F491124

General Info

Members Datasets Scaffolds Average Seq Length
1169 540 2338 144

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10480633|Ga0075365_104806332
Length 139
Sequence MKLTQGTFSFLPDLTDEQIRRQVQYCIDNGWAVNIEFTDDPHPRNTYWEMWGTPMFDVPDAAGVMMELAECRKVYGGRMYIRLSAFDASHGWESVKLSFLVGRPHNEPGFAIERQERGGRNVVYTTRSYATARPEGERY

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
202 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
264 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
265 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
270 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
271 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
272 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
275 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
276 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
277 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
278 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
279 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
280 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
281 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
282 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
285 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
356 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
357 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
358 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
359 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
360 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
377 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
385 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
386 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
387 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
393 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
398 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
399 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
418 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
419 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
420 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
423 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
437 2512875024
438 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
439 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
440 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
441 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
442 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
443 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
444 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
445 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
446 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
447 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
448 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
449 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
450 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
451 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
452 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
453 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
454 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
455 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
456 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
457 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
458 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
459 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
460 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
461 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
462 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
463 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
464 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
465 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
466 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
467 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
468 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
469 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
470 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
471 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
472 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
473 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
474 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
475 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
476 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
477 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
478 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
479 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
480 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
481 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
482 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
483 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
484 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
485 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
486 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
487 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
488 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
489 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
490 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
491 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
492 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
493 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
494 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
495 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
496 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
497 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
498 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
499 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
500 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
501 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
502 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
503 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
504 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
505 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
506 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
507 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
508 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
509 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
510 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
511 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
512 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
513 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
514 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
515 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
516 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
517 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
518 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
519 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
520 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
521 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
522 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
523 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
524 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
525 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
526 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
527 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
528 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
529 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
530 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
531 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
532 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
533 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
534 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
535 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
536 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
537 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
538 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
539 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
540 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.99
Metatranscriptomes 1.03
Isolates 8.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 8.55
Rhizoplane 7.61
Rhizosphere 74.85
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10480633 3300006038 Bacteria 878
2 JGI24736J21556_1007436 3300001904 Unclassified 1840
3 JGI24740J21852_10100024 3300001979 Bacteria 739
4 JGI24739J22299_10016922 3300001989 Bacteria 2635
5 JGI24735J21928_10002119 3300002067 Bacteria 6991
6 Ga0055534_1004115 3300003784 Bacteria 4332
7 Ga0058861_12066902 3300004800 Bacteria 1589
8 Ga0058862_12526120 3300004803 Bacteria 1244
9 Ga0065715_10032408 3300005293 Bacteria 1335
10 Ga0065707_10000803 3300005295 Bacteria 13375
11 Ga0070658_10925235 3300005327 Bacteria 758
12 Ga0070658_11557118 3300005327 Bacteria 573
13 Ga0070676_10017904 3300005328 Bacteria 3922
14 Ga0070676_10075424 3300005328 Bacteria 2033
15 Ga0070690_100050635 3300005330 Bacteria 2650
16 Ga0070690_100250419 3300005330 Bacteria 1253
17 Ga0070670_100006378 3300005331 Bacteria 9985
18 Ga0070670_101289223 3300005331 Bacteria 669
19 Ga0068869_100068203 3300005334 Bacteria 2626
20 Ga0068869_100441575 3300005334 Bacteria 1077
21 Ga0068869_101057373 3300005334 Bacteria 709
22 Ga0068869_101523328 3300005334 Bacteria 594
23 Ga0070666_10001775 3300005335 Bacteria 13133
24 Ga0070666_10004360 3300005335 Bacteria 8619
25 Ga0070666_10043847 3300005335 Bacteria 2996
26 Ga0070680_100404963 3300005336 Bacteria 1163
27 Ga0070680_100813641 3300005336 Bacteria 805
28 Ga0070682_100144442 3300005337 Bacteria 1626
29 Ga0068868_100104028 3300005338 Bacteria 2301
30 Ga0068868_100196963 3300005338 Bacteria 1678
31 Ga0068868_101091021 3300005338 Bacteria 734
32 Ga0070660_100277389 3300005339 Bacteria 1371
33 Ga0070660_100295014 3300005339 Bacteria 1328
34 Ga0070660_100560139 3300005339 Bacteria 954
35 Ga0070687_100125438 3300005343 Bacteria 1475
36 Ga0070661_100260163 3300005344 Bacteria 1341
37 Ga0070668_100019969 3300005347 Bacteria 5050
38 Ga0070668_100236002 3300005347 Bacteria 1513
39 Ga0070668_100491751 3300005347 Bacteria 1061
40 Ga0070675_101036010 3300005354 Bacteria 754
41 Ga0070671_100180519 3300005355 Bacteria 1787
42 Ga0070671_100583007 3300005355 Bacteria 966
43 Ga0070671_100663115 3300005355 Bacteria 904
44 Ga0070671_101911823 3300005355 Bacteria 528
45 Ga0070674_100183682 3300005356 Bacteria 1604
46 Ga0070674_100400189 3300005356 Bacteria 1122
47 Ga0070674_100411013 3300005356 Bacteria 1108
48 Ga0070674_100660285 3300005356 Bacteria 890
49 Ga0070673_100138381 3300005364 Bacteria 2052
50 Ga0070673_100445116 3300005364 Bacteria 1165
51 Ga0070673_100647918 3300005364 Bacteria 967
52 Ga0070659_100018342 3300005366 Bacteria 5281
53 Ga0070659_100939487 3300005366 Bacteria 757
54 Ga0070667_100000093 3300005367 Bacteria 111322
55 Ga0070667_100015768 3300005367 Bacteria 6250
56 Ga0070667_100030089 3300005367 Bacteria 4528
57 Ga0070667_100037240 3300005367 Bacteria 4078
58 Ga0070667_100135420 3300005367 Bacteria 2153
59 Ga0070667_100178445 3300005367 Bacteria 1877
60 Ga0070667_100656347 3300005367 Bacteria 969
61 Ga0070667_100714562 3300005367 Bacteria 928
62 Ga0070667_100988563 3300005367 Bacteria 785
63 Ga0070709_10036799 3300005434 Bacteria 2985
64 Ga0070709_10662112 3300005434 Bacteria 809
65 Ga0070709_10811252 3300005434 Bacteria 735
66 Ga0070714_100012455 3300005435 Bacteria 6791
67 Ga0070714_100017974 3300005435 Bacteria 5734
68 Ga0070714_100209133 3300005435 Bacteria 1788
69 Ga0070714_101712751 3300005435 Bacteria 614
70 Ga0070713_100000685 3300005436 Bacteria 21745
71 Ga0070713_100006493 3300005436 Bacteria 8113
72 Ga0070713_100168451 3300005436 Bacteria 1960
73 Ga0070710_10022315 3300005437 Bacteria 3308
74 Ga0070710_10082186 3300005437 Bacteria 1883
75 Ga0070710_10256624 3300005437 Bacteria 1126
76 Ga0070710_10316057 3300005437 Bacteria 1024
77 Ga0070711_100013034 3300005439 Bacteria 5212
78 Ga0070711_100076600 3300005439 Bacteria 2372
79 Ga0070711_100191959 3300005439 Bacteria 1571
80 Ga0070711_100207682 3300005439 Bacteria 1515
81 Ga0070705_100380101 3300005440 Bacteria 1039
82 Ga0070700_100039035 3300005441 Bacteria 2898
83 Ga0070663_100000032 3300005455 Bacteria 72041
84 Ga0070663_100026851 3300005455 Bacteria 3903
85 Ga0070663_100044703 3300005455 Bacteria 3125
86 Ga0070663_100427101 3300005455 Bacteria 1088
87 Ga0070663_100515492 3300005455 Bacteria 995
88 Ga0070663_100603667 3300005455 Bacteria 923
89 Ga0070663_101116662 3300005455 Bacteria 690
90 Ga0070678_100031443 3300005456 Bacteria 3662
91 Ga0070678_100173200 3300005456 Bacteria 1760
92 Ga0070678_100228280 3300005456 Bacteria 1551
93 Ga0070678_100304224 3300005456 Bacteria 1356
94 Ga0070678_100314635 3300005456 Bacteria 1335
95 Ga0070678_101610308 3300005456 Bacteria 610
96 Ga0070678_101958351 3300005456 Bacteria 554
97 Ga0070662_100024585 3300005457 Bacteria 4152
98 Ga0070662_100291348 3300005457 Bacteria 1324
99 Ga0070681_10003267 3300005458 Bacteria 15125
100 Ga0070681_10011892 3300005458 Bacteria 8630
101 Ga0070681_10927157 3300005458 Bacteria 790
102 Ga0068867_100005073 3300005459 Bacteria 9298
103 Ga0068867_100051842 3300005459 Bacteria 3027
104 Ga0068867_100132254 3300005459 Bacteria 1941
105 Ga0068867_100434831 3300005459 Bacteria 1115
106 Ga0068867_101758870 3300005459 Bacteria 582
107 Ga0070685_11003596 3300005466 Bacteria 626
108 Ga0070707_101962369 3300005468 Bacteria 553
109 Ga0070679_100057111 3300005530 Bacteria 3890
110 Ga0070679_100235803 3300005530 Bacteria 1788
111 Ga0070679_101687356 3300005530 Bacteria 581
112 Ga0070684_100410922 3300005535 Bacteria 1249
113 Ga0068853_100004507 3300005539 Bacteria 10803
114 Ga0068853_100027988 3300005539 Bacteria 4740
115 Ga0068853_100366376 3300005539 Bacteria 1343
116 Ga0068853_100384769 3300005539 Bacteria 1311
117 Ga0068853_101344825 3300005539 Bacteria 691
118 Ga0068853_101592476 3300005539 Bacteria 633
119 Ga0070672_100007230 3300005543 Bacteria 7522
120 Ga0070672_100063532 3300005543 Bacteria 2916
121 Ga0070672_100942088 3300005543 Bacteria 764
122 Ga0070672_101064120 3300005543 Bacteria 718
123 Ga0070686_100067137 3300005544 Bacteria 2335
124 Ga0070695_100405074 3300005545 Bacteria 1035
125 Ga0070696_100500481 3300005546 Bacteria 967
126 Ga0070693_100031554 3300005547 Bacteria 2905
127 Ga0070693_100299072 3300005547 Bacteria 1084
128 Ga0070665_100000065 3300005548 Bacteria 212975
129 Ga0070665_100013533 3300005548 Bacteria 8207
130 Ga0070665_100021742 3300005548 Bacteria 6450
131 Ga0070665_100024362 3300005548 Bacteria 6094
132 Ga0070665_100033044 3300005548 Bacteria 5205
133 Ga0070665_100071381 3300005548 Bacteria 3479
134 Ga0070665_100089749 3300005548 Bacteria 3079
135 Ga0070665_100418351 3300005548 Bacteria 1349
136 Ga0070665_100553541 3300005548 Bacteria 1163
137 Ga0070665_100940453 3300005548 Bacteria 877
138 Ga0070665_100961378 3300005548 Bacteria 866
139 Ga0070665_101585939 3300005548 Bacteria 662
140 Ga0070704_100570899 3300005549 Bacteria 991
141 Ga0068855_100042304 3300005563 Bacteria 5398
142 Ga0068855_100347684 3300005563 Bacteria 1634
143 Ga0068855_100670190 3300005563 Bacteria 1112
144 Ga0068855_101097669 3300005563 Bacteria 832
145 Ga0070664_100462330 3300005564 Bacteria 1166
146 Ga0068854_100096521 3300005578 Bacteria 2209
147 Ga0068856_100146118 3300005614 Bacteria 2372
148 Ga0068856_100294116 3300005614 Bacteria 1641
149 Ga0068856_100431063 3300005614 Bacteria 1339
150 Ga0068856_100453433 3300005614 Bacteria 1303
151 Ga0068856_100566740 3300005614 Bacteria 1157
152 Ga0068856_101090544 3300005614 Bacteria 816
153 Ga0068856_101434808 3300005614 Bacteria 704
154 Ga0068856_101769711 3300005614 Bacteria 630
155 Ga0068852_100037728 3300005616 Bacteria 4054
156 Ga0068852_100071507 3300005616 Bacteria 3046
157 Ga0068852_100256278 3300005616 Bacteria 1678
158 Ga0068852_101492301 3300005616 Bacteria 698
159 Ga0068859_100000070 3300005617 Bacteria 94311
160 Ga0068859_100224705 3300005617 Bacteria 1965
161 Ga0068859_100825600 3300005617 Bacteria 1014
162 Ga0068859_101248223 3300005617 Bacteria 819
163 Ga0068864_100954493 3300005618 Bacteria 849
164 Ga0068864_101199439 3300005618 Bacteria 757
165 Ga0068864_101841010 3300005618 Bacteria 611
166 Ga0068866_10062250 3300005718 Bacteria 1941
167 Ga0068861_100003543 3300005719 Bacteria 10382
168 Ga0068861_100009492 3300005719 Bacteria 6719
169 Ga0068851_10018980 3300005834 Bacteria 3320
170 Ga0068851_10871204 3300005834 Bacteria 563
171 Ga0068863_100196184 3300005841 Bacteria 1941
172 Ga0068863_100242827 3300005841 Bacteria 1738
173 Ga0068863_100391841 3300005841 Bacteria 1357
174 Ga0068863_100404990 3300005841 Bacteria 1335
175 Ga0068863_100563235 3300005841 Bacteria 1126
176 Ga0068858_100003907 3300005842 Bacteria 14721
177 Ga0068858_100015311 3300005842 Bacteria 7214
178 Ga0068858_100130761 3300005842 Bacteria 2354
179 Ga0068858_100465824 3300005842 Bacteria 1219
180 Ga0068860_100002268 3300005843 Bacteria 20215
181 Ga0068860_100062495 3300005843 Bacteria 3538
182 Ga0068860_100315074 3300005843 Bacteria 1535
183 Ga0068860_100712708 3300005843 Bacteria 1014
184 Ga0068862_100000041 3300005844 Bacteria 166801
185 Ga0068862_100039926 3300005844 Bacteria 3988
186 Ga0068862_100083515 3300005844 Bacteria 2773
187 Ga0068862_100845412 3300005844 Bacteria 897
188 Ga0068862_101266828 3300005844 Bacteria 738
189 Ga0081455_10080955 3300005937 Bacteria 2661
190 Ga0081455_10121862 3300005937 Bacteria 2053
191 Ga0081540_1011727 3300005983 Bacteria 5834
192 Ga0081540_1015034 3300005983 Bacteria 4915
193 Ga0070717_10000814 3300006028 Bacteria 20536
194 Ga0070717_10124938 3300006028 Bacteria 2208
195 Ga0075368_10154105 3300006042 Bacteria 960
196 Ga0075363_100031120 3300006048 Bacteria 2765
197 Ga0075364_10169639 3300006051 Bacteria 1475
198 Ga0070715_10007032 3300006163 Bacteria 3854
199 Ga0070715_10299341 3300006163 Bacteria 860
200 Ga0070715_10627156 3300006163 Bacteria 633
201 Ga0070715_11071613 3300006163 Bacteria 506
202 Ga0070716_100017024 3300006173 Bacteria 3761
203 Ga0070716_100029503 3300006173 Bacteria 2966
204 Ga0070716_101684933 3300006173 Bacteria 523
205 Ga0070712_100009205 3300006175 Bacteria 6219
206 Ga0070712_100018789 3300006175 Bacteria 4495
207 Ga0070712_100099596 3300006175 Bacteria 2145
208 Ga0070712_100240266 3300006175 Bacteria 1442
209 Ga0075367_10143760 3300006178 Bacteria 1478
210 Ga0075366_10026333 3300006195 Bacteria 3406
211 Ga0075366_10138130 3300006195 Bacteria 1472
212 Ga0075366_10256786 3300006195 Bacteria 1066
213 Ga0075366_10319170 3300006195 Bacteria 951
214 Ga0075366_10380523 3300006195 Bacteria 868
215 Ga0075366_10511477 3300006195 Bacteria 743
216 Ga0097621_100046041 3300006237 Bacteria 3527
217 Ga0097621_100267826 3300006237 Bacteria 1500
218 Ga0097621_100542722 3300006237 Bacteria 1057
219 Ga0097621_100584282 3300006237 Bacteria 1020
220 Ga0097621_101251852 3300006237 Bacteria 700
221 Ga0075370_10000125 3300006353 Bacteria 25536
222 Ga0068871_100122204 3300006358 Bacteria 2201
223 Ga0068871_100234885 3300006358 Bacteria 1592
224 Ga0068871_100386708 3300006358 Bacteria 1244
225 Ga0068871_100497282 3300006358 Bacteria 1099
226 Ga0068871_101009652 3300006358 Bacteria 775
227 Ga0068871_101074246 3300006358 Bacteria 752
228 Ga0068871_101489570 3300006358 Bacteria 639
229 Ga0075428_100380664 3300006844 Bacteria 1513
230 Ga0075430_100046015 3300006846 Bacteria 3685
231 Ga0075434_100515446 3300006871 Bacteria 1216
232 Ga0075434_101050381 3300006871 Bacteria 828
233 Ga0075429_100004520 3300006880 Bacteria 11962
234 Ga0068865_100014391 3300006881 Bacteria 5025
235 Ga0068865_100047454 3300006881 Bacteria 2951
236 Ga0068865_100123750 3300006881 Bacteria 1927
237 Ga0068865_100308774 3300006881 Bacteria 1268
238 Ga0068865_101286169 3300006881 Bacteria 650
239 Ga0075436_100024062 3300006914 Bacteria 4187
240 Ga0075436_100099007 3300006914 Bacteria 2030
241 Ga0097620_100000070 3300006931 Bacteria 94311
242 Ga0097620_100224701 3300006931 Bacteria 1965
243 Ga0097620_100825600 3300006931 Bacteria 1014
244 Ga0097620_101248241 3300006931 Bacteria 819
245 Ga0075435_100388011 3300007076 Bacteria 1200
246 Ga0075435_100536029 3300007076 Bacteria 1013
247 Ga0099795_10000192 3300007788 Bacteria 10332
248 Ga0105244_10009239 3300009036 Bacteria 6079
249 Ga0105250_10038856 3300009092 Bacteria 1909
250 Ga0105250_10116508 3300009092 Bacteria 1096
251 Ga0105240_10013944 3300009093 Bacteria 11003
252 Ga0105240_10287177 3300009093 Bacteria 1888
253 Ga0111539_10057983 3300009094 Bacteria 4596
254 Ga0111539_10139972 3300009094 Bacteria 2833
255 Ga0105245_10002177 3300009098 Bacteria 17752
256 Ga0105245_10265585 3300009098 Bacteria 1672
257 Ga0105245_10597262 3300009098 Bacteria 1130
258 Ga0105247_10003807 3300009101 Bacteria 9770
259 Ga0105247_10121477 3300009101 Bacteria 1693
260 Ga0105247_10373498 3300009101 Bacteria 1009
261 Ga0105247_10498343 3300009101 Bacteria 887
262 Ga0105243_10044965 3300009148 Bacteria 3467
263 Ga0105243_10129905 3300009148 Bacteria 2136
264 Ga0105243_10375202 3300009148 Bacteria 1314
265 Ga0105241_10009761 3300009174 Bacteria 7054
266 Ga0105241_10099570 3300009174 Bacteria 2309
267 Ga0105241_10360243 3300009174 Bacteria 1265
268 Ga0105241_10503864 3300009174 Bacteria 1080
269 Ga0105241_11022523 3300009174 Bacteria 774
270 Ga0105242_10002301 3300009176 Bacteria 15072
271 Ga0105242_10004392 3300009176 Bacteria 10967
272 Ga0105242_10436943 3300009176 Bacteria 1230
273 Ga0105242_10635332 3300009176 Bacteria 1036
274 Ga0105242_11909669 3300009176 Bacteria 634
275 Ga0105242_11989660 3300009176 Bacteria 623
276 Ga0105248_10002111 3300009177 Bacteria 22008
277 Ga0105248_10038865 3300009177 Bacteria 5328
278 Ga0105248_10473001 3300009177 Bacteria 1413
279 Ga0105248_10508775 3300009177 Bacteria 1358
280 Ga0105248_10552277 3300009177 Bacteria 1299
281 Ga0105248_10678870 3300009177 Bacteria 1162
282 Ga0105248_10820021 3300009177 Bacteria 1050
283 Ga0105237_10016690 3300009545 Bacteria 7622
284 Ga0105237_10146176 3300009545 Bacteria 2359
285 Ga0105237_10311568 3300009545 Bacteria 1577
286 Ga0105237_10703642 3300009545 Bacteria 1017
287 Ga0105237_11482502 3300009545 Bacteria 685
288 Ga0105238_10062185 3300009551 Bacteria 3734
289 Ga0105238_10303444 3300009551 Bacteria 1581
290 Ga0105238_10333358 3300009551 Bacteria 1504
291 Ga0105238_10758448 3300009551 Bacteria 984
292 Ga0105238_11266315 3300009551 Bacteria 763
293 Ga0105249_10000394 3300009553 Bacteria 42210
294 Ga0105249_10028985 3300009553 Bacteria 4999
295 Ga0105249_10889331 3300009553 Bacteria 957
296 Ga0105249_11470458 3300009553 Bacteria 753
297 Ga0099796_10000158 3300010159 Bacteria 10091
298 Ga0105239_10057725 3300010375 Bacteria 4258
299 Ga0105239_10115296 3300010375 Bacteria 2980
300 Ga0105239_10345479 3300010375 Bacteria 1680
301 Ga0105239_10448529 3300010375 Bacteria 1463
302 Ga0105239_10759839 3300010375 Bacteria 1110
303 Ga0105239_10927649 3300010375 Bacteria 1000
304 Ga0105239_12533388 3300010375 Bacteria 598
305 Ga0105246_10050555 3300011119 Bacteria 2851
306 Ga0105246_10796713 3300011119 Bacteria 838
307 Ga0157327_1003260 3300012512 Bacteria 1185
308 Ga0157373_10123963 3300013100 Bacteria 1817
309 Ga0157373_10149500 3300013100 Bacteria 1643
310 Ga0157371_11003566 3300013102 Bacteria 637
311 Ga0157370_10111268 3300013104 Bacteria 2560
312 Ga0157370_10112382 3300013104 Bacteria 2546
313 Ga0157370_10836613 3300013104 Bacteria 837
314 Ga0157369_10392167 3300013105 Bacteria 1441
315 Ga0157369_10830659 3300013105 Bacteria 949
316 Ga0157374_10008134 3300013296 Bacteria 8964
317 Ga0157374_10008293 3300013296 Bacteria 8864
318 Ga0157374_10064875 3300013296 Bacteria 3428
319 Ga0157374_10269835 3300013296 Bacteria 1677
320 Ga0157374_10704962 3300013296 Bacteria 1023
321 Ga0157374_12659743 3300013296 Bacteria 528
322 Ga0157378_10001565 3300013297 Bacteria 20672
323 Ga0157378_10004721 3300013297 Bacteria 11949
324 Ga0157378_10293254 3300013297 Bacteria 1572
325 Ga0157378_10863564 3300013297 Bacteria 934
326 Ga0163162_10029905 3300013306 Bacteria 5394
327 Ga0163162_10172753 3300013306 Bacteria 2286
328 Ga0163162_10453435 3300013306 Bacteria 1414
329 Ga0163162_10488736 3300013306 Bacteria 1362
330 Ga0163162_10629544 3300013306 Bacteria 1197
331 Ga0163162_11204204 3300013306 Bacteria 859
332 Ga0163162_12130504 3300013306 Bacteria 643
333 Ga0157372_10059970 3300013307 Bacteria 4257
334 Ga0157372_10397688 3300013307 Bacteria 1606
335 Ga0157375_10000948 3300013308 Bacteria 25130
336 Ga0157375_10074252 3300013308 Bacteria 3422
337 Ga0157375_10343217 3300013308 Bacteria 1659
338 Ga0157375_10489604 3300013308 Bacteria 1394
339 Ga0157375_10765112 3300013308 Bacteria 1116
340 Ga0163163_10026109 3300014325 Bacteria 5578
341 Ga0163163_10041754 3300014325 Bacteria 4487
342 Ga0163163_10159059 3300014325 Bacteria 2304
343 Ga0163163_10311885 3300014325 Bacteria 1626
344 Ga0163163_11023989 3300014325 Bacteria 889
345 Ga0163163_11986717 3300014325 Bacteria 641
346 Ga0157380_10032011 3300014326 Bacteria 4041
347 Ga0157380_10742773 3300014326 Bacteria 992
348 Ga0157380_11312766 3300014326 Bacteria 771
349 Ga0182008_10151380 3300014497 Bacteria 1164
350 Ga0157379_10077258 3300014968 Bacteria 2981
351 Ga0157379_10336291 3300014968 Bacteria 1380
352 Ga0157379_10372351 3300014968 Bacteria 1310
353 Ga0157379_10820234 3300014968 Bacteria 879
354 Ga0157376_10014847 3300014969 Bacteria 5862
355 Ga0157376_10148780 3300014969 Bacteria 2110
356 Ga0157376_10153728 3300014969 Bacteria 2078
357 Ga0157376_10643819 3300014969 Bacteria 1059
358 Ga0157376_10709419 3300014969 Bacteria 1012
359 Ga0157376_10713645 3300014969 Bacteria 1009
360 Ga0157376_11042362 3300014969 Bacteria 842
361 Ga0163161_10156287 3300017792 Bacteria 1736
362 Ga0163161_10377699 3300017792 Bacteria 1132
363 Ga0163161_10913340 3300017792 Bacteria 745
364 Ga0206356_10568014 3300020070 Bacteria 622
365 Ga0207427_100158 3300025231 Bacteria 76687
366 Ga0209130_1003425 3300025284 Bacteria 6759
367 Ga0209675_1006592 3300025291 Bacteria 4623
368 Ga0209676_1010982 3300025292 Bacteria 3704
369 Ga0209025_1067864 3300025294 Bacteria 1285
370 Ga0209564_1027276 3300025295 Bacteria 1859
371 Ga0209050_1062310 3300025298 Bacteria 874
372 Ga0207426_1002416 3300025302 Bacteria 11980
373 Ga0209051_1009603 3300025303 Bacteria 4968
374 Ga0209051_1039391 3300025303 Bacteria 1707
375 Ga0209051_1046380 3300025303 Bacteria 1495
376 Ga0209257_1102878 3300025304 Bacteria 693
377 Ga0207697_10182817 3300025315 Bacteria 919
378 Ga0207656_10007225 3300025321 Bacteria 4034
379 Ga0207713_1005978 3300025735 Bacteria 7507
380 Ga0207692_10235097 3300025898 Bacteria 1092
381 Ga0207692_10761859 3300025898 Bacteria 631
382 Ga0207642_10048391 3300025899 Bacteria 1906
383 Ga0207642_10166567 3300025899 Bacteria 1188
384 Ga0207710_10065981 3300025900 Bacteria 1651
385 Ga0207688_10517267 3300025901 Bacteria 748
386 Ga0207680_10012058 3300025903 Bacteria 4392
387 Ga0207680_10031290 3300025903 Bacteria 3013
388 Ga0207680_10094061 3300025903 Bacteria 1913
389 Ga0207680_10579696 3300025903 Bacteria 802
390 Ga0207680_10589432 3300025903 Bacteria 795
391 Ga0207680_10718197 3300025903 Bacteria 716
392 Ga0207647_10000023 3300025904 Bacteria 115648
393 Ga0207685_10013506 3300025905 Bacteria 2528
394 Ga0207685_10514333 3300025905 Bacteria 632
395 Ga0207685_10578114 3300025905 Bacteria 600
396 Ga0207699_10059384 3300025906 Bacteria 2291
397 Ga0207645_10041741 3300025907 Bacteria 2936
398 Ga0207645_10076851 3300025907 Bacteria 2139
399 Ga0207705_10914426 3300025909 Bacteria 679
400 Ga0207654_10016769 3300025911 Bacteria 3818
401 Ga0207654_10019088 3300025911 Bacteria 3610
402 Ga0207654_10078914 3300025911 Bacteria 1976
403 Ga0207654_10640961 3300025911 Bacteria 760
404 Ga0207707_10002957 3300025912 Bacteria 15139
405 Ga0207707_10043393 3300025912 Bacteria 3923
406 Ga0207707_10987409 3300025912 Bacteria 692
407 Ga0207695_10010030 3300025913 Bacteria 11631
408 Ga0207695_10081843 3300025913 Bacteria 3266
409 Ga0207695_10104708 3300025913 Bacteria 2818
410 Ga0207695_10158019 3300025913 Bacteria 2200
411 Ga0207671_10000929 3300025914 Bacteria 36747
412 Ga0207671_10011778 3300025914 Bacteria 7081
413 Ga0207671_10100850 3300025914 Bacteria 2186
414 Ga0207671_10585154 3300025914 Bacteria 890
415 Ga0207693_10001689 3300025915 Bacteria 19438
416 Ga0207693_10026865 3300025915 Bacteria 4553
417 Ga0207693_10514204 3300025915 Bacteria 934
418 Ga0207663_10025632 3300025916 Bacteria 3412
419 Ga0207663_10083792 3300025916 Bacteria 2095
420 Ga0207663_10208455 3300025916 Bacteria 1415
421 Ga0207663_10467677 3300025916 Bacteria 975
422 Ga0207660_10719809 3300025917 Bacteria 814
423 Ga0207660_11108272 3300025917 Bacteria 645
424 Ga0207662_10326671 3300025918 Bacteria 1025
425 Ga0207657_10145429 3300025919 Bacteria 1934
426 Ga0207649_10462676 3300025920 Bacteria 959
427 Ga0207649_10679841 3300025920 Bacteria 797
428 Ga0207649_10817584 3300025920 Bacteria 728
429 Ga0207652_10054792 3300025921 Bacteria 3429
430 Ga0207681_10081260 3300025923 Bacteria 2288
431 Ga0207681_10084547 3300025923 Bacteria 2250
432 Ga0207681_10440498 3300025923 Bacteria 1059
433 Ga0207681_10542115 3300025923 Bacteria 957
434 Ga0207694_10414659 3300025924 Bacteria 1121
435 Ga0207650_10024055 3300025925 Bacteria 4326
436 Ga0207650_10242540 3300025925 Bacteria 1457
437 Ga0207687_10037950 3300025927 Bacteria 3290
438 Ga0207687_10853595 3300025927 Bacteria 778
439 Ga0207700_10088146 3300025928 Bacteria 2442
440 Ga0207700_10153328 3300025928 Bacteria 1906
441 Ga0207700_10197190 3300025928 Bacteria 1695
442 Ga0207664_10037381 3300025929 Bacteria 3757
443 Ga0207664_10100991 3300025929 Bacteria 2383
444 Ga0207664_10374008 3300025929 Bacteria 1264
445 Ga0207644_10105748 3300025931 Bacteria 2121
446 Ga0207644_10145853 3300025931 Bacteria 1827
447 Ga0207644_10231254 3300025931 Bacteria 1469
448 Ga0207690_10087522 3300025932 Bacteria 2192
449 Ga0207690_11594588 3300025932 Bacteria 545
450 Ga0207706_10002543 3300025933 Bacteria 17778
451 Ga0207706_10092120 3300025933 Bacteria 2665
452 Ga0207706_10506427 3300025933 Bacteria 1042
453 Ga0207686_10147050 3300025934 Bacteria 1636
454 Ga0207686_10280585 3300025934 Bacteria 1230
455 Ga0207686_10689411 3300025934 Bacteria 811
456 Ga0207686_10994451 3300025934 Bacteria 680
457 Ga0207709_10149103 3300025935 Bacteria 1618
458 Ga0207669_10143318 3300025937 Bacteria 1662
459 Ga0207669_10861237 3300025937 Bacteria 755
460 Ga0207704_10048960 3300025938 Bacteria 2538
461 Ga0207704_10061757 3300025938 Bacteria 2326
462 Ga0207704_10166441 3300025938 Bacteria 1575
463 Ga0207665_10001560 3300025939 Bacteria 15442
464 Ga0207665_10013681 3300025939 Bacteria 5337
465 Ga0207691_10013978 3300025940 Bacteria 7658
466 Ga0207711_10001156 3300025941 Bacteria 25114
467 Ga0207711_10217817 3300025941 Bacteria 1745
468 Ga0207711_10244437 3300025941 Bacteria 1646
469 Ga0207711_10358182 3300025941 Bacteria 1351
470 Ga0207689_10110716 3300025942 Bacteria 2256
471 Ga0207689_10130815 3300025942 Bacteria 2066
472 Ga0207689_10324490 3300025942 Bacteria 1278
473 Ga0207689_10351873 3300025942 Bacteria 1225
474 Ga0207689_10985436 3300025942 Bacteria 711
475 Ga0207679_10394142 3300025945 Bacteria 1217
476 Ga0207679_10497371 3300025945 Bacteria 1087
477 Ga0207679_10839500 3300025945 Bacteria 839
478 Ga0207667_10338935 3300025949 Bacteria 1534
479 Ga0207651_10197611 3300025960 Bacteria 1609
480 Ga0207651_10639864 3300025960 Bacteria 933
481 Ga0207712_10000228 3300025961 Bacteria 55397
482 Ga0207712_10000345 3300025961 Bacteria 41964
483 Ga0207712_10893126 3300025961 Bacteria 785
484 Ga0207712_10967274 3300025961 Bacteria 754
485 Ga0207668_10041101 3300025972 Bacteria 3123
486 Ga0207668_10311917 3300025972 Bacteria 1302
487 Ga0207640_10095297 3300025981 Bacteria 2072
488 Ga0207658_10000020 3300025986 Bacteria 202984
489 Ga0207658_10019220 3300025986 Bacteria 4724
490 Ga0207658_10057948 3300025986 Bacteria 2880
491 Ga0207658_10128742 3300025986 Bacteria 2030
492 Ga0207658_10168481 3300025986 Bacteria 1802
493 Ga0207658_10208875 3300025986 Bacteria 1635
494 Ga0207658_10457342 3300025986 Bacteria 1131
495 Ga0207658_10854596 3300025986 Bacteria 827
496 Ga0207658_11019182 3300025986 Bacteria 755
497 Ga0207658_11414647 3300025986 Bacteria 636
498 Ga0207677_10217653 3300026023 Bacteria 1529
499 Ga0207677_10289434 3300026023 Bacteria 1348
500 Ga0207677_10337959 3300026023 Bacteria 1257
501 Ga0207677_10429316 3300026023 Bacteria 1127
502 Ga0207677_10566905 3300026023 Bacteria 992
503 Ga0207703_10002854 3300026035 Bacteria 14736
504 Ga0207703_10102252 3300026035 Bacteria 2431
505 Ga0207703_10205502 3300026035 Bacteria 1753
506 Ga0207703_11244141 3300026035 Bacteria 716
507 Ga0207703_11676247 3300026035 Bacteria 611
508 Ga0207639_10000405 3300026041 Bacteria 29812
509 Ga0207639_10026683 3300026041 Bacteria 4198
510 Ga0207639_10190287 3300026041 Bacteria 1752
511 Ga0207639_10337375 3300026041 Bacteria 1343
512 Ga0207639_10339752 3300026041 Bacteria 1338
513 Ga0207639_10342494 3300026041 Bacteria 1333
514 Ga0207639_10394079 3300026041 Bacteria 1246
515 Ga0207678_10000010 3300026067 Bacteria 149258
516 Ga0207678_10013505 3300026067 Bacteria 7170
517 Ga0207678_11342139 3300026067 Bacteria 632
518 Ga0207708_10009588 3300026075 Bacteria 7178
519 Ga0207702_10057451 3300026078 Bacteria 3307
520 Ga0207702_10206754 3300026078 Bacteria 1823
521 Ga0207702_10334280 3300026078 Bacteria 1446
522 Ga0207702_10469533 3300026078 Bacteria 1223
523 Ga0207702_10916315 3300026078 Bacteria 869
524 Ga0207702_12213726 3300026078 Bacteria 538
525 Ga0207641_10113987 3300026088 Bacteria 2401
526 Ga0207641_10142348 3300026088 Bacteria 2165
527 Ga0207641_10610878 3300026088 Bacteria 1068
528 Ga0207641_10710383 3300026088 Bacteria 990
529 Ga0207641_10774288 3300026088 Bacteria 948
530 Ga0207648_10001067 3300026089 Bacteria 30723
531 Ga0207648_10030844 3300026089 Bacteria 4744
532 Ga0207648_10044786 3300026089 Bacteria 3882
533 Ga0207648_10083622 3300026089 Bacteria 2784
534 Ga0207676_10189897 3300026095 Bacteria 1807
535 Ga0207676_10306071 3300026095 Bacteria 1453
536 Ga0207676_10635479 3300026095 Bacteria 1029
537 Ga0207674_11219568 3300026116 Bacteria 722
538 Ga0207675_100000393 3300026118 Bacteria 41975
539 Ga0207675_100010527 3300026118 Bacteria 8665
540 Ga0207675_101366704 3300026118 Bacteria 729
541 Ga0207683_10103520 3300026121 Bacteria 2543
542 Ga0207683_10104979 3300026121 Bacteria 2525
543 Ga0207683_10207272 3300026121 Bacteria 1783
544 Ga0207683_10226302 3300026121 Bacteria 1705
545 Ga0207683_10309386 3300026121 Bacteria 1446
546 Ga0207698_10234682 3300026142 Bacteria 1668
547 Ga0207698_10536126 3300026142 Bacteria 1145
548 Ga0207698_11145356 3300026142 Bacteria 791
549 Ga0207698_11387585 3300026142 Bacteria 718
550 Ga0209179_1017778 3300027512 Bacteria 1351
551 Ga0209813_10008637 3300027866 Bacteria 2581
552 Ga0207428_10382011 3300027907 Bacteria 1033
553 Ga0268266_10000001 3300028379 Bacteria 4040580
554 Ga0268266_10000013 3300028379 Bacteria 649715
555 Ga0268266_10052426 3300028379 Bacteria 3503
556 Ga0268266_10155888 3300028379 Bacteria 2062
557 Ga0268266_10562249 3300028379 Bacteria 1093
558 Ga0268266_10593665 3300028379 Bacteria 1063
559 Ga0268265_10000137 3300028380 Bacteria 93389
560 Ga0268265_10018829 3300028380 Bacteria 4790
561 Ga0268265_10036752 3300028380 Bacteria 3589
562 Ga0268265_10084184 3300028380 Bacteria 2520
563 Ga0268265_11990173 3300028380 Bacteria 588
564 Ga0268264_10001497 3300028381 Bacteria 21798
565 Ga0268264_10468084 3300028381 Bacteria 1224
566 Ga0268264_10809535 3300028381 Bacteria 936
567 Ga0265326_10023708 3300028558 Bacteria 1753
568 Ga0265319_1011783 3300028563 Bacteria 3560
569 Ga0265334_10000686 3300028573 Bacteria 16949
570 Ga0265318_10002965 3300028577 Bacteria 8782
571 Ga0307517_10049020 3300028786 Bacteria 4331
572 Ga0307515_10000030 3300028794 Bacteria 364482
573 Ga0307515_10176759 3300028794 Bacteria 2102
574 Ga0265338_10009041 3300028800 Bacteria 11981
575 Ga0265338_10132868 3300028800 Bacteria 1962
576 Ga0265767_101674 3300030836 Bacteria 1113
577 Ga0265769_110927 3300030888 Bacteria 626
578 Ga0265330_10072924 3300031235 Bacteria 1484
579 Ga0265332_10056646 3300031238 Bacteria 1679
580 Ga0265328_10070910 3300031239 Bacteria 1281
581 Ga0265320_10020389 3300031240 Bacteria 3596
582 Ga0265325_10043888 3300031241 Bacteria 2330
583 Ga0265340_10151579 3300031247 Bacteria 1056
584 Ga0265331_10005291 3300031250 Bacteria 7812
585 Ga0265331_10007111 3300031250 Bacteria 6516
586 Ga0265331_10080610 3300031250 Bacteria 1513
587 Ga0265327_10000217 3300031251 Bacteria 117085
588 Ga0265327_10000923 3300031251 Bacteria 43037
589 Ga0265316_10197716 3300031344 Bacteria 1491
590 Ga0307513_10037093 3300031456 Bacteria 5427
591 Ga0307513_10623189 3300031456 Bacteria 787
592 Ga0307509_10251736 3300031507 Bacteria 1549
593 Ga0307509_10512826 3300031507 Bacteria 882
594 Ga0307509_10621751 3300031507 Bacteria 751
595 Ga0307408_100159070 3300031548 Bacteria 1792
596 Ga0307408_100281305 3300031548 Bacteria 1386
597 Ga0307408_100742666 3300031548 Bacteria 886
598 Ga0307408_101092041 3300031548 Bacteria 740
599 Ga0265313_10013741 3300031595 Bacteria 4830
600 Ga0316575_10023148 3300031665 Bacteria 2399
601 Ga0316579_10000335 3300031691 Bacteria 14709
602 Ga0316579_10036051 3300031691 Bacteria 2281
603 Ga0316579_10056016 3300031691 Bacteria 1850
604 Ga0265314_10046888 3300031711 Bacteria 3046
605 Ga0265342_10025329 3300031712 Bacteria 3732
606 Ga0316576_10501143 3300031727 Bacteria 893
