F491151

General Info

Members Datasets Scaffolds Average Seq Length
1170 505 1058 370

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0004642|Ga0495651_0004642_4108_5352
Length 409
Sequence MDRADRAWPAKNKQAGLFLLCPPGRLADMSFVEPEERVALRQAVRDLAKRYGPDYVRRQAKAGLKSTELWDEVGRAGYLGVSLPEEYGIADLAAVGEELARAGCPLLLIVVSPAICGTIISRFGTEAQKRKWLPGIADGSFTMAFGITEPDAGSNSHQITTTVRRDGDEWVLSGQKVFISGVDEADAVLVVSRTKDGATGNLKPALMVVPTDAPGFTRTMIDMEIAGPEKQFQLFFDDVRLPADALIGDEDAGLLQLFAGLNPERIMASAFAIGTAKYALDRAAEYAKTRTVWRDRPIGTHQGVAHPLAQAAIHVELAKVMTQKAAWLYDSGDDFAAGEAANMAKFASADAAVEAVDQAIQTHGGNGLATEYGLAPLLAATRVTRIAPVSREMILNFVAQHTLGLPKSY

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2619618881 Frankia sp. ACN1ag Isolate Unclassified
7 2619619003 Frankia sp. CpI1-P Isolate Nodule
8 2626541554 Frankia sp. AvcI.1 Isolate Nodule
9 2643221561 Nocardioides sp. Root151 Isolate Unclassified
10 2643221576 Nocardioides sp. Root614 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221590 Nocardioides sp. Root682 Isolate Unclassified
14 2643221604 Nocardioides sp. Root190 Isolate Unclassified
15 2643221615 Nocardioides sp. Root224 Isolate Unclassified
16 2643221617 Nocardioides sp. Root79 Isolate Unclassified
17 2643221620 Nocardioides sp. Root240 Isolate Unclassified
18 2643221641 Nocardioides sp. Root122 Isolate Unclassified
19 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
20 2643221670 Streptomyces sp. Root431 Isolate Unclassified
21 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
22 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
23 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
24 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
25 2643221696 Nocardioides sp. Root140 Isolate Unclassified
26 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
27 2643221714 Streptomyces sp. Root264 Isolate Unclassified
28 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
29 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
30 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
31 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
32 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
33 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
34 2738541305 Nocardioides sp. CF167 Isolate Unclassified
35 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
36 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
37 2739367898 Nocardioides sp. CF479 Isolate Unclassified
38 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
39 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
40 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
41 2773857933 Frankia sp. BMG5.30 Isolate Nodule
42 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
43 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
44 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
45 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
46 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
47 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
48 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
49 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
50 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
51 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
52 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
53 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
54 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
55 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
56 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
57 2862574272 Streptomyces sp. AcE210 Isolate Nodule
58 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
59 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
60 2867428634 Streptomyces sp. RP5T Isolate Unclassified
61 2867475112 Streptomyces sp. TM32 Isolate Unclassified
62 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
63 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
64 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
65 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
66 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
67 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
68 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
69 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
70 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
71 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
72 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
73 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
74 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
75 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
76 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
77 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
78 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
79 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
80 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
81 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
82 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
83 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
84 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
85 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
86 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
87 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
88 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
89 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
90 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
91 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
92 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
93 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
94 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
95 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
98 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
102 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
103 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
106 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
116 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
117 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
122 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
123 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
130 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
131 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
132 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
137 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
144 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
149 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
150 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
151 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
152 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
155 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
156 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
159 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
160 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
161 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
162 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
165 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
166 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
167 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
168 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
169 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
170 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
171 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
185 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
186 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
187 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
188 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
189 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
190 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
191 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
192 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
193 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
194 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
195 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
196 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
197 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
200 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
201 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
264 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
265 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
266 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
267 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
268 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
269 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
281 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
282 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
283 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
286 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
289 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
290 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
291 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
292 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
314 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
315 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
316 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
317 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
318 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
319 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
320 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
321 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
322 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
323 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
324 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
325 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
326 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
327 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
328 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
329 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
330 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
331 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
332 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
333 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
334 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
335 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
336 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
337 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
338 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
339 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
340 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
360 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
361 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
367 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
368 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
369 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
370 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
371 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
374 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
375 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
376 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
377 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
378 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
379 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
397 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
401 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
446 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
461 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
462 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
465 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
466 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
467 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
468 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
469 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
470 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
471 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
472 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
473 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
476 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
477 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
489 8002775197 Frankia nepalensis CN7 Isolate Nodule
490 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
491 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
492 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
493 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
494 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
495 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
496 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
497 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
498 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
499 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
500 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
501 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
502 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
503 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
504 8054920844 Frankia tisae Agncl-8 Isolate Nodule
505 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.89
Metatranscriptomes 1.54
Isolates 9.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 2.91
Nodule 1.03
Rhizoplane 5.13
Rhizosphere 80.26
Stem 0
Stem Tuber 0.09
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001085 3300000545 Bacteria 1795
2 JGI24738J21930_10009989 3300002075 Bacteria 2123
3 rootH2_10022528 3300003320 Bacteria 3270
4 rootH2_10150640 3300003320 Bacteria 1419
5 JGI25160J50197_1016270 3300003354 Bacteria 2402
6 Ga0006562J51391_1051951 3300003578 Bacteria 9000
7 Ga0006562J51391_1051956 3300003578 Bacteria 2700
8 Ga0006562J51391_1116078 3300003578 Bacteria 12055
9 Ga0006562J51391_1116083 3300003578 Bacteria 4900
10 JGI25404J52841_10009330 3300003659 Bacteria 2097
11 Ga0055540_1000022 3300003792 Bacteria 201257
12 Ga0055540_1000060 3300003792 Bacteria 131775
13 Ga0070658_10005788 3300005327 Bacteria 10025
14 Ga0070658_10114254 3300005327 Bacteria 2238
15 Ga0070658_10121263 3300005327 Bacteria 2173
16 Ga0070683_100011058 3300005329 Bacteria 7780
17 Ga0070683_100016218 3300005329 Bacteria 6564
18 Ga0070683_100019998 3300005329 Bacteria 5952
19 Ga0070683_100069913 3300005329 Bacteria 3274
20 Ga0070683_100090665 3300005329 Bacteria 2870
21 Ga0070670_100094393 3300005331 Bacteria 2573
22 Ga0070680_100074698 3300005336 Bacteria 2789
23 Ga0070680_100225827 3300005336 Bacteria 1581
24 Ga0070682_100010596 3300005337 Bacteria 5235
25 Ga0070682_100068936 3300005337 Unclassified 2257
26 Ga0070660_100039774 3300005339 Bacteria 3575
27 Ga0070660_100059112 3300005339 Bacteria 2973
28 Ga0070660_100074360 3300005339 Bacteria 2658
29 Ga0070660_100243378 3300005339 Bacteria 1466
30 Ga0070687_100093523 3300005343 Bacteria 1668
31 Ga0070661_100022430 3300005344 Bacteria 4520
32 Ga0070692_10024089 3300005345 Bacteria 2989
33 Ga0070668_100094399 3300005347 Bacteria 2361
34 Ga0070675_100190681 3300005354 Bacteria 1776
35 Ga0070671_100000399 3300005355 Bacteria 29938
36 Ga0070671_100118890 3300005355 Bacteria 2223
37 Ga0070673_100127747 3300005364 Bacteria 2129
38 Ga0070673_100304409 3300005364 Bacteria 1404
39 Ga0070659_100178516 3300005366 Bacteria 1742
40 Ga0070667_100002542 3300005367 Bacteria 15875
41 Ga0070667_100179936 3300005367 Bacteria 1869
42 Ga0070709_10002604 3300005434 Bacteria 9744
43 Ga0070709_10002855 3300005434 Bacteria 9343
44 Ga0070709_10025009 3300005434 Bacteria 3523
45 Ga0070714_100000192 3300005435 Bacteria 49531
46 Ga0070714_100001420 3300005435 Bacteria 17388
47 Ga0070714_100080416 3300005435 Bacteria 2836
48 Ga0070714_100111955 3300005435 Bacteria 2418
49 Ga0070713_100143620 3300005436 Bacteria 2116
50 Ga0070713_100155913 3300005436 Bacteria 2035
51 Ga0070710_10000119 3300005437 Bacteria 37136
52 Ga0070710_10007794 3300005437 Bacteria 5197
53 Ga0070701_10010173 3300005438 Bacteria 4148
54 Ga0070711_100041461 3300005439 Bacteria 3109
55 Ga0070711_100049614 3300005439 Bacteria 2874
56 Ga0070711_100071711 3300005439 Bacteria 2442
57 Ga0070711_100186327 3300005439 Bacteria 1591
58 Ga0070711_100231411 3300005439 Bacteria 1441
59 Ga0070700_100000033 3300005441 Bacteria 114863
60 Ga0070700_100000681 3300005441 Bacteria 16777
61 Ga0070700_100001719 3300005441 Bacteria 10986
62 Ga0070694_100132577 3300005444 Bacteria 1802
63 Ga0070708_100058155 3300005445 Bacteria 3444
64 Ga0070708_100065007 3300005445 Bacteria 3270
65 Ga0070708_100102844 3300005445 Bacteria 2618
66 Ga0070708_100116712 3300005445 Bacteria 2458
67 Ga0070708_100129663 3300005445 Bacteria 2333
68 Ga0070663_100009372 3300005455 Bacteria 6060
69 Ga0070663_100061733 3300005455 Bacteria 2700
70 Ga0070663_100073466 3300005455 Bacteria 2494
71 Ga0070678_100083931 3300005456 Bacteria 2423
72 Ga0070681_10011047 3300005458 Bacteria 8927
73 Ga0070685_10024594 3300005466 Bacteria 3309
74 Ga0070706_100029291 3300005467 Bacteria 5073
75 Ga0070706_100048489 3300005467 Bacteria 3920
76 Ga0070706_100115508 3300005467 Bacteria 2499
77 Ga0070706_100253873 3300005467 Bacteria 1642
78 Ga0070698_100000387 3300005471 Bacteria 46238
79 Ga0070698_100001963 3300005471 Bacteria 22848
80 Ga0070698_100002657 3300005471 Bacteria 19715
81 Ga0070698_100005449 3300005471 Bacteria 13900
82 Ga0070698_100008703 3300005471 Bacteria 10933
83 Ga0070698_100015358 3300005471 Bacteria 8092
84 Ga0070699_100001693 3300005518 Bacteria 20068
85 Ga0070684_100025696 3300005535 Bacteria 4953
86 Ga0070684_100246365 3300005535 Bacteria 1633
87 Ga0070697_100002299 3300005536 Bacteria 14671
88 Ga0068853_100113216 3300005539 Bacteria 2412
89 Ga0070672_100151294 3300005543 Bacteria 1920
90 Ga0070686_100026870 3300005544 Bacteria 3478
91 Ga0070686_100038936 3300005544 Bacteria 2959
92 Ga0070695_100164235 3300005545 Bacteria 1561
93 Ga0070693_100096105 3300005547 Bacteria 1795
94 Ga0070665_100130765 3300005548 Bacteria 2512
95 Ga0068855_100039642 3300005563 Bacteria 5591
96 Ga0068855_100108506 3300005563 Bacteria 3188
97 Ga0070664_100066221 3300005564 Bacteria 3084
98 Ga0068857_100052746 3300005577 Bacteria 3607
99 Ga0068857_100145327 3300005577 Bacteria 2146
100 Ga0068856_100026991 3300005614 Bacteria 5602
101 Ga0068856_100132178 3300005614 Bacteria 2501
102 Ga0068856_100446439 3300005614 Bacteria 1314
103 Ga0070702_100002173 3300005615 Bacteria 8351
104 Ga0070702_100132068 3300005615 Bacteria 1578
105 Ga0068852_100033058 3300005616 Bacteria 4290
106 Ga0068852_100327673 3300005616 Bacteria 1489
107 Ga0068864_100021017 3300005618 Bacteria 5465
108 Ga0068864_100024230 3300005618 Bacteria 5103
109 Ga0068864_100118475 3300005618 Bacteria 2364
110 Ga0068851_10070312 3300005834 Bacteria 1810
111 Ga0068863_100076234 3300005841 Bacteria 3172
112 Ga0068863_100142424 3300005841 Bacteria 2292
113 Ga0068858_100008064 3300005842 Bacteria 10142
114 Ga0068858_100386285 3300005842 Bacteria 1344
115 Ga0068860_100035062 3300005843 Bacteria 4814
116 Ga0068860_100212008 3300005843 Bacteria 1879
117 Ga0068862_100142200 3300005844 Bacteria 2130
118 Ga0081455_10000273 3300005937 Bacteria 68345
119 Ga0081455_10000480 3300005937 Bacteria 51756
120 Ga0081455_10010997 3300005937 Bacteria 9119
