249 | 376 |
| 1155 | 3300049592 | Ga0501076_0062608 | Ga0501076_0062608_158_1315 | 376 |
| 1156 | 3300049593 | Ga0501077_0097904 | Ga0501077_0097904_330_1499 | 376 |
| 1157 | 3300049593 | Ga0501077_0146462 | Ga0501077_0146462_114_1271 | 376 |
| 1158 | 3300049743 | Ga0501081_0023218 | Ga0501081_0023218_1083_2240 | 376 |
| 1159 | 3300049822 | Ga0501035_0076635 | Ga0501035_0076635_1451_2608 | 376 |
| 1160 | 3300049824 | Ga0501045_0001364 | Ga0501045_0001364_1562_2719 | 376 |
| 1161 | 3300050510 | nmdc:mga06r32_35394_c1 | nmdc:mga06r32_35394_c1_957_2144 | 376 |
| 1162 | 3300053085 | Ga0495619_0106288 | Ga0495619_0106288_203_1357 | 376 |
| 1163 | 3300053153 | Ga0500616_0069850 | Ga0500616_0069850_225_1397 | 376 |
| 1164 | 3300054114 | Ga0501084_0003411 | Ga0501084_0003411_1945_3102 | 376 |
| 1165 | 3300060353 | Ga0501082_0026489 | Ga0501082_0026489_1441_2598 | 376 |
| 1166 | 3300061719 | Ga0466962_0060835 | Ga0466962_0060835_260_1414 | 376 |
| 1167 | 3300000545 | CNXas_1001085 | CNXas_10010852 | 379 |
| 1168 | 3300031251 | Ga0265327_10000274 | Ga0265327_100002746 | 379 |
| 1169 | 3300044693 | Ga0466961_0014531 | Ga0466961_0014531_1552_2712 | 379 |
| 1170 | 3300045836 | Ga0466958_0005084 | Ga0466958_0005084_3505_4665 | 379 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ol2-assembly2.cif.gz_F | the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile | 0.9481 | 6 | 373 |
| 2vig-assembly1.cif.gz_A | crystal structure of human short-chain acyl coa dehydrogenase | 0.9474 | 5 | 374 |
| 3mpi-assembly2.cif.gz_C | structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex | 0.9397 | 1 | 377 |
| 1rx0-assembly1.cif.gz_C | crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. | 0.9363 | 2 | 375 |
| 2a1t-assembly1.cif.gz_D | structure of the human mcad:etf e165betaa complex | 0.9343 | 5 | 378 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQG3_234_382_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9832 | 236 | 372 | 1.20.140.10 |
| af_P9WQG3_2_120_1.10.540.10 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9743 | 5 | 117 | 1.10.540.10 |
| af_Q4CLQ5_90_238_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.969 | 236 | 374 | 1.20.140.10 |
| 3mpjB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9604 | 232 | 372 | 1.20.140.10 |
| af_P96397_240_357_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9598 | 238 | 345 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J6VZ32-F1-model_v4 | Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) | 0.9684 | 1 | 379 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A0J6VZ32-F1-model_v4 | Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) | 0.9659 | 1 | 379 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A6I0FAM6-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9611 | 5 | 379 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-A0A2N5GDE7-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9566 | 1 | 379 |
GO:0003995
GO:0050660 |
| AF-A0A544TDJ9-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9547 | 5 | 374 |
GO:0003995
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar