F491124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1169 | 540 | 2338 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10480633|Ga0075365_104806332 |
| Length | 139 |
| Sequence | MKLTQGTFSFLPDLTDEQIRRQVQYCIDNGWAVNIEFTDDPHPRNTYWEMWGTPMFDVPDAAGVMMELAECRKVYGGRMYIRLSAFDASHGWESVKLSFLVGRPHNEPGFAIERQERGGRNVVYTTRSYATARPEGERY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 224 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 256 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 264 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 265 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 269 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 270 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 279 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 280 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 281 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 282 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 285 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 356 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 357 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 358 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 359 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 360 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 386 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 387 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 421 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 424 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 425 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 429 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 437 | 2512875024 | |||
| 438 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 439 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 440 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 441 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 442 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 443 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 444 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 445 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 446 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 447 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 448 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 449 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 450 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 451 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 452 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 453 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 454 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 455 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 456 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 457 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 458 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 459 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 460 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 461 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 462 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 463 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 464 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 465 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 466 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 467 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 468 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 469 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 470 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 471 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 472 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 473 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 474 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 475 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 476 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 477 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 478 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 479 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 480 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 481 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 482 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 483 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 484 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 485 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 486 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 487 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 488 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 489 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 490 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 491 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 492 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 493 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 494 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 495 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 496 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 497 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 498 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 499 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 500 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 501 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 502 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 503 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 504 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 505 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 506 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 507 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 508 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 509 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 510 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 511 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 512 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 513 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 514 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 515 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 516 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 517 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 518 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 519 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 520 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 521 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 522 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 523 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 524 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 525 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 526 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 527 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 528 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 529 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 530 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 531 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 532 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 533 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 534 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 535 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 536 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 537 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 538 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 539 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 540 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.99 |
| Metatranscriptomes | 1.03 |
| Isolates | 8.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.53 |
| Nodule | 8.55 |
| Rhizoplane | 7.61 |
| Rhizosphere | 74.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10480633 | 3300006038 | Bacteria | 878 |
| 2 | JGI24736J21556_1007436 | 3300001904 | Unclassified | 1840 |
| 3 | JGI24740J21852_10100024 | 3300001979 | Bacteria | 739 |
| 4 | JGI24739J22299_10016922 | 3300001989 | Bacteria | 2635 |
| 5 | JGI24735J21928_10002119 | 3300002067 | Bacteria | 6991 |
| 6 | Ga0055534_1004115 | 3300003784 | Bacteria | 4332 |
| 7 | Ga0058861_12066902 | 3300004800 | Bacteria | 1589 |
| 8 | Ga0058862_12526120 | 3300004803 | Bacteria | 1244 |
| 9 | Ga0065715_10032408 | 3300005293 | Bacteria | 1335 |
| 10 | Ga0065707_10000803 | 3300005295 | Bacteria | 13375 |
| 11 | Ga0070658_10925235 | 3300005327 | Bacteria | 758 |
| 12 | Ga0070658_11557118 | 3300005327 | Bacteria | 573 |
| 13 | Ga0070676_10017904 | 3300005328 | Bacteria | 3922 |
| 14 | Ga0070676_10075424 | 3300005328 | Bacteria | 2033 |
| 15 | Ga0070690_100050635 | 3300005330 | Bacteria | 2650 |
| 16 | Ga0070690_100250419 | 3300005330 | Bacteria | 1253 |
| 17 | Ga0070670_100006378 | 3300005331 | Bacteria | 9985 |
| 18 | Ga0070670_101289223 | 3300005331 | Bacteria | 669 |
| 19 | Ga0068869_100068203 | 3300005334 | Bacteria | 2626 |
| 20 | Ga0068869_100441575 | 3300005334 | Bacteria | 1077 |
| 21 | Ga0068869_101057373 | 3300005334 | Bacteria | 709 |
| 22 | Ga0068869_101523328 | 3300005334 | Bacteria | 594 |
| 23 | Ga0070666_10001775 | 3300005335 | Bacteria | 13133 |
| 24 | Ga0070666_10004360 | 3300005335 | Bacteria | 8619 |
| 25 | Ga0070666_10043847 | 3300005335 | Bacteria | 2996 |
| 26 | Ga0070680_100404963 | 3300005336 | Bacteria | 1163 |
| 27 | Ga0070680_100813641 | 3300005336 | Bacteria | 805 |
| 28 | Ga0070682_100144442 | 3300005337 | Bacteria | 1626 |
| 29 | Ga0068868_100104028 | 3300005338 | Bacteria | 2301 |
| 30 | Ga0068868_100196963 | 3300005338 | Bacteria | 1678 |
| 31 | Ga0068868_101091021 | 3300005338 | Bacteria | 734 |
| 32 | Ga0070660_100277389 | 3300005339 | Bacteria | 1371 |
| 33 | Ga0070660_100295014 | 3300005339 | Bacteria | 1328 |
| 34 | Ga0070660_100560139 | 3300005339 | Bacteria | 954 |
| 35 | Ga0070687_100125438 | 3300005343 | Bacteria | 1475 |
| 36 | Ga0070661_100260163 | 3300005344 | Bacteria | 1341 |
| 37 | Ga0070668_100019969 | 3300005347 | Bacteria | 5050 |
| 38 | Ga0070668_100236002 | 3300005347 | Bacteria | 1513 |
| 39 | Ga0070668_100491751 | 3300005347 | Bacteria | 1061 |
| 40 | Ga0070675_101036010 | 3300005354 | Bacteria | 754 |
| 41 | Ga0070671_100180519 | 3300005355 | Bacteria | 1787 |
| 42 | Ga0070671_100583007 | 3300005355 | Bacteria | 966 |
| 43 | Ga0070671_100663115 | 3300005355 | Bacteria | 904 |
| 44 | Ga0070671_101911823 | 3300005355 | Bacteria | 528 |
| 45 | Ga0070674_100183682 | 3300005356 | Bacteria | 1604 |
| 46 | Ga0070674_100400189 | 3300005356 | Bacteria | 1122 |
| 47 | Ga0070674_100411013 | 3300005356 | Bacteria | 1108 |
| 48 | Ga0070674_100660285 | 3300005356 | Bacteria | 890 |
| 49 | Ga0070673_100138381 | 3300005364 | Bacteria | 2052 |
| 50 | Ga0070673_100445116 | 3300005364 | Bacteria | 1165 |
| 51 | Ga0070673_100647918 | 3300005364 | Bacteria | 967 |
| 52 | Ga0070659_100018342 | 3300005366 | Bacteria | 5281 |
| 53 | Ga0070659_100939487 | 3300005366 | Bacteria | 757 |
| 54 | Ga0070667_100000093 | 3300005367 | Bacteria | 111322 |
| 55 | Ga0070667_100015768 | 3300005367 | Bacteria | 6250 |
| 56 | Ga0070667_100030089 | 3300005367 | Bacteria | 4528 |
| 57 | Ga0070667_100037240 | 3300005367 | Bacteria | 4078 |
| 58 | Ga0070667_100135420 | 3300005367 | Bacteria | 2153 |
| 59 | Ga0070667_100178445 | 3300005367 | Bacteria | 1877 |
| 60 | Ga0070667_100656347 | 3300005367 | Bacteria | 969 |
| 61 | Ga0070667_100714562 | 3300005367 | Bacteria | 928 |
| 62 | Ga0070667_100988563 | 3300005367 | Bacteria | 785 |
| 63 | Ga0070709_10036799 | 3300005434 | Bacteria | 2985 |
| 64 | Ga0070709_10662112 | 3300005434 | Bacteria | 809 |
| 65 | Ga0070709_10811252 | 3300005434 | Bacteria | 735 |
| 66 | Ga0070714_100012455 | 3300005435 | Bacteria | 6791 |
| 67 | Ga0070714_100017974 | 3300005435 | Bacteria | 5734 |
| 68 | Ga0070714_100209133 | 3300005435 | Bacteria | 1788 |
| 69 | Ga0070714_101712751 | 3300005435 | Bacteria | 614 |
| 70 | Ga0070713_100000685 | 3300005436 | Bacteria | 21745 |
| 71 | Ga0070713_100006493 | 3300005436 | Bacteria | 8113 |
| 72 | Ga0070713_100168451 | 3300005436 | Bacteria | 1960 |
| 73 | Ga0070710_10022315 | 3300005437 | Bacteria | 3308 |
| 74 | Ga0070710_10082186 | 3300005437 | Bacteria | 1883 |
| 75 | Ga0070710_10256624 | 3300005437 | Bacteria | 1126 |
| 76 | Ga0070710_10316057 | 3300005437 | Bacteria | 1024 |
| 77 | Ga0070711_100013034 | 3300005439 | Bacteria | 5212 |
| 78 | Ga0070711_100076600 | 3300005439 | Bacteria | 2372 |
| 79 | Ga0070711_100191959 | 3300005439 | Bacteria | 1571 |
| 80 | Ga0070711_100207682 | 3300005439 | Bacteria | 1515 |
| 81 | Ga0070705_100380101 | 3300005440 | Bacteria | 1039 |
| 82 | Ga0070700_100039035 | 3300005441 | Bacteria | 2898 |
| 83 | Ga0070663_100000032 | 3300005455 | Bacteria | 72041 |
| 84 | Ga0070663_100026851 | 3300005455 | Bacteria | 3903 |
| 85 | Ga0070663_100044703 | 3300005455 | Bacteria | 3125 |
| 86 | Ga0070663_100427101 | 3300005455 | Bacteria | 1088 |
| 87 | Ga0070663_100515492 | 3300005455 | Bacteria | 995 |
| 88 | Ga0070663_100603667 | 3300005455 | Bacteria | 923 |
| 89 | Ga0070663_101116662 | 3300005455 | Bacteria | 690 |
| 90 | Ga0070678_100031443 | 3300005456 | Bacteria | 3662 |
| 91 | Ga0070678_100173200 | 3300005456 | Bacteria | 1760 |
| 92 | Ga0070678_100228280 | 3300005456 | Bacteria | 1551 |
| 93 | Ga0070678_100304224 | 3300005456 | Bacteria | 1356 |
| 94 | Ga0070678_100314635 | 3300005456 | Bacteria | 1335 |
| 95 | Ga0070678_101610308 | 3300005456 | Bacteria | 610 |
| 96 | Ga0070678_101958351 | 3300005456 | Bacteria | 554 |
| 97 | Ga0070662_100024585 | 3300005457 | Bacteria | 4152 |
| 98 | Ga0070662_100291348 | 3300005457 | Bacteria | 1324 |
| 99 | Ga0070681_10003267 | 3300005458 | Bacteria | 15125 |
| 100 | Ga0070681_10011892 | 3300005458 | Bacteria | 8630 |
| 101 | Ga0070681_10927157 | 3300005458 | Bacteria | 790 |
| 102 | Ga0068867_100005073 | 3300005459 | Bacteria | 9298 |
| 103 | Ga0068867_100051842 | 3300005459 | Bacteria | 3027 |
| 104 | Ga0068867_100132254 | 3300005459 | Bacteria | 1941 |
| 105 | Ga0068867_100434831 | 3300005459 | Bacteria | 1115 |
| 106 | Ga0068867_101758870 | 3300005459 | Bacteria | 582 |
| 107 | Ga0070685_11003596 | 3300005466 | Bacteria | 626 |
| 108 | Ga0070707_101962369 | 3300005468 | Bacteria | 553 |
| 109 | Ga0070679_100057111 | 3300005530 | Bacteria | 3890 |
| 110 | Ga0070679_100235803 | 3300005530 | Bacteria | 1788 |
| 111 | Ga0070679_101687356 | 3300005530 | Bacteria | 581 |
| 112 | Ga0070684_100410922 | 3300005535 | Bacteria | 1249 |
| 113 | Ga0068853_100004507 | 3300005539 | Bacteria | 10803 |
| 114 | Ga0068853_100027988 | 3300005539 | Bacteria | 4740 |
| 115 | Ga0068853_100366376 | 3300005539 | Bacteria | 1343 |
| 116 | Ga0068853_100384769 | 3300005539 | Bacteria | 1311 |
| 117 | Ga0068853_101344825 | 3300005539 | Bacteria | 691 |
| 118 | Ga0068853_101592476 | 3300005539 | Bacteria | 633 |
| 119 | Ga0070672_100007230 | 3300005543 | Bacteria | 7522 |
| 120 | Ga0070672_100063532 | 3300005543 | Bacteria | 2916 |
| 121 | Ga0070672_100942088 | 3300005543 | Bacteria | 764 |
| 122 | Ga0070672_101064120 | 3300005543 | Bacteria | 718 |
| 123 | Ga0070686_100067137 | 3300005544 | Bacteria | 2335 |
| 124 | Ga0070695_100405074 | 3300005545 | Bacteria | 1035 |
| 125 | Ga0070696_100500481 | 3300005546 | Bacteria | 967 |
| 126 | Ga0070693_100031554 | 3300005547 | Bacteria | 2905 |
| 127 | Ga0070693_100299072 | 3300005547 | Bacteria | 1084 |
| 128 | Ga0070665_100000065 | 3300005548 | Bacteria | 212975 |
| 129 | Ga0070665_100013533 | 3300005548 | Bacteria | 8207 |
| 130 | Ga0070665_100021742 | 3300005548 | Bacteria | 6450 |
| 131 | Ga0070665_100024362 | 3300005548 | Bacteria | 6094 |
| 132 | Ga0070665_100033044 | 3300005548 | Bacteria | 5205 |
| 133 | Ga0070665_100071381 | 3300005548 | Bacteria | 3479 |
| 134 | Ga0070665_100089749 | 3300005548 | Bacteria | 3079 |
| 135 | Ga0070665_100418351 | 3300005548 | Bacteria | 1349 |
| 136 | Ga0070665_100553541 | 3300005548 | Bacteria | 1163 |
| 137 | Ga0070665_100940453 | 3300005548 | Bacteria | 877 |
| 138 | Ga0070665_100961378 | 3300005548 | Bacteria | 866 |
| 139 | Ga0070665_101585939 | 3300005548 | Bacteria | 662 |
| 140 | Ga0070704_100570899 | 3300005549 | Bacteria | 991 |
| 141 | Ga0068855_100042304 | 3300005563 | Bacteria | 5398 |
| 142 | Ga0068855_100347684 | 3300005563 | Bacteria | 1634 |
| 143 | Ga0068855_100670190 | 3300005563 | Bacteria | 1112 |
| 144 | Ga0068855_101097669 | 3300005563 | Bacteria | 832 |
| 145 | Ga0070664_100462330 | 3300005564 | Bacteria | 1166 |
| 146 | Ga0068854_100096521 | 3300005578 | Bacteria | 2209 |
| 147 | Ga0068856_100146118 | 3300005614 | Bacteria | 2372 |
| 148 | Ga0068856_100294116 | 3300005614 | Bacteria | 1641 |
| 149 | Ga0068856_100431063 | 3300005614 | Bacteria | 1339 |
| 150 | Ga0068856_100453433 | 3300005614 | Bacteria | 1303 |
| 151 | Ga0068856_100566740 | 3300005614 | Bacteria | 1157 |
| 152 | Ga0068856_101090544 | 3300005614 | Bacteria | 816 |
| 153 | Ga0068856_101434808 | 3300005614 | Bacteria | 704 |
| 154 | Ga0068856_101769711 | 3300005614 | Bacteria | 630 |
| 155 | Ga0068852_100037728 | 3300005616 | Bacteria | 4054 |
| 156 | Ga0068852_100071507 | 3300005616 | Bacteria | 3046 |
| 157 | Ga0068852_100256278 | 3300005616 | Bacteria | 1678 |
| 158 | Ga0068852_101492301 | 3300005616 | Bacteria | 698 |
| 159 | Ga0068859_100000070 | 3300005617 | Bacteria | 94311 |
| 160 | Ga0068859_100224705 | 3300005617 | Bacteria | 1965 |
| 161 | Ga0068859_100825600 | 3300005617 | Bacteria | 1014 |
| 162 | Ga0068859_101248223 | 3300005617 | Bacteria | 819 |
| 163 | Ga0068864_100954493 | 3300005618 | Bacteria | 849 |
| 164 | Ga0068864_101199439 | 3300005618 | Bacteria | 757 |
| 165 | Ga0068864_101841010 | 3300005618 | Bacteria | 611 |
| 166 | Ga0068866_10062250 | 3300005718 | Bacteria | 1941 |
| 167 | Ga0068861_100003543 | 3300005719 | Bacteria | 10382 |
| 168 | Ga0068861_100009492 | 3300005719 | Bacteria | 6719 |
| 169 | Ga0068851_10018980 | 3300005834 | Bacteria | 3320 |
| 170 | Ga0068851_10871204 | 3300005834 | Bacteria | 563 |
| 171 | Ga0068863_100196184 | 3300005841 | Bacteria | 1941 |
| 172 | Ga0068863_100242827 | 3300005841 | Bacteria | 1738 |
| 173 | Ga0068863_100391841 | 3300005841 | Bacteria | 1357 |
| 174 | Ga0068863_100404990 | 3300005841 | Bacteria | 1335 |
| 175 | Ga0068863_100563235 | 3300005841 | Bacteria | 1126 |
| 176 | Ga0068858_100003907 | 3300005842 | Bacteria | 14721 |
| 177 | Ga0068858_100015311 | 3300005842 | Bacteria | 7214 |
| 178 | Ga0068858_100130761 | 3300005842 | Bacteria | 2354 |
| 179 | Ga0068858_100465824 | 3300005842 | Bacteria | 1219 |
| 180 | Ga0068860_100002268 | 3300005843 | Bacteria | 20215 |
| 181 | Ga0068860_100062495 | 3300005843 | Bacteria | 3538 |
| 182 | Ga0068860_100315074 | 3300005843 | Bacteria | 1535 |
| 183 | Ga0068860_100712708 | 3300005843 | Bacteria | 1014 |
| 184 | Ga0068862_100000041 | 3300005844 | Bacteria | 166801 |
| 185 | Ga0068862_100039926 | 3300005844 | Bacteria | 3988 |
| 186 | Ga0068862_100083515 | 3300005844 | Bacteria | 2773 |
| 187 | Ga0068862_100845412 | 3300005844 | Bacteria | 897 |
| 188 | Ga0068862_101266828 | 3300005844 | Bacteria | 738 |
| 189 | Ga0081455_10080955 | 3300005937 | Bacteria | 2661 |
| 190 | Ga0081455_10121862 | 3300005937 | Bacteria | 2053 |
| 191 | Ga0081540_1011727 | 3300005983 | Bacteria | 5834 |
| 192 | Ga0081540_1015034 | 3300005983 | Bacteria | 4915 |
| 193 | Ga0070717_10000814 | 3300006028 | Bacteria | 20536 |
| 194 | Ga0070717_10124938 | 3300006028 | Bacteria | 2208 |
| 195 | Ga0075368_10154105 | 3300006042 | Bacteria | 960 |
| 196 | Ga0075363_100031120 | 3300006048 | Bacteria | 2765 |
| 197 | Ga0075364_10169639 | 3300006051 | Bacteria | 1475 |
| 198 | Ga0070715_10007032 | 3300006163 | Bacteria | 3854 |
| 199 | Ga0070715_10299341 | 3300006163 | Bacteria | 860 |
| 200 | Ga0070715_10627156 | 3300006163 | Bacteria | 633 |
| 201 | Ga0070715_11071613 | 3300006163 | Bacteria | 506 |
| 202 | Ga0070716_100017024 | 3300006173 | Bacteria | 3761 |
| 203 | Ga0070716_100029503 | 3300006173 | Bacteria | 2966 |
| 204 | Ga0070716_101684933 | 3300006173 | Bacteria | 523 |
| 205 | Ga0070712_100009205 | 3300006175 | Bacteria | 6219 |
| 206 | Ga0070712_100018789 | 3300006175 | Bacteria | 4495 |
| 207 | Ga0070712_100099596 | 3300006175 | Bacteria | 2145 |
| 208 | Ga0070712_100240266 | 3300006175 | Bacteria | 1442 |
| 209 | Ga0075367_10143760 | 3300006178 | Bacteria | 1478 |
| 210 | Ga0075366_10026333 | 3300006195 | Bacteria | 3406 |
| 211 | Ga0075366_10138130 | 3300006195 | Bacteria | 1472 |
| 212 | Ga0075366_10256786 | 3300006195 | Bacteria | 1066 |
| 213 | Ga0075366_10319170 | 3300006195 | Bacteria | 951 |
| 214 | Ga0075366_10380523 | 3300006195 | Bacteria | 868 |
| 215 | Ga0075366_10511477 | 3300006195 | Bacteria | 743 |
| 216 | Ga0097621_100046041 | 3300006237 | Bacteria | 3527 |
| 217 | Ga0097621_100267826 | 3300006237 | Bacteria | 1500 |
| 218 | Ga0097621_100542722 | 3300006237 | Bacteria | 1057 |
| 219 | Ga0097621_100584282 | 3300006237 | Bacteria | 1020 |
| 220 | Ga0097621_101251852 | 3300006237 | Bacteria | 700 |
| 221 | Ga0075370_10000125 | 3300006353 | Bacteria | 25536 |
| 222 | Ga0068871_100122204 | 3300006358 | Bacteria | 2201 |
| 223 | Ga0068871_100234885 | 3300006358 | Bacteria | 1592 |
| 224 | Ga0068871_100386708 | 3300006358 | Bacteria | 1244 |
| 225 | Ga0068871_100497282 | 3300006358 | Bacteria | 1099 |
| 226 | Ga0068871_101009652 | 3300006358 | Bacteria | 775 |
| 227 | Ga0068871_101074246 | 3300006358 | Bacteria | 752 |
| 228 | Ga0068871_101489570 | 3300006358 | Bacteria | 639 |
| 229 | Ga0075428_100380664 | 3300006844 | Bacteria | 1513 |
| 230 | Ga0075430_100046015 | 3300006846 | Bacteria | 3685 |
| 231 | Ga0075434_100515446 | 3300006871 | Bacteria | 1216 |
| 232 | Ga0075434_101050381 | 3300006871 | Bacteria | 828 |
| 233 | Ga0075429_100004520 | 3300006880 | Bacteria | 11962 |
| 234 | Ga0068865_100014391 | 3300006881 | Bacteria | 5025 |
| 235 | Ga0068865_100047454 | 3300006881 | Bacteria | 2951 |
| 236 | Ga0068865_100123750 | 3300006881 | Bacteria | 1927 |
| 237 | Ga0068865_100308774 | 3300006881 | Bacteria | 1268 |
| 238 | Ga0068865_101286169 | 3300006881 | Bacteria | 650 |
| 239 | Ga0075436_100024062 | 3300006914 | Bacteria | 4187 |
| 240 | Ga0075436_100099007 | 3300006914 | Bacteria | 2030 |
| 241 | Ga0097620_100000070 | 3300006931 | Bacteria | 94311 |
| 242 | Ga0097620_100224701 | 3300006931 | Bacteria | 1965 |
| 243 | Ga0097620_100825600 | 3300006931 | Bacteria | 1014 |
| 244 | Ga0097620_101248241 | 3300006931 | Bacteria | 819 |
| 245 | Ga0075435_100388011 | 3300007076 | Bacteria | 1200 |
| 246 | Ga0075435_100536029 | 3300007076 | Bacteria | 1013 |
| 247 | Ga0099795_10000192 | 3300007788 | Bacteria | 10332 |
| 248 | Ga0105244_10009239 | 3300009036 | Bacteria | 6079 |
| 249 | Ga0105250_10038856 | 3300009092 | Bacteria | 1909 |
| 250 | Ga0105250_10116508 | 3300009092 | Bacteria | 1096 |
| 251 | Ga0105240_10013944 | 3300009093 | Bacteria | 11003 |
| 252 | Ga0105240_10287177 | 3300009093 | Bacteria | 1888 |
| 253 | Ga0111539_10057983 | 3300009094 | Bacteria | 4596 |
| 254 | Ga0111539_10139972 | 3300009094 | Bacteria | 2833 |
| 255 | Ga0105245_10002177 | 3300009098 | Bacteria | 17752 |
| 256 | Ga0105245_10265585 | 3300009098 | Bacteria | 1672 |
| 257 | Ga0105245_10597262 | 3300009098 | Bacteria | 1130 |
| 258 | Ga0105247_10003807 | 3300009101 | Bacteria | 9770 |
| 259 | Ga0105247_10121477 | 3300009101 | Bacteria | 1693 |
| 260 | Ga0105247_10373498 | 3300009101 | Bacteria | 1009 |
| 261 | Ga0105247_10498343 | 3300009101 | Bacteria | 887 |
| 262 | Ga0105243_10044965 | 3300009148 | Bacteria | 3467 |
| 263 | Ga0105243_10129905 | 3300009148 | Bacteria | 2136 |
| 264 | Ga0105243_10375202 | 3300009148 | Bacteria | 1314 |
| 265 | Ga0105241_10009761 | 3300009174 | Bacteria | 7054 |
| 266 | Ga0105241_10099570 | 3300009174 | Bacteria | 2309 |
| 267 | Ga0105241_10360243 | 3300009174 | Bacteria | 1265 |
| 268 | Ga0105241_10503864 | 3300009174 | Bacteria | 1080 |
| 269 | Ga0105241_11022523 | 3300009174 | Bacteria | 774 |
| 270 | Ga0105242_10002301 | 3300009176 | Bacteria | 15072 |
| 271 | Ga0105242_10004392 | 3300009176 | Bacteria | 10967 |
| 272 | Ga0105242_10436943 | 3300009176 | Bacteria | 1230 |
| 273 | Ga0105242_10635332 | 3300009176 | Bacteria | 1036 |
| 274 | Ga0105242_11909669 | 3300009176 | Bacteria | 634 |
| 275 | Ga0105242_11989660 | 3300009176 | Bacteria | 623 |
| 276 | Ga0105248_10002111 | 3300009177 | Bacteria | 22008 |
| 277 | Ga0105248_10038865 | 3300009177 | Bacteria | 5328 |
| 278 | Ga0105248_10473001 | 3300009177 | Bacteria | 1413 |
| 279 | Ga0105248_10508775 | 3300009177 | Bacteria | 1358 |
| 280 | Ga0105248_10552277 | 3300009177 | Bacteria | 1299 |
| 281 | Ga0105248_10678870 | 3300009177 | Bacteria | 1162 |
| 282 | Ga0105248_10820021 | 3300009177 | Bacteria | 1050 |
| 283 | Ga0105237_10016690 | 3300009545 | Bacteria | 7622 |
| 284 | Ga0105237_10146176 | 3300009545 | Bacteria | 2359 |
| 285 | Ga0105237_10311568 | 3300009545 | Bacteria | 1577 |
| 286 | Ga0105237_10703642 | 3300009545 | Bacteria | 1017 |
| 287 | Ga0105237_11482502 | 3300009545 | Bacteria | 685 |
| 288 | Ga0105238_10062185 | 3300009551 | Bacteria | 3734 |
| 289 | Ga0105238_10303444 | 3300009551 | Bacteria | 1581 |
| 290 | Ga0105238_10333358 | 3300009551 | Bacteria | 1504 |
| 291 | Ga0105238_10758448 | 3300009551 | Bacteria | 984 |
| 292 | Ga0105238_11266315 | 3300009551 | Bacteria | 763 |
| 293 | Ga0105249_10000394 | 3300009553 | Bacteria | 42210 |
| 294 | Ga0105249_10028985 | 3300009553 | Bacteria | 4999 |
| 295 | Ga0105249_10889331 | 3300009553 | Bacteria | 957 |
| 296 | Ga0105249_11470458 | 3300009553 | Bacteria | 753 |
| 297 | Ga0099796_10000158 | 3300010159 | Bacteria | 10091 |
| 298 | Ga0105239_10057725 | 3300010375 | Bacteria | 4258 |
| 299 | Ga0105239_10115296 | 3300010375 | Bacteria | 2980 |
| 300 | Ga0105239_10345479 | 3300010375 | Bacteria | 1680 |
| 301 | Ga0105239_10448529 | 3300010375 | Bacteria | 1463 |
| 302 | Ga0105239_10759839 | 3300010375 | Bacteria | 1110 |
| 303 | Ga0105239_10927649 | 3300010375 | Bacteria | 1000 |
| 304 | Ga0105239_12533388 | 3300010375 | Bacteria | 598 |
| 305 | Ga0105246_10050555 | 3300011119 | Bacteria | 2851 |
| 306 | Ga0105246_10796713 | 3300011119 | Bacteria | 838 |
| 307 | Ga0157327_1003260 | 3300012512 | Bacteria | 1185 |
| 308 | Ga0157373_10123963 | 3300013100 | Bacteria | 1817 |
| 309 | Ga0157373_10149500 | 3300013100 | Bacteria | 1643 |
| 310 | Ga0157371_11003566 | 3300013102 | Bacteria | 637 |
| 311 | Ga0157370_10111268 | 3300013104 | Bacteria | 2560 |
| 312 | Ga0157370_10112382 | 3300013104 | Bacteria | 2546 |
| 313 | Ga0157370_10836613 | 3300013104 | Bacteria | 837 |
| 314 | Ga0157369_10392167 | 3300013105 | Bacteria | 1441 |
| 315 | Ga0157369_10830659 | 3300013105 | Bacteria | 949 |
| 316 | Ga0157374_10008134 | 3300013296 | Bacteria | 8964 |
| 317 | Ga0157374_10008293 | 3300013296 | Bacteria | 8864 |
| 318 | Ga0157374_10064875 | 3300013296 | Bacteria | 3428 |
| 319 | Ga0157374_10269835 | 3300013296 | Bacteria | 1677 |
| 320 | Ga0157374_10704962 | 3300013296 | Bacteria | 1023 |
| 321 | Ga0157374_12659743 | 3300013296 | Bacteria | 528 |
| 322 | Ga0157378_10001565 | 3300013297 | Bacteria | 20672 |
| 323 | Ga0157378_10004721 | 3300013297 | Bacteria | 11949 |
| 324 | Ga0157378_10293254 | 3300013297 | Bacteria | 1572 |
| 325 | Ga0157378_10863564 | 3300013297 | Bacteria | 934 |
| 326 | Ga0163162_10029905 | 3300013306 | Bacteria | 5394 |
| 327 | Ga0163162_10172753 | 3300013306 | Bacteria | 2286 |
| 328 | Ga0163162_10453435 | 3300013306 | Bacteria | 1414 |
| 329 | Ga0163162_10488736 | 3300013306 | Bacteria | 1362 |
| 330 | Ga0163162_10629544 | 3300013306 | Bacteria | 1197 |
| 331 | Ga0163162_11204204 | 3300013306 | Bacteria | 859 |
| 332 | Ga0163162_12130504 | 3300013306 | Bacteria | 643 |
| 333 | Ga0157372_10059970 | 3300013307 | Bacteria | 4257 |
| 334 | Ga0157372_10397688 | 3300013307 | Bacteria | 1606 |
| 335 | Ga0157375_10000948 | 3300013308 | Bacteria | 25130 |
| 336 | Ga0157375_10074252 | 3300013308 | Bacteria | 3422 |
| 337 | Ga0157375_10343217 | 3300013308 | Bacteria | 1659 |
| 338 | Ga0157375_10489604 | 3300013308 | Bacteria | 1394 |
| 339 | Ga0157375_10765112 | 3300013308 | Bacteria | 1116 |
| 340 | Ga0163163_10026109 | 3300014325 | Bacteria | 5578 |
| 341 | Ga0163163_10041754 | 3300014325 | Bacteria | 4487 |
| 342 | Ga0163163_10159059 | 3300014325 | Bacteria | 2304 |
| 343 | Ga0163163_10311885 | 3300014325 | Bacteria | 1626 |
| 344 | Ga0163163_11023989 | 3300014325 | Bacteria | 889 |
| 345 | Ga0163163_11986717 | 3300014325 | Bacteria | 641 |
| 346 | Ga0157380_10032011 | 3300014326 | Bacteria | 4041 |
| 347 | Ga0157380_10742773 | 3300014326 | Bacteria | 992 |
| 348 | Ga0157380_11312766 | 3300014326 | Bacteria | 771 |
| 349 | Ga0182008_10151380 | 3300014497 | Bacteria | 1164 |
| 350 | Ga0157379_10077258 | 3300014968 | Bacteria | 2981 |
| 351 | Ga0157379_10336291 | 3300014968 | Bacteria | 1380 |
| 352 | Ga0157379_10372351 | 3300014968 | Bacteria | 1310 |
| 353 | Ga0157379_10820234 | 3300014968 | Bacteria | 879 |
| 354 | Ga0157376_10014847 | 3300014969 | Bacteria | 5862 |
| 355 | Ga0157376_10148780 | 3300014969 | Bacteria | 2110 |
| 356 | Ga0157376_10153728 | 3300014969 | Bacteria | 2078 |
| 357 | Ga0157376_10643819 | 3300014969 | Bacteria | 1059 |
| 358 | Ga0157376_10709419 | 3300014969 | Bacteria | 1012 |
| 359 | Ga0157376_10713645 | 3300014969 | Bacteria | 1009 |
| 360 | Ga0157376_11042362 | 3300014969 | Bacteria | 842 |
| 361 | Ga0163161_10156287 | 3300017792 | Bacteria | 1736 |
| 362 | Ga0163161_10377699 | 3300017792 | Bacteria | 1132 |
| 363 | Ga0163161_10913340 | 3300017792 | Bacteria | 745 |
| 364 | Ga0206356_10568014 | 3300020070 | Bacteria | 622 |
| 365 | Ga0207427_100158 | 3300025231 | Bacteria | 76687 |
| 366 | Ga0209130_1003425 | 3300025284 | Bacteria | 6759 |
| 367 | Ga0209675_1006592 | 3300025291 | Bacteria | 4623 |
| 368 | Ga0209676_1010982 | 3300025292 | Bacteria | 3704 |
| 369 | Ga0209025_1067864 | 3300025294 | Bacteria | 1285 |
| 370 | Ga0209564_1027276 | 3300025295 | Bacteria | 1859 |
| 371 | Ga0209050_1062310 | 3300025298 | Bacteria | 874 |
| 372 | Ga0207426_1002416 | 3300025302 | Bacteria | 11980 |
| 373 | Ga0209051_1009603 | 3300025303 | Bacteria | 4968 |
| 374 | Ga0209051_1039391 | 3300025303 | Bacteria | 1707 |
| 375 | Ga0209051_1046380 | 3300025303 | Bacteria | 1495 |
| 376 | Ga0209257_1102878 | 3300025304 | Bacteria | 693 |
| 377 | Ga0207697_10182817 | 3300025315 | Bacteria | 919 |
| 378 | Ga0207656_10007225 | 3300025321 | Bacteria | 4034 |
| 379 | Ga0207713_1005978 | 3300025735 | Bacteria | 7507 |
| 380 | Ga0207692_10235097 | 3300025898 | Bacteria | 1092 |
| 381 | Ga0207692_10761859 | 3300025898 | Bacteria | 631 |
| 382 | Ga0207642_10048391 | 3300025899 | Bacteria | 1906 |
| 383 | Ga0207642_10166567 | 3300025899 | Bacteria | 1188 |
| 384 | Ga0207710_10065981 | 3300025900 | Bacteria | 1651 |
| 385 | Ga0207688_10517267 | 3300025901 | Bacteria | 748 |
| 386 | Ga0207680_10012058 | 3300025903 | Bacteria | 4392 |
| 387 | Ga0207680_10031290 | 3300025903 | Bacteria | 3013 |
| 388 | Ga0207680_10094061 | 3300025903 | Bacteria | 1913 |
| 389 | Ga0207680_10579696 | 3300025903 | Bacteria | 802 |
| 390 | Ga0207680_10589432 | 3300025903 | Bacteria | 795 |
| 391 | Ga0207680_10718197 | 3300025903 | Bacteria | 716 |
| 392 | Ga0207647_10000023 | 3300025904 | Bacteria | 115648 |
| 393 | Ga0207685_10013506 | 3300025905 | Bacteria | 2528 |
| 394 | Ga0207685_10514333 | 3300025905 | Bacteria | 632 |
| 395 | Ga0207685_10578114 | 3300025905 | Bacteria | 600 |
| 396 | Ga0207699_10059384 | 3300025906 | Bacteria | 2291 |
| 397 | Ga0207645_10041741 | 3300025907 | Bacteria | 2936 |
| 398 | Ga0207645_10076851 | 3300025907 | Bacteria | 2139 |
| 399 | Ga0207705_10914426 | 3300025909 | Bacteria | 679 |
| 400 | Ga0207654_10016769 | 3300025911 | Bacteria | 3818 |
| 401 | Ga0207654_10019088 | 3300025911 | Bacteria | 3610 |
| 402 | Ga0207654_10078914 | 3300025911 | Bacteria | 1976 |
| 403 | Ga0207654_10640961 | 3300025911 | Bacteria | 760 |
| 404 | Ga0207707_10002957 | 3300025912 | Bacteria | 15139 |
| 405 | Ga0207707_10043393 | 3300025912 | Bacteria | 3923 |
| 406 | Ga0207707_10987409 | 3300025912 | Bacteria | 692 |
| 407 | Ga0207695_10010030 | 3300025913 | Bacteria | 11631 |
| 408 | Ga0207695_10081843 | 3300025913 | Bacteria | 3266 |
| 409 | Ga0207695_10104708 | 3300025913 | Bacteria | 2818 |
| 410 | Ga0207695_10158019 | 3300025913 | Bacteria | 2200 |
| 411 | Ga0207671_10000929 | 3300025914 | Bacteria | 36747 |
| 412 | Ga0207671_10011778 | 3300025914 | Bacteria | 7081 |
| 413 | Ga0207671_10100850 | 3300025914 | Bacteria | 2186 |
| 414 | Ga0207671_10585154 | 3300025914 | Bacteria | 890 |
| 415 | Ga0207693_10001689 | 3300025915 | Bacteria | 19438 |
| 416 | Ga0207693_10026865 | 3300025915 | Bacteria | 4553 |
| 417 | Ga0207693_10514204 | 3300025915 | Bacteria | 934 |
| 418 | Ga0207663_10025632 | 3300025916 | Bacteria | 3412 |
| 419 | Ga0207663_10083792 | 3300025916 | Bacteria | 2095 |
| 420 | Ga0207663_10208455 | 3300025916 | Bacteria | 1415 |
| 421 | Ga0207663_10467677 | 3300025916 | Bacteria | 975 |
| 422 | Ga0207660_10719809 | 3300025917 | Bacteria | 814 |
| 423 | Ga0207660_11108272 | 3300025917 | Bacteria | 645 |
| 424 | Ga0207662_10326671 | 3300025918 | Bacteria | 1025 |
| 425 | Ga0207657_10145429 | 3300025919 | Bacteria | 1934 |
| 426 | Ga0207649_10462676 | 3300025920 | Bacteria | 959 |
| 427 | Ga0207649_10679841 | 3300025920 | Bacteria | 797 |
| 428 | Ga0207649_10817584 | 3300025920 | Bacteria | 728 |
| 429 | Ga0207652_10054792 | 3300025921 | Bacteria | 3429 |
| 430 | Ga0207681_10081260 | 3300025923 | Bacteria | 2288 |
| 431 | Ga0207681_10084547 | 3300025923 | Bacteria | 2250 |
| 432 | Ga0207681_10440498 | 3300025923 | Bacteria | 1059 |
| 433 | Ga0207681_10542115 | 3300025923 | Bacteria | 957 |
| 434 | Ga0207694_10414659 | 3300025924 | Bacteria | 1121 |
| 435 | Ga0207650_10024055 | 3300025925 | Bacteria | 4326 |
| 436 | Ga0207650_10242540 | 3300025925 | Bacteria | 1457 |
| 437 | Ga0207687_10037950 | 3300025927 | Bacteria | 3290 |
| 438 | Ga0207687_10853595 | 3300025927 | Bacteria | 778 |
| 439 | Ga0207700_10088146 | 3300025928 | Bacteria | 2442 |
| 440 | Ga0207700_10153328 | 3300025928 | Bacteria | 1906 |
| 441 | Ga0207700_10197190 | 3300025928 | Bacteria | 1695 |
| 442 | Ga0207664_10037381 | 3300025929 | Bacteria | 3757 |
| 443 | Ga0207664_10100991 | 3300025929 | Bacteria | 2383 |
| 444 | Ga0207664_10374008 | 3300025929 | Bacteria | 1264 |
| 445 | Ga0207644_10105748 | 3300025931 | Bacteria | 2121 |
| 446 | Ga0207644_10145853 | 3300025931 | Bacteria | 1827 |
| 447 | Ga0207644_10231254 | 3300025931 | Bacteria | 1469 |
| 448 | Ga0207690_10087522 | 3300025932 | Bacteria | 2192 |
| 449 | Ga0207690_11594588 | 3300025932 | Bacteria | 545 |
| 450 | Ga0207706_10002543 | 3300025933 | Bacteria | 17778 |
| 451 | Ga0207706_10092120 | 3300025933 | Bacteria | 2665 |
| 452 | Ga0207706_10506427 | 3300025933 | Bacteria | 1042 |
| 453 | Ga0207686_10147050 | 3300025934 | Bacteria | 1636 |
| 454 | Ga0207686_10280585 | 3300025934 | Bacteria | 1230 |
| 455 | Ga0207686_10689411 | 3300025934 | Bacteria | 811 |
| 456 | Ga0207686_10994451 | 3300025934 | Bacteria | 680 |
| 457 | Ga0207709_10149103 | 3300025935 | Bacteria | 1618 |
| 458 | Ga0207669_10143318 | 3300025937 | Bacteria | 1662 |
| 459 | Ga0207669_10861237 | 3300025937 | Bacteria | 755 |
| 460 | Ga0207704_10048960 | 3300025938 | Bacteria | 2538 |
| 461 | Ga0207704_10061757 | 3300025938 | Bacteria | 2326 |
| 462 | Ga0207704_10166441 | 3300025938 | Bacteria | 1575 |
| 463 | Ga0207665_10001560 | 3300025939 | Bacteria | 15442 |
| 464 | Ga0207665_10013681 | 3300025939 | Bacteria | 5337 |
| 465 | Ga0207691_10013978 | 3300025940 | Bacteria | 7658 |
| 466 | Ga0207711_10001156 | 3300025941 | Bacteria | 25114 |
| 467 | Ga0207711_10217817 | 3300025941 | Bacteria | 1745 |
| 468 | Ga0207711_10244437 | 3300025941 | Bacteria | 1646 |
| 469 | Ga0207711_10358182 | 3300025941 | Bacteria | 1351 |
| 470 | Ga0207689_10110716 | 3300025942 | Bacteria | 2256 |
| 471 | Ga0207689_10130815 | 3300025942 | Bacteria | 2066 |
| 472 | Ga0207689_10324490 | 3300025942 | Bacteria | 1278 |
| 473 | Ga0207689_10351873 | 3300025942 | Bacteria | 1225 |
| 474 | Ga0207689_10985436 | 3300025942 | Bacteria | 711 |
| 475 | Ga0207679_10394142 | 3300025945 | Bacteria | 1217 |
| 476 | Ga0207679_10497371 | 3300025945 | Bacteria | 1087 |
| 477 | Ga0207679_10839500 | 3300025945 | Bacteria | 839 |
| 478 | Ga0207667_10338935 | 3300025949 | Bacteria | 1534 |
| 479 | Ga0207651_10197611 | 3300025960 | Bacteria | 1609 |
| 480 | Ga0207651_10639864 | 3300025960 | Bacteria | 933 |
| 481 | Ga0207712_10000228 | 3300025961 | Bacteria | 55397 |
| 482 | Ga0207712_10000345 | 3300025961 | Bacteria | 41964 |
| 483 | Ga0207712_10893126 | 3300025961 | Bacteria | 785 |
| 484 | Ga0207712_10967274 | 3300025961 | Bacteria | 754 |
| 485 | Ga0207668_10041101 | 3300025972 | Bacteria | 3123 |
| 486 | Ga0207668_10311917 | 3300025972 | Bacteria | 1302 |
| 487 | Ga0207640_10095297 | 3300025981 | Bacteria | 2072 |
| 488 | Ga0207658_10000020 | 3300025986 | Bacteria | 202984 |
| 489 | Ga0207658_10019220 | 3300025986 | Bacteria | 4724 |
| 490 | Ga0207658_10057948 | 3300025986 | Bacteria | 2880 |
| 491 | Ga0207658_10128742 | 3300025986 | Bacteria | 2030 |
| 492 | Ga0207658_10168481 | 3300025986 | Bacteria | 1802 |
| 493 | Ga0207658_10208875 | 3300025986 | Bacteria | 1635 |
| 494 | Ga0207658_10457342 | 3300025986 | Bacteria | 1131 |
| 495 | Ga0207658_10854596 | 3300025986 | Bacteria | 827 |
| 496 | Ga0207658_11019182 | 3300025986 | Bacteria | 755 |
| 497 | Ga0207658_11414647 | 3300025986 | Bacteria | 636 |
| 498 | Ga0207677_10217653 | 3300026023 | Bacteria | 1529 |
| 499 | Ga0207677_10289434 | 3300026023 | Bacteria | 1348 |
| 500 | Ga0207677_10337959 | 3300026023 | Bacteria | 1257 |
| 501 | Ga0207677_10429316 | 3300026023 | Bacteria | 1127 |
| 502 | Ga0207677_10566905 | 3300026023 | Bacteria | 992 |
| 503 | Ga0207703_10002854 | 3300026035 | Bacteria | 14736 |
| 504 | Ga0207703_10102252 | 3300026035 | Bacteria | 2431 |
| 505 | Ga0207703_10205502 | 3300026035 | Bacteria | 1753 |
| 506 | Ga0207703_11244141 | 3300026035 | Bacteria | 716 |
| 507 | Ga0207703_11676247 | 3300026035 | Bacteria | 611 |
| 508 | Ga0207639_10000405 | 3300026041 | Bacteria | 29812 |
| 509 | Ga0207639_10026683 | 3300026041 | Bacteria | 4198 |
| 510 | Ga0207639_10190287 | 3300026041 | Bacteria | 1752 |
| 511 | Ga0207639_10337375 | 3300026041 | Bacteria | 1343 |
| 512 | Ga0207639_10339752 | 3300026041 | Bacteria | 1338 |
| 513 | Ga0207639_10342494 | 3300026041 | Bacteria | 1333 |
| 514 | Ga0207639_10394079 | 3300026041 | Bacteria | 1246 |
| 515 | Ga0207678_10000010 | 3300026067 | Bacteria | 149258 |
| 516 | Ga0207678_10013505 | 3300026067 | Bacteria | 7170 |
| 517 | Ga0207678_11342139 | 3300026067 | Bacteria | 632 |
| 518 | Ga0207708_10009588 | 3300026075 | Bacteria | 7178 |
| 519 | Ga0207702_10057451 | 3300026078 | Bacteria | 3307 |
| 520 | Ga0207702_10206754 | 3300026078 | Bacteria | 1823 |
| 521 | Ga0207702_10334280 | 3300026078 | Bacteria | 1446 |
| 522 | Ga0207702_10469533 | 3300026078 | Bacteria | 1223 |
| 523 | Ga0207702_10916315 | 3300026078 | Bacteria | 869 |
| 524 | Ga0207702_12213726 | 3300026078 | Bacteria | 538 |
| 525 | Ga0207641_10113987 | 3300026088 | Bacteria | 2401 |
| 526 | Ga0207641_10142348 | 3300026088 | Bacteria | 2165 |
| 527 | Ga0207641_10610878 | 3300026088 | Bacteria | 1068 |
| 528 | Ga0207641_10710383 | 3300026088 | Bacteria | 990 |
| 529 | Ga0207641_10774288 | 3300026088 | Bacteria | 948 |
| 530 | Ga0207648_10001067 | 3300026089 | Bacteria | 30723 |
| 531 | Ga0207648_10030844 | 3300026089 | Bacteria | 4744 |
| 532 | Ga0207648_10044786 | 3300026089 | Bacteria | 3882 |
| 533 | Ga0207648_10083622 | 3300026089 | Bacteria | 2784 |
| 534 | Ga0207676_10189897 | 3300026095 | Bacteria | 1807 |
| 535 | Ga0207676_10306071 | 3300026095 | Bacteria | 1453 |
| 536 | Ga0207676_10635479 | 3300026095 | Bacteria | 1029 |
| 537 | Ga0207674_11219568 | 3300026116 | Bacteria | 722 |
| 538 | Ga0207675_100000393 | 3300026118 | Bacteria | 41975 |
| 539 | Ga0207675_100010527 | 3300026118 | Bacteria | 8665 |
| 540 | Ga0207675_101366704 | 3300026118 | Bacteria | 729 |
| 541 | Ga0207683_10103520 | 3300026121 | Bacteria | 2543 |
| 542 | Ga0207683_10104979 | 3300026121 | Bacteria | 2525 |
| 543 | Ga0207683_10207272 | 3300026121 | Bacteria | 1783 |
| 544 | Ga0207683_10226302 | 3300026121 | Bacteria | 1705 |
| 545 | Ga0207683_10309386 | 3300026121 | Bacteria | 1446 |
| 546 | Ga0207698_10234682 | 3300026142 | Bacteria | 1668 |
| 547 | Ga0207698_10536126 | 3300026142 | Bacteria | 1145 |
| 548 | Ga0207698_11145356 | 3300026142 | Bacteria | 791 |
| 549 | Ga0207698_11387585 | 3300026142 | Bacteria | 718 |
| 550 | Ga0209179_1017778 | 3300027512 | Bacteria | 1351 |
| 551 | Ga0209813_10008637 | 3300027866 | Bacteria | 2581 |
| 552 | Ga0207428_10382011 | 3300027907 | Bacteria | 1033 |
| 553 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 554 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 555 | Ga0268266_10052426 | 3300028379 | Bacteria | 3503 |
| 556 | Ga0268266_10155888 | 3300028379 | Bacteria | 2062 |
| 557 | Ga0268266_10562249 | 3300028379 | Bacteria | 1093 |
| 558 | Ga0268266_10593665 | 3300028379 | Bacteria | 1063 |
| 559 | Ga0268265_10000137 | 3300028380 | Bacteria | 93389 |
| 560 | Ga0268265_10018829 | 3300028380 | Bacteria | 4790 |
| 561 | Ga0268265_10036752 | 3300028380 | Bacteria | 3589 |
| 562 | Ga0268265_10084184 | 3300028380 | Bacteria | 2520 |
| 563 | Ga0268265_11990173 | 3300028380 | Bacteria | 588 |
| 564 | Ga0268264_10001497 | 3300028381 | Bacteria | 21798 |
| 565 | Ga0268264_10468084 | 3300028381 | Bacteria | 1224 |
| 566 | Ga0268264_10809535 | 3300028381 | Bacteria | 936 |
| 567 | Ga0265326_10023708 | 3300028558 | Bacteria | 1753 |
| 568 | Ga0265319_1011783 | 3300028563 | Bacteria | 3560 |
| 569 | Ga0265334_10000686 | 3300028573 | Bacteria | 16949 |
| 570 | Ga0265318_10002965 | 3300028577 | Bacteria | 8782 |
| 571 | Ga0307517_10049020 | 3300028786 | Bacteria | 4331 |
| 572 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 573 | Ga0307515_10176759 | 3300028794 | Bacteria | 2102 |
| 574 | Ga0265338_10009041 | 3300028800 | Bacteria | 11981 |
| 575 | Ga0265338_10132868 | 3300028800 | Bacteria | 1962 |
| 576 | Ga0265767_101674 | 3300030836 | Bacteria | 1113 |
| 577 | Ga0265769_110927 | 3300030888 | Bacteria | 626 |
| 578 | Ga0265330_10072924 | 3300031235 | Bacteria | 1484 |
| 579 | Ga0265332_10056646 | 3300031238 | Bacteria | 1679 |
| 580 | Ga0265328_10070910 | 3300031239 | Bacteria | 1281 |
| 581 | Ga0265320_10020389 | 3300031240 | Bacteria | 3596 |
| 582 | Ga0265325_10043888 | 3300031241 | Bacteria | 2330 |
| 583 | Ga0265340_10151579 | 3300031247 | Bacteria | 1056 |
| 584 | Ga0265331_10005291 | 3300031250 | Bacteria | 7812 |
| 585 | Ga0265331_10007111 | 3300031250 | Bacteria | 6516 |
| 586 | Ga0265331_10080610 | 3300031250 | Bacteria | 1513 |
| 587 | Ga0265327_10000217 | 3300031251 | Bacteria | 117085 |
| 588 | Ga0265327_10000923 | 3300031251 | Bacteria | 43037 |
| 589 | Ga0265316_10197716 | 3300031344 | Bacteria | 1491 |
| 590 | Ga0307513_10037093 | 3300031456 | Bacteria | 5427 |
| 591 | Ga0307513_10623189 | 3300031456 | Bacteria | 787 |
| 592 | Ga0307509_10251736 | 3300031507 | Bacteria | 1549 |
| 593 | Ga0307509_10512826 | 3300031507 | Bacteria | 882 |
| 594 | Ga0307509_10621751 | 3300031507 | Bacteria | 751 |
| 595 | Ga0307408_100159070 | 3300031548 | Bacteria | 1792 |
| 596 | Ga0307408_100281305 | 3300031548 | Bacteria | 1386 |
| 597 | Ga0307408_100742666 | 3300031548 | Bacteria | 886 |
| 598 | Ga0307408_101092041 | 3300031548 | Bacteria | 740 |
| 599 | Ga0265313_10013741 | 3300031595 | Bacteria | 4830 |
| 600 | Ga0316575_10023148 | 3300031665 | Bacteria | 2399 |
| 601 | Ga0316579_10000335 | 3300031691 | Bacteria | 14709 |
| 602 | Ga0316579_10036051 | 3300031691 | Bacteria | 2281 |
| 603 | Ga0316579_10056016 | 3300031691 | Bacteria | 1850 |
| 604 | Ga0265314_10046888 | 3300031711 | Bacteria | 3046 |
| 605 | Ga0265342_10025329 | 3300031712 | Bacteria | 3732 |
| 606 | Ga0316576_10501143 | 3300031727 | Bacteria | 893 |
| 607 | Ga0316578_10005901 | 3300031728 | Bacteria | 5991 |
| 608 | Ga0316578_10123723 | 3300031728 | Bacteria | 1555 |
| 609 | Ga0307516_10008706 | 3300031730 | Bacteria | 11411 |
| 610 | Ga0307516_10192768 | 3300031730 | Bacteria | 1763 |
| 611 | Ga0316577_10290875 | 3300031733 | Bacteria | 925 |
| 612 | Ga0307413_10690716 | 3300031824 | Bacteria | 847 |
| 613 | Ga0307413_11018302 | 3300031824 | Bacteria | 711 |
| 614 | Ga0307413_11084135 | 3300031824 | Bacteria | 691 |
| 615 | Ga0307410_10269118 | 3300031852 | Bacteria | 1332 |
| 616 | Ga0307410_10580325 | 3300031852 | Bacteria | 933 |
| 617 | Ga0307410_10868954 | 3300031852 | Bacteria | 771 |
| 618 | Ga0307412_10380154 | 3300031911 | Bacteria | 1143 |
| 619 | Ga0307412_10577018 | 3300031911 | Bacteria | 949 |
| 620 | Ga0307412_11502820 | 3300031911 | Bacteria | 612 |
| 621 | Ga0307414_10073307 | 3300032004 | Bacteria | 2476 |
| 622 | Ga0307414_10603819 | 3300032004 | Bacteria | 984 |
| 623 | Ga0307414_11985021 | 3300032004 | Bacteria | 543 |
| 624 | Ga0307411_10376212 | 3300032005 | Bacteria | 1167 |
| 625 | Ga0307411_10741296 | 3300032005 | Bacteria | 860 |
| 626 | Ga0307415_100800222 | 3300032126 | Bacteria | 860 |
| 627 | Ga0316583_10012201 | 3300032133 | Bacteria | 3100 |
| 628 | Ga0316583_10019818 | 3300032133 | Bacteria | 2411 |
| 629 | Ga0307507_10166340 | 3300033179 | Bacteria | 1615 |
| 630 | Ga0307510_10014225 | 3300033180 | Bacteria | 9423 |
| 631 | Ga0373923_0169290 | 3300035111 | Bacteria | 1000 |
| 632 | Ga0373923_0279400 | 3300035111 | Bacteria | 787 |
| 633 | Ga0373923_0381825 | 3300035111 | Bacteria | 676 |
| 634 | Ga0373936_0049743 | 3300035113 | Bacteria | 1694 |
| 635 | Ga0373936_0122300 | 3300035113 | Bacteria | 1113 |
| 636 | Ga0373939_0312432 | 3300035114 | Bacteria | 630 |
| 637 | Ga0373945_0075432 | 3300035116 | Bacteria | 1284 |
| 638 | Ga0373957_0100589 | 3300035120 | Bacteria | 1157 |
| 639 | Ga0373957_0292915 | 3300035120 | Bacteria | 689 |
| 640 | Ga0373943_0169191 | 3300035170 | Bacteria | 1195 |
| 641 | Ga0373943_0404926 | 3300035170 | Bacteria | 788 |
| 642 | Ga0373946_0116842 | 3300035171 | Bacteria | 1214 |
| 643 | Ga0373946_0138135 | 3300035171 | Bacteria | 1127 |
| 644 | Ga0373955_0015873 | 3300035172 | Bacteria | 3696 |
| 645 | Ga0316574_0018381 | 3300035398 | Bacteria | 4106 |
| 646 | Ga0373924_0414075 | 3300035410 | Bacteria | 603 |
| 647 | Ga0373931_0240633 | 3300035691 | Bacteria | 1097 |
| 648 | Ga0373935_1316134 | 3300035692 | Bacteria | 540 |
| 649 | Ga0373927_0008876 | 3300035695 | Bacteria | 6752 |
| 650 | Ga0373927_0008998 | 3300035695 | Bacteria | 6704 |
| 651 | Ga0373933_0137840 | 3300035724 | Bacteria | 1538 |
| 652 | Ga0373933_0759234 | 3300035724 | Bacteria | 638 |
| 653 | Ga0373937_0007789 | 3300036401 | Bacteria | 9286 |
| 654 | Ga0373937_0044059 | 3300036401 | Bacteria | 4075 |
| 655 | Ga0373937_0226658 | 3300036401 | Bacteria | 1759 |
| 656 | Ga0373937_0354444 | 3300036401 | Bacteria | 1390 |
| 657 | Ga0316582_0131502 | 3300036647 | Bacteria | 1681 |
| 658 | Ga0316584_0002853 | 3300036712 | Bacteria | 11086 |
| 659 | Ga0316584_1137019 | 3300036712 | Bacteria | 517 |
| 660 | Ga0373925_0019765 | 3300037068 | Bacteria | 4902 |
| 661 | Ga0373925_0297118 | 3300037068 | Bacteria | 1303 |
| 662 | Ga0395899_0160092 | 3300037312 | Bacteria | 1591 |
| 663 | Ga0395900_0062240 | 3300037418 | Bacteria | 3836 |
| 664 | Ga0395900_0529314 | 3300037418 | Bacteria | 1126 |
| 665 | Ga0395905_0091825 | 3300037471 | Bacteria | 2846 |
| 666 | Ga0395905_0321319 | 3300037471 | Bacteria | 1437 |
| 667 | Ga0395905_0814794 | 3300037471 | Bacteria | 836 |
| 668 | Ga0316581_0113039 | 3300037588 | Bacteria | 836 |
| 669 | Ga0395901_0592085 | 3300038443 | Bacteria | 1119 |
| 670 | Ga0400485_20664 | 3300038735 | Bacteria | 2386 |
| 671 | Ga0400486_05964 | 3300038742 | Bacteria | 2633 |
| 672 | Ga0400486_24080 | 3300038742 | Bacteria | 1589 |
| 673 | Ga0400487_64253 | 3300039110 | Bacteria | 1283 |
| 674 | Ga0436363_1408620 | 3300039450 | Bacteria | 547 |
| 675 | Ga0436363_1696509 | 3300039450 | Bacteria | 635 |
| 676 | Ga0439436_0193526 | 3300041404 | Bacteria | 581 |
| 677 | Ga0439461_0054247 | 3300041410 | Bacteria | 896 |
| 678 | Ga0439465_0179017 | 3300041413 | Bacteria | 766 |
| 679 | Ga0451787_090787 | 3300041441 | Bacteria | 1234 |
| 680 | Ga0451789_0077899 | 3300041443 | Bacteria | 721 |
| 681 | Ga0451789_0844787 | 3300041443 | Bacteria | 1111 |
| 682 | Ga0451791_1373322 | 3300041451 | Bacteria | 808 |
| 683 | Ga0451793_0165339 | 3300041452 | Bacteria | 645 |
| 684 | Ga0451793_0173052 | 3300041452 | Bacteria | 568 |
| 685 | Ga0451793_1258784 | 3300041452 | Bacteria | 779 |
| 686 | Ga0451795_1351381 | 3300041456 | Bacteria | 1046 |
| 687 | Ga0451800_1428091 | 3300041459 | Bacteria | 989 |
| 688 | Ga0451804_0833077 | 3300041463 | Bacteria | 596 |
| 689 | Ga0451807_2726366 | 3300041486 | Bacteria | 505 |
| 690 | Ga0451835_0574946 | 3300041492 | Bacteria | 619 |
| 691 | Ga0451841_1204341 | 3300041498 | Bacteria | 871 |
| 692 | Ga0451847_0397701 | 3300041503 | Bacteria | 934 |
| 693 | Ga0451851_0422575 | 3300041507 | Bacteria | 572 |
| 694 | Ga0451851_1233695 | 3300041507 | Bacteria | 761 |
| 695 | Ga0451843_1018122 | 3300041509 | Bacteria | 882 |
| 696 | Ga0451853_0843378 | 3300041512 | Bacteria | 665 |
| 697 | Ga0439462_0083638 | 3300042015 | Bacteria | 873 |
| 698 | Ga0450893_0018963 | 3300042532 | Bacteria | 1175 |
| 699 | Ga0451577_0093636 | 3300042876 | Bacteria | 2683 |
| 700 | Ga0451577_0324788 | 3300042876 | Bacteria | 1395 |
| 701 | Ga0451577_1539865 | 3300042876 | Bacteria | 587 |
| 702 | Ga0453684_0003473 | 3300044712 | Bacteria | 35388 |
| 703 | Ga0453684_0214192 | 3300044712 | Bacteria | 2236 |
| 704 | Ga0453684_1426442 | 3300044712 | Bacteria | 717 |
| 705 | Ga0451576_0529544 | 3300045051 | Bacteria | 1238 |
| 706 | Ga0451576_0834716 | 3300045051 | Bacteria | 967 |
| 707 | Ga0466967_0320759 | 3300045976 | Bacteria | 1494 |
| 708 | Ga0466967_0329752 | 3300045976 | Bacteria | 1474 |
| 709 | Ga0466967_0430551 | 3300045976 | Bacteria | 1287 |
| 710 | Ga0495603_0607818 | 3300046455 | Bacteria | 626 |
| 711 | Ga0495590_0002486 | 3300046457 | Bacteria | 7626 |
| 712 | Ga0495629_0380930 | 3300046459 | Bacteria | 960 |
| 713 | Ga0495629_0630211 | 3300046459 | Bacteria | 715 |
| 714 | Ga0495638_0061927 | 3300046460 | Bacteria | 2310 |
| 715 | Ga0495641_0194236 | 3300046461 | Bacteria | 910 |
| 716 | Ga0495650_0007591 | 3300046471 | Bacteria | 6484 |
| 717 | Ga0495650_0031451 | 3300046471 | Bacteria | 2388 |
| 718 | Ga0495650_0092512 | 3300046471 | Bacteria | 1148 |
| 719 | Ga0495580_0000952 | 3300046472 | Bacteria | 25321 |
| 720 | Ga0495580_0107786 | 3300046472 | Bacteria | 1934 |
| 721 | Ga0495582_0006801 | 3300046473 | Bacteria | 6363 |
| 722 | Ga0495639_0053130 | 3300046475 | Bacteria | 1845 |
| 723 | Ga0495664_0116619 | 3300046477 | Bacteria | 1614 |
| 724 | Ga0495596_0329117 | 3300046500 | Bacteria | 594 |
| 725 | Ga0495583_0168485 | 3300046506 | Bacteria | 901 |
| 726 | Ga0495608_0193354 | 3300046511 | Bacteria | 1284 |
| 727 | Ga0495618_0595548 | 3300046514 | Bacteria | 658 |
| 728 | Ga0495620_0012529 | 3300046515 | Bacteria | 4373 |
| 729 | Ga0495620_0026015 | 3300046515 | Bacteria | 2758 |
| 730 | Ga0495630_0345860 | 3300046517 | Bacteria | 1138 |
| 731 | Ga0495642_0515727 | 3300046528 | Bacteria | 530 |
| 732 | Ga0495652_1012914 | 3300046529 | Bacteria | 543 |
| 733 | Ga0495665_0130413 | 3300046531 | Bacteria | 1316 |
| 734 | Ga0495587_0370021 | 3300046536 | Bacteria | 798 |
| 735 | Ga0495597_0012789 | 3300046542 | Bacteria | 4040 |
| 736 | Ga0495645_0200776 | 3300046543 | Bacteria | 1353 |
| 737 | Ga0495645_0258893 | 3300046543 | Bacteria | 1153 |
| 738 | Ga0495667_0286764 | 3300046559 | Bacteria | 1045 |
| 739 | Ga0495656_0001865 | 3300046615 | Bacteria | 6952 |
| 740 | Ga0495625_0386740 | 3300046660 | Bacteria | 877 |
| 741 | Ga0495657_0647518 | 3300046675 | Bacteria | 609 |
| 742 | Ga0495599_0204334 | 3300046678 | Bacteria | 1213 |
| 743 | Ga0495646_0195434 | 3300046680 | Bacteria | 1104 |
| 744 | Ga0495647_0163002 | 3300046681 | Bacteria | 962 |
| 745 | Ga0495647_0216957 | 3300046681 | Bacteria | 843 |
| 746 | Ga0495658_0021327 | 3300046683 | Bacteria | 3414 |
| 747 | Ga0495624_0297296 | 3300046690 | Bacteria | 974 |
| 748 | Ga0495660_0146296 | 3300046810 | Bacteria | 1171 |
| 749 | Ga0495581_0079163 | 3300047315 | Bacteria | 1902 |
| 750 | Ga0495581_0261624 | 3300047315 | Bacteria | 1012 |
| 751 | Ga0495674_0243093 | 3300047319 | Bacteria | 1483 |
| 752 | Ga0495674_0356455 | 3300047319 | Bacteria | 1187 |
| 753 | Ga0495683_0005445 | 3300047323 | Bacteria | 7065 |
| 754 | Ga0495687_066428 | 3300047443 | Bacteria | 1464 |
| 755 | Ga0495686_0023221 | 3300047472 | Bacteria | 4093 |
| 756 | Ga0495602_0125516 | 3300048088 | Bacteria | 2057 |
| 757 | Ga0495602_0192246 | 3300048088 | Bacteria | 1564 |
| 758 | Ga0495626_0039747 | 3300048091 | Bacteria | 2225 |
| 759 | Ga0496100_0017862 | 3300048903 | Bacteria | 4196 |
| 760 | Ga0496100_0061986 | 3300048903 | Bacteria | 2466 |
| 761 | Ga0496100_0174448 | 3300048903 | Bacteria | 1551 |
| 762 | Ga0496100_0191056 | 3300048903 | Bacteria | 1486 |
| 763 | Ga0496101_0006111 | 3300048904 | Bacteria | 7732 |
| 764 | Ga0496101_0059923 | 3300048904 | Bacteria | 2760 |
| 765 | Ga0496101_0067611 | 3300048904 | Bacteria | 2609 |
| 766 | Ga0496101_0070758 | 3300048904 | Bacteria | 2555 |
| 767 | Ga0496101_0494880 | 3300048904 | Bacteria | 966 |
| 768 | Ga0496101_1137070 | 3300048904 | Bacteria | 613 |
| 769 | Ga0496102_0017184 | 3300048905 | Bacteria | 6334 |
| 770 | Ga0496102_0091734 | 3300048905 | Bacteria | 2812 |
| 771 | Ga0496102_0152454 | 3300048905 | Bacteria | 2172 |
| 772 | Ga0496102_0340311 | 3300048905 | Bacteria | 1413 |
| 773 | Ga0496103_0005415 | 3300048906 | Bacteria | 7641 |
| 774 | Ga0496103_0027159 | 3300048906 | Bacteria | 3466 |
| 775 | Ga0496103_0096419 | 3300048906 | Bacteria | 1869 |
| 776 | Ga0496104_0056562 | 3300048907 | Bacteria | 3710 |
| 777 | Ga0496104_0292031 | 3300048907 | Bacteria | 1543 |
| 778 | Ga0496104_0558598 | 3300048907 | Bacteria | 1055 |
| 779 | Ga0496104_0581398 | 3300048907 | Bacteria | 1030 |
| 780 | Ga0496104_0889711 | 3300048907 | Bacteria | 796 |
| 781 | Ga0496104_0906569 | 3300048907 | Bacteria | 786 |
| 782 | Ga0496105_0000080 | 3300048908 | Bacteria | 70744 |
| 783 | Ga0496105_0010228 | 3300048908 | Bacteria | 7375 |
| 784 | Ga0496105_0142394 | 3300048908 | Bacteria | 1973 |
| 785 | Ga0496105_0305285 | 3300048908 | Bacteria | 1278 |
| 786 | Ga0496105_1144733 | 3300048908 | Bacteria | 575 |
| 787 | Ga0496106_0017058 | 3300048909 | Bacteria | 5374 |
| 788 | Ga0496106_0063569 | 3300048909 | Bacteria | 2805 |
| 789 | Ga0496106_0064017 | 3300048909 | Bacteria | 2797 |
| 790 | Ga0496107_0002917 | 3300048910 | Bacteria | 11308 |
| 791 | Ga0496107_0009091 | 3300048910 | Bacteria | 6888 |
| 792 | Ga0496107_0015412 | 3300048910 | Bacteria | 5356 |
| 793 | Ga0496107_0611552 | 3300048910 | Bacteria | 805 |
| 794 | Ga0496108_0007173 | 3300048911 | Bacteria | 9033 |
| 795 | Ga0496108_0011741 | 3300048911 | Bacteria | 7124 |
| 796 | Ga0496108_0226900 | 3300048911 | Bacteria | 1623 |
| 797 | Ga0496108_0295537 | 3300048911 | Bacteria | 1410 |
| 798 | Ga0496108_1799845 | 3300048911 | Bacteria | 501 |
| 799 | Ga0496109_0007077 | 3300048912 | Bacteria | 9468 |
| 800 | Ga0496109_0024423 | 3300048912 | Bacteria | 5373 |
| 801 | Ga0496109_0037304 | 3300048912 | Bacteria | 4392 |
| 802 | Ga0496109_0208071 | 3300048912 | Bacteria | 1840 |
| 803 | Ga0496109_0403962 | 3300048912 | Bacteria | 1290 |
| 804 | Ga0496110_0006629 | 3300048913 | Bacteria | 9196 |
| 805 | Ga0496110_0009205 | 3300048913 | Bacteria | 7980 |
| 806 | Ga0496110_0026379 | 3300048913 | Bacteria | 4971 |
| 807 | Ga0496110_0039980 | 3300048913 | Bacteria | 4086 |
| 808 | Ga0496110_0077126 | 3300048913 | Bacteria | 2964 |
| 809 | Ga0496110_0308662 | 3300048913 | Bacteria | 1441 |
| 810 | Ga0496111_0002222 | 3300048914 | Bacteria | 11636 |
| 811 | Ga0496111_0012669 | 3300048914 | Bacteria | 5714 |
| 812 | Ga0496111_0042213 | 3300048914 | Bacteria | 3274 |
| 813 | Ga0496111_0138442 | 3300048914 | Bacteria | 1803 |
| 814 | Ga0496112_0013065 | 3300048915 | Bacteria | 7660 |
| 815 | Ga0496112_0015540 | 3300048915 | Bacteria | 7108 |
| 816 | Ga0496112_0238766 | 3300048915 | Bacteria | 1770 |
| 817 | Ga0496112_0336732 | 3300048915 | Bacteria | 1452 |
| 818 | Ga0496112_0348160 | 3300048915 | Bacteria | 1424 |
| 819 | Ga0496112_0630340 | 3300048915 | Bacteria | 1003 |
| 820 | Ga0496112_0675050 | 3300048915 | Bacteria | 962 |
| 821 | Ga0496113_0032347 | 3300048916 | Bacteria | 3802 |
| 822 | Ga0496113_0068854 | 3300048916 | Bacteria | 2686 |
| 823 | Ga0496113_0075150 | 3300048916 | Bacteria | 2578 |
| 824 | Ga0496113_0304407 | 3300048916 | Bacteria | 1276 |
| 825 | Ga0496114_0009906 | 3300048917 | Bacteria | 7574 |
| 826 | Ga0496114_0022098 | 3300048917 | Bacteria | 5181 |
| 827 | Ga0496114_0071374 | 3300048917 | Bacteria | 2918 |
| 828 | Ga0496114_0078738 | 3300048917 | Bacteria | 2781 |
| 829 | Ga0496114_0370448 | 3300048917 | Bacteria | 1268 |
| 830 | Ga0496115_0031021 | 3300048918 | Bacteria | 4210 |
| 831 | Ga0496115_0096757 | 3300048918 | Bacteria | 2417 |
| 832 | Ga0496115_0121241 | 3300048918 | Bacteria | 2152 |
| 833 | Ga0496115_0129348 | 3300048918 | Bacteria | 2081 |
| 834 | Ga0496115_0446711 | 3300048918 | Bacteria | 1045 |
| 835 | Ga0496115_0613797 | 3300048918 | Bacteria | 863 |
| 836 | Ga0496115_1072203 | 3300048918 | Bacteria | 612 |
| 837 | Ga0496116_0017591 | 3300048919 | Bacteria | 5540 |
| 838 | Ga0496117_0012573 | 3300048920 | Bacteria | 7446 |
| 839 | Ga0496117_0016467 | 3300048920 | Bacteria | 6240 |
| 840 | Ga0496117_0122349 | 3300048920 | Bacteria | 1596 |
| 841 | Ga0496118_0000065 | 3300048921 | Bacteria | 211750 |
| 842 | Ga0496118_0022961 | 3300048921 | Bacteria | 5435 |
| 843 | Ga0496118_0248337 | 3300048921 | Bacteria | 1013 |
| 844 | Ga0496120_0151662 | 3300048923 | Bacteria | 1164 |
| 845 | Ga0496121_0009477 | 3300048924 | Bacteria | 11183 |
| 846 | Ga0496121_0333113 | 3300048924 | Bacteria | 1017 |
| 847 | Ga0496121_0472280 | 3300048924 | Bacteria | 803 |
| 848 | Ga0496122_0000037 | 3300048925 | Bacteria | 304495 |
| 849 | Ga0496122_0018370 | 3300048925 | Bacteria | 6468 |
| 850 | Ga0496123_0000083 | 3300048926 | Bacteria | 188730 |
| 851 | Ga0496123_0019013 | 3300048926 | Bacteria | 5428 |
| 852 | Ga0496123_0123554 | 3300048926 | Bacteria | 1450 |
| 853 | Ga0496124_0022270 | 3300048927 | Bacteria | 5814 |
| 854 | Ga0496125_0064514 | 3300048928 | Bacteria | 2910 |
| 855 | Ga0496125_0080260 | 3300048928 | Bacteria | 2497 |
| 856 | Ga0496126_0027014 | 3300048929 | Bacteria | 5493 |
| 857 | Ga0496126_0230540 | 3300048929 | Bacteria | 1552 |
| 858 | Ga0496126_0326938 | 3300048929 | Bacteria | 1259 |
| 859 | Ga0501292_002778 | 3300049515 | Bacteria | 2284 |
| 860 | Ga0501293_029372 | 3300049516 | Bacteria | 581 |
| 861 | Ga0501295_093728 | 3300049518 | Bacteria | 697 |
| 862 | Ga0501298_004866 | 3300049521 | Bacteria | 2138 |
| 863 | Ga0501301_047182 | 3300049524 | Bacteria | 504 |
| 864 | Ga0501312_079694 | 3300049528 | Bacteria | 591 |
| 865 | Ga0501031_0001171 | 3300049568 | Bacteria | 15946 |
| 866 | Ga0501031_0148047 | 3300049568 | Bacteria | 1534 |
| 867 | Ga0501032_0019455 | 3300049569 | Bacteria | 4750 |
| 868 | Ga0501032_0041573 | 3300049569 | Bacteria | 3120 |
| 869 | Ga0501032_0113849 | 3300049569 | Bacteria | 1789 |
| 870 | Ga0501032_0262813 | 3300049569 | Bacteria | 1119 |
| 871 | Ga0501032_0264790 | 3300049569 | Bacteria | 1114 |
| 872 | Ga0501032_0301938 | 3300049569 | Bacteria | 1035 |
| 873 | Ga0501032_0557083 | 3300049569 | Bacteria | 730 |
| 874 | Ga0501033_0000119 | 3300049570 | Bacteria | 75685 |
| 875 | Ga0501033_0001903 | 3300049570 | Bacteria | 18166 |
| 876 | Ga0501033_0003250 | 3300049570 | Bacteria | 13453 |
| 877 | Ga0501033_0010752 | 3300049570 | Bacteria | 7016 |
| 878 | Ga0501033_0034779 | 3300049570 | Bacteria | 3777 |
| 879 | Ga0501033_0102959 | 3300049570 | Bacteria | 2082 |
| 880 | Ga0501033_0150000 | 3300049570 | Bacteria | 1682 |
| 881 | Ga0501033_0437446 | 3300049570 | Bacteria | 910 |
| 882 | Ga0501034_0003243 | 3300049571 | Bacteria | 18603 |
| 883 | Ga0501034_0003757 | 3300049571 | Bacteria | 17152 |
| 884 | Ga0501034_0010856 | 3300049571 | Bacteria | 9462 |
| 885 | Ga0501034_0050141 | 3300049571 | Bacteria | 4210 |
| 886 | Ga0501034_0157831 | 3300049571 | Bacteria | 2241 |
| 887 | Ga0501034_0176854 | 3300049571 | Bacteria | 2100 |
| 888 | Ga0501036_0031608 | 3300049572 | Bacteria | 4474 |
| 889 | Ga0501036_0229796 | 3300049572 | Bacteria | 1557 |
| 890 | Ga0501036_0409736 | 3300049572 | Bacteria | 1131 |
| 891 | Ga0501036_0723676 | 3300049572 | Bacteria | 822 |
| 892 | Ga0501037_0001095 | 3300049573 | Bacteria | 20074 |
| 893 | Ga0501037_0001996 | 3300049573 | Bacteria | 14804 |
| 894 | Ga0501037_0017927 | 3300049573 | Bacteria | 5210 |
| 895 | Ga0501037_0022321 | 3300049573 | Bacteria | 4682 |
| 896 | Ga0501037_0025177 | 3300049573 | Bacteria | 4397 |
| 897 | Ga0501037_0130115 | 3300049573 | Bacteria | 1805 |
| 898 | Ga0501037_0136727 | 3300049573 | Bacteria | 1755 |
| 899 | Ga0501037_0140106 | 3300049573 | Bacteria | 1731 |
| 900 | Ga0501037_0211043 | 3300049573 | Bacteria | 1369 |
| 901 | Ga0501037_0257021 | 3300049573 | Bacteria | 1221 |
| 902 | Ga0501037_0545061 | 3300049573 | Bacteria | 783 |
| 903 | Ga0501038_0022260 | 3300049574 | Bacteria | 5680 |
| 904 | Ga0501038_0029396 | 3300049574 | Bacteria | 4870 |
| 905 | Ga0501038_0031724 | 3300049574 | Bacteria | 4667 |
| 906 | Ga0501038_0080698 | 3300049574 | Bacteria | 2742 |
| 907 | Ga0501038_0090850 | 3300049574 | Bacteria | 2558 |
| 908 | Ga0501038_0173904 | 3300049574 | Bacteria | 1741 |
| 909 | Ga0501038_0368466 | 3300049574 | Bacteria | 1116 |
| 910 | Ga0501039_0004467 | 3300049575 | Bacteria | 10560 |
| 911 | Ga0501039_0017922 | 3300049575 | Bacteria | 5431 |
| 912 | Ga0501039_0951659 | 3300049575 | Bacteria | 668 |
| 913 | Ga0501040_0001459 | 3300049576 | Bacteria | 14989 |
| 914 | Ga0501040_0011183 | 3300049576 | Bacteria | 5870 |
| 915 | Ga0501042_0017213 | 3300049578 | Bacteria | 4981 |
| 916 | Ga0501042_0039489 | 3300049578 | Bacteria | 3354 |
| 917 | Ga0501042_0169789 | 3300049578 | Bacteria | 1574 |
| 918 | Ga0501042_0425308 | 3300049578 | Bacteria | 963 |
| 919 | Ga0501043_0006122 | 3300049579 | Bacteria | 9661 |
| 920 | Ga0501043_0126453 | 3300049579 | Bacteria | 2004 |
| 921 | Ga0501043_0131240 | 3300049579 | Bacteria | 1963 |
| 922 | Ga0501043_0207349 | 3300049579 | Bacteria | 1519 |
| 923 | Ga0501043_0550178 | 3300049579 | Bacteria | 857 |
| 924 | Ga0501043_0644042 | 3300049579 | Bacteria | 779 |
| 925 | Ga0501046_0002502 | 3300049580 | Bacteria | 17209 |
| 926 | Ga0501046_0006871 | 3300049580 | Bacteria | 10034 |
| 927 | Ga0501046_0172929 | 3300049580 | Bacteria | 1619 |
| 928 | Ga0501046_0339788 | 3300049580 | Bacteria | 1091 |
| 929 | Ga0501046_0343290 | 3300049580 | Bacteria | 1085 |
| 930 | Ga0501046_0420246 | 3300049580 | Bacteria | 964 |
| 931 | Ga0501047_0068927 | 3300049581 | Bacteria | 3407 |
| 932 | Ga0501047_0080356 | 3300049581 | Bacteria | 3133 |
| 933 | Ga0501047_0119099 | 3300049581 | Bacteria | 2522 |
| 934 | Ga0501047_0192642 | 3300049581 | Bacteria | 1901 |
| 935 | Ga0501047_0285851 | 3300049581 | Bacteria | 1493 |
| 936 | Ga0501047_0505263 | 3300049581 | Bacteria | 1035 |
| 937 | Ga0501047_0912082 | 3300049581 | Bacteria | 692 |
| 938 | Ga0501048_0000241 | 3300049582 | Bacteria | 36408 |
| 939 | Ga0501048_0018845 | 3300049582 | Bacteria | 5073 |
| 940 | Ga0501067_0003311 | 3300049583 | Bacteria | 8860 |
| 941 | Ga0501068_0013520 | 3300049584 | Bacteria | 4646 |
| 942 | Ga0501068_0031983 | 3300049584 | Bacteria | 3127 |
| 943 | Ga0501068_0073524 | 3300049584 | Bacteria | 2088 |
| 944 | Ga0501069_0001034 | 3300049585 | Bacteria | 13289 |
| 945 | Ga0501070_0000428 | 3300049586 | Bacteria | 38253 |
| 946 | Ga0501070_0007440 | 3300049586 | Bacteria | 9302 |
| 947 | Ga0501070_0031950 | 3300049586 | Bacteria | 4409 |
| 948 | Ga0501070_0036635 | 3300049586 | Bacteria | 4096 |
| 949 | Ga0501070_0052474 | 3300049586 | Bacteria | 3384 |
| 950 | Ga0501070_0053369 | 3300049586 | Bacteria | 3353 |
| 951 | Ga0501070_1252289 | 3300049586 | Bacteria | 568 |
| 952 | Ga0501071_0006335 | 3300049587 | Bacteria | 7675 |
| 953 | Ga0501072_0007353 | 3300049588 | Bacteria | 8354 |
| 954 | Ga0501072_0376802 | 3300049588 | Bacteria | 1126 |
| 955 | Ga0501073_0002050 | 3300049589 | Bacteria | 15050 |
| 956 | Ga0501073_0040357 | 3300049589 | Bacteria | 3303 |
| 957 | Ga0501073_0049205 | 3300049589 | Bacteria | 2956 |
| 958 | Ga0501073_0238679 | 3300049589 | Bacteria | 1255 |
| 959 | Ga0501073_0439683 | 3300049589 | Bacteria | 901 |
| 960 | Ga0501073_0549882 | 3300049589 | Bacteria | 798 |
| 961 | Ga0501074_0002658 | 3300049590 | Bacteria | 12518 |
| 962 | Ga0501074_0014200 | 3300049590 | Bacteria | 5793 |
| 963 | Ga0501074_0062152 | 3300049590 | Bacteria | 2690 |
| 964 | Ga0501074_0170458 | 3300049590 | Bacteria | 1554 |
| 965 | Ga0501076_0359902 | 3300049592 | Bacteria | 1195 |
| 966 | Ga0501076_1096234 | 3300049592 | Bacteria | 656 |
| 967 | Ga0501077_0107621 | 3300049593 | Bacteria | 1767 |
| 968 | Ga0501198_000051 | 3300049649 | Bacteria | 36831 |
| 969 | Ga0501206_022387 | 3300049653 | Bacteria | 906 |
| 970 | Ga0501206_043217 | 3300049653 | Bacteria | 700 |
| 971 | Ga0501222_000007 | 3300049662 | Bacteria | 126703 |
| 972 | Ga0501079_0000161 | 3300049741 | Bacteria | 37103 |
| 973 | Ga0501079_0317914 | 3300049741 | Bacteria | 1219 |
| 974 | Ga0501079_0408293 | 3300049741 | Bacteria | 1065 |
| 975 | Ga0501080_0000936 | 3300049742 | Bacteria | 23861 |
| 976 | Ga0501080_0004748 | 3300049742 | Bacteria | 12117 |
| 977 | Ga0501080_0012677 | 3300049742 | Bacteria | 7730 |
| 978 | Ga0501080_0214072 | 3300049742 | Bacteria | 1765 |
| 979 | Ga0501080_0255937 | 3300049742 | Bacteria | 1596 |
| 980 | Ga0501080_0309994 | 3300049742 | Bacteria | 1430 |
| 981 | Ga0501080_1059994 | 3300049742 | Bacteria | 701 |
| 982 | Ga0501081_0074979 | 3300049743 | Bacteria | 2361 |
| 983 | Ga0501083_0003232 | 3300049744 | Bacteria | 11364 |
| 984 | Ga0501262_002003 | 3300049759 | Bacteria | 2294 |
| 985 | Ga0501265_001880 | 3300049762 | Bacteria | 2387 |
| 986 | Ga0501035_0001977 | 3300049822 | Bacteria | 20520 |
| 987 | Ga0501035_0003316 | 3300049822 | Bacteria | 15427 |
| 988 | Ga0501035_0032433 | 3300049822 | Bacteria | 4752 |
| 989 | Ga0501035_0204802 | 3300049822 | Bacteria | 1690 |
| 990 | Ga0501035_0340231 | 3300049822 | Bacteria | 1257 |
| 991 | Ga0501035_0489548 | 3300049822 | Bacteria | 1013 |
| 992 | Ga0501035_0821460 | 3300049822 | Bacteria | 741 |
| 993 | Ga0501035_0841184 | 3300049822 | Bacteria | 730 |
| 994 | Ga0501044_0000093 | 3300049823 | Bacteria | 109832 |
| 995 | Ga0501044_0013110 | 3300049823 | Bacteria | 8974 |
| 996 | Ga0501044_0013845 | 3300049823 | Bacteria | 8719 |
| 997 | Ga0501044_0056204 | 3300049823 | Bacteria | 4040 |
| 998 | Ga0501044_0066979 | 3300049823 | Bacteria | 3659 |
| 999 | Ga0501044_0088404 | 3300049823 | Bacteria | 3127 |
| 1000 | Ga0501044_0098680 | 3300049823 | Bacteria | 2940 |
| 1001 | Ga0501044_0102897 | 3300049823 | Bacteria | 2871 |
| 1002 | Ga0501044_0137218 | 3300049823 | Bacteria | 2436 |
| 1003 | Ga0501044_0154017 | 3300049823 | Bacteria | 2279 |
| 1004 | Ga0501044_0247185 | 3300049823 | Bacteria | 1726 |
| 1005 | Ga0501044_0384951 | 3300049823 | Bacteria | 1317 |
| 1006 | Ga0501044_0723340 | 3300049823 | Bacteria | 879 |
| 1007 | Ga0501045_0010011 | 3300049824 | Bacteria | 6631 |
| 1008 | Ga0501045_0018784 | 3300049824 | Bacteria | 4920 |
| 1009 | Ga0501045_0692039 | 3300049824 | Bacteria | 752 |
| 1010 | nmdc:mga03n38_268446_c1 | 3300050490 | Bacteria | 907 |
| 1011 | nmdc:mga00v17_405969_c1 | 3300050491 | Bacteria | 885 |
| 1012 | nmdc:mga0yw44_494019_c1 | 3300050492 | Bacteria | 830 |
| 1013 | nmdc:mga0k408_231895_c1 | 3300050493 | Bacteria | 1102 |
| 1014 | nmdc:mga0k408_3923_c1 | 3300050493 | Bacteria | 7887 |
| 1015 | nmdc:mga0k408_409795_c1 | 3300050493 | Bacteria | 806 |
| 1016 | nmdc:mga0k408_432122_c1 | 3300050493 | Bacteria | 782 |
| 1017 | nmdc:mga0k408_687952_c1 | 3300050493 | Bacteria | 600 |
| 1018 | nmdc:mga0k408_77497_c1 | 3300050493 | Bacteria | 1944 |
| 1019 | nmdc:mga06z11_9354_c1 | 3300050494 | Bacteria | 4128 |
| 1020 | nmdc:mga04h51_11100_c1 | 3300050495 | Bacteria | 2492 |
| 1021 | nmdc:mga07m45_566_c1 | 3300050496 | Bacteria | 15704 |
| 1022 | nmdc:mga09592_695_c1 | 3300050508 | Bacteria | 25743 |
| 1023 | nmdc:mga0qj67_37172_c1 | 3300050509 | Bacteria | 3813 |
| 1024 | nmdc:mga06r32_607241_c1 | 3300050510 | Bacteria | 1064 |
| 1025 | nmdc:mga08y16_22681_c1 | 3300050511 | Bacteria | 6628 |
| 1026 | nmdc:mga0n895_1195261_c1 | 3300050512 | Bacteria | 734 |
| 1027 | nmdc:mga0n895_514648_c1 | 3300050512 | Bacteria | 1205 |
| 1028 | nmdc:mga0n895_978329_c1 | 3300050512 | Bacteria | 828 |
| 1029 | nmdc:mga0rr50_114656_c1 | 3300050513 | Bacteria | 2137 |
| 1030 | nmdc:mga0rr50_213045_c1 | 3300050513 | Bacteria | 1592 |
| 1031 | nmdc:mga08x19_171003_c1 | 3300050514 | Bacteria | 1480 |
| 1032 | nmdc:mga08x19_71321_c1 | 3300050514 | Bacteria | 2265 |
| 1033 | Ga0495601_0111607 | 3300053077 | Bacteria | 1771 |
| 1034 | Ga0495601_0239480 | 3300053077 | Bacteria | 1185 |
| 1035 | Ga0495612_0105680 | 3300053078 | Bacteria | 1202 |
| 1036 | Ga0495619_0158811 | 3300053085 | Bacteria | 1561 |
| 1037 | Ga0500643_010278 | 3300053087 | Bacteria | 3496 |
| 1038 | Ga0500643_011018 | 3300053087 | Bacteria | 3327 |
| 1039 | Ga0500644_0162350 | 3300053088 | Bacteria | 904 |
| 1040 | Ga0500651_0037846 | 3300053093 | Bacteria | 3040 |
| 1041 | Ga0500651_0078326 | 3300053093 | Bacteria | 2050 |
| 1042 | Ga0500593_212413 | 3300053117 | Bacteria | 688 |
| 1043 | Ga0500594_0006885 | 3300053118 | Bacteria | 2562 |
| 1044 | Ga0500597_000163 | 3300053120 | Bacteria | 13574 |
| 1045 | Ga0500655_028976 | 3300053133 | Bacteria | 1061 |
| 1046 | Ga0500559_0000109 | 3300053136 | Bacteria | 65246 |
| 1047 | Ga0500561_0007598 | 3300053137 | Bacteria | 2120 |
| 1048 | Ga0500568_0000488 | 3300053139 | Bacteria | 29209 |
| 1049 | Ga0500622_0004240 | 3300053156 | Bacteria | 9119 |
| 1050 | Ga0500645_073221 | 3300053730 | Bacteria | 982 |
| 1051 | Ga0500587_009531 | 3300053739 | Bacteria | 1239 |
| 1052 | Ga0501084_0024823 | 3300054114 | Bacteria | 5003 |
| 1053 | Ga0501084_0120148 | 3300054114 | Bacteria | 2209 |
| 1054 | Ga0590071_002496 | 3300059421 | Bacteria | 4628 |
| 1055 | Ga0587073_0103746 | 3300059492 | Bacteria | 743 |
| 1056 | Ga0587077_104311 | 3300059493 | Bacteria | 685 |
| 1057 | Ga0587085_024358 | 3300059506 | Bacteria | 948 |
| 1058 | Ga0587109_148500 | 3300059624 | Bacteria | 578 |
| 1059 | Ga0587076_049623 | 3300059645 | Bacteria | 814 |
| 1060 | Ga0587071_135435 | 3300060344 | Bacteria | 601 |
| 1061 | Ga0501082_0000666 | 3300060353 | Bacteria | 30194 |
| 1062 | Ga0501082_0013706 | 3300060353 | Bacteria | 6968 |
| 1063 | Ga0501082_0166122 | 3300060353 | Bacteria | 1918 |
| 1064 | Ga0501082_0689536 | 3300060353 | Bacteria | 894 |
| 1065 | 2510317718 | 2510065059 | Bacteria | 6847884 |
| 1066 | 2512963812 | 2512875024 | Bacteria | 7195110 |
| 1067 | 2514588476 | 2513237351 | Bacteria | 6968952 |
| 1068 | 2597812540 | 2597489875 | Bacteria | 7010078 |
| 1069 | 2644305769 | 2643221654 | Bacteria | 5273570 |
| 1070 | 2688599639 | 2687453392 | Bacteria | 6880454 |
| 1071 | 2841738540 | 2841734538 | Bacteria | 6784580 |
| 1072 | 2844014935 | 2844009547 | Bacteria | 6728125 |
| 1073 | 2856334161 | 2856328259 | Bacteria | 6528202 |
| 1074 | 2856341120 | 2856334872 | Bacteria | 7037011 |
| 1075 | 2856347063 | 2856342000 | Bacteria | 7176905 |
| 1076 | 2857371748 | 2857367948 | Bacteria | 6965560 |
| 1077 | 2869171325 | 2869169390 | Bacteria | 6659796 |
| 1078 | 2869236469 | 2869234852 | Bacteria | 6654993 |
| 1079 | 2869246102 | 2869242130 | Bacteria | 6609239 |
| 1080 | 2869255614 | 2869249662 | Bacteria | 6868783 |
| 1081 | 2869260854 | 2869256925 | Bacteria | 6981691 |
| 1082 | 2869265987 | 2869264136 | Bacteria | 6880765 |
| 1083 | 2869274575 | 2869271264 | Bacteria | 6908218 |
| 1084 | 2871436665 | 2871435913 | Bacteria | 6880295 |
| 1085 | 2871456951 | 2871451962 | Bacteria | 7336357 |
| 1086 | 2871466421 | 2871459585 | Bacteria | 6866887 |
| 1087 | 2871479880 | 2871474448 | Bacteria | 6806570 |
| 1088 | 2871483791 | 2871481445 | Bacteria | 6700002 |
| 1089 | 2874114305 | 2874109183 | Bacteria | 6517025 |
| 1090 | 2874117104 | 2874116593 | Bacteria | 6674494 |
| 1091 | 2874133570 | 2874131515 | Bacteria | 6820270 |
| 1092 | 2874164861 | 2874162495 | Bacteria | 6174670 |
| 1093 | 2876392629 | 2876386047 | Bacteria | 6698674 |
| 1094 | 2876406762 | 2876399893 | Bacteria | 6927900 |
| 1095 | 2876409857 | 2876406927 | Bacteria | 6191900 |
| 1096 | 2876426168 | 2876420981 | Bacteria | 6687741 |
| 1097 | 2878735147 | 2878730984 | Bacteria | 6380721 |
| 1098 | 2878778967 | 2878774303 | Bacteria | 6108671 |
| 1099 | 2878783484 | 2878781027 | Bacteria | 6834456 |
| 1100 | 2878788897 | 2878788777 | Bacteria | 6567085 |
| 1101 | 2888346496 | 2888343758 | Bacteria | 6611049 |
| 1102 | 2903514227 | 2903513507 | Bacteria | 6344008 |
| 1103 | 2906363519 | 2906363423 | Bacteria | 6856682 |
| 1104 | 2906371368 | 2906370794 | Bacteria | 6881062 |
| 1105 | 2906395538 | 2906393657 | Bacteria | 6790866 |
| 1106 | 2906401737 | 2906401398 | Bacteria | 6693206 |
| 1107 | 2906410768 | 2906408224 | Bacteria | 6162342 |
| 1108 | 2906432849 | 2906427513 | Bacteria | 6375796 |
| 1109 | 2922155997 | 2922151315 | Bacteria | 6902399 |
| 1110 | 2922177392 | 2922172374 | Bacteria | 6167644 |
| 1111 | 2922181394 | 2922178524 | Bacteria | 6025201 |
| 1112 | 2924711288 | 2924710171 | Bacteria | 6752351 |
| 1113 | 2924733746 | 2924733363 | Bacteria | 7574837 |
| 1114 | 2924741848 | 2924741084 | Bacteria | 6661321 |
| 1115 | 2924752325 | 2924748358 | Bacteria | 6154725 |
| 1116 | 2924761584 | 2924754689 | Bacteria | 6774424 |
| 1117 | 2937841822 | 2937836603 | Bacteria | 6811263 |
| 1118 | 2937866040 | 2937861824 | Bacteria | 6660327 |
| 1119 | 2937869027 | 2937868953 | Bacteria | 6639878 |
| 1120 | 2937983883 | 2937980651 | Bacteria | 6517427 |
| 1121 | 2958077838 | 2958071322 | Bacteria | 6815895 |
| 1122 | 2958111772 | 2958108152 | Bacteria | 6681128 |
| 1123 | 2958127236 | 2958122699 | Bacteria | 7280457 |
| 1124 | 2958138826 | 2958137437 | Bacteria | 6050276 |
| 1125 | 2958164636 | 2958158011 | Bacteria | 6058449 |
| 1126 | 2961140319 | 2961136820 | Bacteria | 6775228 |
| 1127 | 2961189470 | 2961183825 | Bacteria | 6688536 |
| 1128 | 2965027880 | 2965025482 | Bacteria | 6532201 |
| 1129 | 2965054889 | 2965047637 | Bacteria | 6623551 |
| 1130 | 2965091373 | 2965089291 | Bacteria | 6866420 |
| 1131 | 2965107713 | 2965102966 | Bacteria | 6800987 |
| 1132 | 2965114673 | 2965110997 | Bacteria | 6693150 |
| 1133 | 2968139276 | 2968138860 | Bacteria | 6605449 |
| 1134 | 2970490342 | 2970489779 | Bacteria | 6517260 |
| 1135 | 2970512916 | 2970510686 | Bacteria | 7006402 |
| 1136 | 2970528051 | 2970524798 | Bacteria | 6840927 |
| 1137 | 2970533690 | 2970532167 | Bacteria | 6553173 |
| 1138 | 2970541157 | 2970540015 | Bacteria | 6977556 |
| 1139 | 2970552847 | 2970547951 | Bacteria | 6931819 |
| 1140 | 2970622512 | 2970619444 | Bacteria | 6986144 |
| 1141 | 2970633326 | 2970627176 | Bacteria | 6680862 |
| 1142 | 2977851687 | 2977851361 | Bacteria | 6694324 |
| 1143 | 2977879200 | 2977872689 | Bacteria | 7270173 |
| 1144 | 2977905132 | 2977898635 | Bacteria | 6675551 |
| 1145 | 2977921136 | 2977915119 | Bacteria | 6829656 |
| 1146 | 2977936168 | 2977935797 | Bacteria | 6252826 |
| 1147 | 2977954773 | 2977950692 | Bacteria | 6893264 |
| 1148 | 2977961073 | 2977957713 | Bacteria | 6877875 |
| 1149 | 2979767460 | 2979764755 | Bacteria | 6610066 |
| 1150 | 2979774129 | 2979772303 | Bacteria | 6618277 |
| 1151 | 2979797586 | 2979793036 | Bacteria | 6808957 |
| 1152 | 2987646488 | 2987645492 | Bacteria | 6117018 |
| 1153 | 2987676876 | 2987673487 | Bacteria | 6884027 |
| 1154 | 2996314366 | 2996310559 | Bacteria | 6357320 |
| 1155 | 2996393180 | 2996386984 | Bacteria | 6978667 |
| 1156 | 3004197786 | 3004195979 | Bacteria | 6776956 |
| 1157 | 3004235520 | 3004232784 | Bacteria | 6662140 |
| 1158 | 3004247868 | 3004239961 | Bacteria | 6892290 |
| 1159 | 3004251761 | 3004248173 | Bacteria | 6563236 |
| 1160 | 3004274501 | 3004268573 | Bacteria | 7043476 |
| 1161 | 649874143 | 649633066 | Bacteria | 6690028 |
| 1162 | 8004302372 | 8004300914 | Bacteria | 6132239 |
| 1163 | 8004315974 | 8004312739 | Bacteria | 7444653 |
| 1164 | 8004363149 | 8004361976 | Bacteria | 6858373 |
| 1165 | 8004397613 | 8004395343 | Bacteria | 6620908 |
| 1166 | 8004634163 | 8004633249 | Bacteria | 6723080 |
| 1167 | 8004700102 | 8004695233 | Bacteria | 6731676 |
| 1168 | 8004731056 | 8004727605 | Bacteria | 6643904 |
| 1169 | 8055620167 | 8055617313 | Bacteria | 7548464 |
| 1170 | Ga0075365_10480633 | |||
| 1171 | JGI24736J21556_1007436 | |||
| 1172 | JGI24740J21852_10100024 | |||
| 1173 | JGI24739J22299_10016922 | |||
| 1174 | JGI24735J21928_10002119 | |||
| 1175 | Ga0055534_1004115 | |||
| 1176 | Ga0058861_12066902 | |||
| 1177 | Ga0058862_12526120 | |||
| 1178 | Ga0065715_10032408 | |||
| 1179 | Ga0065707_10000803 | |||
| 1180 | Ga0070658_10925235 | |||
| 1181 | Ga0070658_11557118 | |||
| 1182 | Ga0070676_10017904 | |||
| 1183 | Ga0070676_10075424 | |||
| 1184 | Ga0070690_100050635 | |||
| 1185 | Ga0070690_100250419 | |||
| 1186 | Ga0070670_100006378 | |||
| 1187 | Ga0070670_101289223 | |||
| 1188 | Ga0068869_100068203 | |||
| 1189 | Ga0068869_100441575 | |||
| 1190 | Ga0068869_101057373 | |||
| 1191 | Ga0068869_101523328 | |||
| 1192 | Ga0070666_10001775 | |||
| 1193 | Ga0070666_10004360 | |||
| 1194 | Ga0070666_10043847 | |||
| 1195 | Ga0070680_100404963 | |||
| 1196 | Ga0070680_100813641 | |||
| 1197 | Ga0070682_100144442 | |||
| 1198 | Ga0068868_100104028 | |||
| 1199 | Ga0068868_100196963 | |||
| 1200 | Ga0068868_101091021 | |||
| 1201 | Ga0070660_100277389 | |||
| 1202 | Ga0070660_100295014 | |||
| 1203 | Ga0070660_100560139 | |||
| 1204 | Ga0070687_100125438 | |||
| 1205 | Ga0070661_100260163 | |||
| 1206 | Ga0070668_100019969 | |||
| 1207 | Ga0070668_100236002 | |||
| 1208 | Ga0070668_100491751 | |||
| 1209 | Ga0070675_101036010 | |||
| 1210 | Ga0070671_100180519 | |||
| 1211 | Ga0070671_100583007 | |||
| 1212 | Ga0070671_100663115 | |||
| 1213 | Ga0070671_101911823 | |||
| 1214 | Ga0070674_100183682 | |||
| 1215 | Ga0070674_100400189 | |||
| 1216 | Ga0070674_100411013 | |||
| 1217 | Ga0070674_100660285 | |||
| 1218 | Ga0070673_100138381 | |||
| 1219 | Ga0070673_100445116 | |||
| 1220 | Ga0070673_100647918 | |||
| 1221 | Ga0070659_100018342 | |||
| 1222 | Ga0070659_100939487 | |||
| 1223 | Ga0070667_100000093 | |||
| 1224 | Ga0070667_100015768 | |||
| 1225 | Ga0070667_100030089 | |||
| 1226 | Ga0070667_100037240 | |||
| 1227 | Ga0070667_100135420 | |||
| 1228 | Ga0070667_100178445 | |||
| 1229 | Ga0070667_100656347 | |||
| 1230 | Ga0070667_100714562 | |||
| 1231 | Ga0070667_100988563 | |||
| 1232 | Ga0070709_10036799 | |||
| 1233 | Ga0070709_10662112 | |||
| 1234 | Ga0070709_10811252 | |||
| 1235 | Ga0070714_100012455 | |||
| 1236 | Ga0070714_100017974 | |||
| 1237 | Ga0070714_100209133 | |||
| 1238 | Ga0070714_101712751 | |||
| 1239 | Ga0070713_100000685 | |||
| 1240 | Ga0070713_100006493 | |||
| 1241 | Ga0070713_100168451 | |||
| 1242 | Ga0070710_10022315 | |||
| 1243 | Ga0070710_10082186 | |||
| 1244 | Ga0070710_10256624 | |||
| 1245 | Ga0070710_10316057 | |||
| 1246 | Ga0070711_100013034 | |||
| 1247 | Ga0070711_100076600 | |||
| 1248 | Ga0070711_100191959 | |||
| 1249 | Ga0070711_100207682 | |||
| 1250 | Ga0070705_100380101 | |||
| 1251 | Ga0070700_100039035 | |||
| 1252 | Ga0070663_100000032 | |||
| 1253 | Ga0070663_100026851 | |||
| 1254 | Ga0070663_100044703 | |||
| 1255 | Ga0070663_100427101 | |||
| 1256 | Ga0070663_100515492 | |||
| 1257 | Ga0070663_100603667 | |||
| 1258 | Ga0070663_101116662 | |||
| 1259 | Ga0070678_100031443 | |||
| 1260 | Ga0070678_100173200 | |||
| 1261 | Ga0070678_100228280 | |||
| 1262 | Ga0070678_100304224 | |||
| 1263 | Ga0070678_100314635 | |||
| 1264 | Ga0070678_101610308 | |||
| 1265 | Ga0070678_101958351 | |||
| 1266 | Ga0070662_100024585 | |||
| 1267 | Ga0070662_100291348 | |||
| 1268 | Ga0070681_10003267 | |||
| 1269 | Ga0070681_10011892 | |||
| 1270 | Ga0070681_10927157 | |||
| 1271 | Ga0068867_100005073 | |||
| 1272 | Ga0068867_100051842 | |||
| 1273 | Ga0068867_100132254 | |||
| 1274 | Ga0068867_100434831 | |||
| 1275 | Ga0068867_101758870 | |||
| 1276 | Ga0070685_11003596 | |||
| 1277 | Ga0070707_101962369 | |||
| 1278 | Ga0070679_100057111 | |||
| 1279 | Ga0070679_100235803 | |||
| 1280 | Ga0070679_101687356 | |||
| 1281 | Ga0070684_100410922 | |||
| 1282 | Ga0068853_100004507 | |||
| 1283 | Ga0068853_100027988 | |||
| 1284 | Ga0068853_100366376 | |||
| 1285 | Ga0068853_100384769 | |||
| 1286 | Ga0068853_101344825 | |||
| 1287 | Ga0068853_101592476 | |||
| 1288 | Ga0070672_100007230 | |||
| 1289 | Ga0070672_100063532 | |||
| 1290 | Ga0070672_100942088 | |||
| 1291 | Ga0070672_101064120 | |||
| 1292 | Ga0070686_100067137 | |||
| 1293 | Ga0070695_100405074 | |||
| 1294 | Ga0070696_100500481 | |||
| 1295 | Ga0070693_100031554 | |||
| 1296 | Ga0070693_100299072 | |||
| 1297 | Ga0070665_100000065 | |||
| 1298 | Ga0070665_100013533 | |||
| 1299 | Ga0070665_100021742 | |||
| 1300 | Ga0070665_100024362 | |||
| 1301 | Ga0070665_100033044 | |||
| 1302 | Ga0070665_100071381 | |||
| 1303 | Ga0070665_100089749 | |||
| 1304 | Ga0070665_100418351 | |||
| 1305 | Ga0070665_100553541 | |||
| 1306 | Ga0070665_100940453 | |||
| 1307 | Ga0070665_100961378 | |||
| 1308 | Ga0070665_101585939 | |||
| 1309 | Ga0070704_100570899 | |||
| 1310 | Ga0068855_100042304 | |||
| 1311 | Ga0068855_100347684 | |||
| 1312 | Ga0068855_100670190 | |||
| 1313 | Ga0068855_101097669 | |||
| 1314 | Ga0070664_100462330 | |||
| 1315 | Ga0068854_100096521 | |||
| 1316 | Ga0068856_100146118 | |||
| 1317 | Ga0068856_100294116 | |||
| 1318 | Ga0068856_100431063 | |||
| 1319 | Ga0068856_100453433 | |||
| 1320 | Ga0068856_100566740 | |||
| 1321 | Ga0068856_101090544 | |||
| 1322 | Ga0068856_101434808 | |||
| 1323 | Ga0068856_101769711 | |||
| 1324 | Ga0068852_100037728 | |||
| 1325 | Ga0068852_100071507 | |||
| 1326 | Ga0068852_100256278 | |||
| 1327 | Ga0068852_101492301 | |||
| 1328 | Ga0068859_100000070 | |||
| 1329 | Ga0068859_100224705 | |||
| 1330 | Ga0068859_100825600 | |||
| 1331 | Ga0068859_101248223 | |||
| 1332 | Ga0068864_100954493 | |||
| 1333 | Ga0068864_101199439 | |||
| 1334 | Ga0068864_101841010 | |||
| 1335 | Ga0068866_10062250 | |||
| 1336 | Ga0068861_100003543 | |||
| 1337 | Ga0068861_100009492 | |||
| 1338 | Ga0068851_10018980 | |||
| 1339 | Ga0068851_10871204 | |||
| 1340 | Ga0068863_100196184 | |||
| 1341 | Ga0068863_100242827 | |||
| 1342 | Ga0068863_100391841 | |||
| 1343 | Ga0068863_100404990 | |||
| 1344 | Ga0068863_100563235 | |||
| 1345 | Ga0068858_100003907 | |||
| 1346 | Ga0068858_100015311 | |||
| 1347 | Ga0068858_100130761 | |||
| 1348 | Ga0068858_100465824 | |||
| 1349 | Ga0068860_100002268 | |||
| 1350 | Ga0068860_100062495 | |||
| 1351 | Ga0068860_100315074 | |||
| 1352 | Ga0068860_100712708 | |||
| 1353 | Ga0068862_100000041 | |||
| 1354 | Ga0068862_100039926 | |||
| 1355 | Ga0068862_100083515 | |||
| 1356 | Ga0068862_100845412 | |||
| 1357 | Ga0068862_101266828 | |||
| 1358 | Ga0081455_10080955 | |||
| 1359 | Ga0081455_10121862 | |||
| 1360 | Ga0081540_1011727 | |||
| 1361 | Ga0081540_1015034 | |||
| 1362 | Ga0070717_10000814 | |||
| 1363 | Ga0070717_10124938 | |||
| 1364 | Ga0075368_10154105 | |||
| 1365 | Ga0075363_100031120 | |||
| 1366 | Ga0075364_10169639 | |||
| 1367 | Ga0070715_10007032 | |||
| 1368 | Ga0070715_10299341 | |||
| 1369 | Ga0070715_10627156 | |||
| 1370 | Ga0070715_11071613 | |||
| 1371 | Ga0070716_100017024 | |||
| 1372 | Ga0070716_100029503 | |||
| 1373 | Ga0070716_101684933 | |||
| 1374 | Ga0070712_100009205 | |||
| 1375 | Ga0070712_100018789 | |||
| 1376 | Ga0070712_100099596 | |||
| 1377 | Ga0070712_100240266 | |||
| 1378 | Ga0075367_10143760 | |||
| 1379 | Ga0075366_10026333 | |||
| 1380 | Ga0075366_10138130 | |||
| 1381 | Ga0075366_10256786 | |||
| 1382 | Ga0075366_10319170 | |||
| 1383 | Ga0075366_10380523 | |||
| 1384 | Ga0075366_10511477 | |||
| 1385 | Ga0097621_100046041 | |||
| 1386 | Ga0097621_100267826 | |||
| 1387 | Ga0097621_100542722 | |||
| 1388 | Ga0097621_100584282 | |||
| 1389 | Ga0097621_101251852 | |||
| 1390 | Ga0075370_10000125 | |||
| 1391 | Ga0068871_100122204 | |||
| 1392 | Ga0068871_100234885 | |||
| 1393 | Ga0068871_100386708 | |||
| 1394 | Ga0068871_100497282 | |||
| 1395 | Ga0068871_101009652 | |||
| 1396 | Ga0068871_101074246 | |||
| 1397 | Ga0068871_101489570 | |||
| 1398 | Ga0075428_100380664 | |||
| 1399 | Ga0075430_100046015 | |||
| 1400 | Ga0075434_100515446 | |||
| 1401 | Ga0075434_101050381 | |||
| 1402 | Ga0075429_100004520 | |||
| 1403 | Ga0068865_100014391 | |||
| 1404 | Ga0068865_100047454 | |||
| 1405 | Ga0068865_100123750 | |||
| 1406 | Ga0068865_100308774 | |||
| 1407 | Ga0068865_101286169 | |||
| 1408 | Ga0075436_100024062 | |||
| 1409 | Ga0075436_100099007 | |||
| 1410 | Ga0097620_100000070 | |||
| 1411 | Ga0097620_100224701 | |||
| 1412 | Ga0097620_100825600 | |||
| 1413 | Ga0097620_101248241 | |||
| 1414 | Ga0075435_100388011 | |||
| 1415 | Ga0075435_100536029 | |||
| 1416 | Ga0099795_10000192 | |||
| 1417 | Ga0105244_10009239 | |||
| 1418 | Ga0105250_10038856 | |||
| 1419 | Ga0105250_10116508 | |||
| 1420 | Ga0105240_10013944 | |||
| 1421 | Ga0105240_10287177 | |||
| 1422 | Ga0111539_10057983 | |||
| 1423 | Ga0111539_10139972 | |||
| 1424 | Ga0105245_10002177 | |||
| 1425 | Ga0105245_10265585 | |||
| 1426 | Ga0105245_10597262 | |||
| 1427 | Ga0105247_10003807 | |||
| 1428 | Ga0105247_10121477 | |||
| 1429 | Ga0105247_10373498 | |||
| 1430 | Ga0105247_10498343 | |||
| 1431 | Ga0105243_10044965 | |||
| 1432 | Ga0105243_10129905 | |||
| 1433 | Ga0105243_10375202 | |||
| 1434 | Ga0105241_10009761 | |||
| 1435 | Ga0105241_10099570 | |||
| 1436 | Ga0105241_10360243 | |||
| 1437 | Ga0105241_10503864 | |||
| 1438 | Ga0105241_11022523 | |||
| 1439 | Ga0105242_10002301 | |||
| 1440 | Ga0105242_10004392 | |||
| 1441 | Ga0105242_10436943 | |||
| 1442 | Ga0105242_10635332 | |||
| 1443 | Ga0105242_11909669 | |||
| 1444 | Ga0105242_11989660 | |||
| 1445 | Ga0105248_10002111 | |||
| 1446 | Ga0105248_10038865 | |||
| 1447 | Ga0105248_10473001 | |||
| 1448 | Ga0105248_10508775 | |||
| 1449 | Ga0105248_10552277 | |||
| 1450 | Ga0105248_10678870 | |||
| 1451 | Ga0105248_10820021 | |||
| 1452 | Ga0105237_10016690 | |||
| 1453 | Ga0105237_10146176 | |||
| 1454 | Ga0105237_10311568 | |||
| 1455 | Ga0105237_10703642 | |||
| 1456 | Ga0105237_11482502 | |||
| 1457 | Ga0105238_10062185 | |||
| 1458 | Ga0105238_10303444 | |||
| 1459 | Ga0105238_10333358 | |||
| 1460 | Ga0105238_10758448 | |||
| 1461 | Ga0105238_11266315 | |||
| 1462 | Ga0105249_10000394 | |||
| 1463 | Ga0105249_10028985 | |||
| 1464 | Ga0105249_10889331 | |||
| 1465 | Ga0105249_11470458 | |||
| 1466 | Ga0099796_10000158 | |||
| 1467 | Ga0105239_10057725 | |||
| 1468 | Ga0105239_10115296 | |||
| 1469 | Ga0105239_10345479 | |||
| 1470 | Ga0105239_10448529 | |||
| 1471 | Ga0105239_10759839 | |||
| 1472 | Ga0105239_10927649 | |||
| 1473 | Ga0105239_12533388 | |||
| 1474 | Ga0105246_10050555 | |||
| 1475 | Ga0105246_10796713 | |||
| 1476 | Ga0157327_1003260 | |||
| 1477 | Ga0157373_10123963 | |||
| 1478 | Ga0157373_10149500 | |||
| 1479 | Ga0157371_11003566 | |||
| 1480 | Ga0157370_10111268 | |||
| 1481 | Ga0157370_10112382 | |||
| 1482 | Ga0157370_10836613 | |||
| 1483 | Ga0157369_10392167 | |||
| 1484 | Ga0157369_10830659 | |||
| 1485 | Ga0157374_10008134 | |||
| 1486 | Ga0157374_10008293 | |||
| 1487 | Ga0157374_10064875 | |||
| 1488 | Ga0157374_10269835 | |||
| 1489 | Ga0157374_10704962 | |||
| 1490 | Ga0157374_12659743 | |||
| 1491 | Ga0157378_10001565 | |||
| 1492 | Ga0157378_10004721 | |||
| 1493 | Ga0157378_10293254 | |||
| 1494 | Ga0157378_10863564 | |||
| 1495 | Ga0163162_10029905 | |||
| 1496 | Ga0163162_10172753 | |||
| 1497 | Ga0163162_10453435 | |||
| 1498 | Ga0163162_10488736 | |||
| 1499 | Ga0163162_10629544 | |||
| 1500 | Ga0163162_11204204 | |||
| 1501 | Ga0163162_12130504 | |||
| 1502 | Ga0157372_10059970 | |||
| 1503 | Ga0157372_10397688 | |||
| 1504 | Ga0157375_10000948 | |||
| 1505 | Ga0157375_10074252 | |||
| 1506 | Ga0157375_10343217 | |||
| 1507 | Ga0157375_10489604 | |||
| 1508 | Ga0157375_10765112 | |||
| 1509 | Ga0163163_10026109 | |||
| 1510 | Ga0163163_10041754 | |||
| 1511 | Ga0163163_10159059 | |||
| 1512 | Ga0163163_10311885 | |||
| 1513 | Ga0163163_11023989 | |||
| 1514 | Ga0163163_11986717 | |||
| 1515 | Ga0157380_10032011 | |||
| 1516 | Ga0157380_10742773 | |||
| 1517 | Ga0157380_11312766 | |||
| 1518 | Ga0182008_10151380 | |||
| 1519 | Ga0157379_10077258 | |||
| 1520 | Ga0157379_10336291 | |||
| 1521 | Ga0157379_10372351 | |||
| 1522 | Ga0157379_10820234 | |||
| 1523 | Ga0157376_10014847 | |||
| 1524 | Ga0157376_10148780 | |||
| 1525 | Ga0157376_10153728 | |||
| 1526 | Ga0157376_10643819 | |||
| 1527 | Ga0157376_10709419 | |||
| 1528 | Ga0157376_10713645 | |||
| 1529 | Ga0157376_11042362 | |||
| 1530 | Ga0163161_10156287 | |||
| 1531 | Ga0163161_10377699 | |||
| 1532 | Ga0163161_10913340 | |||
| 1533 | Ga0206356_10568014 | |||
| 1534 | Ga0207427_100158 | |||
| 1535 | Ga0209130_1003425 | |||
| 1536 | Ga0209675_1006592 | |||
| 1537 | Ga0209676_1010982 | |||
| 1538 | Ga0209025_1067864 | |||
| 1539 | Ga0209564_1027276 | |||
| 1540 | Ga0209050_1062310 | |||
| 1541 | Ga0207426_1002416 | |||
| 1542 | Ga0209051_1009603 | |||
| 1543 | Ga0209051_1039391 | |||
| 1544 | Ga0209051_1046380 | |||
| 1545 | Ga0209257_1102878 | |||
| 1546 | Ga0207697_10182817 | |||
| 1547 | Ga0207656_10007225 | |||
| 1548 | Ga0207713_1005978 | |||
| 1549 | Ga0207692_10235097 | |||
| 1550 | Ga0207692_10761859 | |||
| 1551 | Ga0207642_10048391 | |||
| 1552 | Ga0207642_10166567 | |||
| 1553 | Ga0207710_10065981 | |||
| 1554 | Ga0207688_10517267 | |||
| 1555 | Ga0207680_10012058 | |||
| 1556 | Ga0207680_10031290 | |||
| 1557 | Ga0207680_10094061 | |||
| 1558 | Ga0207680_10579696 | |||
| 1559 | Ga0207680_10589432 | |||
| 1560 | Ga0207680_10718197 | |||
| 1561 | Ga0207647_10000023 | |||
| 1562 | Ga0207685_10013506 | |||
| 1563 | Ga0207685_10514333 | |||
| 1564 | Ga0207685_10578114 | |||
| 1565 | Ga0207699_10059384 | |||
| 1566 | Ga0207645_10041741 | |||
| 1567 | Ga0207645_10076851 | |||
| 1568 | Ga0207705_10914426 | |||
| 1569 | Ga0207654_10016769 | |||
| 1570 | Ga0207654_10019088 | |||
| 1571 | Ga0207654_10078914 | |||
| 1572 | Ga0207654_10640961 | |||
| 1573 | Ga0207707_10002957 | |||
| 1574 | Ga0207707_10043393 | |||
| 1575 | Ga0207707_10987409 | |||
| 1576 | Ga0207695_10010030 | |||
| 1577 | Ga0207695_10081843 | |||
| 1578 | Ga0207695_10104708 | |||
| 1579 | Ga0207695_10158019 | |||
| 1580 | Ga0207671_10000929 | |||
| 1581 | Ga0207671_10011778 | |||
| 1582 | Ga0207671_10100850 | |||
| 1583 | Ga0207671_10585154 | |||
| 1584 | Ga0207693_10001689 | |||
| 1585 | Ga0207693_10026865 | |||
| 1586 | Ga0207693_10514204 | |||
| 1587 | Ga0207663_10025632 | |||
| 1588 | Ga0207663_10083792 | |||
| 1589 | Ga0207663_10208455 | |||
| 1590 | Ga0207663_10467677 | |||
| 1591 | Ga0207660_10719809 | |||
| 1592 | Ga0207660_11108272 | |||
| 1593 | Ga0207662_10326671 | |||
| 1594 | Ga0207657_10145429 | |||
| 1595 | Ga0207649_10462676 | |||
| 1596 | Ga0207649_10679841 | |||
| 1597 | Ga0207649_10817584 | |||
| 1598 | Ga0207652_10054792 | |||
| 1599 | Ga0207681_10081260 | |||
| 1600 | Ga0207681_10084547 | |||
| 1601 | Ga0207681_10440498 | |||
| 1602 | Ga0207681_10542115 | |||
| 1603 | Ga0207694_10414659 | |||
| 1604 | Ga0207650_10024055 | |||
| 1605 | Ga0207650_10242540 | |||
| 1606 | Ga0207687_10037950 | |||
| 1607 | Ga0207687_10853595 | |||
| 1608 | Ga0207700_10088146 | |||
| 1609 | Ga0207700_10153328 | |||
| 1610 | Ga0207700_10197190 | |||
| 1611 | Ga0207664_10037381 | |||
| 1612 | Ga0207664_10100991 | |||
| 1613 | Ga0207664_10374008 | |||
| 1614 | Ga0207644_10105748 | |||
| 1615 | Ga0207644_10145853 | |||
| 1616 | Ga0207644_10231254 | |||
| 1617 | Ga0207690_10087522 | |||
| 1618 | Ga0207690_11594588 | |||
| 1619 | Ga0207706_10002543 | |||
| 1620 | Ga0207706_10092120 | |||
| 1621 | Ga0207706_10506427 | |||
| 1622 | Ga0207686_10147050 | |||
| 1623 | Ga0207686_10280585 | |||
| 1624 | Ga0207686_10689411 | |||
| 1625 | Ga0207686_10994451 | |||
| 1626 | Ga0207709_10149103 | |||
| 1627 | Ga0207669_10143318 | |||
| 1628 | Ga0207669_10861237 | |||
| 1629 | Ga0207704_10048960 | |||
| 1630 | Ga0207704_10061757 | |||
| 1631 | Ga0207704_10166441 | |||
| 1632 | Ga0207665_10001560 | |||
| 1633 | Ga0207665_10013681 | |||
| 1634 | Ga0207691_10013978 | |||
| 1635 | Ga0207711_10001156 | |||
| 1636 | Ga0207711_10217817 | |||
| 1637 | Ga0207711_10244437 | |||
| 1638 | Ga0207711_10358182 | |||
| 1639 | Ga0207689_10110716 | |||
| 1640 | Ga0207689_10130815 | |||
| 1641 | Ga0207689_10324490 | |||
| 1642 | Ga0207689_10351873 | |||
| 1643 | Ga0207689_10985436 | |||
| 1644 | Ga0207679_10394142 | |||
| 1645 | Ga0207679_10497371 | |||
| 1646 | Ga0207679_10839500 | |||
| 1647 | Ga0207667_10338935 | |||
| 1648 | Ga0207651_10197611 | |||
| 1649 | Ga0207651_10639864 | |||
| 1650 | Ga0207712_10000228 | |||
| 1651 | Ga0207712_10000345 | |||
| 1652 | Ga0207712_10893126 | |||
| 1653 | Ga0207712_10967274 | |||
| 1654 | Ga0207668_10041101 | |||
| 1655 | Ga0207668_10311917 | |||
| 1656 | Ga0207640_10095297 | |||
| 1657 | Ga0207658_10000020 | |||
| 1658 | Ga0207658_10019220 | |||
| 1659 | Ga0207658_10057948 | |||
| 1660 | Ga0207658_10128742 | |||
| 1661 | Ga0207658_10168481 | |||
| 1662 | Ga0207658_10208875 | |||
| 1663 | Ga0207658_10457342 | |||
| 1664 | Ga0207658_10854596 | |||
| 1665 | Ga0207658_11019182 | |||
| 1666 | Ga0207658_11414647 | |||
| 1667 | Ga0207677_10217653 | |||
| 1668 | Ga0207677_10289434 | |||
| 1669 | Ga0207677_10337959 | |||
| 1670 | Ga0207677_10429316 | |||
| 1671 | Ga0207677_10566905 | |||
| 1672 | Ga0207703_10002854 | |||
| 1673 | Ga0207703_10102252 | |||
| 1674 | Ga0207703_10205502 | |||
| 1675 | Ga0207703_11244141 | |||
| 1676 | Ga0207703_11676247 | |||
| 1677 | Ga0207639_10000405 | |||
| 1678 | Ga0207639_10026683 | |||
| 1679 | Ga0207639_10190287 | |||
| 1680 | Ga0207639_10337375 | |||
| 1681 | Ga0207639_10339752 | |||
| 1682 | Ga0207639_10342494 | |||
| 1683 | Ga0207639_10394079 | |||
| 1684 | Ga0207678_10000010 | |||
| 1685 | Ga0207678_10013505 | |||
| 1686 | Ga0207678_11342139 | |||
| 1687 | Ga0207708_10009588 | |||
| 1688 | Ga0207702_10057451 | |||
| 1689 | Ga0207702_10206754 | |||
| 1690 | Ga0207702_10334280 | |||
| 1691 | Ga0207702_10469533 | |||
| 1692 | Ga0207702_10916315 | |||
| 1693 | Ga0207702_12213726 | |||
| 1694 | Ga0207641_10113987 | |||
| 1695 | Ga0207641_10142348 | |||
| 1696 | Ga0207641_10610878 | |||
| 1697 | Ga0207641_10710383 | |||
| 1698 | Ga0207641_10774288 | |||
| 1699 | Ga0207648_10001067 | |||
| 1700 | Ga0207648_10030844 | |||
| 1701 | Ga0207648_10044786 | |||
| 1702 | Ga0207648_10083622 | |||
| 1703 | Ga0207676_10189897 | |||
| 1704 | Ga0207676_10306071 | |||
| 1705 | Ga0207676_10635479 | |||
| 1706 | Ga0207674_11219568 | |||
| 1707 | Ga0207675_100000393 | |||
| 1708 | Ga0207675_100010527 | |||
| 1709 | Ga0207675_101366704 | |||
| 1710 | Ga0207683_10103520 | |||
| 1711 | Ga0207683_10104979 | |||
| 1712 | Ga0207683_10207272 | |||
| 1713 | Ga0207683_10226302 | |||
| 1714 | Ga0207683_10309386 | |||
| 1715 | Ga0207698_10234682 | |||
| 1716 | Ga0207698_10536126 | |||
| 1717 | Ga0207698_11145356 | |||
| 1718 | Ga0207698_11387585 | |||
| 1719 | Ga0209179_1017778 | |||
| 1720 | Ga0209813_10008637 | |||
| 1721 | Ga0207428_10382011 | |||
| 1722 | Ga0268266_10000001 | |||
| 1723 | Ga0268266_10000013 | |||
| 1724 | Ga0268266_10052426 | |||
| 1725 | Ga0268266_10155888 | |||
| 1726 | Ga0268266_10562249 | |||
| 1727 | Ga0268266_10593665 | |||
| 1728 | Ga0268265_10000137 | |||
| 1729 | Ga0268265_10018829 | |||
| 1730 | Ga0268265_10036752 | |||
| 1731 | Ga0268265_10084184 | |||
| 1732 | Ga0268265_11990173 | |||
| 1733 | Ga0268264_10001497 | |||
| 1734 | Ga0268264_10468084 | |||
| 1735 | Ga0268264_10809535 | |||
| 1736 | Ga0265326_10023708 | |||
| 1737 | Ga0265319_1011783 | |||
| 1738 | Ga0265334_10000686 | |||
| 1739 | Ga0265318_10002965 | |||
| 1740 | Ga0307517_10049020 | |||
| 1741 | Ga0307515_10000030 | |||
| 1742 | Ga0307515_10176759 | |||
| 1743 | Ga0265338_10009041 | |||
| 1744 | Ga0265338_10132868 | |||
| 1745 | Ga0265767_101674 | |||
| 1746 | Ga0265769_110927 | |||
| 1747 | Ga0265330_10072924 | |||
| 1748 | Ga0265332_10056646 | |||
| 1749 | Ga0265328_10070910 | |||
| 1750 | Ga0265320_10020389 | |||
| 1751 | Ga0265325_10043888 | |||
| 1752 | Ga0265340_10151579 | |||
| 1753 | Ga0265331_10005291 | |||
| 1754 | Ga0265331_10007111 | |||
| 1755 | Ga0265331_10080610 | |||
| 1756 | Ga0265327_10000217 | |||
| 1757 | Ga0265327_10000923 | |||
| 1758 | Ga0265316_10197716 | |||
| 1759 | Ga0307513_10037093 | |||
| 1760 | Ga0307513_10623189 | |||
| 1761 | Ga0307509_10251736 | |||
| 1762 | Ga0307509_10512826 | |||
| 1763 | Ga0307509_10621751 | |||
| 1764 | Ga0307408_100159070 | |||
| 1765 | Ga0307408_100281305 | |||
| 1766 | Ga0307408_100742666 | |||
| 1767 | Ga0307408_101092041 | |||
| 1768 | Ga0265313_10013741 | |||
| 1769 | Ga0316575_10023148 | |||
| 1770 | Ga0316579_10000335 | |||
| 1771 | Ga0316579_10036051 | |||
| 1772 | Ga0316579_10056016 | |||
| 1773 | Ga0265314_10046888 | |||
| 1774 | Ga0265342_10025329 | |||
| 1775 | Ga0316576_10501143 | |||
| 1776 | Ga0316578_10005901 | |||
| 1777 | Ga0316578_10123723 | |||
| 1778 | Ga0307516_10008706 | |||
| 1779 | Ga0307516_10192768 | |||
| 1780 | Ga0316577_10290875 | |||
| 1781 | Ga0307413_10690716 | |||
| 1782 | Ga0307413_11018302 | |||
| 1783 | Ga0307413_11084135 | |||
| 1784 | Ga0307410_10269118 | |||
| 1785 | Ga0307410_10580325 | |||
| 1786 | Ga0307410_10868954 | |||
| 1787 | Ga0307412_10380154 | |||
| 1788 | Ga0307412_10577018 | |||
| 1789 | Ga0307412_11502820 | |||
| 1790 | Ga0307414_10073307 | |||
| 1791 | Ga0307414_10603819 | |||
| 1792 | Ga0307414_11985021 | |||
| 1793 | Ga0307411_10376212 | |||
| 1794 | Ga0307411_10741296 | |||
| 1795 | Ga0307415_100800222 | |||
| 1796 | Ga0316583_10012201 | |||
| 1797 | Ga0316583_10019818 | |||
| 1798 | Ga0307507_10166340 | |||
| 1799 | Ga0307510_10014225 | |||
| 1800 | Ga0373923_0169290 | |||
| 1801 | Ga0373923_0279400 | |||
| 1802 | Ga0373923_0381825 | |||
| 1803 | Ga0373936_0049743 | |||
| 1804 | Ga0373936_0122300 | |||
| 1805 | Ga0373939_0312432 | |||
| 1806 | Ga0373945_0075432 | |||
| 1807 | Ga0373957_0100589 | |||
| 1808 | Ga0373957_0292915 | |||
| 1809 | Ga0373943_0169191 | |||
| 1810 | Ga0373943_0404926 | |||
| 1811 | Ga0373946_0116842 | |||
| 1812 | Ga0373946_0138135 | |||
| 1813 | Ga0373955_0015873 | |||
| 1814 | Ga0316574_0018381 | |||
| 1815 | Ga0373924_0414075 | |||
| 1816 | Ga0373931_0240633 | |||
| 1817 | Ga0373935_1316134 | |||
| 1818 | Ga0373927_0008876 | |||
| 1819 | Ga0373927_0008998 | |||
| 1820 | Ga0373933_0137840 | |||
| 1821 | Ga0373933_0759234 | |||
| 1822 | Ga0373937_0007789 | |||
| 1823 | Ga0373937_0044059 | |||
| 1824 | Ga0373937_0226658 | |||
| 1825 | Ga0373937_0354444 | |||
| 1826 | Ga0316582_0131502 | |||
| 1827 | Ga0316584_0002853 | |||
| 1828 | Ga0316584_1137019 | |||
| 1829 | Ga0373925_0019765 | |||
| 1830 | Ga0373925_0297118 | |||
| 1831 | Ga0395899_0160092 | |||
| 1832 | Ga0395900_0062240 | |||
| 1833 | Ga0395900_0529314 | |||
| 1834 | Ga0395905_0091825 | |||
| 1835 | Ga0395905_0321319 | |||
| 1836 | Ga0395905_0814794 | |||
| 1837 | Ga0316581_0113039 | |||
| 1838 | Ga0395901_0592085 | |||
| 1839 | Ga0400485_20664 | |||
| 1840 | Ga0400486_05964 | |||
| 1841 | Ga0400486_24080 | |||
| 1842 | Ga0400487_64253 | |||
| 1843 | Ga0436363_1408620 | |||
| 1844 | Ga0436363_1696509 | |||
| 1845 | Ga0439436_0193526 | |||
| 1846 | Ga0439461_0054247 | |||
| 1847 | Ga0439465_0179017 | |||
| 1848 | Ga0451787_090787 | |||
| 1849 | Ga0451789_0077899 | |||
| 1850 | Ga0451789_0844787 | |||
| 1851 | Ga0451791_1373322 | |||
| 1852 | Ga0451793_0165339 | |||
| 1853 | Ga0451793_0173052 | |||
| 1854 | Ga0451793_1258784 | |||
| 1855 | Ga0451795_1351381 | |||
| 1856 | Ga0451800_1428091 | |||
| 1857 | Ga0451804_0833077 | |||
| 1858 | Ga0451807_2726366 | |||
| 1859 | Ga0451835_0574946 | |||
| 1860 | Ga0451841_1204341 | |||
| 1861 | Ga0451847_0397701 | |||
| 1862 | Ga0451851_0422575 | |||
| 1863 | Ga0451851_1233695 | |||
| 1864 | Ga0451843_1018122 | |||
| 1865 | Ga0451853_0843378 | |||
| 1866 | Ga0439462_0083638 | |||
| 1867 | Ga0450893_0018963 | |||
| 1868 | Ga0451577_0093636 | |||
| 1869 | Ga0451577_0324788 | |||
| 1870 | Ga0451577_1539865 | |||
| 1871 | Ga0453684_0003473 | |||
| 1872 | Ga0453684_0214192 | |||
| 1873 | Ga0453684_1426442 | |||
| 1874 | Ga0451576_0529544 | |||
| 1875 | Ga0451576_0834716 | |||
| 1876 | Ga0466967_0320759 | |||
| 1877 | Ga0466967_0329752 | |||
| 1878 | Ga0466967_0430551 | |||
| 1879 | Ga0495603_0607818 | |||
| 1880 | Ga0495590_0002486 | |||
| 1881 | Ga0495629_0380930 | |||
| 1882 | Ga0495629_0630211 | |||
| 1883 | Ga0495638_0061927 | |||
| 1884 | Ga0495641_0194236 | |||
| 1885 | Ga0495650_0007591 | |||
| 1886 | Ga0495650_0031451 | |||
| 1887 | Ga0495650_0092512 | |||
| 1888 | Ga0495580_0000952 | |||
| 1889 | Ga0495580_0107786 | |||
| 1890 | Ga0495582_0006801 | |||
| 1891 | Ga0495639_0053130 | |||
| 1892 | Ga0495664_0116619 | |||
| 1893 | Ga0495596_0329117 | |||
| 1894 | Ga0495583_0168485 | |||
| 1895 | Ga0495608_0193354 | |||
| 1896 | Ga0495618_0595548 | |||
| 1897 | Ga0495620_0012529 | |||
| 1898 | Ga0495620_0026015 | |||
| 1899 | Ga0495630_0345860 | |||
| 1900 | Ga0495642_0515727 | |||
| 1901 | Ga0495652_1012914 | |||
| 1902 | Ga0495665_0130413 | |||
| 1903 | Ga0495587_0370021 | |||
| 1904 | Ga0495597_0012789 | |||
| 1905 | Ga0495645_0200776 | |||
| 1906 | Ga0495645_0258893 | |||
| 1907 | Ga0495667_0286764 | |||
| 1908 | Ga0495656_0001865 | |||
| 1909 | Ga0495625_0386740 | |||
| 1910 | Ga0495657_0647518 | |||
| 1911 | Ga0495599_0204334 | |||
| 1912 | Ga0495646_0195434 | |||
| 1913 | Ga0495647_0163002 | |||
| 1914 | Ga0495647_0216957 | |||
| 1915 | Ga0495658_0021327 | |||
| 1916 | Ga0495624_0297296 | |||
| 1917 | Ga0495660_0146296 | |||
| 1918 | Ga0495581_0079163 | |||
| 1919 | Ga0495581_0261624 | |||
| 1920 | Ga0495674_0243093 | |||
| 1921 | Ga0495674_0356455 | |||
| 1922 | Ga0495683_0005445 | |||
| 1923 | Ga0495687_066428 | |||
| 1924 | Ga0495686_0023221 | |||
| 1925 | Ga0495602_0125516 | |||
| 1926 | Ga0495602_0192246 | |||
| 1927 | Ga0495626_0039747 | |||
| 1928 | Ga0496100_0017862 | |||
| 1929 | Ga0496100_0061986 | |||
| 1930 | Ga0496100_0174448 | |||
| 1931 | Ga0496100_0191056 | |||
| 1932 | Ga0496101_0006111 | |||
| 1933 | Ga0496101_0059923 | |||
| 1934 | Ga0496101_0067611 | |||
| 1935 | Ga0496101_0070758 | |||
| 1936 | Ga0496101_0494880 | |||
| 1937 | Ga0496101_1137070 | |||
| 1938 | Ga0496102_0017184 | |||
| 1939 | Ga0496102_0091734 | |||
| 1940 | Ga0496102_0152454 | |||
| 1941 | Ga0496102_0340311 | |||
| 1942 | Ga0496103_0005415 | |||
| 1943 | Ga0496103_0027159 | |||
| 1944 | Ga0496103_0096419 | |||
| 1945 | Ga0496104_0056562 | |||
| 1946 | Ga0496104_0292031 | |||
| 1947 | Ga0496104_0558598 | |||
| 1948 | Ga0496104_0581398 | |||
| 1949 | Ga0496104_0889711 | |||
| 1950 | Ga0496104_0906569 | |||
| 1951 | Ga0496105_0000080 | |||
| 1952 | Ga0496105_0010228 | |||
| 1953 | Ga0496105_0142394 | |||
| 1954 | Ga0496105_0305285 | |||
| 1955 | Ga0496105_1144733 | |||
| 1956 | Ga0496106_0017058 | |||
| 1957 | Ga0496106_0063569 | |||
| 1958 | Ga0496106_0064017 | |||
| 1959 | Ga0496107_0002917 | |||
| 1960 | Ga0496107_0009091 | |||
| 1961 | Ga0496107_0015412 | |||
| 1962 | Ga0496107_0611552 | |||
| 1963 | Ga0496108_0007173 | |||
| 1964 | Ga0496108_0011741 | |||
| 1965 | Ga0496108_0226900 | |||
| 1966 | Ga0496108_0295537 | |||
| 1967 | Ga0496108_1799845 | |||
| 1968 | Ga0496109_0007077 | |||
| 1969 | Ga0496109_0024423 | |||
| 1970 | Ga0496109_0037304 | |||
| 1971 | Ga0496109_0208071 | |||
| 1972 | Ga0496109_0403962 | |||
| 1973 | Ga0496110_0006629 | |||
| 1974 | Ga0496110_0009205 | |||
| 1975 | Ga0496110_0026379 | |||
| 1976 | Ga0496110_0039980 | |||
| 1977 | Ga0496110_0077126 | |||
| 1978 | Ga0496110_0308662 | |||
| 1979 | Ga0496111_0002222 | |||
| 1980 | Ga0496111_0012669 | |||
| 1981 | Ga0496111_0042213 | |||
| 1982 | Ga0496111_0138442 | |||
| 1983 | Ga0496112_0013065 | |||
| 1984 | Ga0496112_0015540 | |||
| 1985 | Ga0496112_0238766 | |||
| 1986 | Ga0496112_0336732 | |||
| 1987 | Ga0496112_0348160 | |||
| 1988 | Ga0496112_0630340 | |||
| 1989 | Ga0496112_0675050 | |||
| 1990 | Ga0496113_0032347 | |||
| 1991 | Ga0496113_0068854 | |||
| 1992 | Ga0496113_0075150 | |||
| 1993 | Ga0496113_0304407 | |||
| 1994 | Ga0496114_0009906 | |||
| 1995 | Ga0496114_0022098 | |||
| 1996 | Ga0496114_0071374 | |||
| 1997 | Ga0496114_0078738 | |||
| 1998 | Ga0496114_0370448 | |||
| 1999 | Ga0496115_0031021 | |||
| 2000 | Ga0496115_0096757 | |||
| 2001 | Ga0496115_0121241 | |||
| 2002 | Ga0496115_0129348 | |||
| 2003 | Ga0496115_0446711 | |||
| 2004 | Ga0496115_0613797 | |||
| 2005 | Ga0496115_1072203 | |||
| 2006 | Ga0496116_0017591 | |||
| 2007 | Ga0496117_0012573 | |||
| 2008 | Ga0496117_0016467 | |||
| 2009 | Ga0496117_0122349 | |||
| 2010 | Ga0496118_0000065 | |||
| 2011 | Ga0496118_0022961 | |||
| 2012 | Ga0496118_0248337 | |||
| 2013 | Ga0496120_0151662 | |||
| 2014 | Ga0496121_0009477 | |||
| 2015 | Ga0496121_0333113 | |||
| 2016 | Ga0496121_0472280 | |||
| 2017 | Ga0496122_0000037 | |||
| 2018 | Ga0496122_0018370 | |||
| 2019 | Ga0496123_0000083 | |||
| 2020 | Ga0496123_0019013 | |||
| 2021 | Ga0496123_0123554 | |||
| 2022 | Ga0496124_0022270 | |||
| 2023 | Ga0496125_0064514 | |||
| 2024 | Ga0496125_0080260 | |||
| 2025 | Ga0496126_0027014 | |||
| 2026 | Ga0496126_0230540 | |||
| 2027 | Ga0496126_0326938 | |||
| 2028 | Ga0501292_002778 | |||
| 2029 | Ga0501293_029372 | |||
| 2030 | Ga0501295_093728 | |||
| 2031 | Ga0501298_004866 | |||
| 2032 | Ga0501301_047182 | |||
| 2033 | Ga0501312_079694 | |||
| 2034 | Ga0501031_0001171 | |||
| 2035 | Ga0501031_0148047 | |||
| 2036 | Ga0501032_0019455 | |||
| 2037 | Ga0501032_0041573 | |||
| 2038 | Ga0501032_0113849 | |||
| 2039 | Ga0501032_0262813 | |||
| 2040 | Ga0501032_0264790 | |||
| 2041 | Ga0501032_0301938 | |||
| 2042 | Ga0501032_0557083 | |||
| 2043 | Ga0501033_0000119 | |||
| 2044 | Ga0501033_0001903 | |||
| 2045 | Ga0501033_0003250 | |||
| 2046 | Ga0501033_0010752 | |||
| 2047 | Ga0501033_0034779 | |||
| 2048 | Ga0501033_0102959 | |||
| 2049 | Ga0501033_0150000 | |||
| 2050 | Ga0501033_0437446 | |||
| 2051 | Ga0501034_0003243 | |||
| 2052 | Ga0501034_0003757 | |||
| 2053 | Ga0501034_0010856 | |||
| 2054 | Ga0501034_0050141 | |||
| 2055 | Ga0501034_0157831 | |||
| 2056 | Ga0501034_0176854 | |||
| 2057 | Ga0501036_0031608 | |||
| 2058 | Ga0501036_0229796 | |||
| 2059 | Ga0501036_0409736 | |||
| 2060 | Ga0501036_0723676 | |||
| 2061 | Ga0501037_0001095 | |||
| 2062 | Ga0501037_0001996 | |||
| 2063 | Ga0501037_0017927 | |||
| 2064 | Ga0501037_0022321 | |||
| 2065 | Ga0501037_0025177 | |||
| 2066 | Ga0501037_0130115 | |||
| 2067 | Ga0501037_0136727 | |||
| 2068 | Ga0501037_0140106 | |||
| 2069 | Ga0501037_0211043 | |||
| 2070 | Ga0501037_0257021 | |||
| 2071 | Ga0501037_0545061 | |||
| 2072 | Ga0501038_0022260 | |||
| 2073 | Ga0501038_0029396 | |||
| 2074 | Ga0501038_0031724 | |||
| 2075 | Ga0501038_0080698 | |||
| 2076 | Ga0501038_0090850 | |||
| 2077 | Ga0501038_0173904 | |||
| 2078 | Ga0501038_0368466 | |||
| 2079 | Ga0501039_0004467 | |||
| 2080 | Ga0501039_0017922 | |||
| 2081 | Ga0501039_0951659 | |||
| 2082 | Ga0501040_0001459 | |||
| 2083 | Ga0501040_0011183 | |||
| 2084 | Ga0501042_0017213 | |||
| 2085 | Ga0501042_0039489 | |||
| 2086 | Ga0501042_0169789 | |||
| 2087 | Ga0501042_0425308 | |||
| 2088 | Ga0501043_0006122 | |||
| 2089 | Ga0501043_0126453 | |||
| 2090 | Ga0501043_0131240 | |||
| 2091 | Ga0501043_0207349 | |||
| 2092 | Ga0501043_0550178 | |||
| 2093 | Ga0501043_0644042 | |||
| 2094 | Ga0501046_0002502 | |||
| 2095 | Ga0501046_0006871 | |||
| 2096 | Ga0501046_0172929 | |||
| 2097 | Ga0501046_0339788 | |||
| 2098 | Ga0501046_0343290 | |||
| 2099 | Ga0501046_0420246 | |||
| 2100 | Ga0501047_0068927 | |||
| 2101 | Ga0501047_0080356 | |||
| 2102 | Ga0501047_0119099 | |||
| 2103 | Ga0501047_0192642 | |||
| 2104 | Ga0501047_0285851 | |||
| 2105 | Ga0501047_0505263 | |||
| 2106 | Ga0501047_0912082 | |||
| 2107 | Ga0501048_0000241 | |||
| 2108 | Ga0501048_0018845 | |||
| 2109 | Ga0501067_0003311 | |||
| 2110 | Ga0501068_0013520 | |||
| 2111 | Ga0501068_0031983 | |||
| 2112 | Ga0501068_0073524 | |||
| 2113 | Ga0501069_0001034 | |||
| 2114 | Ga0501070_0000428 | |||
| 2115 | Ga0501070_0007440 | |||
| 2116 | Ga0501070_0031950 | |||
| 2117 | Ga0501070_0036635 | |||
| 2118 | Ga0501070_0052474 | |||
| 2119 | Ga0501070_0053369 | |||
| 2120 | Ga0501070_1252289 | |||
| 2121 | Ga0501071_0006335 | |||
| 2122 | Ga0501072_0007353 | |||
| 2123 | Ga0501072_0376802 | |||
| 2124 | Ga0501073_0002050 | |||
| 2125 | Ga0501073_0040357 | |||
| 2126 | Ga0501073_0049205 | |||
| 2127 | Ga0501073_0238679 | |||
| 2128 | Ga0501073_0439683 | |||
| 2129 | Ga0501073_0549882 | |||
| 2130 | Ga0501074_0002658 | |||
| 2131 | Ga0501074_0014200 | |||
| 2132 | Ga0501074_0062152 | |||
| 2133 | Ga0501074_0170458 | |||
| 2134 | Ga0501076_0359902 | |||
| 2135 | Ga0501076_1096234 | |||
| 2136 | Ga0501077_0107621 | |||
| 2137 | Ga0501198_000051 | |||
| 2138 | Ga0501206_022387 | |||
| 2139 | Ga0501206_043217 | |||
| 2140 | Ga0501222_000007 | |||
| 2141 | Ga0501079_0000161 | |||
| 2142 | Ga0501079_0317914 | |||
| 2143 | Ga0501079_0408293 | |||
| 2144 | Ga0501080_0000936 | |||
| 2145 | Ga0501080_0004748 | |||
| 2146 | Ga0501080_0012677 | |||
| 2147 | Ga0501080_0214072 | |||
| 2148 | Ga0501080_0255937 | |||
| 2149 | Ga0501080_0309994 | |||
| 2150 | Ga0501080_1059994 | |||
| 2151 | Ga0501081_0074979 | |||
| 2152 | Ga0501083_0003232 | |||
| 2153 | Ga0501262_002003 | |||
| 2154 | Ga0501265_001880 | |||
| 2155 | Ga0501035_0001977 | |||
| 2156 | Ga0501035_0003316 | |||
| 2157 | Ga0501035_0032433 | |||
| 2158 | Ga0501035_0204802 | |||
| 2159 | Ga0501035_0340231 | |||
| 2160 | Ga0501035_0489548 | |||
| 2161 | Ga0501035_0821460 | |||
| 2162 | Ga0501035_0841184 | |||
| 2163 | Ga0501044_0000093 | |||
| 2164 | Ga0501044_0013110 | |||
| 2165 | Ga0501044_0013845 | |||
| 2166 | Ga0501044_0056204 | |||
| 2167 | Ga0501044_0066979 | |||
| 2168 | Ga0501044_0088404 | |||
| 2169 | Ga0501044_0098680 | |||
| 2170 | Ga0501044_0102897 | |||
| 2171 | Ga0501044_0137218 | |||
| 2172 | Ga0501044_0154017 | |||
| 2173 | Ga0501044_0247185 | |||
| 2174 | Ga0501044_0384951 | |||
| 2175 | Ga0501044_0723340 | |||
| 2176 | Ga0501045_0010011 | |||
| 2177 | Ga0501045_0018784 | |||
| 2178 | Ga0501045_0692039 | |||
| 2179 | nmdc:mga03n38_268446_c1 | |||
| 2180 | nmdc:mga00v17_405969_c1 | |||
| 2181 | nmdc:mga0yw44_494019_c1 | |||
| 2182 | nmdc:mga0k408_231895_c1 | |||
| 2183 | nmdc:mga0k408_3923_c1 | |||
| 2184 | nmdc:mga0k408_409795_c1 | |||
| 2185 | nmdc:mga0k408_432122_c1 | |||
| 2186 | nmdc:mga0k408_687952_c1 | |||
| 2187 | nmdc:mga0k408_77497_c1 | |||
| 2188 | nmdc:mga06z11_9354_c1 | |||
| 2189 | nmdc:mga04h51_11100_c1 | |||
| 2190 | nmdc:mga07m45_566_c1 | |||
| 2191 | nmdc:mga09592_695_c1 | |||
| 2192 | nmdc:mga0qj67_37172_c1 | |||
| 2193 | nmdc:mga06r32_607241_c1 | |||
| 2194 | nmdc:mga08y16_22681_c1 | |||
| 2195 | nmdc:mga0n895_1195261_c1 | |||
| 2196 | nmdc:mga0n895_514648_c1 | |||
| 2197 | nmdc:mga0n895_978329_c1 | |||
| 2198 | nmdc:mga0rr50_114656_c1 | |||
| 2199 | nmdc:mga0rr50_213045_c1 | |||
| 2200 | nmdc:mga08x19_171003_c1 | |||
| 2201 | nmdc:mga08x19_71321_c1 | |||
| 2202 | Ga0495601_0111607 | |||
| 2203 | Ga0495601_0239480 | |||
| 2204 | Ga0495612_0105680 | |||
| 2205 | Ga0495619_0158811 | |||
| 2206 | Ga0500643_010278 | |||
| 2207 | Ga0500643_011018 | |||
| 2208 | Ga0500644_0162350 | |||
| 2209 | Ga0500651_0037846 | |||
| 2210 | Ga0500651_0078326 | |||
| 2211 | Ga0500593_212413 | |||
| 2212 | Ga0500594_0006885 | |||
| 2213 | Ga0500597_000163 | |||
| 2214 | Ga0500655_028976 | |||
| 2215 | Ga0500559_0000109 | |||
| 2216 | Ga0500561_0007598 | |||
| 2217 | Ga0500568_0000488 | |||
| 2218 | Ga0500622_0004240 | |||
| 2219 | Ga0500645_073221 | |||
| 2220 | Ga0500587_009531 | |||
| 2221 | Ga0501084_0024823 | |||
| 2222 | Ga0501084_0120148 | |||
| 2223 | Ga0590071_002496 | |||
| 2224 | Ga0587073_0103746 | |||
| 2225 | Ga0587077_104311 | |||
| 2226 | Ga0587085_024358 | |||
| 2227 | Ga0587109_148500 | |||
| 2228 | Ga0587076_049623 | |||
| 2229 | Ga0587071_135435 | |||
| 2230 | Ga0501082_0000666 | |||
| 2231 | Ga0501082_0013706 | |||
| 2232 | Ga0501082_0166122 | |||
| 2233 | Ga0501082_0689536 | |||
| 2234 | 2510317718 | |||
| 2235 | 2512963812 | |||
| 2236 | 2514588476 | |||
| 2237 | 2597812540 | |||
| 2238 | 2644305769 | |||
| 2239 | 2688599639 | |||
| 2240 | 2841738540 | |||
| 2241 | 2844014935 | |||
| 2242 | 2856334161 | |||
| 2243 | 2856341120 | |||
| 2244 | 2856347063 | |||
| 2245 | 2857371748 | |||
| 2246 | 2869171325 | |||
| 2247 | 2869236469 | |||
| 2248 | 2869246102 | |||
| 2249 | 2869255614 | |||
| 2250 | 2869260854 | |||
| 2251 | 2869265987 | |||
| 2252 | 2869274575 | |||
| 2253 | 2871436665 | |||
| 2254 | 2871456951 | |||
| 2255 | 2871466421 | |||
| 2256 | 2871479880 | |||
| 2257 | 2871483791 | |||
| 2258 | 2874114305 | |||
| 2259 | 2874117104 | |||
| 2260 | 2874133570 | |||
| 2261 | 2874164861 | |||
| 2262 | 2876392629 | |||
| 2263 | 2876406762 | |||
| 2264 | 2876409857 | |||
| 2265 | 2876426168 | |||
| 2266 | 2878735147 | |||
| 2267 | 2878778967 | |||
| 2268 | 2878783484 | |||
| 2269 | 2878788897 | |||
| 2270 | 2888346496 | |||
| 2271 | 2903514227 | |||
| 2272 | 2906363519 | |||
| 2273 | 2906371368 | |||
| 2274 | 2906395538 | |||
| 2275 | 2906401737 | |||
| 2276 | 2906410768 | |||
| 2277 | 2906432849 | |||
| 2278 | 2922155997 | |||
| 2279 | 2922177392 | |||
| 2280 | 2922181394 | |||
| 2281 | 2924711288 | |||
| 2282 | 2924733746 | |||
| 2283 | 2924741848 | |||
| 2284 | 2924752325 | |||
| 2285 | 2924761584 | |||
| 2286 | 2937841822 | |||
| 2287 | 2937866040 | |||
| 2288 | 2937869027 | |||
| 2289 | 2937983883 | |||
| 2290 | 2958077838 | |||
| 2291 | 2958111772 | |||
| 2292 | 2958127236 | |||
| 2293 | 2958138826 | |||
| 2294 | 2958164636 | |||
| 2295 | 2961140319 | |||
| 2296 | 2961189470 | |||
| 2297 | 2965027880 | |||
| 2298 | 2965054889 | |||
| 2299 | 2965091373 | |||
| 2300 | 2965107713 | |||
| 2301 | 2965114673 | |||
| 2302 | 2968139276 | |||
| 2303 | 2970490342 | |||
| 2304 | 2970512916 | |||
| 2305 | 2970528051 | |||
| 2306 | 2970533690 | |||
| 2307 | 2970541157 | |||
| 2308 | 2970552847 | |||
| 2309 | 2970622512 | |||
| 2310 | 2970633326 | |||
| 2311 | 2977851687 | |||
| 2312 | 2977879200 | |||
| 2313 | 2977905132 | |||
| 2314 | 2977921136 | |||
| 2315 | 2977936168 | |||
| 2316 | 2977954773 | |||
| 2317 | 2977961073 | |||
| 2318 | 2979767460 | |||
| 2319 | 2979774129 | |||
| 2320 | 2979797586 | |||
| 2321 | 2987646488 | |||
| 2322 | 2987676876 | |||
| 2323 | 2996314366 | |||
| 2324 | 2996393180 | |||
| 2325 | 3004197786 | |||
| 2326 | 3004235520 | |||
| 2327 | 3004247868 | |||
| 2328 | 3004251761 | |||
| 2329 | 3004274501 | |||
| 2330 | 649874143 | |||
| 2331 | 8004302372 | |||
| 2332 | 8004315974 | |||
| 2333 | 8004363149 | |||
| 2334 | 8004397613 | |||
| 2335 | 8004634163 | |||
| 2336 | 8004700102 | |||
| 2337 | 8004731056 | |||
| 2338 | 8055620167 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qsw-assembly1.cif.gz_B-2 | l8s8-complex forming rubisco derived from ancestral sequence reconstruction of the last common ancestor of ssu-bearing form i rubiscos | 0.9356 | 14 | 110 |
| 1rbl-assembly1.cif.gz_M | structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301 | 0.9217 | 14 | 111 |
| 1rsc-assembly1.cif.gz_M | structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate | 0.9206 | 14 | 111 |
| 3zxw-assembly1.cif.gz_B | structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate | 0.9199 | 15 | 109 |
| 3zxw-assembly1.cif.gz_B | structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate | 0.9108 | 15 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zxwD00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9201 | 15 | 109 | 3.30.190.10 |
| 3zxwD00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.9109 | 15 | 109 | 3.30.190.10 |
| 2ybvN00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.8864 | 8 | 109 | 3.30.190.10 |
| 2ybvN00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.8307 | 8 | 109 | 3.30.190.10 |
| 5mz2I00 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit | 0.8244 | 8 | 144 | 3.30.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A218QH27-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) | 0.9329 | 15 | 111 |
GO:0009853
GO:0016984 GO:0019253 GO:0031470 |
| AF-A0A0A2AQ53-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) | 0.9294 | 20 | 109 |
GO:0009853
GO:0016984 GO:0019253 GO:0031470 |
| AF-A0A354B4H2-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit | 0.9247 | 20 | 93 |
GO:0019253
GO:0031469 |
| AF-A0A7T5JEG5-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) | 0.9246 | 14 | 110 |
GO:0009853
GO:0016984 GO:0019253 GO:0031470 |
| AF-A0A1Y1QBE6-F1-model_v4 | Ribulose bisphosphate carboxylase small subunit | 0.9161 | 25 | 111 |
GO:0019253
|