121 Ga0081455_10162152 3300005937 Bacteria 1712
122 Ga0081540_1000251 3300005983 Bacteria 56572
123 Ga0081540_1004108 3300005983 Bacteria 11236
124 Ga0081539_10015563 3300005985 Bacteria 5518
125 Ga0070717_10004480 3300006028 Bacteria 10091
126 Ga0070717_10019840 3300006028 Bacteria 5278
127 Ga0075365_10062234 3300006038 Bacteria 2495
128 Ga0075365_10062984 3300006038 Bacteria 2482
129 Ga0075365_10097606 3300006038 Bacteria 2009
130 Ga0075365_10139772 3300006038 Bacteria 1681
131 Ga0075363_100000236 3300006048 Bacteria 15495
132 Ga0075363_100021242 3300006048 Bacteria 3266
133 Ga0075363_100112970 3300006048 Bacteria 1511
134 Ga0075364_10000270 3300006051 Bacteria 25296
135 Ga0075364_10111026 3300006051 Bacteria 1830
136 Ga0070715_10002088 3300006163 Bacteria 6040
137 Ga0070715_10084394 3300006163 Bacteria 1448
138 Ga0070716_100001616 3300006173 Bacteria 10157
139 Ga0070716_100004393 3300006173 Bacteria 6738
140 Ga0070712_100001096 3300006175 Bacteria 16300
141 Ga0070712_100010761 3300006175 Bacteria 5783
142 Ga0070712_100067807 3300006175 Bacteria 2540
143 Ga0075362_10085424 3300006177 Bacteria 1459
144 Ga0075369_10041175 3300006186 Bacteria 1977
145 Ga0075370_10043626 3300006353 Bacteria 2534
146 Ga0068871_100169919 3300006358 Bacteria 1868
147 Ga0075428_100002078 3300006844 Bacteria 21607
148 Ga0075428_100009631 3300006844 Bacteria 10726
149 Ga0075428_100032010 3300006844 Bacteria 5810
150 Ga0075428_100052109 3300006844 Bacteria 4487
151 Ga0075428_100085800 3300006844 Bacteria 3434
152 Ga0075428_100270273 3300006844 Bacteria 1829
153 Ga0075430_100000279 3300006846 Bacteria 35927
154 Ga0075430_100010653 3300006846 Bacteria 7791
155 Ga0075430_100014467 3300006846 Bacteria 6722
156 Ga0075430_100016395 3300006846 Bacteria 6309
157 Ga0075430_100037166 3300006846 Bacteria 4128
158 Ga0075430_100088387 3300006846 Bacteria 2593
159 Ga0075430_100137042 3300006846 Bacteria 2039
160 Ga0075431_100082966 3300006847 Bacteria 3309
161 Ga0075431_100096916 3300006847 Bacteria 3045
162 Ga0075431_100101797 3300006847 Bacteria 2964
163 Ga0075431_100102607 3300006847 Bacteria 2952
164 Ga0075431_100163216 3300006847 Bacteria 2290
165 Ga0075431_100230562 3300006847 Bacteria 1887
166 Ga0075429_100044816 3300006880 Bacteria 3848
167 Ga0075429_100062205 3300006880 Bacteria 3252
168 Ga0075429_100090988 3300006880 Bacteria 2661
169 Ga0068865_100011636 3300006881 Bacteria 5513
170 Ga0068865_100170251 3300006881 Bacteria 1669
171 Ga0075436_100076442 3300006914 Bacteria 2318
172 Ga0105251_10007408 3300009011 Bacteria 6764
173 Ga0105240_10036032 3300009093 Bacteria 6371
174 Ga0105240_10096255 3300009093 Bacteria 3608
175 Ga0111539_10532486 3300009094 Bacteria 1369
176 Ga0111539_10582360 3300009094 Bacteria 1303
177 Ga0105245_10009265 3300009098 Bacteria 8587
178 Ga0105245_10026851 3300009098 Bacteria 5070
179 Ga0105245_10042060 3300009098 Bacteria 4076
180 Ga0114129_10000184 3300009147 Bacteria 69831
181 Ga0114129_10083453 3300009147 Bacteria 4438
182 Ga0114129_10140886 3300009147 Bacteria 3306
183 Ga0114129_10211324 3300009147 Bacteria 2623
184 Ga0114129_10325631 3300009147 Bacteria 2042
185 Ga0114129_10343298 3300009147 Bacteria 1980
186 Ga0105241_10002543 3300009174 Bacteria 13688
187 Ga0105241_10227964 3300009174 Bacteria 1569
188 Ga0105242_10190723 3300009176 Bacteria 1814
189 Ga0105248_10022567 3300009177 Bacteria 6984
190 Ga0105248_10077006 3300009177 Bacteria 3749
191 Ga0105248_10190455 3300009177 Bacteria 2311
192 Ga0105248_10525356 3300009177 Bacteria 1335
193 Ga0105237_10000385 3300009545 Bacteria 62800
194 Ga0105237_10001712 3300009545 Bacteria 28358
195 Ga0105237_10003886 3300009545 Bacteria 17538
196 Ga0105237_10016595 3300009545 Bacteria 7648
197 Ga0105237_10142149 3300009545 Bacteria 2394
198 Ga0105237_10236455 3300009545 Bacteria 1828
199 Ga0105238_10181196 3300009551 Bacteria 2083
200 Ga0105249_10036751 3300009553 Bacteria 4443
201 Ga0105249_10104615 3300009553 Bacteria 2667
202 Ga0105239_10004355 3300010375 Bacteria 16960
203 Ga0105239_10021851 3300010375 Bacteria 7054
204 Ga0105239_10117212 3300010375 Bacteria 2956
205 Ga0105239_10127640 3300010375 Bacteria 2828
206 Ga0105239_10154865 3300010375 Bacteria 2559
207 Ga0105239_10245862 3300010375 Bacteria 2009
208 Ga0105239_10387897 3300010375 Bacteria 1580
209 Ga0105246_10022684 3300011119 Bacteria 4053
210 Ga0157370_10019049 3300013104 Bacteria 6898
211 Ga0157369_10098639 3300013105 Bacteria 3115
212 Ga0157374_10030832 3300013296 Bacteria 4870
213 Ga0157374_10155370 3300013296 Bacteria 2226
214 Ga0157372_10000004 3300013307 Bacteria 435659
215 Ga0157375_10023922 3300013308 Bacteria 5644
216 Ga0157375_10122181 3300013308 Bacteria 2715
217 Ga0157375_10136271 3300013308 Bacteria 2579
218 Ga0157375_10306763 3300013308 Bacteria 1751
219 Ga0163163_10065892 3300014325 Bacteria 3596
220 Ga0163163_10097671 3300014325 Bacteria 2958
221 Ga0163163_10109287 3300014325 Bacteria 2792
222 Ga0157380_10074641 3300014326 Bacteria 2753
223 Ga0157380_10154227 3300014326 Bacteria 1989
224 Ga0182008_10003431 3300014497 Bacteria 9569
225 Ga0182008_10044341 3300014497 Bacteria 2211
226 Ga0157377_10023955 3300014745 Bacteria 3242
227 Ga0157377_10120847 3300014745 Bacteria 1587
228 Ga0157379_10128818 3300014968 Bacteria 2277
229 Ga0157379_10135958 3300014968 Bacteria 2215
230 Ga0157376_10294314 3300014969 Bacteria 1534
231 Ga0182006_1008344 3300015261 Bacteria 4695
232 Ga0183367_1005 3300015688 Bacteria 652063
233 Ga0206354_11292861 3300020081 Bacteria 1237
234 Ga0206353_10485089 3300020082 Bacteria 3861
235 Ga0206353_10727382 3300020082 Bacteria 1351
236 Ga0206353_11429297 3300020082 Bacteria 2374
237 Ga0213876_10027796 3300021384 Bacteria 2983
238 Ga0213875_10000341 3300021388 Bacteria 44027
239 Ga0213875_10000443 3300021388 Bacteria 36140
240 Ga0213875_10004207 3300021388 Bacteria 7950
241 Ga0213875_10014440 3300021388 Bacteria 3854
242 Ga0213875_10022735 3300021388 Bacteria 2998
243 Ga0213875_10025198 3300021388 Bacteria 2835
244 Ga0213875_10026873 3300021388 Bacteria 2738
245 Ga0213875_10032702 3300021388 Bacteria 2457
246 Ga0224712_10002142 3300022467 Bacteria 4804
247 Ga0207426_1002193 3300025302 Bacteria 13159
248 Ga0207426_1005887 3300025302 Bacteria 5458
249 Ga0209051_1000033 3300025303 Bacteria 380540
250 Ga0209051_1000149 3300025303 Bacteria 132185
251 Ga0209051_1026594 3300025303 Bacteria 2328
252 Ga0207697_10022659 3300025315 Bacteria 2572
253 Ga0207713_1040811 3300025735 Bacteria 1943
254 Ga0207653_10021501 3300025885 Bacteria 2046
255 Ga0207692_10000731 3300025898 Bacteria 11587
256 Ga0207688_10001198 3300025901 Bacteria 13408
257 Ga0207688_10031595 3300025901 Bacteria 2924
258 Ga0207647_10009986 3300025904 Bacteria 6723
259 Ga0207647_10036803 3300025904 Bacteria 3107
260 Ga0207685_10000827 3300025905 Bacteria 5759
261 Ga0207699_10003262 3300025906 Bacteria 7728
262 Ga0207699_10005748 3300025906 Bacteria 5967
263 Ga0207699_10186244 3300025906 Bacteria 1398
264 Ga0207643_10002654 3300025908 Bacteria 9672
265 Ga0207705_10042992 3300025909 Bacteria 3245
266 Ga0207705_10093491 3300025909 Bacteria 2204
267 Ga0207705_10164411 3300025909 Bacteria 1668
268 Ga0207684_10037530 3300025910 Bacteria 4111
269 Ga0207684_10186380 3300025910 Bacteria 1789
270 Ga0207684_10235209 3300025910 Bacteria 1581
271 Ga0207684_10264070 3300025910 Bacteria 1485
272 Ga0207654_10048124 3300025911 Bacteria 2439
273 Ga0207695_10008695 3300025913 Bacteria 12665
274 Ga0207695_10049275 3300025913 Bacteria 4442
275 Ga0207671_10002091 3300025914 Bacteria 21853
276 Ga0207671_10004746 3300025914 Bacteria 12826
277 Ga0207671_10006836 3300025914 Bacteria 10070
278 Ga0207671_10018178 3300025914 Bacteria 5401
279 Ga0207671_10072609 3300025914 Bacteria 2568
280 Ga0207693_10000911 3300025915 Bacteria 26527
281 Ga0207693_10023553 3300025915 Bacteria 4888
282 Ga0207693_10036848 3300025915 Bacteria 3857
283 Ga0207693_10061517 3300025915 Bacteria 2941
284 Ga0207693_10137513 3300025915 Bacteria 1921
285 Ga0207693_10174266 3300025915 Bacteria 1693
286 Ga0207663_10000286 3300025916 Bacteria 22144
287 Ga0207663_10069316 3300025916 Bacteria 2268
288 Ga0207663_10111126 3300025916 Bacteria 1860
289 Ga0207660_10170236 3300025917 Bacteria 1685
290 Ga0207662_10006419 3300025918 Bacteria 6344
291 Ga0207657_10027499 3300025919 Bacteria 5208
292 Ga0207657_10061614 3300025919 Bacteria 3215
293 Ga0207646_10016205 3300025922 Bacteria 7003
294 Ga0207694_10006958 3300025924 Bacteria 8588
295 Ga0207694_10034238 3300025924 Bacteria 3895
296 Ga0207650_10036629 3300025925 Bacteria 3570
297 Ga0207650_10250162 3300025925 Bacteria 1435
298 Ga0207659_10245249 3300025926 Bacteria 1451
299 Ga0207687_10015059 3300025927 Bacteria 5065
300 Ga0207700_10043803 3300025928 Bacteria 3290
301 Ga0207664_10000028 3300025929 Bacteria 188245
302 Ga0207664_10004412 3300025929 Bacteria 9527
303 Ga0207664_10013195 3300025929 Bacteria 5920
304 Ga0207664_10016850 3300025929 Bacteria 5342
305 Ga0207664_10029351 3300025929 Bacteria 4188
306 Ga0207664_10045694 3300025929 Bacteria 3435
307 Ga0207664_10054994 3300025929 Bacteria 3156
308 Ga0207664_10306092 3300025929 Bacteria 1399
309 Ga0207644_10001153 3300025931 Bacteria 16935
310 Ga0207644_10068549 3300025931 Bacteria 2588
311 Ga0207690_10269930 3300025932 Bacteria 1321
312 Ga0207686_10034246 3300025934 Bacteria 3039
313 Ga0207709_10138697 3300025935 Bacteria 1669
314 Ga0207670_10050823 3300025936 Bacteria 2780
315 Ga0207669_10145992 3300025937 Bacteria 1650
316 Ga0207665_10001704 3300025939 Bacteria 14776
317 Ga0207665_10002796 3300025939 Bacteria 11696
318 Ga0207665_10064935 3300025939 Bacteria 2481
319 Ga0207691_10225211 3300025940 Bacteria 1625
320 Ga0207711_10111646 3300025941 Bacteria 2432
321 Ga0207711_10114808 3300025941 Bacteria 2399
322 Ga0207711_10276961 3300025941 Bacteria 1544
323 Ga0207689_10005326 3300025942 Bacteria 11532
324 Ga0207661_10001544 3300025944 Bacteria 15656
325 Ga0207661_10008204 3300025944 Bacteria 7454
326 Ga0207661_10148400 3300025944 Bacteria 2025
327 Ga0207661_10164640 3300025944 Bacteria 1926
328 Ga0207661_10274438 3300025944 Bacteria 1505
329 Ga0207679_10096164 3300025945 Bacteria 2304
330 Ga0207679_10144663 3300025945 Bacteria 1926
331 Ga0207651_10255558 3300025960 Bacteria 1436
332 Ga0207712_10055949 3300025961 Bacteria 2778
333 Ga0207640_10124025 3300025981 Bacteria 1856
334 Ga0207658_10006962 3300025986 Bacteria 7698
335 Ga0207658_10027583 3300025986 Bacteria 3991
336 Ga0207677_10116564 3300026023 Bacteria 2000
337 Ga0207703_10005581 3300026035 Bacteria 10098
338 Ga0207703_10145264 3300026035 Bacteria 2062
339 Ga0207639_10327121 3300026041 Bacteria 1363
340 Ga0207708_10000004 3300026075 Bacteria 293087
341 Ga0207708_10000511 3300026075 Bacteria 29928
342 Ga0207708_10010498 3300026075 Bacteria 6875
343 Ga0207702_10076268 3300026078 Bacteria 2898
344 Ga0207702_10121393 3300026078 Bacteria 2339
345 Ga0207702_10122071 3300026078 Bacteria 2333
346 Ga0207641_10181629 3300026088 Bacteria 1927
347 Ga0207641_10239164 3300026088 Bacteria 1691
348 Ga0207648_10018964 3300026089 Bacteria 6213
349 Ga0207676_10092276 3300026095 Bacteria 2490
350 Ga0207676_10096247 3300026095 Bacteria 2443
351 Ga0207676_10289779 3300026095 Bacteria 1490
352 Ga0207674_10061251 3300026116 Bacteria 3803
353 Ga0207674_10175584 3300026116 Bacteria 2095
354 Ga0207674_10209722 3300026116 Bacteria 1897
355 Ga0207675_100002095 3300026118 Bacteria 19806
356 Ga0207683_10000264 3300026121 Bacteria 46774
357 Ga0207683_10010950 3300026121 Bacteria 7735
358 Ga0207698_10078047 3300026142 Bacteria 2657
359 Ga0207698_10213861 3300026142 Bacteria 1736
360 Ga0268266_10000297 3300028379 Bacteria 80133
361 Ga0268266_10004062 3300028379 Bacteria 14146
362 Ga0268266_10055947 3300028379 Bacteria 3393
363 Ga0268266_10097157 3300028379 Bacteria 2590
364 Ga0268266_10181253 3300028379 Bacteria 1918
365 Ga0268265_10051630 3300028380 Bacteria 3105
366 Ga0268264_10245417 3300028381 Bacteria 1661
367 Ga0265336_10014160 3300028666 Bacteria 2646
368 Ga0265336_10030675 3300028666 Bacteria 1674
369 Ga0307515_10232096 3300028794 Bacteria 1635
370 Ga0265338_10003557 3300028800 Bacteria 21782
371 Ga0316177_1078543 3300030731 Bacteria 7048
372 Ga0316176_1182197 3300030732 Bacteria 2247
373 Ga0265320_10076281 3300031240 Bacteria 1571
374 Ga0265327_10000274 3300031251 Bacteria 101723
375 Ga0265327_10000566 3300031251 Bacteria 62909
376 Ga0265327_10005854 3300031251 Bacteria 10058
377 Ga0265327_10007949 3300031251 Bacteria 8026
378 Ga0265327_10012472 3300031251 Bacteria 5730
379 Ga0307513_10001629 3300031456 Bacteria 32145
380 Ga0307513_10013188 3300031456 Bacteria 10152
381 Ga0307513_10031541 3300031456 Bacteria 5999
382 Ga0307513_10046377 3300031456 Bacteria 4738
383 Ga0307513_10115253 3300031456 Bacteria 2670
384 Ga0307513_10124907 3300031456 Bacteria 2531
385 Ga0307509_10130256 3300031507 Bacteria 2473
386 Ga0307508_10029541 3300031616 Bacteria 4954
387 Ga0316578_10040140 3300031728 Bacteria 2704
388 Ga0307405_10007322 3300031731 Bacteria 5505
389 Ga0307413_10020555 3300031824 Bacteria 3515
390 Ga0307518_10019364 3300031838 Bacteria 4889
391 Ga0307406_10055468 3300031901 Bacteria 2533
392 Ga0307412_10101159 3300031911 Bacteria 2039
393 Ga0307409_100038568 3300031995 Bacteria 3535
394 Ga0307416_100002333 3300032002 Bacteria 10849
395 Ga0307416_100112187 3300032002 Bacteria 2406
396 Ga0307414_10182368 3300032004 Bacteria 1690
397 Ga0307415_100000334 3300032126 Bacteria 20322
398 Ga0307415_100027877 3300032126 Bacteria 3585
399 Ga0307415_100058151 3300032126 Bacteria 2661
400 Ga0307415_100104352 3300032126 Bacteria 2088
401 Ga0307507_10043371 3300033179 Bacteria 4464
402 Ga0307507_10050890 3300033179 Bacteria 3993
403 Ga0373959_0007164 3300034820 Bacteria 1871
404 Ga0373926_0000994 3300035083 Bacteria 8263
405 Ga0373926_0001597 3300035083 Bacteria 6974
406 Ga0373934_0000021 3300035086 Bacteria 53680
407 Ga0373934_0014480 3300035086 Bacteria 2989
408 Ga0373934_0014619 3300035086 Bacteria 2974
409 Ga0373944_0000931 3300035089 Bacteria 7250
410 Ga0373944_0019099 3300035089 Bacteria 1964
411 Ga0373923_0006087 3300035111 Bacteria 4145
412 Ga0373923_0046191 3300035111 Bacteria 1811
413 Ga0373936_0001598 3300035113 Bacteria 8273
414 Ga0373936_0006015 3300035113 Bacteria 4573
415 Ga0373945_0000887 3300035116 Bacteria 8843
416 Ga0373953_0000208 3300035117 Bacteria 15869
417 Ga0373953_0010112 3300035117 Bacteria 3271
418 Ga0373954_0003993 3300035118 Bacteria 6308
419 Ga0373954_0016140 3300035118 Bacteria 3341
420 Ga0373956_0001684 3300035119 Bacteria 9104
421 Ga0373957_0000240 3300035120 Bacteria 13672
422 Ga0373957_0004970 3300035120 Bacteria 4095
423 Ga0373943_0000433 3300035170 Bacteria 17675
424 Ga0373943_0000668 3300035170 Bacteria 14898
425 Ga0373943_0106056 3300035170 Bacteria 1476
426 Ga0373946_0001834 3300035171 Bacteria 7425
427 Ga0373946_0007641 3300035171 Bacteria 3959
428 Ga0373955_0000092 3300035172 Bacteria 36115
429 Ga0373955_0039034 3300035172 Bacteria 2532
430 Ga0373955_0156313 3300035172 Bacteria 1343
431 Ga0373942_0001767 3300035207 Bacteria 5470
432 Ga0373942_0028635 3300035207 Bacteria 1457
433 Ga0373961_0007699 3300035241 Bacteria 2610
434 Ga0316574_0067887 3300035398 Bacteria 2248
435 Ga0316574_0107546 3300035398 Bacteria 1787
436 Ga0373924_0001270 3300035410 Bacteria 8095
437 Ga0373924_0004310 3300035410 Bacteria 4965
438 Ga0373924_0101325 3300035410 Bacteria 1239
439 Ga0373927_0000850 3300035695 Bacteria 23303
440 Ga0373927_0065892 3300035695 Bacteria 2342
441 Ga0373933_0000366 3300035724 Bacteria 28850
442 Ga0373933_0047490 3300035724 Bacteria 2553
443 Ga0373933_0145104 3300035724 Bacteria 1500
444 Ga0373933_0229000 3300035724 Bacteria 1193
445 Ga0373947_0006092 3300035725 Bacteria 7024
446 Ga0373937_0000169 3300036401 Bacteria 63595
447 Ga0373937_0037668 3300036401 Bacteria 4407
448 Ga0373937_0053289 3300036401 Bacteria 3711
449 Ga0373937_0128154 3300036401 Bacteria 2369
450 Ga0373937_0289444 3300036401 Bacteria 1547
451 Ga0373937_0296786 3300036401 Bacteria 1527
452 Ga0373937_0413086 3300036401 Bacteria 1280
453 Ga0373925_0002970 3300037068 Bacteria 13390
454 Ga0373925_0149580 3300037068 Bacteria 1832
455 Ga0373925_0228546 3300037068 Bacteria 1487
456 Ga0395900_0008528 3300037418 Bacteria 10534
457 Ga0395900_0013835 3300037418 Bacteria 8234
458 Ga0395900_0041531 3300037418 Bacteria 4741
459 Ga0395900_0074250 3300037418 Bacteria 3497
460 Ga0395900_0106822 3300037418 Bacteria 2876
461 Ga0395900_0141460 3300037418 Bacteria 2464
462 Ga0395900_0310219 3300037418 Bacteria 1561
463 Ga0395898_0004050 3300037466 Bacteria 16108
464 Ga0395898_0006827 3300037466 Bacteria 12140
465 Ga0395898_0125014 3300037466 Bacteria 2464
466 Ga0395898_0136157 3300037466 Bacteria 2352
467 Ga0395898_0426969 3300037466 Bacteria 1263
468 Ga0395905_0017993 3300037471 Bacteria 6709
469 Ga0436364_0070962 3300037853 Bacteria 23054
470 Ga0436364_0141518 3300037853 Bacteria 7713
471 Ga0436364_0201210 3300037853 Bacteria 60188
472 Ga0436364_0816924 3300037853 Bacteria 15997
473 Ga0436364_0936746 3300037853 Bacteria 31021
474 Ga0436364_1206830 3300037853 Bacteria 4070
475 Ga0436364_1563654 3300037853 Bacteria 5080
476 Ga0395901_0031390 3300038443 Bacteria 5479
477 Ga0395901_0054448 3300038443 Bacteria 4158
478 Ga0395901_0081432 3300038443 Bacteria 3381
479 Ga0395901_0096903 3300038443 Bacteria 3091
480 Ga0400483_006444 3300039062 Bacteria 13556
481 Ga0436365_0346317 3300039437 Bacteria 1664
482 Ga0436365_0556984 3300039437 Bacteria 2297
483 Ga0436363_1096919 3300039450 Bacteria 4613
484 Ga0436362_0815789 3300039453 Bacteria 1653
485 Ga0439436_0001972 3300041404 Bacteria 6084
486 Ga0439465_0008224 3300041413 Bacteria 3293
487 Ga0439465_0026681 3300041413 Bacteria 1828
488 Ga0451797_1175257 3300041453 Bacteria 1277
489 Ga0451833_0347183 3300041491 Bacteria 11313
490 Ga0451833_0579776 3300041491 Bacteria 14024
491 Ga0451837_0453617 3300041494 Bacteria 5236
492 Ga0451837_1227407 3300041494 Bacteria 1830
493 Ga0451837_1855256 3300041494 Bacteria 1295
494 Ga0451839_1348762 3300041496 Bacteria 3609
495 Ga0451841_0636182 3300041498 Bacteria 1697
496 Ga0451853_0096484 3300041512 Bacteria 7363
497 Ga0451853_0520998 3300041512 Bacteria 3444
498 Ga0451853_2105047 3300041512 Bacteria 3341
499 Ga0451853_3575533 3300041512 Bacteria 8991
500 Ga0439433_0000517 3300041999 Bacteria 7246
501 Ga0439448_0004601 3300042005 Bacteria 3902
502 Ga0439432_027315 3300042006 Bacteria 1864
503 Ga0439457_001264 3300042014 Bacteria 7581
504 Ga0439457_006917 3300042014 Bacteria 2744
505 Ga0439462_0000793 3300042015 Bacteria 6567
506 Ga0450894_000158 3300042131 Bacteria 11965
507 Ga0450896_002075 3300042133 Bacteria 2553
508 Ga0450898_000485 3300042134 Bacteria 4630
509 Ga0450899_000424 3300042135 Bacteria 4715
510 Ga0450906_004270 3300042145 Bacteria 3001
511 Ga0450908_010034 3300042184 Bacteria 1752
512 Ga0439434_0016740 3300042435 Bacteria 2191
513 Ga0466969_0079676 3300044656 Bacteria 1565
514 Ga0466972_0005263 3300044658 Bacteria 6477
515 Ga0466972_0029503 3300044658 Bacteria 2700
516 Ga0466972_0064138 3300044658 Bacteria 1759
517 Ga0466965_0000282 3300044683 Bacteria 16749
518 Ga0466965_0014556 3300044683 Bacteria 3725
519 Ga0466965_0022450 3300044683 Bacteria 3042
520 Ga0466965_0034221 3300044683 Bacteria 2485
521 Ga0466965_0043620 3300044683 Bacteria 2215
522 Ga0466965_0043867 3300044683 Bacteria 2209
523 Ga0466965_0048192 3300044683 Bacteria 2110
524 Ga0466966_0004077 3300044684 Bacteria 9646
525 Ga0466966_0011511 3300044684 Bacteria 5868
526 Ga0466966_0021414 3300044684 Bacteria 4245
527 Ga0466966_0037031 3300044684 Bacteria 3148
528 Ga0466966_0280613 3300044684 Bacteria 1002
529 Ga0466961_0008226 3300044693 Bacteria 6642
530 Ga0466961_0012530 3300044693 Bacteria 5427
531 Ga0466961_0014531 3300044693 Bacteria 5059
532 Ga0466961_0030609 3300044693 Bacteria 3459
533 Ga0466961_0047652 3300044693 Bacteria 2740
534 Ga0466961_0071435 3300044693 Bacteria 2202
535 Ga0466961_0083796 3300044693 Bacteria 2017
536 Ga0466961_0088258 3300044693 Bacteria 1959
537 Ga0466961_0107490 3300044693 Bacteria 1756
538 Ga0466961_0144609 3300044693 Bacteria 1487
539 Ga0466963_0004036 3300044694 Bacteria 8493
540 Ga0466963_0004428 3300044694 Bacteria 8162
541 Ga0466963_0020953 3300044694 Bacteria 4119
542 Ga0466963_0032600 3300044694 Bacteria 3375
543 Ga0466963_0032883 3300044694 Bacteria 3362
544 Ga0466963_0045398 3300044694 Bacteria 2894
545 Ga0466963_0103365 3300044694 Bacteria 1952
546 Ga0466963_0131756 3300044694 Bacteria 1728
547 Ga0466963_0138807 3300044694 Bacteria 1683
548 Ga0466963_0164051 3300044694 Bacteria 1547
549 Ga0466964_0004070 3300044706 Bacteria 5380
550 Ga0466964_0013734 3300044706 Bacteria 3074
551 Ga0466964_0015273 3300044706 Bacteria 2922
552 Ga0466964_0018329 3300044706 Bacteria 2686
553 Ga0466971_0009420 3300044719 Bacteria 4264
554 Ga0466971_0019399 3300044719 Bacteria 3019
555 Ga0466971_0021415 3300044719 Bacteria 2877
556 Ga0466971_0084465 3300044719 Bacteria 1450
557 Ga0466971_0153351 3300044719 Bacteria 1076
558 Ga0466968_0015159 3300044735 Bacteria 3053
559 Ga0466970_0000600 3300044765 Bacteria 17664
560 Ga0466970_0014063 3300044765 Bacteria 4104
561 Ga0466970_0015762 3300044765 Bacteria 3891
562 Ga0466970_0033587 3300044765 Bacteria 2711
563 Ga0466970_0053211 3300044765 Bacteria 2162
564 Ga0466970_0054439 3300044765 Bacteria 2136
565 Ga0466970_0086939 3300044765 Bacteria 1695
566 Ga0466970_0088787 3300044765 Bacteria 1676
567 Ga0466970_0101908 3300044765 Bacteria 1564
568 Ga0466970_0107705 3300044765 Bacteria 1521
569 Ga0466957_0001424 3300044842 Bacteria 12485
570 Ga0466957_0010202 3300044842 Bacteria 5380
571 Ga0466957_0026802 3300044842 Bacteria 3421
572 Ga0466957_0029857 3300044842 Bacteria 3253
573 Ga0466957_0031279 3300044842 Bacteria 3180
574 Ga0466957_0036938 3300044842 Bacteria 2939
575 Ga0466957_0056816 3300044842 Bacteria 2394
576 Ga0466957_0082198 3300044842 Bacteria 2007
577 Ga0466957_0118406 3300044842 Bacteria 1686
578 Ga0466960_0000512 3300044901 Bacteria 13309
579 Ga0466960_0003036 3300044901 Bacteria 6409
580 Ga0466960_0010489 3300044901 Bacteria 3850
581 Ga0466960_0017687 3300044901 Bacteria 3114
582 Ga0466960_0059460 3300044901 Bacteria 1870
583 Ga0466960_0258362 3300044901 Bacteria 970
584 Ga0466959_0000556 3300045049 Bacteria 21663
585 Ga0466959_0010190 3300045049 Bacteria 6710
586 Ga0466959_0059397 3300045049 Bacteria 2784
587 Ga0466959_0066847 3300045049 Bacteria 2607
588 Ga0466959_0068503 3300045049 Bacteria 2571
589 Ga0466959_0104564 3300045049 Bacteria 2025
590 Ga0466959_0178175 3300045049 Bacteria 1488
591 Ga0466958_0001433 3300045836 Bacteria 11303
592 Ga0466958_0005084 3300045836 Bacteria 7028
593 Ga0466958_0007686 3300045836 Bacteria 5945
594 Ga0466958_0015028 3300045836 Bacteria 4428
595 Ga0466958_0028932 3300045836 Bacteria 3287
596 Ga0466958_0031299 3300045836 Bacteria 3162
597 Ga0466958_0067962 3300045836 Bacteria 2178
598 Ga0466958_0080183 3300045836 Bacteria 2008
599 Ga0466958_0098283 3300045836 Bacteria 1817
600 Ga0466967_0004195 3300045976 Bacteria 9658
601 Ga0466967_0009093 3300045976 Bacteria 7348
602 Ga0466967_0019133 3300045976 Bacteria 5499
603 Ga0466967_0025149 3300045976 Bacteria 4906
604 Ga0466967_0048632 3300045976 Bacteria 3705
605 Ga0466967_0052996 3300045976 Bacteria 3564
606 Ga0466967_0062368 3300045976 Bacteria 3309
607 Ga0466967_0125828 3300045976 Bacteria 2374
608 Ga0466967_0156915 3300045976 Bacteria 2132
609 Ga0466967_0204268 3300045976 Bacteria 1872
610 Ga0466967_0235245 3300045976 Bacteria 1745
611 Ga0495592_0000070 3300046454 Bacteria 93255
612 Ga0495592_0003761 3300046454 Bacteria 10953
613 Ga0495592_0019076 3300046454 Bacteria 5220
614 Ga0495592_0054001 3300046454 Bacteria 2978
615 Ga0495592_0075543 3300046454 Bacteria 2447
616 Ga0495603_0001078 3300046455 Bacteria 15811
617 Ga0495603_0029572 3300046455 Bacteria 3303
618 Ga0495603_0042945 3300046455 Bacteria 2701
619 Ga0495603_0140210 3300046455 Bacteria 1406
620 Ga0495629_0033578 3300046459 Bacteria 3629
621 Ga0495629_0038574 3300046459 Bacteria 3364
622 Ga0495629_0068708 3300046459 Bacteria 2473
623 Ga0495629_0102359 3300046459 Bacteria 1998
624 Ga0495629_0118484 3300046459 Bacteria 1845
625 Ga0495629_0137347 3300046459 Bacteria 1702
626 Ga0495638_0002768 3300046460 Bacteria 14093
627 Ga0495638_0013391 3300046460 Bacteria 5584
628 Ga0495641_0007988 3300046461 Bacteria 6521
629 Ga0495651_0000042 3300046462 Bacteria 93255
630 Ga0495651_0001340 3300046462 Bacteria 19069
631 Ga0495651_0004043 3300046462 Bacteria 11213
632 Ga0495651_0004642 3300046462 Bacteria 10508
633 Ga0495651_0005285 3300046462 Bacteria 9843
634 Ga0495651_0011356 3300046462 Bacteria 6844
635 Ga0495653_0004255 3300046463 Bacteria 11599
636 Ga0495653_0004341 3300046463 Bacteria 11467
637 Ga0495653_0007576 3300046463 Bacteria 8876
638 Ga0495653_0033959 3300046463 Bacteria 4038
639 Ga0495653_0073109 3300046463 Bacteria 2559
640 Ga0495653_0104079 3300046463 Bacteria 2051
641 Ga0495653_0190790 3300046463 Bacteria 1398
642 Ga0495650_0009549 3300046471 Bacteria 5509
643 Ga0495580_0005682 3300046472 Bacteria 10259
644 Ga0495582_0009339 3300046473 Bacteria 5402
645 Ga0495582_0049238 3300046473 Bacteria 2320
646 Ga0495582_0163062 3300046473 Bacteria 1268
647 Ga0495639_0002234 3300046475 Bacteria 8511
648 Ga0495639_0005243 3300046475 Bacteria 5571
649 Ga0495639_0076021 3300046475 Bacteria 1557
650 Ga0495662_0005674 3300046476 Bacteria 6237
651 Ga0495662_0047963 3300046476 Bacteria 2062
652 Ga0495664_0002240 3300046477 Bacteria 10355
653 Ga0495664_0020949 3300046477 Bacteria 3774
654 Ga0495664_0058993 3300046477 Bacteria 2284
655 Ga0495584_0088049 3300046491 Bacteria 1565
656 Ga0495585_0057795 3300046492 Bacteria 2140
657 Ga0495594_0008847 3300046499 Bacteria 5191
658 Ga0495594_0044866 3300046499 Bacteria 2426
659 Ga0495594_0056745 3300046499 Bacteria 2162
660 Ga0495594_0063609 3300046499 Bacteria 2044
661 Ga0495606_0016107 3300046507 Bacteria 5721
662 Ga0495608_0000054 3300046511 Bacteria 93255
663 Ga0495608_0001336 3300046511 Bacteria 17579
664 Ga0495608_0017004 3300046511 Bacteria 5032
665 Ga0495608_0029635 3300046511 Bacteria 3710
666 Ga0495618_0030747 3300046514 Bacteria 3355
667 Ga0495618_0031013 3300046514 Bacteria 3342
668 Ga0495618_0200496 3300046514 Bacteria 1263
669 Ga0495628_0000106 3300046516 Bacteria 67965
670 Ga0495628_0003697 3300046516 Bacteria 13636
671 Ga0495628_0006638 3300046516 Bacteria 10091
672 Ga0495628_0023177 3300046516 Bacteria 5098
673 Ga0495628_0029558 3300046516 Bacteria 4441
674 Ga0495628_0048568 3300046516 Bacteria 3363
675 Ga0495628_0057402 3300046516 Bacteria 3062
676 Ga0495628_0146392 3300046516 Bacteria 1801
677 Ga0495630_0001894 3300046517 Bacteria 14558
678 Ga0495630_0016231 3300046517 Bacteria 5440
679 Ga0495630_0026681 3300046517 Bacteria 4279
680 Ga0495630_0032403 3300046517 Bacteria 3894
681 Ga0495631_0086630 3300046518 Bacteria 1349
682 Ga0495666_0024816 3300046526 Bacteria 2961
683 Ga0495652_0000119 3300046529 Bacteria 85582
684 Ga0495652_0000962 3300046529 Bacteria 32990
685 Ga0495652_0002560 3300046529 Bacteria 18621
686 Ga0495652_0020277 3300046529 Bacteria 5910
687 Ga0495652_0039120 3300046529 Bacteria 4102
688 Ga0495652_0044200 3300046529 Bacteria 3837
689 Ga0495652_0073854 3300046529 Bacteria 2838
690 Ga0495652_0083865 3300046529 Bacteria 2622
691 Ga0495665_0001352 3300046531 Bacteria 13106
692 Ga0495665_0048891 3300046531 Bacteria 2242
693 Ga0495640_0014615 3300046533 Bacteria 5932
694 Ga0495640_0015422 3300046533 Bacteria 5750
695 Ga0495640_0020297 3300046533 Bacteria 4894
696 Ga0495640_0059033 3300046533 Bacteria 2615
697 Ga0495640_0067625 3300046533 Bacteria 2406
698 Ga0495640_0138922 3300046533 Bacteria 1567
699 Ga0495586_0015987 3300046535 Bacteria 3993
700 Ga0495586_0086626 3300046535 Bacteria 1726
701 Ga0495587_0000119 3300046536 Bacteria 60244
702 Ga0495587_0004723 3300046536 Bacteria 8939
703 Ga0495587_0013279 3300046536 Bacteria 5177
704 Ga0495587_0055200 3300046536 Bacteria 2340
705 Ga0495645_0036471 3300046543 Bacteria 3584
706 Ga0495645_0045633 3300046543 Bacteria 3198
707 Ga0495645_0051614 3300046543 Bacteria 2992
708 Ga0495645_0086313 3300046543 Bacteria 2246
709 Ga0495645_0090177 3300046543 Bacteria 2191
710 Ga0495645_0120160 3300046543 Bacteria 1850
711 Ga0495645_0134109 3300046543 Bacteria 1733
712 Ga0495645_0156060 3300046543 Bacteria 1581
713 Ga0495645_0230733 3300046543 Bacteria 1240
714 Ga0495622_0027746 3300046557 Bacteria 2642
715 Ga0495667_0000114 3300046559 Bacteria 58520
716 Ga0495667_0003986 3300046559 Bacteria 9912
717 Ga0495667_0020524 3300046559 Bacteria 4456
718 Ga0495667_0039390 3300046559 Bacteria 3142
719 Ga0495667_0057369 3300046559 Bacteria 2559
720 Ga0495667_0102519 3300046559 Bacteria 1850
721 Ga0495667_0114283 3300046559 Bacteria 1744
722 Ga0495667_0118811 3300046559 Bacteria 1707
723 Ga0495634_0005589 3300046642 Bacteria 9645
724 Ga0495634_0015214 3300046642 Bacteria 5531
725 Ga0495634_0065783 3300046642 Bacteria 2401
726 Ga0495634_0102555 3300046642 Bacteria 1848
727 Ga0495625_0083268 3300046660 Bacteria 2224
728 Ga0495635_0000410 3300046663 Bacteria 27259
729 Ga0495635_0004670 3300046663 Bacteria 9512
730 Ga0495635_0014535 3300046663 Bacteria 5506
731 Ga0495635_0023234 3300046663 Bacteria 4321
732 Ga0495635_0026174 3300046663 Bacteria 4062
733 Ga0495635_0034337 3300046663 Bacteria 3517
734 Ga0495635_0211567 3300046663 Bacteria 1313
735 Ga0495588_0005715 3300046674 Bacteria 5548
736 Ga0495588_0024140 3300046674 Bacteria 3018
737 Ga0495657_0000067 3300046675 Bacteria 93255
738 Ga0495657_0015104 3300046675 Bacteria 5659
739 Ga0495657_0026413 3300046675 Bacteria 4111
740 Ga0495657_0027454 3300046675 Bacteria 4016
741 Ga0495657_0032809 3300046675 Bacteria 3620
742 Ga0495657_0062497 3300046675 Bacteria 2460
743 Ga0495657_0079194 3300046675 Bacteria 2128
744 Ga0495657_0109277 3300046675 Bacteria 1753
745 Ga0495599_0000042 3300046678 Bacteria 94912
746 Ga0495599_0003359 3300046678 Bacteria 9349
747 Ga0495599_0057963 3300046678 Bacteria 2423
748 Ga0495599_0065362 3300046678 Bacteria 2272
749 Ga0495623_0002839 3300046679 Bacteria 11421
750 Ga0495623_0015065 3300046679 Bacteria 4998
751 Ga0495623_0036803 3300046679 Bacteria 3135
752 Ga0495646_0008843 3300046680 Bacteria 6395
753 Ga0495646_0009579 3300046680 Bacteria 6149
754 Ga0495646_0087206 3300046680 Bacteria 1809
755 Ga0495646_0116672 3300046680 Bacteria 1514
756 Ga0495658_0011380 3300046683 Bacteria 4473
757 Ga0495658_0024875 3300046683 Bacteria 3195
758 Ga0495658_0165922 3300046683 Bacteria 1364
759 Ga0495613_0012310 3300046689 Bacteria 6354
760 Ga0495613_0023097 3300046689 Bacteria 4635
761 Ga0495613_0026890 3300046689 Bacteria 4283
762 Ga0495624_0007418 3300046690 Bacteria 7693
763 Ga0495624_0024215 3300046690 Bacteria 3997
764 Ga0495624_0036400 3300046690 Bacteria 3173
765 Ga0495670_0044445 3300046691 Bacteria 2218
766 Ga0495589_0042177 3300046794 Bacteria 2274
767 Ga0495600_0003923 3300046809 Bacteria 8837
768 Ga0495600_0022970 3300046809 Bacteria 4010
769 Ga0495600_0025737 3300046809 Bacteria 3792
770 Ga0495600_0030735 3300046809 Bacteria 3478
771 Ga0495581_0000844 3300047315 Bacteria 16332
772 Ga0495581_0108469 3300047315 Bacteria 1614
773 Ga0495604_0000121 3300047317 Bacteria 65991
774 Ga0495604_0015027 3300047317 Bacteria 6176
775 Ga0495604_0030089 3300047317 Bacteria 4316
776 Ga0495604_0058706 3300047317 Bacteria 2953
777 Ga0495604_0070928 3300047317 Bacteria 2637
778 Ga0495604_0112127 3300047317 Bacteria 1987
779 Ga0495636_0075127 3300047318 Bacteria 1448
780 Ga0495674_0013463 3300047319 Bacteria 7692
781 Ga0495674_0048622 3300047319 Bacteria 3752
782 Ga0495674_0051826 3300047319 Bacteria 3616
783 Ga0495674_0103594 3300047319 Bacteria 2419
784 Ga0495674_0166701 3300047319 Bacteria 1840
785 Ga0495676_0027812 3300047321 Bacteria 4844
786 Ga0495676_0036181 3300047321 Bacteria 4125
787 Ga0495676_0054455 3300047321 Bacteria 3180
788 Ga0495676_0064593 3300047321 Bacteria 2844
789 Ga0495680_0000054 3300047322 Bacteria 93244
790 Ga0495680_0003673 3300047322 Bacteria 14986
791 Ga0495680_0003752 3300047322 Bacteria 14802
792 Ga0495680_0005407 3300047322 Bacteria 12028
793 Ga0495680_0013023 3300047322 Bacteria 7275
794 Ga0495680_0032607 3300047322 Bacteria 4225
795 Ga0495680_0033747 3300047322 Bacteria 4140
796 Ga0495680_0092880 3300047322 Bacteria 2259
797 Ga0495683_0000585 3300047323 Bacteria 27495
798 Ga0495687_019515 3300047443 Bacteria 3324
799 Ga0495675_0000176 3300047444 Bacteria 46587
800 Ga0495675_0023505 3300047444 Bacteria 3927
801 Ga0495675_0033598 3300047444 Bacteria 3274
802 Ga0495675_0079930 3300047444 Bacteria 2059
803 Ga0495675_0241486 3300047444 Bacteria 1087
804 Ga0495684_0001955 3300047471 Bacteria 16551
805 Ga0495684_0003123 3300047471 Bacteria 12985
806 Ga0495684_0003656 3300047471 Bacteria 11982
807 Ga0495684_0009313 3300047471 Bacteria 7581
808 Ga0495684_0013396 3300047471 Bacteria 6312
809 Ga0495684_0087413 3300047471 Bacteria 2362
810 Ga0495686_0019765 3300047472 Bacteria 4497
811 Ga0495593_0000862 3300047673 Bacteria 17564
812 Ga0495593_0057885 3300047673 Bacteria 2034
813 Ga0495593_0096202 3300047673 Bacteria 1522
814 Ga0495602_0000083 3300048088 Bacteria 93242
815 Ga0495602_0019576 3300048088 Bacteria 6716
816 Ga0495602_0036862 3300048088 Bacteria 4545
817 Ga0495602_0052846 3300048088 Bacteria 3604
818 Ga0495614_0002807 3300048089 Bacteria 7749
819 Ga0496100_0013250 3300048903 Bacteria 4748
820 Ga0496100_0057190 3300048903 Bacteria 2554
821 Ga0496101_0114612 3300048904 Bacteria 2032
822 Ga0496101_0121509 3300048904 Bacteria 1975
823 Ga0496101_0148113 3300048904 Bacteria 1794
824 Ga0496101_0186990 3300048904 Bacteria 1597
825 Ga0496102_0000263 3300048905 Bacteria 67095
826 Ga0496102_0018543 3300048905 Bacteria 6117
827 Ga0496102_0096331 3300048905 Bacteria 2743
828 Ga0496102_0121639 3300048905 Bacteria 2438
829 Ga0496102_0145751 3300048905 Bacteria 2222
830 Ga0496102_0219377 3300048905 Bacteria 1792
831 Ga0496102_0406771 3300048905 Bacteria 1279
832 Ga0496104_0002025 3300048907 Bacteria 17601
833 Ga0496104_0008359 3300048907 Bacteria 9198
834 Ga0496104_0031076 3300048907 Bacteria 4965
835 Ga0496104_0048446 3300048907 Bacteria 4006
836 Ga0496104_0063449 3300048907 Bacteria 3504
837 Ga0496104_0277753 3300048907 Bacteria 1588
838 Ga0496105_0017243 3300048908 Bacteria 5784
839 Ga0496105_0047247 3300048908 Bacteria 3552
840 Ga0496105_0060507 3300048908 Bacteria 3125
841 Ga0496105_0074525 3300048908 Bacteria 2804
842 Ga0496105_0112794 3300048908 Bacteria 2244
843 Ga0496105_0220998 3300048908 Bacteria 1542
844 Ga0496105_0270906 3300048908 Bacteria 1371
845 Ga0496106_0097744 3300048909 Bacteria 2273
846 Ga0496107_0017857 3300048910 Bacteria 4993
847 Ga0496107_0037547 3300048910 Bacteria 3476
848 Ga0496107_0040353 3300048910 Bacteria 3350
849 Ga0496108_0041662 3300048911 Bacteria 3834
850 Ga0496108_0108639 3300048911 Bacteria 2370
851 Ga0496109_0018389 3300048912 Bacteria 6141
852 Ga0496109_0021669 3300048912 Bacteria 5686
853 Ga0496109_0084625 3300048912 Bacteria 2926
854 Ga0496109_0085370 3300048912 Bacteria 2913
855 Ga0496109_0121134 3300048912 Bacteria 2437
856 Ga0496109_0196419 3300048912 Bacteria 1896
857 Ga0496110_0037673 3300048913 Bacteria 4204
858 Ga0496110_0040580 3300048913 Bacteria 4056
859 Ga0496111_0021088 3300048914 Bacteria 4545
860 Ga0496111_0022063 3300048914 Bacteria 4453
861 Ga0496112_0002456 3300048915 Bacteria 14946
862 Ga0496112_0002788 3300048915 Bacteria 14185
863 Ga0496112_0121966 3300048915 Bacteria 2577
864 Ga0496112_0173958 3300048915 Bacteria 2118
865 Ga0496112_0182609 3300048915 Bacteria 2061
866 Ga0496113_0000626 3300048916 Bacteria 17778
867 Ga0496113_0005086 3300048916 Bacteria 8169
868 Ga0496113_0014532 3300048916 Bacteria 5374
869 Ga0496113_0030602 3300048916 Bacteria 3898
870 Ga0496113_0091797 3300048916 Bacteria 2341
871 Ga0496113_0103800 3300048916 Bacteria 2205
872 Ga0496114_0022382 3300048917 Bacteria 5151
873 Ga0496114_0063435 3300048917 Bacteria 3094
874 Ga0496114_0125698 3300048917 Bacteria 2210
875 Ga0496114_0209494 3300048917 Bacteria 1709
876 Ga0496115_0014024 3300048918 Bacteria 6066
877 Ga0496119_0015582 3300048922 Bacteria 5839
878 Ga0496123_0021932 3300048926 Bacteria 4943
879 Ga0496126_0000036 3300048929 Bacteria 354901
880 Ga0496126_0013957 3300048929 Bacteria 8146
881 Ga0496126_0018493 3300048929 Bacteria 6901
882 Ga0496126_0096202 3300048929 Bacteria 2596
883 Ga0496126_0142193 3300048929 Bacteria 2064
884 Ga0501031_0003245 3300049568 Bacteria 10454
885 Ga0501031_0095617 3300049568 Bacteria 1938
886 Ga0501031_0105563 3300049568 Bacteria 1838
887 Ga0501032_0025500 3300049569 Bacteria 4075
888 Ga0501032_0110917 3300049569 Bacteria 1815
889 Ga0501032_0124489 3300049569 Bacteria 1703
890 Ga0501033_0001361 3300049570 Bacteria 21789
891 Ga0501033_0001790 3300049570 Bacteria 18761
892 Ga0501033_0005042 3300049570 Bacteria 10517
893 Ga0501033_0101095 3300049570 Bacteria 2103
894 Ga0501033_0204059 3300049570 Bacteria 1411
895 Ga0501034_0017417 3300049571 Bacteria 7368
896 Ga0501034_0026995 3300049571 Bacteria 5841
897 Ga0501034_0027076 3300049571 Bacteria 5833
898 Ga0501034_0097799 3300049571 Bacteria 2931
899 Ga0501034_0159396 3300049571 Bacteria 2228
900 Ga0501036_0007027 3300049572 Bacteria 9165
901 Ga0501036_0009260 3300049572 Bacteria 8093
902 Ga0501036_0032192 3300049572 Bacteria 4430
903 Ga0501036_0084244 3300049572 Bacteria 2688
904 Ga0501036_0094749 3300049572 Bacteria 2523
905 Ga0501036_0119005 3300049572 Bacteria 2230
906 Ga0501037_0029643 3300049573 Bacteria 4043
907 Ga0501037_0216543 3300049573 Bacteria 1349
908 Ga0501038_0001063 3300049574 Bacteria 24793
909 Ga0501038_0002102 3300049574 Bacteria 18461
910 Ga0501038_0115015 3300049574 Bacteria 2224
911 Ga0501039_0073375 3300049575 Bacteria 2659
912 Ga0501043_0050608 3300049579 Bacteria 3265
913 Ga0501043_0075950 3300049579 Bacteria 2639
914 Ga0501046_0085768 3300049580 Bacteria 2427
915 Ga0501046_0087836 3300049580 Bacteria 2395
916 Ga0501046_0172247 3300049580 Bacteria 1624
917 Ga0501047_0000088 3300049581 Bacteria 117495
918 Ga0501047_0000354 3300049581 Bacteria 52008
919 Ga0501047_0004122 3300049581 Bacteria 13676
920 Ga0501047_0019106 3300049581 Bacteria 6575
921 Ga0501047_0033092 3300049581 Bacteria 4991
922 Ga0501047_0039386 3300049581 Bacteria 4571
923 Ga0501047_0057065 3300049581 Bacteria 3776
924 Ga0501047_0061266 3300049581 Bacteria 3630
925 Ga0501047_0117172 3300049581 Bacteria 2545
926 Ga0501047_0193336 3300049581 Bacteria 1898
927 Ga0501047_0244542 3300049581 Bacteria 1644
928 Ga0501048_0056423 3300049582 Bacteria 2787
929 Ga0501048_0057917 3300049582 Bacteria 2747
930 Ga0501048_0135992 3300049582 Bacteria 1737
931 Ga0501067_0007301 3300049583 Bacteria 6136
932 Ga0501067_0008669 3300049583 Bacteria 5637
933 Ga0501067_0022825 3300049583 Bacteria 3464
934 Ga0501067_0024913 3300049583 Bacteria 3318
935 Ga0501068_0009431 3300049584 Bacteria 5462
936 Ga0501068_0017127 3300049584 Bacteria 4188
937 Ga0501068_0057881 3300049584 Bacteria 2351
938 Ga0501068_0140266 3300049584 Bacteria 1515
939 Ga0501069_0093690 3300049585 Bacteria 1700
940 Ga0501069_0108393 3300049585 Bacteria 1580
941 Ga0501070_0009187 3300049586 Bacteria 8356
942 Ga0501070_0018520 3300049586 Bacteria 5842
943 Ga0501070_0026400 3300049586 Bacteria 4871
944 Ga0501070_0140698 3300049586 Bacteria 1992
945 Ga0501070_0283390 3300049586 Bacteria 1352
946 Ga0501071_0035304 3300049587 Bacteria 3561
947 Ga0501071_0043872 3300049587 Bacteria 3207
948 Ga0501072_0010591 3300049588 Bacteria 7023
949 Ga0501072_0016492 3300049588 Bacteria 5674
950 Ga0501072_0039107 3300049588 Bacteria 3725
951 Ga0501072_0080501 3300049588 Bacteria 2581
952 Ga0501073_0009470 3300049589 Bacteria 7190
953 Ga0501073_0017123 3300049589 Bacteria 5249
954 Ga0501073_0021675 3300049589 Bacteria 4629
955 Ga0501073_0049014 3300049589 Bacteria 2962
956 Ga0501074_0002005 3300049590 Bacteria 14031
957 Ga0501074_0017346 3300049590 Bacteria 5222
958 Ga0501074_0089726 3300049590 Bacteria 2201
959 Ga0501075_0016388 3300049591 Bacteria 5338
960 Ga0501075_0280150 3300049591 Bacteria 1270
961 Ga0501076_0052576 3300049592 Bacteria 3227
962 Ga0501076_0062608 3300049592 Bacteria 2963
963 Ga0501076_0073402 3300049592 Bacteria 2740
964 Ga0501076_0295197 3300049592 Bacteria 1328
965 Ga0501077_0020720 3300049593 Bacteria 4163
966 Ga0501077_0045303 3300049593 Bacteria 2794
967 Ga0501077_0097904 3300049593 Bacteria 1859
968 Ga0501077_0146462 3300049593 Bacteria 1498
969 Ga0501079_0038976 3300049741 Bacteria 3665
970 Ga0501080_0022611 3300049742 Bacteria 5824
971 Ga0501080_0022862 3300049742 Bacteria 5796
972 Ga0501080_0027211 3300049742 Bacteria 5318
973 Ga0501081_0023218 3300049743 Bacteria 4156
974 Ga0501083_0002982 3300049744 Bacteria 11752
975 Ga0501083_0033908 3300049744 Bacteria 3493
976 Ga0501083_0094960 3300049744 Bacteria 1968
977 Ga0501035_0003607 3300049822 Bacteria 14775
978 Ga0501035_0005740 3300049822 Bacteria 11709
979 Ga0501035_0024418 3300049822 Bacteria 5544
980 Ga0501035_0031854 3300049822 Bacteria 4802
981 Ga0501035_0044728 3300049822 Bacteria 3985
982 Ga0501035_0048503 3300049822 Bacteria 3808
983 Ga0501035_0057252 3300049822 Bacteria 3475
984 Ga0501035_0058997 3300049822 Bacteria 3418
985 Ga0501035_0076635 3300049822 Bacteria 2957
986 Ga0501035_0118695 3300049822 Bacteria 2314
987 Ga0501035_0285472 3300049822 Bacteria 1394
988 Ga0501044_0004033 3300049823 Bacteria 16468
989 Ga0501044_0013775 3300049823 Bacteria 8739
990 Ga0501044_0026079 3300049823 Bacteria 6190
991 Ga0501044_0033301 3300049823 Bacteria 5416
992 Ga0501044_0035691 3300049823 Bacteria 5205
993 Ga0501044_0051989 3300049823 Bacteria 4224
994 Ga0501044_0062687 3300049823 Bacteria 3800
995 Ga0501044_0118396 3300049823 Bacteria 2652
996 Ga0501045_0001364 3300049824 Bacteria 16238
997 Ga0501045_0035483 3300049824 Bacteria 3621
998 nmdc:mga03683_62862_c1 3300050489 Bacteria 1573
999 nmdc:mga00v17_26489_c1 3300050491 Bacteria 3380
1000 nmdc:mga0yw44_195209_c1 3300050492 Bacteria 1336
1001 nmdc:mga06z11_76044_c1 3300050494 Bacteria 1790
1002 nmdc:mga09592_12762_c1 3300050508 Bacteria 6847
1003 nmdc:mga09592_177_c1 3300050508 Bacteria 45265
1004 nmdc:mga09592_232602_c1 3300050508 Bacteria 1597
1005 nmdc:mga0qj67_1247_c1 3300050509 Bacteria 17793
1006 nmdc:mga0qj67_26683_c1 3300050509 Bacteria 4472
1007 nmdc:mga0qj67_36_c3 3300050509 Bacteria 71496
1008 nmdc:mga06r32_181565_c1 3300050510 Bacteria 2090
1009 nmdc:mga06r32_218963_c1 3300050510 Bacteria 1892
1010 nmdc:mga06r32_29461_c1 3300050510 Bacteria 5145
1011 nmdc:mga06r32_35394_c1 3300050510 Bacteria 4712
1012 nmdc:mga06r32_9191_c1 3300050510 Bacteria 8910
1013 nmdc:mga08x19_71015_c1 3300050514 Bacteria 2269
1014 Ga0495601_0011038 3300053077 Bacteria 5395
1015 Ga0495601_0024892 3300053077 Bacteria 3688
1016 Ga0495612_0001711 3300053078 Bacteria 9001
1017 Ga0495595_0000341 3300053084 Bacteria 17842
1018 Ga0495595_0011202 3300053084 Bacteria 3746
1019 Ga0495595_0012296 3300053084 Bacteria 3595
1020 Ga0495595_0012347 3300053084 Bacteria 3589
1021 Ga0495619_0002180 3300053085 Bacteria 12975
1022 Ga0495619_0008175 3300053085 Bacteria 6618
1023 Ga0495619_0069135 3300053085 Bacteria 2360
1024 Ga0495619_0106288 3300053085 Bacteria 1914
1025 Ga0495619_0149057 3300053085 Bacteria 1613
1026 Ga0500643_000290 3300053087 Bacteria 43109
1027 Ga0500646_0000613 3300053090 Bacteria 10196
1028 Ga0500566_0000593 3300053094 Bacteria 20272
1029 Ga0500556_0001524 3300053104 Bacteria 9519
1030 Ga0500556_0003518 3300053104 Bacteria 4590
1031 Ga0500559_0003009 3300053136 Bacteria 8439
1032 Ga0500573_0094999 3300053140 Bacteria 1681
1033 Ga0500616_0036868 3300053153 Bacteria 2651
1034 Ga0500616_0069850 3300053153 Bacteria 1794
1035 Ga0500627_0019123 3300053158 Bacteria 2723
1036 Ga0501084_0000772 3300054114 Bacteria 24335
1037 Ga0501084_0003411 3300054114 Bacteria 12887
1038 Ga0501084_0020426 3300054114 Bacteria 5522
1039 Ga0501084_0154328 3300054114 Bacteria 1936
1040 Ga0587073_0000923 3300059492 Bacteria 3111
1041 Ga0587082_007356 3300059504 Bacteria 1500
1042 Ga0587088_000572 3300059508 Bacteria 3155
1043 Ga0587091_002082 3300059511 Bacteria 2308
1044 Ga0587113_000431 3300059625 Bacteria 2200
1045 Ga0587067_000648 3300059640 Bacteria 3225
1046 Ga0587072_010902 3300059643 Bacteria 1476
1047 Ga0587079_008019 3300059647 Bacteria 1600
1048 Ga0587071_012313 3300060344 Bacteria 1457
1049 Ga0501082_0026489 3300060353 Bacteria 4997
1050 Ga0501082_0051265 3300060353 Bacteria 3557
1051 Ga0501082_0070952 3300060353 Bacteria 2999
1052 Ga0501082_0246171 3300060353 Bacteria 1556
1053 Ga0466962_0000057 3300061719 Bacteria 46351
1054 Ga0466962_0003856 3300061719 Bacteria 7164
1055 Ga0466962_0060835 3300061719 Bacteria 1803
1056 Ga0466962_0069651 3300061719 Bacteria 1680
1057 Ga0466962_0081198 3300061719 Bacteria 1550
1058 Ga0530510_0132898 3300061734 Bacteria 1831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0258362 Ga0466960_0258362_43_948 287
2 3300046680 Ga0495646_0087206 Ga0495646_0087206_877_1779 289
3 3300047444 Ga0495675_0241486 Ga0495675_0241486_53_955 289
4 3300048908 Ga0496105_0112794 Ga0496105_0112794_876_1910 303
5 3300044684 Ga0466966_0280613 Ga0466966_0280613_44_988 306
6 3300048929 Ga0496126_0142193 Ga0496126_0142193_1099_2052 309
7 3300044719 Ga0466971_0153351 Ga0466971_0153351_29_991 310
8 3300031456 Ga0307513_10115253 Ga0307513_101152531 312
9 3300049586 Ga0501070_0283390 Ga0501070_0283390_15_983 313
10 3300044706 Ga0466964_0018329 Ga0466964_0018329_322_1476 326
11 3300045836 Ga0466958_0080183 Ga0466958_0080183_59_1213 326
12 3300045976 Ga0466967_0019133 Ga0466967_0019133_1525_2673 326
13 3300046459 Ga0495629_0118484 Ga0495629_0118484_676_1830 327
14 3300046499 Ga0495594_0044866 Ga0495594_0044866_1002_2156 327
15 3300049581 Ga0501047_0000088 Ga0501047_0000088_61339_62493 327
16 3300005329 Ga0070683_100069913 Ga0070683_1000699131 330
17 3300005336 Ga0070680_100074698 Ga0070680_1000746982 330
18 3300005339 Ga0070660_100074360 Ga0070660_1000743602 330
19 3300005355 Ga0070671_100118890 Ga0070671_1001188902 330
20 3300005364 Ga0070673_100127747 Ga0070673_1001277472 330
21 3300005444 Ga0070694_100132577 Ga0070694_1001325772 330
22 3300005455 Ga0070663_100073466 Ga0070663_1000734663 330
23 3300005467 Ga0070706_100029291 Ga0070706_1000292913 330
24 3300005518 Ga0070699_100001693 Ga0070699_10000169316 330
25 3300005535 Ga0070684_100025696 Ga0070684_1000256963 330
26 3300005536 Ga0070697_100002299 Ga0070697_1000022995 330
27 3300005544 Ga0070686_100038936 Ga0070686_1000389362 330
28 3300005547 Ga0070693_100096105 Ga0070693_1000961052 330
29 3300005563 Ga0068855_100108506 Ga0068855_1001085062 330
30 3300005564 Ga0070664_100066221 Ga0070664_1000662212 330
31 3300005577 Ga0068857_100052746 Ga0068857_1000527462 330
32 3300005615 Ga0070702_100132068 Ga0070702_1001320682 330
33 3300005616 Ga0068852_100033058 Ga0068852_1000330582 330
34 3300005618 Ga0068864_100118475 Ga0068864_1001184752 330
35 3300005843 Ga0068860_100035062 Ga0068860_1000350622 330
36 3300006163 Ga0070715_10084394 Ga0070715_100843941 330
37 3300006358 Ga0068871_100169919 Ga0068871_1001699192 330
38 3300006846 Ga0075430_100016395 Ga0075430_1000163956 330
39 3300009177 Ga0105248_10190455 Ga0105248_101904552 330
40 3300009553 Ga0105249_10104615 Ga0105249_101046151 330
41 3300013308 Ga0157375_10122181 Ga0157375_101221812 330
42 3300020082 Ga0206353_10727382 Ga0206353_107273822 330
43 3300025917 Ga0207660_10170236 Ga0207660_101702361 330
44 3300025918 Ga0207662_10006419 Ga0207662_100064193 330
45 3300025919 Ga0207657_10061614 Ga0207657_100616142 330
46 3300025922 Ga0207646_10016205 Ga0207646_100162053 330
47 3300025926 Ga0207659_10245249 Ga0207659_102452492 330
48 3300025928 Ga0207700_10043803 Ga0207700_100438033 330
49 3300025931 Ga0207644_10068549 Ga0207644_100685493 330
50 3300025936 Ga0207670_10050823 Ga0207670_100508231 330
51 3300025939 Ga0207665_10064935 Ga0207665_100649352 330
52 3300025942 Ga0207689_10005326 Ga0207689_100053268 330
53 3300025944 Ga0207661_10274438 Ga0207661_102744382 330
54 3300025945 Ga0207679_10144663 Ga0207679_101446632 330
55 3300026075 Ga0207708_10010498 Ga0207708_100104983 330
56 3300026116 Ga0207674_10061251 Ga0207674_100612513 330
57 3300026121 Ga0207683_10000264 Ga0207683_1000026434 330
58 3300028380 Ga0268265_10051630 Ga0268265_100516302 330
59 3300034820 Ga0373959_0007164 Ga0373959_0007164_354_1502 330
60 3300035083 Ga0373926_0001597 Ga0373926_0001597_4403_5551 330
61 3300035089 Ga0373944_0000931 Ga0373944_0000931_2941_4089 330
62 3300035111 Ga0373923_0006087 Ga0373923_0006087_446_1594 330
63 3300035113 Ga0373936_0006015 Ga0373936_0006015_3099_4247 330
64 3300035117 Ga0373953_0010112 Ga0373953_0010112_520_1668 330
65 3300035118 Ga0373954_0016140 Ga0373954_0016140_1971_3119 330
66 3300035170 Ga0373943_0000433 Ga0373943_0000433_16170_17318 330
67 3300035171 Ga0373946_0007641 Ga0373946_0007641_441_1589 330
68 3300035207 Ga0373942_0028635 Ga0373942_0028635_89_1237 330
69 3300035241 Ga0373961_0007699 Ga0373961_0007699_1280_2428 330
70 3300035410 Ga0373924_0004310 Ga0373924_0004310_1463_2611 330
71 3300035695 Ga0373927_0065892 Ga0373927_0065892_10_1158 330
72 3300035724 Ga0373933_0229000 Ga0373933_0229000_14_1162 330
73 3300036401 Ga0373937_0289444 Ga0373937_0289444_59_1207 330
74 3300046454 Ga0495592_0003761 Ga0495592_0003761_6072_7220 330
75 3300046462 Ga0495651_0005285 Ga0495651_0005285_1662_2810 330
76 3300046462 Ga0495651_0011356 Ga0495651_0011356_3307_4455 330
77 3300046463 Ga0495653_0073109 Ga0495653_0073109_1010_2158 330
78 3300046463 Ga0495653_0104079 Ga0495653_0104079_59_1207 330
79 3300046472 Ga0495580_0005682 Ga0495580_0005682_2379_3527 330
80 3300046473 Ga0495582_0009339 Ga0495582_0009339_252_1400 330
81 3300046475 Ga0495639_0002234 Ga0495639_0002234_2793_3941 330
82 3300046476 Ga0495662_0005674 Ga0495662_0005674_2491_3639 330
83 3300046499 Ga0495594_0008847 Ga0495594_0008847_3076_4224 330
84 3300046516 Ga0495628_0029558 Ga0495628_0029558_1322_2470 330
85 3300046517 Ga0495630_0001894 Ga0495630_0001894_7765_8913 330
86 3300046526 Ga0495666_0024816 Ga0495666_0024816_93_1241 330
87 3300046529 Ga0495652_0039120 Ga0495652_0039120_592_1740 330
88 3300046531 Ga0495665_0001352 Ga0495665_0001352_9581_10729 330
89 3300046533 Ga0495640_0014615 Ga0495640_0014615_2125_3273 330
90 3300046535 Ga0495586_0086626 Ga0495586_0086626_59_1207 330
91 3300046536 Ga0495587_0013279 Ga0495587_0013279_1941_3089 330
92 3300046536 Ga0495587_0055200 Ga0495587_0055200_1157_2305 330
93 3300046543 Ga0495645_0120160 Ga0495645_0120160_59_1207 330
94 3300046559 Ga0495667_0039390 Ga0495667_0039390_33_1181 330
95 3300046559 Ga0495667_0102519 Ga0495667_0102519_644_1792 330
96 3300046559 Ga0495667_0114283 Ga0495667_0114283_483_1631 330
97 3300046642 Ga0495634_0065783 Ga0495634_0065783_845_1993 330
98 3300046663 Ga0495635_0026174 Ga0495635_0026174_1883_3031 330
99 3300046675 Ga0495657_0032809 Ga0495657_0032809_1972_3120 330
100 3300046675 Ga0495657_0079194 Ga0495657_0079194_126_1274 330
101 3300046678 Ga0495599_0065362 Ga0495599_0065362_844_1992 330
102 3300046679 Ga0495623_0015065 Ga0495623_0015065_3728_4876 330
103 3300046683 Ga0495658_0011380 Ga0495658_0011380_140_1288 330
104 3300046689 Ga0495613_0012310 Ga0495613_0012310_714_1862 330
105 3300046690 Ga0495624_0007418 Ga0495624_0007418_4055_5203 330
106 3300046809 Ga0495600_0025737 Ga0495600_0025737_2125_3273 330
107 3300047315 Ga0495581_0000844 Ga0495581_0000844_14514_15662 330
108 3300047321 Ga0495676_0027812 Ga0495676_0027812_361_1509 330
109 3300047322 Ga0495680_0003673 Ga0495680_0003673_12789_13937 330
110 3300047322 Ga0495680_0032607 Ga0495680_0032607_815_1963 330
111 3300047471 Ga0495684_0001955 Ga0495684_0001955_2533_3681 330
112 3300047471 Ga0495684_0087413 Ga0495684_0087413_207_1355 330
113 3300047673 Ga0495593_0000862 Ga0495593_0000862_5662_6810 330
114 3300048088 Ga0495602_0019576 Ga0495602_0019576_3980_5128 330
115 3300048089 Ga0495614_0002807 Ga0495614_0002807_3480_4628 330
116 3300048905 Ga0496102_0096331 Ga0496102_0096331_706_1854 330
117 3300048909 Ga0496106_0097744 Ga0496106_0097744_502_1650 330
118 3300048910 Ga0496107_0040353 Ga0496107_0040353_2098_3246 330
119 3300048912 Ga0496109_0085370 Ga0496109_0085370_1197_2345 330
120 3300048913 Ga0496110_0040580 Ga0496110_0040580_2196_3344 330
121 3300048914 Ga0496111_0022063 Ga0496111_0022063_303_1451 330
122 3300050514 nmdc:mga08x19_71015_c1 nmdc:mga08x19_71015_c1_528_1676 330
123 3300053077 Ga0495601_0011038 Ga0495601_0011038_2276_3424 330
124 3300053084 Ga0495595_0012296 Ga0495595_0012296_2318_3466 330
125 3300053085 Ga0495619_0002180 Ga0495619_0002180_2561_3709 330
126 3300044694 Ga0466963_0138807 Ga0466963_0138807_471_1625 331
127 3300045836 Ga0466958_0067962 Ga0466958_0067962_581_1735 331
128 3300003659 JGI25404J52841_10009330 JGI25404J52841_100093302 332
129 3300005436 Ga0070713_100155913 Ga0070713_1001559132 332
130 3300005445 Ga0070708_100102844 Ga0070708_1001028443 332
131 3300005983 Ga0081540_1000251 Ga0081540_10002518 332
132 3300025906 Ga0207699_10003262 Ga0207699_100032622 332
133 3300049568 Ga0501031_0095617 Ga0501031_0095617_520_1587 333
134 3300025929 Ga0207664_10306092 Ga0207664_103060921 336
135 3300031456 Ga0307513_10013188 Ga0307513_100131884 336
136 3300031456 Ga0307513_10046377 Ga0307513_100463773 336
137 3300046663 Ga0495635_0211567 Ga0495635_0211567_131_1282 336
138 3300047318 Ga0495636_0075127 Ga0495636_0075127_146_1279 336
139 3300033179 Ga0307507_10050890 Ga0307507_100508903 337
140 3300046459 Ga0495629_0068708 Ga0495629_0068708_124_1278 338
141 3300049581 Ga0501047_0019106 Ga0501047_0019106_3469_4626 338
142 3300049823 Ga0501044_0118396 Ga0501044_0118396_1270_2427 338
143 3300048904 Ga0496101_0148113 Ga0496101_0148113_511_1668 339
144 3300003792 Ga0055540_1000060 Ga0055540_1000060113 340
145 3300005327 Ga0070658_10005788 Ga0070658_100057887 340
146 3300005336 Ga0070680_100225827 Ga0070680_1002258271 340
147 3300005339 Ga0070660_100059112 Ga0070660_1000591123 340
148 3300005344 Ga0070661_100022430 Ga0070661_1000224302 340
149 3300005548 Ga0070665_100130765 Ga0070665_1001307651 340
150 3300005841 Ga0068863_100142424 Ga0068863_1001424242 340
151 3300006846 Ga0075430_100014467 Ga0075430_1000144678 340
152 3300010375 Ga0105239_10387897 Ga0105239_103878972 340
153 3300011119 Ga0105246_10022684 Ga0105246_100226845 340
154 3300013105 Ga0157369_10098639 Ga0157369_100986392 340
155 3300020082 Ga0206353_10485089 Ga0206353_104850893 340
156 3300021388 Ga0213875_10025198 Ga0213875_100251983 340
157 3300025303 Ga0209051_1000149 Ga0209051_100014926 340
158 3300025909 Ga0207705_10164411 Ga0207705_101644111 340
159 3300025941 Ga0207711_10276961 Ga0207711_102769611 340
160 3300025944 Ga0207661_10008204 Ga0207661_100082043 340
161 3300026088 Ga0207641_10181629 Ga0207641_101816292 340
162 3300026095 Ga0207676_10289779 Ga0207676_102897791 340
163 3300026116 Ga0207674_10175584 Ga0207674_101755842 340
164 3300028379 Ga0268266_10055947 Ga0268266_100559471 340
165 3300035086 Ga0373934_0014619 Ga0373934_0014619_495_1643 340
166 3300037853 Ga0436364_1206830 Ga0436364_1206830_1236_2384 340
167 3300039437 Ga0436365_0346317 Ga0436365_0346317_343_1491 340
168 3300046463 Ga0495653_0004341 Ga0495653_0004341_4394_5551 340
169 3300046473 Ga0495582_0049238 Ga0495582_0049238_1037_2194 340
170 3300046514 Ga0495618_0030747 Ga0495618_0030747_1024_2181 340
171 3300046516 Ga0495628_0006638 Ga0495628_0006638_2766_3923 340
172 3300046557 Ga0495622_0027746 Ga0495622_0027746_747_1904 340
173 3300046559 Ga0495667_0057369 Ga0495667_0057369_815_1972 340
174 3300046642 Ga0495634_0102555 Ga0495634_0102555_405_1562 340
175 3300046675 Ga0495657_0062497 Ga0495657_0062497_606_1763 340
176 3300046683 Ga0495658_0024875 Ga0495658_0024875_280_1437 340
177 3300048908 Ga0496105_0074525 Ga0496105_0074525_1422_2579 340
178 3300048917 Ga0496114_0063435 Ga0496114_0063435_739_1905 340
179 3300050509 nmdc:mga0qj67_26683_c1 nmdc:mga0qj67_26683_c1_331_1512 340
180 3300035170 Ga0373943_0106056 Ga0373943_0106056_270_1418 341
181 3300037068 Ga0373925_0228546 Ga0373925_0228546_183_1331 341
182 3300041413 Ga0439465_0008224 Ga0439465_0008224_1625_2782 341
183 3300044765 Ga0466970_0101908 Ga0466970_0101908_55_1224 341
184 3300044842 Ga0466957_0029857 Ga0466957_0029857_107_1345 341
185 3300045049 Ga0466959_0066847 Ga0466959_0066847_1335_2573 341
186 3300045836 Ga0466958_0028932 Ga0466958_0028932_33_1271 341
187 3300046543 Ga0495645_0134109 Ga0495645_0134109_17_1093 341
188 3300005329 Ga0070683_100011058 Ga0070683_1000110583 342
189 3300009545 Ga0105237_10001712 Ga0105237_1000171223 342
190 3300009545 Ga0105237_10142149 Ga0105237_101421492 342
191 3300010375 Ga0105239_10127640 Ga0105239_101276403 342
192 3300025914 Ga0207671_10018178 Ga0207671_100181781 342
193 3300025914 Ga0207671_10072609 Ga0207671_100726092 342
194 3300025944 Ga0207661_10001544 Ga0207661_100015442 342
195 3300031456 Ga0307513_10001629 Ga0307513_1000162917 342
196 3300037853 Ga0436364_1563654 Ga0436364_1563654_1628_2806 342
197 3300049586 Ga0501070_0140698 Ga0501070_0140698_724_1887 342
198 3300021388 Ga0213875_10026873 Ga0213875_100268731 343
199 3300037418 Ga0395900_0008528 Ga0395900_0008528_8148_9314 343
200 3300037853 Ga0436364_0141518 Ga0436364_0141518_3061_4227 343
201 3300044693 Ga0466961_0107490 Ga0466961_0107490_167_1330 343
202 3300044719 Ga0466971_0084465 Ga0466971_0084465_122_1285 343
203 3300044765 Ga0466970_0014063 Ga0466970_0014063_1665_2828 343
204 3300046514 Ga0495618_0200496 Ga0495618_0200496_54_1211 343
205 3300046517 Ga0495630_0032403 Ga0495630_0032403_153_1310 343
206 3300046533 Ga0495640_0015422 Ga0495640_0015422_2508_3665 343
207 3300046535 Ga0495586_0015987 Ga0495586_0015987_656_1813 343
208 3300046559 Ga0495667_0118811 Ga0495667_0118811_399_1556 343
209 3300047317 Ga0495604_0030089 Ga0495604_0030089_3146_4303 343
210 3300047319 Ga0495674_0166701 Ga0495674_0166701_350_1507 343
211 3300053084 Ga0495595_0012347 Ga0495595_0012347_1267_2424 343
212 3300053085 Ga0495619_0008175 Ga0495619_0008175_4018_5175 343
213 3300005445 Ga0070708_100116712 Ga0070708_1001167122 344
214 3300006048 Ga0075363_100112970 Ga0075363_1001129702 344
215 3300006177 Ga0075362_10085424 Ga0075362_100854242 344
216 3300032004 Ga0307414_10182368 Ga0307414_101823682 344
217 3300037466 Ga0395898_0136157 Ga0395898_0136157_82_1251 344
218 3300041494 Ga0451837_1855256 Ga0451837_1855256_50_1216 344
219 3300042435 Ga0439434_0016740 Ga0439434_0016740_496_1662 344
220 3300044683 Ga0466965_0014556 Ga0466965_0014556_28_1197 344
221 3300044901 Ga0466960_0017687 Ga0466960_0017687_211_1383 344
222 3300045976 Ga0466967_0048632 Ga0466967_0048632_1563_2735 344
223 3300045976 Ga0466967_0204268 Ga0466967_0204268_330_1499 344
224 3300049570 Ga0501033_0001361 Ga0501033_0001361_824_1984 344
225 3300049581 Ga0501047_0193336 Ga0501047_0193336_144_1304 344
226 3300049581 Ga0501047_0244542 Ga0501047_0244542_56_1210 344
227 3300049823 Ga0501044_0035691 Ga0501044_0035691_811_1971 344
228 3300050489 nmdc:mga03683_62862_c1 nmdc:mga03683_62862_c1_115_1281 344
229 3300003578 Ga0006562J51391_1116078 Ga0006562J51391_11160789 345
230 3300003578 Ga0006562J51391_1116083 Ga0006562J51391_11160833 345
231 3300005441 Ga0070700_100000033 Ga0070700_100000033118 345
232 3300005471 Ga0070698_100001963 Ga0070698_10000196312 345
233 3300006038 Ga0075365_10062234 Ga0075365_100622342 345
234 3300006847 Ga0075431_100082966 Ga0075431_1000829662 345
235 3300006880 Ga0075429_100062205 Ga0075429_1000622052 345
236 3300009147 Ga0114129_10343298 Ga0114129_103432982 345
237 3300026075 Ga0207708_10000004 Ga0207708_10000004111 345
238 3300044765 Ga0466970_0054439 Ga0466970_0054439_644_1810 345
239 3300046499 Ga0495594_0056745 Ga0495594_0056745_140_1300 345
240 3300048908 Ga0496105_0220998 Ga0496105_0220998_63_1220 345
241 3300048917 Ga0496114_0125698 Ga0496114_0125698_1035_2192 345
242 3300049581 Ga0501047_0000354 Ga0501047_0000354_16873_18027 345
243 3300050508 nmdc:mga09592_232602_c1 nmdc:mga09592_232602_c1_24_1181 345
244 3300053094 Ga0500566_0000593 Ga0500566_0000593_13524_14699 345
245 3300005983 Ga0081540_1004108 Ga0081540_10041083 346
246 3300006844 Ga0075428_100052109 Ga0075428_1000521092 346
247 3300009177 Ga0105248_10525356 Ga0105248_105253561 346
248 3300013308 Ga0157375_10306763 Ga0157375_103067632 346
249 3300037418 Ga0395900_0013835 Ga0395900_0013835_4125_5294 346
250 3300044683 Ga0466965_0043620 Ga0466965_0043620_416_1585 346
251 3300044694 Ga0466963_0032883 Ga0466963_0032883_753_1907 346
252 3300044719 Ga0466971_0021415 Ga0466971_0021415_1547_2701 346
253 3300045976 Ga0466967_0062368 Ga0466967_0062368_1275_2429 346
254 3300049571 Ga0501034_0026995 Ga0501034_0026995_82_1254 346
255 3300049572 Ga0501036_0084244 Ga0501036_0084244_1206_2378 346
256 3300005327 Ga0070658_10114254 Ga0070658_101142542 347
257 3300005339 Ga0070660_100243378 Ga0070660_1002433782 347
258 3300005354 Ga0070675_100190681 Ga0070675_1001906811 347
259 3300005364 Ga0070673_100304409 Ga0070673_1003044091 347
260 3300005366 Ga0070659_100178516 Ga0070659_1001785162 347
261 3300005543 Ga0070672_100151294 Ga0070672_1001512942 347
262 3300006844 Ga0075428_100002078 Ga0075428_10000207814 347
263 3300006844 Ga0075428_100085800 Ga0075428_1000858002 347
264 3300006846 Ga0075430_100037166 Ga0075430_1000371662 347
265 3300006847 Ga0075431_100101797 Ga0075431_1001017973 347
266 3300006880 Ga0075429_100090988 Ga0075429_1000909882 347
267 3300009147 Ga0114129_10000184 Ga0114129_1000018416 347
268 3300009147 Ga0114129_10140886 Ga0114129_101408864 347
269 3300009551 Ga0105238_10181196 Ga0105238_101811962 347
270 3300025937 Ga0207669_10145992 Ga0207669_101459922 347
271 3300025940 Ga0207691_10225211 Ga0207691_102252112 347
272 3300025960 Ga0207651_10255558 Ga0207651_102555581 347
273 3300037418 Ga0395900_0106822 Ga0395900_0106822_1671_2837 347
274 3300038443 Ga0395901_0096903 Ga0395901_0096903_234_1400 347
275 3300045976 Ga0466967_0052996 Ga0466967_0052996_1487_2653 347
276 3300046507 Ga0495606_0016107 Ga0495606_0016107_2490_3650 347
277 3300050508 nmdc:mga09592_177_c1 nmdc:mga09592_177_c1_38713_39885 347
278 3300050509 nmdc:mga0qj67_36_c3 nmdc:mga0qj67_36_c3_31612_32784 347
279 3300050510 nmdc:mga06r32_9191_c1 nmdc:mga06r32_9191_c1_7601_8773 347
280 3300053136 Ga0500559_0003009 Ga0500559_0003009_1521_2714 347
281 3300059492 Ga0587073_0000923 Ga0587073_0000923_176_1333 347
282 3300059504 Ga0587082_007356 Ga0587082_007356_122_1279 347
283 3300059508 Ga0587088_000572 Ga0587088_000572_1785_2942 347
284 3300059511 Ga0587091_002082 Ga0587091_002082_932_2089 347
285 3300059625 Ga0587113_000431 Ga0587113_000431_34_1188 347
286 3300059640 Ga0587067_000648 Ga0587067_000648_1945_3102 347
287 3300059643 Ga0587072_010902 Ga0587072_010902_111_1268 347
288 3300059647 Ga0587079_008019 Ga0587079_008019_220_1377 347
289 3300060344 Ga0587071_012313 Ga0587071_012313_98_1255 347
290 3300005618 Ga0068864_100021017 Ga0068864_1000210173 348
291 3300006844 Ga0075428_100009631 Ga0075428_1000096316 348
292 3300006846 Ga0075430_100010653 Ga0075430_1000106532 348
293 3300009147 Ga0114129_10083453 Ga0114129_100834533 348
294 3300025945 Ga0207679_10096164 Ga0207679_100961642 348
295 3300026095 Ga0207676_10092276 Ga0207676_100922761 348
296 3300050508 nmdc:mga09592_12762_c1 nmdc:mga09592_12762_c1_1548_2708 348
297 3300005467 Ga0070706_100048489 Ga0070706_1000484895 349
298 3300014497 Ga0182008_10044341 Ga0182008_100443412 349
299 3300025910 Ga0207684_10037530 Ga0207684_100375305 349
300 3300032002 Ga0307416_100112187 Ga0307416_1001121872 349
301 3300032126 Ga0307415_100027877 Ga0307415_1000278773 349
302 3300037418 Ga0395900_0041531 Ga0395900_0041531_570_1739 349
303 3300037466 Ga0395898_0006827 Ga0395898_0006827_8322_9491 349
304 3300037471 Ga0395905_0017993 Ga0395905_0017993_3054_4223 349
305 3300038443 Ga0395901_0081432 Ga0395901_0081432_1656_2825 349
306 3300037418 Ga0395900_0074250 Ga0395900_0074250_755_1939 350
307 3300037466 Ga0395898_0125014 Ga0395898_0125014_1035_2219 350
308 3300038443 Ga0395901_0031390 Ga0395901_0031390_2957_4141 350
309 3300041491 Ga0451833_0347183 Ga0451833_0347183_9842_11017 350
310 3300041494 Ga0451837_0453617 Ga0451837_0453617_3765_4940 350
311 3300041496 Ga0451839_1348762 Ga0451839_1348762_1271_2446 350
312 3300041498 Ga0451841_0636182 Ga0451841_0636182_49_1224 350
313 3300044693 Ga0466961_0083796 Ga0466961_0083796_138_1304 350
314 3300044694 Ga0466963_0032600 Ga0466963_0032600_1490_2650 350
315 3300045049 Ga0466959_0059397 Ga0466959_0059397_1158_2318 350
316 3300049571 Ga0501034_0027076 Ga0501034_0027076_2540_3700 350
317 3300049581 Ga0501047_0117172 Ga0501047_0117172_606_1766 350
318 3300049583 Ga0501067_0007301 Ga0501067_0007301_2222_3382 350
319 3300049583 Ga0501067_0008669 Ga0501067_0008669_3981_5147 350
320 3300049584 Ga0501068_0009431 Ga0501068_0009431_2207_3367 350
321 3300049584 Ga0501068_0140266 Ga0501068_0140266_112_1278 350
322 3300049586 Ga0501070_0018520 Ga0501070_0018520_2222_3382 350
323 3300049587 Ga0501071_0035304 Ga0501071_0035304_450_1610 350
324 3300049588 Ga0501072_0016492 Ga0501072_0016492_2363_3523 350
325 3300049589 Ga0501073_0009470 Ga0501073_0009470_2180_3340 350
326 3300049590 Ga0501074_0017346 Ga0501074_0017346_2529_3689 350
327 3300049592 Ga0501076_0073402 Ga0501076_0073402_923_2101 350
328 3300049593 Ga0501077_0045303 Ga0501077_0045303_465_1625 350
329 3300049742 Ga0501080_0022611 Ga0501080_0022611_2450_3610 350
330 3300049742 Ga0501080_0022862 Ga0501080_0022862_3721_4911 350
331 3300049744 Ga0501083_0033908 Ga0501083_0033908_2148_3308 350
332 3300054114 Ga0501084_0020426 Ga0501084_0020426_1113_2273 350
333 3300060353 Ga0501082_0070952 Ga0501082_0070952_1348_2508 350
334 3300061734 Ga0530510_0132898 Ga0530510_0132898_219_1385 350
335 3300049592 Ga0501076_0295197 Ga0501076_0295197_32_1207 351
336 3300053158 Ga0500627_0019123 Ga0500627_0019123_1236_2396 351
337 3300005329 Ga0070683_100016218 Ga0070683_1000162182 352
338 3300025944 Ga0207661_10148400 Ga0207661_101484002 352
339 3300031240 Ga0265320_10076281 Ga0265320_100762811 352
340 3300031251 Ga0265327_10005854 Ga0265327_100058544 352
341 3300047673 Ga0495593_0096202 Ga0495593_0096202_32_1138 352
342 3300049572 Ga0501036_0119005 Ga0501036_0119005_29_1195 352
343 3300049573 Ga0501037_0216543 Ga0501037_0216543_145_1311 352
344 3300049587 Ga0501071_0043872 Ga0501071_0043872_1783_2949 352
345 3300049588 Ga0501072_0039107 Ga0501072_0039107_1165_2331 352
346 3300049591 Ga0501075_0280150 Ga0501075_0280150_16_1182 352
347 3300049592 Ga0501076_0052576 Ga0501076_0052576_1137_2303 352
348 3300049593 Ga0501077_0020720 Ga0501077_0020720_1007_2173 352
349 3300005439 Ga0070711_100049614 Ga0070711_1000496142 353
350 3300005937 Ga0081455_10000480 Ga0081455_1000048062 353
351 3300005985 Ga0081539_10015563 Ga0081539_100155633 353
352 3300025929 Ga0207664_10045694 Ga0207664_100456941 353
353 3300035083 Ga0373926_0000994 Ga0373926_0000994_1150_2298 353
354 3300035089 Ga0373944_0019099 Ga0373944_0019099_99_1247 353
355 3300035113 Ga0373936_0001598 Ga0373936_0001598_5099_6247 353
356 3300035116 Ga0373945_0000887 Ga0373945_0000887_5172_6320 353
357 3300035170 Ga0373943_0000668 Ga0373943_0000668_472_1620 353
358 3300035171 Ga0373946_0001834 Ga0373946_0001834_5971_7119 353
359 3300035695 Ga0373927_0000850 Ga0373927_0000850_6467_7615 353
360 3300035725 Ga0373947_0006092 Ga0373947_0006092_2735_3883 353
361 3300036401 Ga0373937_0296786 Ga0373937_0296786_133_1281 353
362 3300037068 Ga0373925_0149580 Ga0373925_0149580_53_1201 353
363 3300039437 Ga0436365_0556984 Ga0436365_0556984_409_1557 353
364 3300044694 Ga0466963_0131756 Ga0466963_0131756_219_1367 353
365 3300046461 Ga0495641_0007988 Ga0495641_0007988_4738_5886 353
366 3300046463 Ga0495653_0007576 Ga0495653_0007576_6042_7190 353
367 3300046473 Ga0495582_0163062 Ga0495582_0163062_26_1174 353
368 3300046476 Ga0495662_0047963 Ga0495662_0047963_854_2002 353
369 3300046477 Ga0495664_0020949 Ga0495664_0020949_2217_3365 353
370 3300046517 Ga0495630_0016231 Ga0495630_0016231_4044_5192 353
371 3300046529 Ga0495652_0044200 Ga0495652_0044200_1872_3020 353
372 3300046531 Ga0495665_0048891 Ga0495665_0048891_698_1846 353
373 3300046533 Ga0495640_0059033 Ga0495640_0059033_759_1907 353
374 3300046543 Ga0495645_0156060 Ga0495645_0156060_265_1413 353
375 3300046559 Ga0495667_0020524 Ga0495667_0020524_2650_3798 353
376 3300046642 Ga0495634_0005589 Ga0495634_0005589_5813_6961 353
377 3300046663 Ga0495635_0034337 Ga0495635_0034337_1894_3042 353
378 3300046690 Ga0495624_0024215 Ga0495624_0024215_2764_3912 353
379 3300047319 Ga0495674_0103594 Ga0495674_0103594_640_1788 353
380 3300047321 Ga0495676_0054455 Ga0495676_0054455_1971_3119 353
381 3300047322 Ga0495680_0013023 Ga0495680_0013023_38_1186 353
382 3300047471 Ga0495684_0003123 Ga0495684_0003123_5644_6792 353
383 3300047673 Ga0495593_0057885 Ga0495593_0057885_165_1313 353
384 3300048907 Ga0496104_0031076 Ga0496104_0031076_3109_4266 353
385 3300048908 Ga0496105_0060507 Ga0496105_0060507_1558_2715 353
386 3300048911 Ga0496108_0108639 Ga0496108_0108639_825_1973 353
387 3300005434 Ga0070709_10025009 Ga0070709_100250093 354
388 3300005535 Ga0070684_100246365 Ga0070684_1002463652 354
389 3300021388 Ga0213875_10014440 Ga0213875_100144401 354
390 3300025302 Ga0207426_1005887 Ga0207426_10058873 354
391 3300025906 Ga0207699_10186244 Ga0207699_101862442 354
392 3300025915 Ga0207693_10061517 Ga0207693_100615172 354
393 3300025916 Ga0207663_10069316 Ga0207663_100693163 354
394 3300026078 Ga0207702_10122071 Ga0207702_101220711 354
395 3300035724 Ga0373933_0047490 Ga0373933_0047490_115_1272 354
396 3300036401 Ga0373937_0037668 Ga0373937_0037668_1470_2627 354
397 3300046462 Ga0495651_0004043 Ga0495651_0004043_2112_3269 354
398 3300046463 Ga0495653_0033959 Ga0495653_0033959_1091_2248 354
399 3300046477 Ga0495664_0002240 Ga0495664_0002240_1661_2818 354
400 3300046529 Ga0495652_0020277 Ga0495652_0020277_3182_4339 354
401 3300046543 Ga0495645_0045633 Ga0495645_0045633_1059_2216 354
402 3300046663 Ga0495635_0014535 Ga0495635_0014535_2759_3916 354
403 3300046675 Ga0495657_0027454 Ga0495657_0027454_1884_3041 354
404 3300047317 Ga0495604_0112127 Ga0495604_0112127_223_1380 354
405 3300047319 Ga0495674_0051826 Ga0495674_0051826_1790_2947 354
406 3300047322 Ga0495680_0033747 Ga0495680_0033747_2098_3255 354
407 3300047444 Ga0495675_0033598 Ga0495675_0033598_736_1893 354
408 3300047471 Ga0495684_0009313 Ga0495684_0009313_5377_6534 354
409 3300048088 Ga0495602_0036862 Ga0495602_0036862_1819_2976 354
410 3300053084 Ga0495595_0011202 Ga0495595_0011202_647_1804 354
411 3300006846 Ga0075430_100000279 Ga0075430_10000027911 355
412 3300035086 Ga0373934_0014480 Ga0373934_0014480_156_1313 355
413 3300035120 Ga0373957_0004970 Ga0373957_0004970_1393_2541 355
414 3300035172 Ga0373955_0039034 Ga0373955_0039034_524_1681 355
415 3300036401 Ga0373937_0413086 Ga0373937_0413086_34_1191 355
416 3300046463 Ga0495653_0190790 Ga0495653_0190790_203_1360 355
417 3300046511 Ga0495608_0017004 Ga0495608_0017004_1055_2212 355
418 3300046663 Ga0495635_0023234 Ga0495635_0023234_3140_4297 355
419 3300046675 Ga0495657_0109277 Ga0495657_0109277_67_1224 355
420 3300046679 Ga0495623_0036803 Ga0495623_0036803_1602_2759 355
421 3300046683 Ga0495658_0165922 Ga0495658_0165922_136_1284 355
422 3300047322 Ga0495680_0092880 Ga0495680_0092880_1035_2192 355
423 3300047471 Ga0495684_0013396 Ga0495684_0013396_21_1178 355
424 3300050491 nmdc:mga00v17_26489_c1 nmdc:mga00v17_26489_c1_2076_3233 355
425 3300050509 nmdc:mga0qj67_1247_c1 nmdc:mga0qj67_1247_c1_11751_12911 355
426 3300005331 Ga0070670_100094393 Ga0070670_1000943932 356
427 3300005337 Ga0070682_100068936 Ga0070682_1000689362 356
428 3300005347 Ga0070668_100094399 Ga0070668_1000943992 356
429 3300005455 Ga0070663_100009372 Ga0070663_1000093725 356
430 3300005471 Ga0070698_100000387 Ga0070698_10000038731 356
431 3300005544 Ga0070686_100026870 Ga0070686_1000268702 356
432 3300005841 Ga0068863_100076234 Ga0068863_1000762342 356
433 3300005844 Ga0068862_100142200 Ga0068862_1001422002 356
434 3300006038 Ga0075365_10097606 Ga0075365_100976062 356
435 3300006051 Ga0075364_10000270 Ga0075364_100002705 356
436 3300006186 Ga0075369_10041175 Ga0075369_100411752 356
437 3300006353 Ga0075370_10043626 Ga0075370_100436262 356
438 3300009177 Ga0105248_10077006 Ga0105248_100770062 356
439 3300009545 Ga0105237_10003886 Ga0105237_1000388610 356
440 3300010375 Ga0105239_10117212 Ga0105239_101172122 356
441 3300014968 Ga0157379_10135958 Ga0157379_101359582 356
442 3300025914 Ga0207671_10004746 Ga0207671_100047466 356
443 3300025925 Ga0207650_10036629 Ga0207650_100366292 356
444 3300025986 Ga0207658_10027583 Ga0207658_100275832 356
445 3300028379 Ga0268266_10004062 Ga0268266_100040626 356
446 3300035086 Ga0373934_0000021 Ga0373934_0000021_39802_40956 356
447 3300035117 Ga0373953_0000208 Ga0373953_0000208_10694_11848 356
448 3300035118 Ga0373954_0003993 Ga0373954_0003993_1585_2739 356
449 3300035119 Ga0373956_0001684 Ga0373956_0001684_6609_7763 356
450 3300035120 Ga0373957_0000240 Ga0373957_0000240_8061_9215 356
451 3300035172 Ga0373955_0000092 Ga0373955_0000092_22612_23766 356
452 3300035410 Ga0373924_0001270 Ga0373924_0001270_2900_4054 356
453 3300035724 Ga0373933_0000366 Ga0373933_0000366_1444_2598 356
454 3300036401 Ga0373937_0000169 Ga0373937_0000169_22612_23766 356
455 3300046454 Ga0495592_0000070 Ga0495592_0000070_39830_40984 356
456 3300046462 Ga0495651_0000042 Ga0495651_0000042_52272_53426 356
457 3300046463 Ga0495653_0004255 Ga0495653_0004255_3591_4745 356
458 3300046471 Ga0495650_0009549 Ga0495650_0009549_3129_4286 356
459 3300046511 Ga0495608_0000054 Ga0495608_0000054_52272_53426 356
460 3300046516 Ga0495628_0000106 Ga0495628_0000106_49518_50672 356
461 3300046529 Ga0495652_0000119 Ga0495652_0000119_39815_40969 356
462 3300046529 Ga0495652_0073854 Ga0495652_0073854_1550_2710 356
463 3300046536 Ga0495587_0000119 Ga0495587_0000119_52272_53426 356
464 3300046543 Ga0495645_0051614 Ga0495645_0051614_1291_2445 356
465 3300046559 Ga0495667_0000114 Ga0495667_0000114_39830_40984 356
466 3300046675 Ga0495657_0000067 Ga0495657_0000067_52272_53426 356
467 3300046678 Ga0495599_0000042 Ga0495599_0000042_41487_42641 356
468 3300046679 Ga0495623_0002839 Ga0495623_0002839_6620_7774 356
469 3300046680 Ga0495646_0008843 Ga0495646_0008843_4841_5995 356
470 3300047317 Ga0495604_0000121 Ga0495604_0000121_39830_40984 356
471 3300047322 Ga0495680_0000054 Ga0495680_0000054_52261_53415 356
472 3300047444 Ga0495675_0000176 Ga0495675_0000176_45414_46568 356
473 3300048088 Ga0495602_0000083 Ga0495602_0000083_52272_53426 356
474 3300048904 Ga0496101_0114612 Ga0496101_0114612_193_1350 356
475 3300048905 Ga0496102_0219377 Ga0496102_0219377_531_1688 356
476 3300048908 Ga0496105_0047247 Ga0496105_0047247_2140_3297 356
477 3300048912 Ga0496109_0196419 Ga0496109_0196419_34_1191 356
478 3300048916 Ga0496113_0103800 Ga0496113_0103800_432_1589 356
479 3300048922 Ga0496119_0015582 Ga0496119_0015582_3395_4555 356
480 3300050492 nmdc:mga0yw44_195209_c1 nmdc:mga0yw44_195209_c1_148_1305 356
481 3300050494 nmdc:mga06z11_76044_c1 nmdc:mga06z11_76044_c1_353_1510 356
482 3300053077 Ga0495601_0024892 Ga0495601_0024892_994_2154 356
483 3300053078 Ga0495612_0001711 Ga0495612_0001711_6949_8109 356
484 3300053084 Ga0495595_0000341 Ga0495595_0000341_283_1437 356
485 3300053085 Ga0495619_0069135 Ga0495619_0069135_41_1195 356
486 3300053085 Ga0495619_0149057 Ga0495619_0149057_308_1468 356
487 3300005355 Ga0070671_100000399 Ga0070671_10000039914 357
488 3300005842 Ga0068858_100008064 Ga0068858_1000080642 357
489 3300006038 Ga0075365_10139772 Ga0075365_101397722 357
490 3300006048 Ga0075363_100000236 Ga0075363_1000002367 357
491 3300006051 Ga0075364_10111026 Ga0075364_101110262 357
492 3300006844 Ga0075428_100032010 Ga0075428_1000320104 357
493 3300006844 Ga0075428_100270273 Ga0075428_1002702732 357
494 3300006846 Ga0075430_100088387 Ga0075430_1000883872 357
495 3300021388 Ga0213875_10032702 Ga0213875_100327022 357
496 3300025931 Ga0207644_10001153 Ga0207644_1000115315 357
497 3300026035 Ga0207703_10005581 Ga0207703_100055819 357
498 3300037853 Ga0436364_0070962 Ga0436364_0070962_3728_4897 357
499 3300049583 Ga0501067_0022825 Ga0501067_0022825_1548_2708 357
500 3300049584 Ga0501068_0017127 Ga0501068_0017127_2058_3218 357
501 3300049585 Ga0501069_0108393 Ga0501069_0108393_272_1432 357
502 3300049586 Ga0501070_0026400 Ga0501070_0026400_45_1205 357
503 3300049588 Ga0501072_0010591 Ga0501072_0010591_122_1282 357
504 3300049589 Ga0501073_0049014 Ga0501073_0049014_1548_2708 357
505 3300049590 Ga0501074_0089726 Ga0501074_0089726_789_1949 357
506 3300049741 Ga0501079_0038976 Ga0501079_0038976_160_1320 357
507 3300049742 Ga0501080_0027211 Ga0501080_0027211_2136_3296 357
508 3300060353 Ga0501082_0051265 Ga0501082_0051265_747_1907 357
509 3300005327 Ga0070658_10121263 Ga0070658_101212632 358
510 3300005434 Ga0070709_10002855 Ga0070709_100028553 358
511 3300006028 Ga0070717_10004480 Ga0070717_100044807 358
512 3300006173 Ga0070716_100004393 Ga0070716_1000043934 358
513 3300015688 Ga0183367_1005 Ga0183367_1005239 358
514 3300025906 Ga0207699_10005748 Ga0207699_100057483 358
515 3300025909 Ga0207705_10093491 Ga0207705_100934912 358
516 3300025915 Ga0207693_10000911 Ga0207693_100009117 358
517 3300025916 Ga0207663_10000286 Ga0207663_100002864 358
518 3300025929 Ga0207664_10004412 Ga0207664_100044126 358
519 3300025939 Ga0207665_10001704 Ga0207665_1000170410 358
520 3300031251 Ga0265327_10012472 Ga0265327_100124722 358
521 3300044683 Ga0466965_0022450 Ga0466965_0022450_1621_2751 358
522 3300044693 Ga0466961_0030609 Ga0466961_0030609_2283_3413 358
523 3300046460 Ga0495638_0002768 Ga0495638_0002768_4955_6115 358
524 3300053104 Ga0500556_0003518 Ga0500556_0003518_243_1403 358
525 3300005439 Ga0070711_100231411 Ga0070711_1002314111 359
526 3300005445 Ga0070708_100058155 Ga0070708_1000581553 359
527 3300005445 Ga0070708_100129663 Ga0070708_1001296632 359
528 3300005467 Ga0070706_100253873 Ga0070706_1002538731 359
529 3300025303 Ga0209051_1026594 Ga0209051_10265942 359
530 3300025910 Ga0207684_10264070 Ga0207684_102640701 359
531 3300025929 Ga0207664_10029351 Ga0207664_100293512 359
532 3300028381 Ga0268264_10245417 Ga0268264_102454172 359
533 3300041512 Ga0451853_2105047 Ga0451853_2105047_1255_2388 359
534 3300042006 Ga0439432_027315 Ga0439432_027315_285_1454 359
535 3300048929 Ga0496126_0096202 Ga0496126_0096202_1414_2571 359
536 3300049581 Ga0501047_0004122 Ga0501047_0004122_7522_8676 359
537 3300049585 Ga0501069_0093690 Ga0501069_0093690_418_1572 359
538 3300049586 Ga0501070_0009187 Ga0501070_0009187_4084_5238 359
539 3300049822 Ga0501035_0044728 Ga0501035_0044728_668_1804 359
540 iso_pu_bacteria 2811994879 2812358103 359
541 iso_pu_bacteria 2852635781 2852636669 359
542 iso_pu_bacteria 2946064051 2946067740 359
543 iso_pu_bacteria 8056447290 8056451073 359
544 3300002075 JGI24738J21930_10009989 JGI24738J21930_100099892 360
545 3300005345 Ga0070692_10024089 Ga0070692_100240892 360
546 3300005438 Ga0070701_10010173 Ga0070701_100101732 360
547 3300005441 Ga0070700_100000681 Ga0070700_1000006818 360
548 3300005615 Ga0070702_100002173 Ga0070702_1000021734 360
549 3300005834 Ga0068851_10070312 Ga0068851_100703122 360
550 3300006175 Ga0070712_100001096 Ga0070712_10000109612 360
551 3300006881 Ga0068865_100011636 Ga0068865_1000116363 360
552 3300009545 Ga0105237_10236455 Ga0105237_102364552 360
553 3300009553 Ga0105249_10036751 Ga0105249_100367514 360
554 3300025315 Ga0207697_10022659 Ga0207697_100226592 360
555 3300025934 Ga0207686_10034246 Ga0207686_100342463 360
556 3300025935 Ga0207709_10138697 Ga0207709_101386971 360
557 3300026023 Ga0207677_10116564 Ga0207677_101165641 360
558 3300026075 Ga0207708_10000511 Ga0207708_1000051115 360
559 3300026089 Ga0207648_10018964 Ga0207648_100189643 360
560 3300026118 Ga0207675_100002095 Ga0207675_1000020953 360
561 3300031616 Ga0307508_10029541 Ga0307508_100295412 360
562 3300037418 Ga0395900_0141460 Ga0395900_0141460_677_1837 360
563 3300038443 Ga0395901_0054448 Ga0395901_0054448_2368_3528 360
564 3300041494 Ga0451837_1227407 Ga0451837_1227407_379_1548 360
565 3300041512 Ga0451853_3575533 Ga0451853_3575533_6261_7430 360
566 3300044693 Ga0466961_0144609 Ga0466961_0144609_255_1415 360
567 3300044694 Ga0466963_0045398 Ga0466963_0045398_1511_2662 360
568 3300045049 Ga0466959_0178175 Ga0466959_0178175_224_1384 360
569 3300045976 Ga0466967_0009093 Ga0466967_0009093_1931_3082 360
570 3300048903 Ga0496100_0057190 Ga0496100_0057190_101_1267 360
571 3300048916 Ga0496113_0091797 Ga0496113_0091797_859_2025 360
572 3300048929 Ga0496126_0018493 Ga0496126_0018493_4880_6046 360
573 iso_pu_bacteria 2643221714 2644628907 360
574 iso_pu_bacteria 2912715099 2912719953 360
575 3300003320 rootH2_10150640 rootH2_101506401 361
576 3300005563 Ga0068855_100039642 Ga0068855_1000396424 361
577 3300006048 Ga0075363_100021242 Ga0075363_1000212423 361
578 3300009093 Ga0105240_10096255 Ga0105240_100962551 361
579 3300009174 Ga0105241_10002543 Ga0105241_100025437 361
580 3300010375 Ga0105239_10245862 Ga0105239_102458622 361
581 3300013296 Ga0157374_10030832 Ga0157374_100308323 361
582 3300014497 Ga0182008_10003431 Ga0182008_100034317 361
583 3300015261 Ga0182006_1008344 Ga0182006_10083444 361
584 3300025904 Ga0207647_10009986 Ga0207647_100099866 361
585 3300025911 Ga0207654_10048124 Ga0207654_100481241 361
586 3300025913 Ga0207695_10008695 Ga0207695_100086958 361
587 3300025914 Ga0207671_10006836 Ga0207671_100068367 361
588 3300025924 Ga0207694_10006958 Ga0207694_100069582 361
589 3300025981 Ga0207640_10124025 Ga0207640_101240251 361
590 3300028379 Ga0268266_10097157 Ga0268266_100971571 361
591 3300031838 Ga0307518_10019364 Ga0307518_100193641 361
592 3300035207 Ga0373942_0001767 Ga0373942_0001767_1899_3059 361
593 3300041404 Ga0439436_0001972 Ga0439436_0001972_1813_2943 361
594 3300041999 Ga0439433_0000517 Ga0439433_0000517_5781_6911 361
595 3300042014 Ga0439457_001264 Ga0439457_001264_4632_5762 361
596 3300042015 Ga0439462_0000793 Ga0439462_0000793_873_2003 361
597 3300044694 Ga0466963_0020953 Ga0466963_0020953_1356_2519 361
598 3300044706 Ga0466964_0013734 Ga0466964_0013734_1184_2347 361
599 3300045976 Ga0466967_0025149 Ga0466967_0025149_114_1250 361
600 3300049589 Ga0501073_0017123 Ga0501073_0017123_2738_3892 361
601 3300049744 Ga0501083_0002982 Ga0501083_0002982_7155_8309 361
602 3300054114 Ga0501084_0154328 Ga0501084_0154328_320_1474 361
603 3300061719 Ga0466962_0069651 Ga0466962_0069651_58_1194 361
604 iso_pu_bacteria 2808606982 2811849050 361
605 iso_pu_bacteria 8048406513 8048412748 361
606 3300005343 Ga0070687_100093523 Ga0070687_1000935231 362
607 3300005437 Ga0070710_10000119 Ga0070710_1000011914 362
608 3300005458 Ga0070681_10011047 Ga0070681_100110478 362
609 3300005467 Ga0070706_100115508 Ga0070706_1001155082 362
610 3300005545 Ga0070695_100164235 Ga0070695_1001642351 362
611 3300005937 Ga0081455_10000273 Ga0081455_1000027313 362
612 3300006914 Ga0075436_100076442 Ga0075436_1000764422 362
613 3300025885 Ga0207653_10021501 Ga0207653_100215012 362
614 3300025898 Ga0207692_10000731 Ga0207692_1000073111 362
615 3300025910 Ga0207684_10186380 Ga0207684_101863801 362
616 3300030731 Ga0316177_1078543 Ga0316177_10785432 362
617 3300030732 Ga0316176_1182197 Ga0316176_11821972 362
618 3300031251 Ga0265327_10000566 Ga0265327_1000056643 362
619 3300031507 Ga0307509_10130256 Ga0307509_101302562 362
620 3300041413 Ga0439465_0026681 Ga0439465_0026681_79_1242 362
621 3300044658 Ga0466972_0029503 Ga0466972_0029503_1083_2222 362
622 3300044683 Ga0466965_0034221 Ga0466965_0034221_551_1690 362
623 3300044683 Ga0466965_0048192 Ga0466965_0048192_759_1898 362
624 3300044693 Ga0466961_0012530 Ga0466961_0012530_2617_3780 362
625 3300044765 Ga0466970_0088787 Ga0466970_0088787_33_1172 362
626 3300044901 Ga0466960_0000512 Ga0466960_0000512_3888_5027 362
627 3300044901 Ga0466960_0003036 Ga0466960_0003036_3196_4335 362
628 3300046491 Ga0495584_0088049 Ga0495584_0088049_234_1397 362
629 3300048929 Ga0496126_0000036 Ga0496126_0000036_25304_26455 362
630 3300049584 Ga0501068_0057881 Ga0501068_0057881_1120_2283 362
631 3300053140 Ga0500573_0094999 Ga0500573_0094999_31_1191 362
632 iso_pu_bacteria 2867428634 2867433298 362
633 iso_pu_bacteria 2877676314 2877681105 362
634 iso_pu_bacteria 2912757875 2912760790 362
635 iso_pu_bacteria 2954740390 2954745113 362
636 iso_pu_bacteria 2954759201 2954764087 362
637 iso_pu_bacteria 2997600082 2997600409 362
638 iso_pu_bacteria 8025530807 8025538031 362
639 3300005329 Ga0070683_100090665 Ga0070683_1000906653 363
640 3300025908 Ga0207643_10002654 Ga0207643_100026543 363
641 3300025944 Ga0207661_10164640 Ga0207661_101646402 363
642 iso_pu_bacteria 2643221587 2643942177 363
643 iso_pu_bacteria 2643221670 2644389848 363
644 iso_pu_bacteria 2643221677 2644429260 363
645 iso_pu_bacteria 2643221678 2644437169 363
646 iso_pu_bacteria 2919468124 2919469506 363
647 iso_pu_bacteria 3006493962 3006500765 363
648 iso_pu_bacteria 2862178590 2862180168 364
649 3300003354 JGI25160J50197_1016270 JGI25160J50197_10162701 365
650 3300025302 Ga0207426_1002193 Ga0207426_10021939 365
651 3300035398 Ga0316574_0107546 Ga0316574_0107546_11_1141 365
652 iso_pu_bacteria 2915358134 2915361325 365
653 3300013104 Ga0157370_10019049 Ga0157370_100190494 366
654 3300035172 Ga0373955_0156313 Ga0373955_0156313_36_1217 366
655 3300046454 Ga0495592_0054001 Ga0495592_0054001_23_1204 366
656 3300046462 Ga0495651_0001340 Ga0495651_0001340_1778_2959 366
657 3300046511 Ga0495608_0001336 Ga0495608_0001336_16383_17564 366
658 3300046514 Ga0495618_0031013 Ga0495618_0031013_693_1874 366
659 3300046516 Ga0495628_0003697 Ga0495628_0003697_107_1288 366
660 3300046529 Ga0495652_0002560 Ga0495652_0002560_1152_2333 366
661 3300046663 Ga0495635_0000410 Ga0495635_0000410_2381_3562 366
662 3300046678 Ga0495599_0003359 Ga0495599_0003359_8121_9302 366
663 3300046680 Ga0495646_0009579 Ga0495646_0009579_810_1991 366
664 3300047319 Ga0495674_0013463 Ga0495674_0013463_5128_6309 366
665 3300047322 Ga0495680_0005407 Ga0495680_0005407_3074_4255 366
666 3300048088 Ga0495602_0052846 Ga0495602_0052846_2363_3544 366
667 3300049590 Ga0501074_0002005 Ga0501074_0002005_10513_11667 366
668 3300049744 Ga0501083_0094960 Ga0501083_0094960_430_1584 366
669 3300049823 Ga0501044_0004033 Ga0501044_0004033_4273_5433 366
670 3300054114 Ga0501084_0000772 Ga0501084_0000772_19092_20246 366
671 3300005339 Ga0070660_100039774 Ga0070660_1000397742 367
672 3300005435 Ga0070714_100111955 Ga0070714_1001119552 367
673 3300025904 Ga0207647_10036803 Ga0207647_100368033 367
674 3300025909 Ga0207705_10042992 Ga0207705_100429923 367
675 3300025919 Ga0207657_10027499 Ga0207657_100274992 367
676 3300025929 Ga0207664_10054994 Ga0207664_100549942 367
677 3300037466 Ga0395898_0004050 Ga0395898_0004050_666_1820 367
678 3300044684 Ga0466966_0011511 Ga0466966_0011511_3196_4374 367
679 3300044693 Ga0466961_0088258 Ga0466961_0088258_767_1945 367
680 3300044765 Ga0466970_0053211 Ga0466970_0053211_884_2047 367
681 3300044765 Ga0466970_0107705 Ga0466970_0107705_258_1436 367
682 3300044842 Ga0466957_0118406 Ga0466957_0118406_444_1622 367
683 3300044901 Ga0466960_0010489 Ga0466960_0010489_186_1349 367
684 3300045976 Ga0466967_0235245 Ga0466967_0235245_444_1622 367
685 3300046660 Ga0495625_0083268 Ga0495625_0083268_796_1965 367
686 3300046691 Ga0495670_0044445 Ga0495670_0044445_855_2024 367
687 3300053090 Ga0500646_0000613 Ga0500646_0000613_2256_3434 367
688 3300060353 Ga0501082_0246171 Ga0501082_0246171_335_1498 367
689 3300061719 Ga0466962_0081198 Ga0466962_0081198_174_1352 367
690 iso_pu_bacteria 2554235005 2554257860 367
691 iso_pu_bacteria 8047710418 8047716740 367
692 3300003320 rootH2_10022528 rootH2_100225283 368
693 3300005434 Ga0070709_10002604 Ga0070709_100026043 368
694 3300005435 Ga0070714_100001420 Ga0070714_10000142012 368
695 3300005435 Ga0070714_100080416 Ga0070714_1000804162 368
696 3300005436 Ga0070713_100143620 Ga0070713_1001436202 368
697 3300005437 Ga0070710_10007794 Ga0070710_100077942 368
698 3300005439 Ga0070711_100071711 Ga0070711_1000717112 368
699 3300005471 Ga0070698_100005449 Ga0070698_1000054493 368
700 3300005471 Ga0070698_100015358 Ga0070698_1000153582 368
701 3300006028 Ga0070717_10019840 Ga0070717_100198402 368
702 3300006163 Ga0070715_10002088 Ga0070715_100020882 368
703 3300006173 Ga0070716_100001616 Ga0070716_1000016165 368
704 3300006847 Ga0075431_100230562 Ga0075431_1002305622 368
705 3300006880 Ga0075429_100044816 Ga0075429_1000448163 368
706 3300009011 Ga0105251_10007408 Ga0105251_100074083 368
707 3300009147 Ga0114129_10325631 Ga0114129_103256312 368
708 3300025735 Ga0207713_1040811 Ga0207713_10408112 368
709 3300025905 Ga0207685_10000827 Ga0207685_100008272 368
710 3300025910 Ga0207684_10235209 Ga0207684_102352092 368
711 3300025924 Ga0207694_10034238 Ga0207694_100342382 368
712 3300025925 Ga0207650_10250162 Ga0207650_102501621 368
713 3300025929 Ga0207664_10013195 Ga0207664_100131952 368
714 3300025939 Ga0207665_10002796 Ga0207665_100027965 368
715 3300025941 Ga0207711_10114808 Ga0207711_101148082 368
716 3300028666 Ga0265336_10014160 Ga0265336_100141602 368
717 3300028800 Ga0265338_10003557 Ga0265338_100035573 368
718 3300044658 Ga0466972_0005263 Ga0466972_0005263_200_1360 368
719 3300044683 Ga0466965_0000282 Ga0466965_0000282_1110_2270 368
720 3300044693 Ga0466961_0008226 Ga0466961_0008226_201_1361 368
721 3300044694 Ga0466963_0004036 Ga0466963_0004036_4887_6047 368
722 3300044706 Ga0466964_0004070 Ga0466964_0004070_2508_3668 368
723 3300044719 Ga0466971_0019399 Ga0466971_0019399_1015_2175 368
724 3300044765 Ga0466970_0000600 Ga0466970_0000600_5710_6870 368
725 3300044842 Ga0466957_0001424 Ga0466957_0001424_10331_11491 368
726 3300045049 Ga0466959_0000556 Ga0466959_0000556_9045_10205 368
727 3300045836 Ga0466958_0015028 Ga0466958_0015028_1015_2175 368
728 3300046455 Ga0495603_0029572 Ga0495603_0029572_1447_2607 368
729 3300046459 Ga0495629_0033578 Ga0495629_0033578_2426_3586 368
730 3300046475 Ga0495639_0076021 Ga0495639_0076021_359_1519 368
731 3300046499 Ga0495594_0063609 Ga0495594_0063609_217_1377 368
732 3300046517 Ga0495630_0026681 Ga0495630_0026681_795_1955 368
733 3300046674 Ga0495588_0005715 Ga0495588_0005715_3027_4187 368
734 3300046689 Ga0495613_0023097 Ga0495613_0023097_143_1303 368
735 3300046794 Ga0495589_0042177 Ga0495589_0042177_11_1171 368
736 3300047444 Ga0495675_0023505 Ga0495675_0023505_1762_2922 368
737 3300048904 Ga0496101_0121509 Ga0496101_0121509_410_1582 368
738 3300048905 Ga0496102_0145751 Ga0496102_0145751_512_1684 368
739 3300048907 Ga0496104_0002025 Ga0496104_0002025_13058_14230 368
740 3300048908 Ga0496105_0017243 Ga0496105_0017243_2647_3819 368
741 3300048912 Ga0496109_0121134 Ga0496109_0121134_805_1965 368
742 3300048913 Ga0496110_0037673 Ga0496110_0037673_1274_2446 368
743 3300048915 Ga0496112_0002456 Ga0496112_0002456_5378_6550 368
744 3300048916 Ga0496113_0030602 Ga0496113_0030602_791_1963 368
745 3300048917 Ga0496114_0209494 Ga0496114_0209494_168_1340 368
746 3300049570 Ga0501033_0001790 Ga0501033_0001790_17387_18547 368
747 3300050510 nmdc:mga06r32_181565_c1 nmdc:mga06r32_181565_c1_379_1536 368
748 3300061719 Ga0466962_0000057 Ga0466962_0000057_11198_12358 368
749 iso_pu_bacteria 2791355406 2793980058 368
750 iso_pu_bacteria 8047893842 8047898096 368
751 iso_pu_bacteria 8048127548 8048136800 368
752 iso_pu_bacteria 8048356638 8048360797 368
753 iso_pu_bacteria 8048369669 8048375059 368
754 iso_pu_bacteria 8048379754 8048383147 368
755 3300009147 Ga0114129_10211324 Ga0114129_102113242 369
756 3300014325 Ga0163163_10065892 Ga0163163_100658923 369
757 3300031251 Ga0265327_10007949 Ga0265327_100079496 369
758 3300037418 Ga0395900_0310219 Ga0395900_0310219_52_1212 369
759 3300041512 Ga0451853_0520998 Ga0451853_0520998_2126_3301 369
760 3300048907 Ga0496104_0277753 Ga0496104_0277753_378_1547 369
761 3300048915 Ga0496112_0173958 Ga0496112_0173958_825_2036 369
762 3300048916 Ga0496113_0000626 Ga0496113_0000626_12156_13367 369
763 3300049571 Ga0501034_0017417 Ga0501034_0017417_1955_3118 369
764 3300049574 Ga0501038_0002102 Ga0501038_0002102_1941_3104 369
765 3300049581 Ga0501047_0057065 Ga0501047_0057065_2099_3262 369
766 3300049582 Ga0501048_0056423 Ga0501048_0056423_1119_2282 369
767 3300049822 Ga0501035_0005740 Ga0501035_0005740_8979_10142 369
768 3300049822 Ga0501035_0058997 Ga0501035_0058997_660_1850 369
769 3300049823 Ga0501044_0013775 Ga0501044_0013775_7052_8242 369
770 3300049823 Ga0501044_0026079 Ga0501044_0026079_3681_4844 369
771 3300003578 Ga0006562J51391_1051951 Ga0006562J51391_10519517 370
772 3300003578 Ga0006562J51391_1051956 Ga0006562J51391_10519562 370
773 3300005439 Ga0070711_100041461 Ga0070711_1000414612 370
774 3300005614 Ga0068856_100446439 Ga0068856_1004464391 370
775 3300005618 Ga0068864_100024230 Ga0068864_1000242303 370
776 3300005842 Ga0068858_100386285 Ga0068858_1003862851 370
777 3300005843 Ga0068860_100212008 Ga0068860_1002120082 370
778 3300005937 Ga0081455_10162152 Ga0081455_101621522 370
779 3300006175 Ga0070712_100010761 Ga0070712_1000107614 370
780 3300009174 Ga0105241_10227964 Ga0105241_102279642 370
781 3300009177 Ga0105248_10022567 Ga0105248_100225672 370
782 3300010375 Ga0105239_10154865 Ga0105239_101548652 370
783 3300013308 Ga0157375_10136271 Ga0157375_101362712 370
784 3300014325 Ga0163163_10109287 Ga0163163_101092872 370
785 3300014745 Ga0157377_10120847 Ga0157377_101208472 370
786 3300014968 Ga0157379_10128818 Ga0157379_101288182 370
787 3300014969 Ga0157376_10294314 Ga0157376_102943142 370
788 3300021388 Ga0213875_10022735 Ga0213875_100227352 370
789 3300022467 Ga0224712_10002142 Ga0224712_100021423 370
790 3300025901 Ga0207688_10031595 Ga0207688_100315953 370
791 3300025915 Ga0207693_10036848 Ga0207693_100368483 370
792 3300025915 Ga0207693_10174266 Ga0207693_101742662 370
793 3300025916 Ga0207663_10111126 Ga0207663_101111262 370
794 3300025932 Ga0207690_10269930 Ga0207690_102699302 370
795 3300025941 Ga0207711_10111646 Ga0207711_101116462 370
796 3300026035 Ga0207703_10145264 Ga0207703_101452642 370
797 3300026088 Ga0207641_10239164 Ga0207641_102391641 370
798 3300026142 Ga0207698_10213861 Ga0207698_102138612 370
799 3300031456 Ga0307513_10031541 Ga0307513_100315413 370
800 3300032126 Ga0307415_100104352 Ga0307415_1001043523 370
801 3300036401 Ga0373937_0128154 Ga0373937_0128154_521_1681 370
802 3300037853 Ga0436364_0816924 Ga0436364_0816924_3205_4362 370
803 3300039062 Ga0400483_006444 Ga0400483_006444_9330_10511 370
804 3300041453 Ga0451797_1175257 Ga0451797_1175257_84_1244 370
805 3300044658 Ga0466972_0064138 Ga0466972_0064138_449_1612 370
806 3300044683 Ga0466965_0043867 Ga0466965_0043867_746_1906 370
807 3300044693 Ga0466961_0047652 Ga0466961_0047652_1441_2601 370
808 3300044694 Ga0466963_0164051 Ga0466963_0164051_166_1326 370
809 3300044706 Ga0466964_0015273 Ga0466964_0015273_1674_2834 370
810 3300044719 Ga0466971_0009420 Ga0466971_0009420_81_1241 370
811 3300044765 Ga0466970_0033587 Ga0466970_0033587_446_1606 370
812 3300044842 Ga0466957_0031279 Ga0466957_0031279_1769_2929 370
813 3300044901 Ga0466960_0059460 Ga0466960_0059460_553_1716 370
814 3300045836 Ga0466958_0031299 Ga0466958_0031299_37_1197 370
815 3300046454 Ga0495592_0019076 Ga0495592_0019076_4016_5206 370
816 3300046454 Ga0495592_0075543 Ga0495592_0075543_870_2030 370
817 3300046455 Ga0495603_0042945 Ga0495603_0042945_237_1427 370
818 3300046455 Ga0495603_0140210 Ga0495603_0140210_205_1374 370
819 3300046459 Ga0495629_0038574 Ga0495629_0038574_252_1442 370
820 3300046459 Ga0495629_0102359 Ga0495629_0102359_634_1824 370
821 3300046462 Ga0495651_0004642 Ga0495651_0004642_4108_5352 370
822 3300046477 Ga0495664_0058993 Ga0495664_0058993_825_2015 370
823 3300046492 Ga0495585_0057795 Ga0495585_0057795_234_1424 370
824 3300046516 Ga0495628_0023177 Ga0495628_0023177_2712_3956 370
825 3300046516 Ga0495628_0057402 Ga0495628_0057402_847_2037 370
826 3300046516 Ga0495628_0146392 Ga0495628_0146392_99_1289 370
827 3300046518 Ga0495631_0086630 Ga0495631_0086630_70_1239 370
828 3300046529 Ga0495652_0000962 Ga0495652_0000962_19865_21109 370
829 3300046529 Ga0495652_0083865 Ga0495652_0083865_971_2161 370
830 3300046533 Ga0495640_0020297 Ga0495640_0020297_1545_2735 370
831 3300046533 Ga0495640_0138922 Ga0495640_0138922_31_1221 370
832 3300046543 Ga0495645_0230733 Ga0495645_0230733_26_1186 370
833 3300046642 Ga0495634_0015214 Ga0495634_0015214_3042_4232 370
834 3300046675 Ga0495657_0015104 Ga0495657_0015104_3726_4916 370
835 3300046689 Ga0495613_0026890 Ga0495613_0026890_1515_2705 370
836 3300046690 Ga0495624_0036400 Ga0495624_0036400_455_1645 370
837 3300046809 Ga0495600_0003923 Ga0495600_0003923_1319_2563 370
838 3300046809 Ga0495600_0022970 Ga0495600_0022970_1311_2501 370
839 3300047317 Ga0495604_0058706 Ga0495604_0058706_97_1287 370
840 3300047317 Ga0495604_0070928 Ga0495604_0070928_221_1411 370
841 3300047321 Ga0495676_0036181 Ga0495676_0036181_1567_2757 370
842 3300047321 Ga0495676_0064593 Ga0495676_0064593_859_2028 370
843 3300047443 Ga0495687_019515 Ga0495687_019515_1567_2733 370
844 3300047472 Ga0495686_0019765 Ga0495686_0019765_1481_2644 370
845 3300048903 Ga0496100_0013250 Ga0496100_0013250_2951_4111 370
846 3300048905 Ga0496102_0018543 Ga0496102_0018543_3794_4954 370
847 3300048905 Ga0496102_0406771 Ga0496102_0406771_29_1201 370
848 3300048907 Ga0496104_0048446 Ga0496104_0048446_76_1236 370
849 3300048910 Ga0496107_0037547 Ga0496107_0037547_164_1324 370
850 3300048912 Ga0496109_0084625 Ga0496109_0084625_766_1926 370
851 3300048915 Ga0496112_0182609 Ga0496112_0182609_879_2039 370
852 3300048916 Ga0496113_0005086 Ga0496113_0005086_1968_3128 370
853 3300048917 Ga0496114_0022382 Ga0496114_0022382_3821_4981 370
854 3300048918 Ga0496115_0014024 Ga0496115_0014024_3629_4789 370
855 3300048926 Ga0496123_0021932 Ga0496123_0021932_133_1296 370
856 3300048929 Ga0496126_0013957 Ga0496126_0013957_2299_3459 370
857 3300049569 Ga0501032_0110917 Ga0501032_0110917_418_1581 370
858 3300049570 Ga0501033_0005042 Ga0501033_0005042_2062_3225 370
859 3300049570 Ga0501033_0204059 Ga0501033_0204059_90_1277 370
860 3300049571 Ga0501034_0097799 Ga0501034_0097799_1327_2487 370
861 3300049572 Ga0501036_0007027 Ga0501036_0007027_6670_7830 370
862 3300049572 Ga0501036_0009260 Ga0501036_0009260_365_1552 370
863 3300049575 Ga0501039_0073375 Ga0501039_0073375_349_1509 370
864 3300049580 Ga0501046_0085768 Ga0501046_0085768_706_1866 370
865 3300049580 Ga0501046_0172247 Ga0501046_0172247_95_1255 370
866 3300049581 Ga0501047_0033092 Ga0501047_0033092_2663_3823 370
867 3300049581 Ga0501047_0039386 Ga0501047_0039386_3207_4394 370
868 3300049581 Ga0501047_0061266 Ga0501047_0061266_1610_2773 370
869 3300049583 Ga0501067_0024913 Ga0501067_0024913_597_1760 370
870 3300049589 Ga0501073_0021675 Ga0501073_0021675_2381_3541 370
871 3300049822 Ga0501035_0003607 Ga0501035_0003607_10558_11718 370
872 3300049822 Ga0501035_0024418 Ga0501035_0024418_3011_4165 370
873 3300049822 Ga0501035_0048503 Ga0501035_0048503_1622_2785 370
874 3300049822 Ga0501035_0118695 Ga0501035_0118695_1036_2199 370
875 3300049823 Ga0501044_0051989 Ga0501044_0051989_1926_3089 370
876 3300053104 Ga0500556_0001524 Ga0500556_0001524_8031_9209 370
877 3300061719 Ga0466962_0003856 Ga0466962_0003856_278_1438 370
878 iso_pu_bacteria 2675903060 2676494046 370
879 iso_pu_bacteria 2887478801 2887485193 370
880 iso_pu_bacteria 2912723979 2912724340 370
881 iso_pu_bacteria 3002998708 3003005920 370
882 3300006847 Ga0075431_100096916 Ga0075431_1000969163 371
883 3300009093 Ga0105240_10036032 Ga0105240_100360323 371
884 3300009098 Ga0105245_10042060 Ga0105245_100420602 371
885 3300009545 Ga0105237_10000385 Ga0105237_1000038533 371
886 3300010375 Ga0105239_10004355 Ga0105239_1000435512 371
887 3300025913 Ga0207695_10049275 Ga0207695_100492753 371
888 3300025914 Ga0207671_10002091 Ga0207671_100020919 371
889 3300048915 Ga0496112_0121966 Ga0496112_0121966_395_1552 371
890 3300050510 nmdc:mga06r32_218963_c1 nmdc:mga06r32_218963_c1_273_1442 371
891 iso_pu_bacteria 2558860112 2558913178 371
892 iso_pu_bacteria 2643221696 2644533063 371
893 iso_pu_bacteria 2675903059 2676486104 371
894 iso_pu_bacteria 2738541264 2738668300 371
895 iso_pu_bacteria 2738541356 2739147370 371
896 iso_pu_bacteria 2744054611 2744954488 371
897 iso_pu_bacteria 2837183177 2837187308 371
898 iso_pu_bacteria 2842134933 2842137572 371
899 iso_pu_bacteria 2862382967 2862392843 371
900 iso_pu_bacteria 2866552031 2866552365 371
901 iso_pu_bacteria 2870782633 2870783852 371
902 iso_pu_bacteria 8003856774 8003857246 371
903 iso_pu_bacteria 8008558824 8008567303 371
904 iso_pu_bacteria 8033684223 8033684803 371
905 3300006175 Ga0070712_100067807 Ga0070712_1000678072 372
906 iso_pu_bacteria 2506783011 2506866632 372
907 iso_pu_bacteria 2616644941 2616902155 372
908 iso_pu_bacteria 2626541554 2626638749 372
909 iso_pu_bacteria 2643221578 2643902634 372
910 iso_pu_bacteria 2643221641 2644228138 372
911 iso_pu_bacteria 2643221673 2644404858 372
912 iso_pu_bacteria 2643221961 2645721326 372
913 iso_pu_bacteria 2643221962 2645724671 372
914 iso_pu_bacteria 2738541264 2738668905 372
915 iso_pu_bacteria 2738541274 2738705582 372
916 iso_pu_bacteria 2738541356 2739148197 372
917 iso_pu_bacteria 2738543028 2739332369 372
918 iso_pu_bacteria 2773857933 2774903061 372
919 iso_pu_bacteria 2795385470 2795786455 372
920 iso_pu_bacteria 2855386786 2855388644 372
921 iso_pu_bacteria 2863404153 2863404608 372
922 iso_pu_bacteria 2899370129 2899370254 372
923 iso_pu_bacteria 2902792274 2902799174 372
924 iso_pu_bacteria 2902810491 2902812630 372
925 iso_pu_bacteria 2946045630 2946048838 372
926 iso_pu_bacteria 2984592036 2984593178 372
927 iso_pu_bacteria 2990059506 2990066423 372
928 iso_pu_bacteria 3001889506 3001892377 372
929 iso_pu_bacteria 8002775197 8002776735 372
930 iso_pu_bacteria 8054609563 8054612089 372
931 iso_pu_bacteria 8054913762 8054915957 372
932 3300005439 Ga0070711_100186327 Ga0070711_1001863272 373
933 3300025915 Ga0207693_10137513 Ga0207693_101375132 373
934 3300046455 Ga0495603_0001078 Ga0495603_0001078_12400_13560 373
935 3300046475 Ga0495639_0005243 Ga0495639_0005243_2273_3433 373
936 3300046674 Ga0495588_0024140 Ga0495588_0024140_1063_2223 373
937 3300053087 Ga0500643_000290 Ga0500643_000290_14262_15416 373
938 iso_pu_bacteria 2643221615 2644092667 373
939 iso_pu_bacteria 2643221657 2644322280 373
940 iso_pu_bacteria 2643221681 2644455061 373
941 iso_pu_bacteria 2643221697 2644539489 373
942 iso_pu_bacteria 2739367898 2740165622 373
943 iso_pu_bacteria 2751185734 2753071332 373
944 iso_pu_bacteria 2811994874 2812330099 373
945 iso_pu_bacteria 2862574272 2862579247 373
946 iso_pu_bacteria 2867475112 2867480621 373
947 iso_pu_bacteria 2870721527 2870721863 373
948 iso_pu_bacteria 2891968417 2891973499 373
949 iso_pu_bacteria 2935390628 2935393410 373
950 iso_pu_bacteria 2984576629 2984578331 373
951 iso_pu_bacteria 2990256926 2990260810 373
952 3300005367 Ga0070667_100002542 Ga0070667_1000025428 374
953 3300005367 Ga0070667_100179936 Ga0070667_1001799361 374
954 3300014325 Ga0163163_10097671 Ga0163163_100976712 374
955 3300021384 Ga0213876_10027796 Ga0213876_100277962 374
956 3300025986 Ga0207658_10006962 Ga0207658_100069622 374
957 3300028379 Ga0268266_10000297 Ga0268266_1000029749 374
958 3300039453 Ga0436362_0815789 Ga0436362_0815789_211_1398 374
959 3300041512 Ga0451853_0096484 Ga0451853_0096484_2334_3497 374
960 3300042014 Ga0439457_006917 Ga0439457_006917_508_1671 374
961 3300042131 Ga0450894_000158 Ga0450894_000158_7152_8315 374
962 3300042133 Ga0450896_002075 Ga0450896_002075_395_1558 374
963 3300042134 Ga0450898_000485 Ga0450898_000485_552_1715 374
964 3300042135 Ga0450899_000424 Ga0450899_000424_3047_4210 374
965 3300042145 Ga0450906_004270 Ga0450906_004270_483_1646 374
966 3300042184 Ga0450908_010034 Ga0450908_010034_63_1226 374
967 3300044694 Ga0466963_0103365 Ga0466963_0103365_147_1316 374
968 3300044735 Ga0466968_0015159 Ga0466968_0015159_1849_3033 374
969 3300044765 Ga0466970_0086939 Ga0466970_0086939_250_1434 374
970 3300045049 Ga0466959_0104564 Ga0466959_0104564_674_1819 374
971 3300045836 Ga0466958_0007686 Ga0466958_0007686_1011_2195 374
972 iso_pu_bacteria 2643221617 2644101054 374
973 iso_pu_bacteria 2643221620 2644117935 374
974 iso_pu_bacteria 2738541305 2738868652 374
975 iso_pu_bacteria 2808606439 2809193999 374
976 iso_pu_bacteria 2808606522 2809588625 374
977 iso_pu_bacteria 2915768154 2915775326 374
978 iso_pu_bacteria 2932398195 2932401164 374
979 iso_pu_bacteria 8054472261 8054472414 374
980 3300003792 Ga0055540_1000022 Ga0055540_100002212 375
981 3300005435 Ga0070714_100000192 Ga0070714_10000019233 375
982 3300005539 Ga0068853_100113216 Ga0068853_1001132162 375
983 3300005614 Ga0068856_100132178 Ga0068856_1001321782 375
984 3300006038 Ga0075365_10062984 Ga0075365_100629842 375
985 3300006846 Ga0075430_100137042 Ga0075430_1001370422 375
986 3300006847 Ga0075431_100163216 Ga0075431_1001632162 375
987 3300009094 Ga0111539_10582360 Ga0111539_105823602 375
988 3300009098 Ga0105245_10026851 Ga0105245_100268515 375
989 3300009176 Ga0105242_10190723 Ga0105242_101907231 375
990 3300009545 Ga0105237_10016595 Ga0105237_100165953 375
991 3300013307 Ga0157372_10000004 Ga0157372_10000004259 375
992 3300020081 Ga0206354_11292861 Ga0206354_112928611 375
993 3300020082 Ga0206353_11429297 Ga0206353_114292972 375
994 3300021388 Ga0213875_10000443 Ga0213875_1000044313 375
995 3300021388 Ga0213875_10004207 Ga0213875_100042073 375
996 3300025303 Ga0209051_1000033 Ga0209051_100003312 375
997 3300025927 Ga0207687_10015059 Ga0207687_100150593 375
998 3300025929 Ga0207664_10000028 Ga0207664_10000028158 375
999 3300025929 Ga0207664_10016850 Ga0207664_100168505 375
1000 3300028379 Ga0268266_10181253 Ga0268266_101812532 375
1001 3300028666 Ga0265336_10030675 Ga0265336_100306752 375
1002 3300028794 Ga0307515_10232096 Ga0307515_102320961 375
1003 3300031456 Ga0307513_10124907 Ga0307513_101249071 375
1004 3300031728 Ga0316578_10040140 Ga0316578_100401403 375
1005 3300031731 Ga0307405_10007322 Ga0307405_100073222 375
1006 3300031824 Ga0307413_10020555 Ga0307413_100205553 375
1007 3300031901 Ga0307406_10055468 Ga0307406_100554682 375
1008 3300031911 Ga0307412_10101159 Ga0307412_101011592 375
1009 3300031995 Ga0307409_100038568 Ga0307409_1000385682 375
1010 3300032002 Ga0307416_100002333 Ga0307416_1000023338 375
1011 3300032126 Ga0307415_100000334 Ga0307415_1000003349 375
1012 3300033179 Ga0307507_10043371 Ga0307507_100433713 375
1013 3300035398 Ga0316574_0067887 Ga0316574_0067887_866_2026 375
1014 3300037466 Ga0395898_0426969 Ga0395898_0426969_15_1172 375
1015 3300037853 Ga0436364_0936746 Ga0436364_0936746_13289_14449 375
1016 3300041491 Ga0451833_0579776 Ga0451833_0579776_11788_12957 375
1017 3300042005 Ga0439448_0004601 Ga0439448_0004601_2085_3248 375
1018 3300044656 Ga0466969_0079676 Ga0466969_0079676_79_1236 375
1019 3300044684 Ga0466966_0004077 Ga0466966_0004077_1709_2851 375
1020 3300044684 Ga0466966_0021414 Ga0466966_0021414_1183_2340 375
1021 3300044684 Ga0466966_0037031 Ga0466966_0037031_1614_2771 375
1022 3300044693 Ga0466961_0071435 Ga0466961_0071435_373_1530 375
1023 3300044694 Ga0466963_0004428 Ga0466963_0004428_69_1226 375
1024 3300044842 Ga0466957_0010202 Ga0466957_0010202_3888_5030 375
1025 3300044842 Ga0466957_0036938 Ga0466957_0036938_826_1983 375
1026 3300044842 Ga0466957_0056816 Ga0466957_0056816_506_1663 375
1027 3300045049 Ga0466959_0010190 Ga0466959_0010190_1966_3123 375
1028 3300045049 Ga0466959_0068503 Ga0466959_0068503_397_1539 375
1029 3300045836 Ga0466958_0001433 Ga0466958_0001433_10100_11257 375
1030 3300045976 Ga0466967_0004195 Ga0466967_0004195_6491_7648 375
1031 3300045976 Ga0466967_0125828 Ga0466967_0125828_939_2102 375
1032 3300045976 Ga0466967_0156915 Ga0466967_0156915_64_1221 375
1033 3300046459 Ga0495629_0137347 Ga0495629_0137347_443_1603 375
1034 3300046543 Ga0495645_0036471 Ga0495645_0036471_234_1394 375
1035 3300047317 Ga0495604_0015027 Ga0495604_0015027_18_1199 375
1036 3300047323 Ga0495683_0000585 Ga0495683_0000585_7237_8400 375
1037 3300047444 Ga0495675_0079930 Ga0495675_0079930_230_1390 375
1038 3300048905 Ga0496102_0000263 Ga0496102_0000263_13788_14945 375
1039 3300048907 Ga0496104_0063449 Ga0496104_0063449_2025_3185 375
1040 3300048908 Ga0496105_0270906 Ga0496105_0270906_81_1241 375
1041 3300048911 Ga0496108_0041662 Ga0496108_0041662_653_1813 375
1042 3300048912 Ga0496109_0018389 Ga0496109_0018389_3264_4424 375
1043 3300048912 Ga0496109_0021669 Ga0496109_0021669_1039_2199 375
1044 3300048915 Ga0496112_0002788 Ga0496112_0002788_7682_8842 375
1045 3300049568 Ga0501031_0003245 Ga0501031_0003245_5631_6788 375
1046 3300049568 Ga0501031_0105563 Ga0501031_0105563_360_1553 375
1047 3300049569 Ga0501032_0025500 Ga0501032_0025500_2493_3650 375
1048 3300049569 Ga0501032_0124489 Ga0501032_0124489_415_1608 375
1049 3300049570 Ga0501033_0101095 Ga0501033_0101095_296_1489 375
1050 3300049571 Ga0501034_0159396 Ga0501034_0159396_869_2026 375
1051 3300049572 Ga0501036_0094749 Ga0501036_0094749_489_1682 375
1052 3300049573 Ga0501037_0029643 Ga0501037_0029643_616_1773 375
1053 3300049574 Ga0501038_0001063 Ga0501038_0001063_16984_18141 375
1054 3300049574 Ga0501038_0115015 Ga0501038_0115015_563_1756 375
1055 3300049579 Ga0501043_0050608 Ga0501043_0050608_1553_2746 375
1056 3300049579 Ga0501043_0075950 Ga0501043_0075950_839_1996 375
1057 3300049580 Ga0501046_0087836 Ga0501046_0087836_490_1647 375
1058 3300049582 Ga0501048_0135992 Ga0501048_0135992_116_1309 375
1059 3300049822 Ga0501035_0031854 Ga0501035_0031854_2378_3535 375
1060 3300049822 Ga0501035_0057252 Ga0501035_0057252_1764_2957 375
1061 3300049822 Ga0501035_0285472 Ga0501035_0285472_99_1256 375
1062 3300049823 Ga0501044_0033301 Ga0501044_0033301_3085_4242 375
1063 3300049823 Ga0501044_0062687 Ga0501044_0062687_443_1636 375
1064 3300049824 Ga0501045_0035483 Ga0501045_0035483_967_2160 375
1065 3300050510 nmdc:mga06r32_29461_c1 nmdc:mga06r32_29461_c1_1111_2262 375
1066 3300053153 Ga0500616_0036868 Ga0500616_0036868_565_1758 375
1067 iso_pu_bacteria 2579778521 2579856042 375
1068 iso_pu_bacteria 2619618881 2619857005 375
1069 iso_pu_bacteria 2619619003 2620352704 375
1070 iso_pu_bacteria 2643221561 2643824952 375
1071 iso_pu_bacteria 2643221576 2643891182 375
1072 iso_pu_bacteria 2643221590 2643960238 375
1073 iso_pu_bacteria 2643221604 2644034914 375
1074 iso_pu_bacteria 2643221696 2644532498 375
1075 iso_pu_bacteria 2773857762 2774395167 375
1076 iso_pu_bacteria 2811994878 2812348737 375
1077 iso_pu_bacteria 2857481737 2857484928 375
1078 iso_pu_bacteria 2875391855 2875395783 375
1079 iso_pu_bacteria 3006321560 3006328219 375
1080 iso_pu_bacteria 3006486233 3006488609 375
1081 iso_pu_bacteria 8054920844 8054922714 375
1082 3300005329 Ga0070683_100019998 Ga0070683_1000199988 376
1083 3300005337 Ga0070682_100010596 Ga0070682_1000105967 376
1084 3300005441 Ga0070700_100001719 Ga0070700_10000171913 376
1085 3300005445 Ga0070708_100065007 Ga0070708_1000650072 376
1086 3300005455 Ga0070663_100061733 Ga0070663_1000617332 376
1087 3300005456 Ga0070678_100083931 Ga0070678_1000839312 376
1088 3300005466 Ga0070685_10024594 Ga0070685_100245944 376
1089 3300005471 Ga0070698_100002657 Ga0070698_1000026577 376
1090 3300005471 Ga0070698_100008703 Ga0070698_1000087032 376
1091 3300005577 Ga0068857_100145327 Ga0068857_1001453271 376
1092 3300005614 Ga0068856_100026991 Ga0068856_1000269912 376
1093 3300005616 Ga0068852_100327673 Ga0068852_1003276732 376
1094 3300005937 Ga0081455_10010997 Ga0081455_100109972 376
1095 3300006847 Ga0075431_100102607 Ga0075431_1001026073 376
1096 3300006881 Ga0068865_100170251 Ga0068865_1001702512 376
1097 3300009094 Ga0111539_10532486 Ga0111539_105324862 376
1098 3300009098 Ga0105245_10009265 Ga0105245_100092658 376
1099 3300010375 Ga0105239_10021851 Ga0105239_100218513 376
1100 3300013296 Ga0157374_10155370 Ga0157374_101553703 376
1101 3300013308 Ga0157375_10023922 Ga0157375_100239228 376
1102 3300014326 Ga0157380_10074641 Ga0157380_100746412 376
1103 3300014326 Ga0157380_10154227 Ga0157380_101542272 376
1104 3300014745 Ga0157377_10023955 Ga0157377_100239552 376
1105 3300021388 Ga0213875_10000341 Ga0213875_1000034141 376
1106 3300025901 Ga0207688_10001198 Ga0207688_1000119810 376
1107 3300025915 Ga0207693_10023553 Ga0207693_100235536 376
1108 3300025961 Ga0207712_10055949 Ga0207712_100559492 376
1109 3300026041 Ga0207639_10327121 Ga0207639_103271211 376
1110 3300026078 Ga0207702_10076268 Ga0207702_100762682 376
1111 3300026078 Ga0207702_10121393 Ga0207702_101213931 376
1112 3300026095 Ga0207676_10096247 Ga0207676_100962473 376
1113 3300026116 Ga0207674_10209722 Ga0207674_102097221 376
1114 3300026121 Ga0207683_10010950 Ga0207683_100109505 376
1115 3300026142 Ga0207698_10078047 Ga0207698_100780473 376
1116 3300032126 Ga0307415_100058151 Ga0307415_1000581512 376
1117 3300035111 Ga0373923_0046191 Ga0373923_0046191_78_1232 376
1118 3300035410 Ga0373924_0101325 Ga0373924_0101325_58_1212 376
1119 3300035724 Ga0373933_0145104 Ga0373933_0145104_164_1318 376
1120 3300036401 Ga0373937_0053289 Ga0373937_0053289_2001_3161 376
1121 3300037068 Ga0373925_0002970 Ga0373925_0002970_7741_8895 376
1122 3300037853 Ga0436364_0201210 Ga0436364_0201210_17210_18391 376
1123 3300039450 Ga0436363_1096919 Ga0436363_1096919_1490_2644 376
1124 3300044765 Ga0466970_0015762 Ga0466970_0015762_660_1805 376
1125 3300044842 Ga0466957_0026802 Ga0466957_0026802_1737_2891 376
1126 3300044842 Ga0466957_0082198 Ga0466957_0082198_383_1537 376
1127 3300045836 Ga0466958_0098283 Ga0466958_0098283_103_1257 376
1128 3300046460 Ga0495638_0013391 Ga0495638_0013391_2217_3389 376
1129 3300046511 Ga0495608_0029635 Ga0495608_0029635_1009_2163 376
1130 3300046516 Ga0495628_0048568 Ga0495628_0048568_1021_2175 376
1131 3300046533 Ga0495640_0067625 Ga0495640_0067625_465_1625 376
1132 3300046536 Ga0495587_0004723 Ga0495587_0004723_3344_4498 376
1133 3300046543 Ga0495645_0086313 Ga0495645_0086313_29_1189 376
1134 3300046543 Ga0495645_0090177 Ga0495645_0090177_748_1902 376
1135 3300046559 Ga0495667_0003986 Ga0495667_0003986_999_2153 376
1136 3300046663 Ga0495635_0004670 Ga0495635_0004670_256_1410 376
1137 3300046675 Ga0495657_0026413 Ga0495657_0026413_652_1806 376
1138 3300046678 Ga0495599_0057963 Ga0495599_0057963_303_1457 376
1139 3300046680 Ga0495646_0116672 Ga0495646_0116672_291_1445 376
1140 3300046809 Ga0495600_0030735 Ga0495600_0030735_2022_3176 376
1141 3300047315 Ga0495581_0108469 Ga0495581_0108469_338_1495 376
1142 3300047319 Ga0495674_0048622 Ga0495674_0048622_473_1633 376
1143 3300047322 Ga0495680_0003752 Ga0495680_0003752_4048_5202 376
1144 3300047471 Ga0495684_0003656 Ga0495684_0003656_3642_4796 376
1145 3300048904 Ga0496101_0186990 Ga0496101_0186990_35_1222 376
1146 3300048905 Ga0496102_0121639 Ga0496102_0121639_1227_2414 376
1147 3300048907 Ga0496104_0008359 Ga0496104_0008359_897_2084 376
1148 3300048910 Ga0496107_0017857 Ga0496107_0017857_3220_4407 376
1149 3300048914 Ga0496111_0021088 Ga0496111_0021088_248_1435 376
1150 3300048916 Ga0496113_0014532 Ga0496113_0014532_3867_5054 376
1151 3300049572 Ga0501036_0032192 Ga0501036_0032192_3063_4220 376
1152 3300049582 Ga0501048_0057917 Ga0501048_0057917_670_1827 376
1153 3300049588 Ga0501072_0080501 Ga0501072_0080501_803_1960 376
1154 3300049591 Ga0501075_0016388 Ga0501075_0016388_3092_4249 376
1155 3300049592 Ga0501076_0062608 Ga0501076_0062608_158_1315 376
1156 3300049593 Ga0501077_0097904 Ga0501077_0097904_330_1499 376
1157 3300049593 Ga0501077_0146462 Ga0501077_0146462_114_1271 376
1158 3300049743 Ga0501081_0023218 Ga0501081_0023218_1083_2240 376
1159 3300049822 Ga0501035_0076635 Ga0501035_0076635_1451_2608 376
1160 3300049824 Ga0501045_0001364 Ga0501045_0001364_1562_2719 376
1161 3300050510 nmdc:mga06r32_35394_c1 nmdc:mga06r32_35394_c1_957_2144 376
1162 3300053085 Ga0495619_0106288 Ga0495619_0106288_203_1357 376
1163 3300053153 Ga0500616_0069850 Ga0500616_0069850_225_1397 376
1164 3300054114 Ga0501084_0003411 Ga0501084_0003411_1945_3102 376
1165 3300060353 Ga0501082_0026489 Ga0501082_0026489_1441_2598 376
1166 3300061719 Ga0466962_0060835 Ga0466962_0060835_260_1414 376
1167 3300000545 CNXas_1001085 CNXas_10010852 379
1168 3300031251 Ga0265327_10000274 Ga0265327_100002746 379
1169 3300044693 Ga0466961_0014531 Ga0466961_0014531_1552_2712 379
1170 3300045836 Ga0466958_0005084 Ga0466958_0005084_3505_4665 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

251

403

0.96

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

266

375

0.95

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

34

140

0.91

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

144

239

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ol2-assembly2.cif.gz_F the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile 0.9481 6 373
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9474 5 374
3mpi-assembly2.cif.gz_C structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex 0.9397 1 377
1rx0-assembly1.cif.gz_C crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. 0.9363 2 375
2a1t-assembly1.cif.gz_D structure of the human mcad:etf e165betaa complex 0.9343 5 378
ID Description Score Start End Superfamily
af_P9WQG3_234_382_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9832 236 372 1.20.140.10
af_P9WQG3_2_120_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9743 5 117 1.10.540.10
af_Q4CLQ5_90_238_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.969 236 374 1.20.140.10
3mpjB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9604 232 372 1.20.140.10
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9598 238 345 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0J6VZ32-F1-model_v4 Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) 0.9684 1 379 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A0J6VZ32-F1-model_v4 Acyl-CoA dehydrogenase fadE12 (EC 1.3.99.-) 0.9659 1 379 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A6I0FAM6-F1-model_v4 Acyl-CoA dehydrogenase 0.9611 5 379 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A2N5GDE7-F1-model_v4 Acyl-CoA dehydrogenase 0.9566 1 379 GO:0003995
GO:0050660
AF-A0A544TDJ9-F1-model_v4 Acyl-CoA dehydrogenase 0.9547 5 374 GO:0003995
GO:0050660

Feature Viewer

pLDDT pTM Quality
94.55 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map