607 Ga0316578_10005901 3300031728 Bacteria 5991
608 Ga0316578_10123723 3300031728 Bacteria 1555
609 Ga0307516_10008706 3300031730 Bacteria 11411
610 Ga0307516_10192768 3300031730 Bacteria 1763
611 Ga0316577_10290875 3300031733 Bacteria 925
612 Ga0307413_10690716 3300031824 Bacteria 847
613 Ga0307413_11018302 3300031824 Bacteria 711
614 Ga0307413_11084135 3300031824 Bacteria 691
615 Ga0307410_10269118 3300031852 Bacteria 1332
616 Ga0307410_10580325 3300031852 Bacteria 933
617 Ga0307410_10868954 3300031852 Bacteria 771
618 Ga0307412_10380154 3300031911 Bacteria 1143
619 Ga0307412_10577018 3300031911 Bacteria 949
620 Ga0307412_11502820 3300031911 Bacteria 612
621 Ga0307414_10073307 3300032004 Bacteria 2476
622 Ga0307414_10603819 3300032004 Bacteria 984
623 Ga0307414_11985021 3300032004 Bacteria 543
624 Ga0307411_10376212 3300032005 Bacteria 1167
625 Ga0307411_10741296 3300032005 Bacteria 860
626 Ga0307415_100800222 3300032126 Bacteria 860
627 Ga0316583_10012201 3300032133 Bacteria 3100
628 Ga0316583_10019818 3300032133 Bacteria 2411
629 Ga0307507_10166340 3300033179 Bacteria 1615
630 Ga0307510_10014225 3300033180 Bacteria 9423
631 Ga0373923_0169290 3300035111 Bacteria 1000
632 Ga0373923_0279400 3300035111 Bacteria 787
633 Ga0373923_0381825 3300035111 Bacteria 676
634 Ga0373936_0049743 3300035113 Bacteria 1694
635 Ga0373936_0122300 3300035113 Bacteria 1113
636 Ga0373939_0312432 3300035114 Bacteria 630
637 Ga0373945_0075432 3300035116 Bacteria 1284
638 Ga0373957_0100589 3300035120 Bacteria 1157
639 Ga0373957_0292915 3300035120 Bacteria 689
640 Ga0373943_0169191 3300035170 Bacteria 1195
641 Ga0373943_0404926 3300035170 Bacteria 788
642 Ga0373946_0116842 3300035171 Bacteria 1214
643 Ga0373946_0138135 3300035171 Bacteria 1127
644 Ga0373955_0015873 3300035172 Bacteria 3696
645 Ga0316574_0018381 3300035398 Bacteria 4106
646 Ga0373924_0414075 3300035410 Bacteria 603
647 Ga0373931_0240633 3300035691 Bacteria 1097
648 Ga0373935_1316134 3300035692 Bacteria 540
649 Ga0373927_0008876 3300035695 Bacteria 6752
650 Ga0373927_0008998 3300035695 Bacteria 6704
651 Ga0373933_0137840 3300035724 Bacteria 1538
652 Ga0373933_0759234 3300035724 Bacteria 638
653 Ga0373937_0007789 3300036401 Bacteria 9286
654 Ga0373937_0044059 3300036401 Bacteria 4075
655 Ga0373937_0226658 3300036401 Bacteria 1759
656 Ga0373937_0354444 3300036401 Bacteria 1390
657 Ga0316582_0131502 3300036647 Bacteria 1681
658 Ga0316584_0002853 3300036712 Bacteria 11086
659 Ga0316584_1137019 3300036712 Bacteria 517
660 Ga0373925_0019765 3300037068 Bacteria 4902
661 Ga0373925_0297118 3300037068 Bacteria 1303
662 Ga0395899_0160092 3300037312 Bacteria 1591
663 Ga0395900_0062240 3300037418 Bacteria 3836
664 Ga0395900_0529314 3300037418 Bacteria 1126
665 Ga0395905_0091825 3300037471 Bacteria 2846
666 Ga0395905_0321319 3300037471 Bacteria 1437
667 Ga0395905_0814794 3300037471 Bacteria 836
668 Ga0316581_0113039 3300037588 Bacteria 836
669 Ga0395901_0592085 3300038443 Bacteria 1119
670 Ga0400485_20664 3300038735 Bacteria 2386
671 Ga0400486_05964 3300038742 Bacteria 2633
672 Ga0400486_24080 3300038742 Bacteria 1589
673 Ga0400487_64253 3300039110 Bacteria 1283
674 Ga0436363_1408620 3300039450 Bacteria 547
675 Ga0436363_1696509 3300039450 Bacteria 635
676 Ga0439436_0193526 3300041404 Bacteria 581
677 Ga0439461_0054247 3300041410 Bacteria 896
678 Ga0439465_0179017 3300041413 Bacteria 766
679 Ga0451787_090787 3300041441 Bacteria 1234
680 Ga0451789_0077899 3300041443 Bacteria 721
681 Ga0451789_0844787 3300041443 Bacteria 1111
682 Ga0451791_1373322 3300041451 Bacteria 808
683 Ga0451793_0165339 3300041452 Bacteria 645
684 Ga0451793_0173052 3300041452 Bacteria 568
685 Ga0451793_1258784 3300041452 Bacteria 779
686 Ga0451795_1351381 3300041456 Bacteria 1046
687 Ga0451800_1428091 3300041459 Bacteria 989
688 Ga0451804_0833077 3300041463 Bacteria 596
689 Ga0451807_2726366 3300041486 Bacteria 505
690 Ga0451835_0574946 3300041492 Bacteria 619
691 Ga0451841_1204341 3300041498 Bacteria 871
692 Ga0451847_0397701 3300041503 Bacteria 934
693 Ga0451851_0422575 3300041507 Bacteria 572
694 Ga0451851_1233695 3300041507 Bacteria 761
695 Ga0451843_1018122 3300041509 Bacteria 882
696 Ga0451853_0843378 3300041512 Bacteria 665
697 Ga0439462_0083638 3300042015 Bacteria 873
698 Ga0450893_0018963 3300042532 Bacteria 1175
699 Ga0451577_0093636 3300042876 Bacteria 2683
700 Ga0451577_0324788 3300042876 Bacteria 1395
701 Ga0451577_1539865 3300042876 Bacteria 587
702 Ga0453684_0003473 3300044712 Bacteria 35388
703 Ga0453684_0214192 3300044712 Bacteria 2236
704 Ga0453684_1426442 3300044712 Bacteria 717
705 Ga0451576_0529544 3300045051 Bacteria 1238
706 Ga0451576_0834716 3300045051 Bacteria 967
707 Ga0466967_0320759 3300045976 Bacteria 1494
708 Ga0466967_0329752 3300045976 Bacteria 1474
709 Ga0466967_0430551 3300045976 Bacteria 1287
710 Ga0495603_0607818 3300046455 Bacteria 626
711 Ga0495590_0002486 3300046457 Bacteria 7626
712 Ga0495629_0380930 3300046459 Bacteria 960
713 Ga0495629_0630211 3300046459 Bacteria 715
714 Ga0495638_0061927 3300046460 Bacteria 2310
715 Ga0495641_0194236 3300046461 Bacteria 910
716 Ga0495650_0007591 3300046471 Bacteria 6484
717 Ga0495650_0031451 3300046471 Bacteria 2388
718 Ga0495650_0092512 3300046471 Bacteria 1148
719 Ga0495580_0000952 3300046472 Bacteria 25321
720 Ga0495580_0107786 3300046472 Bacteria 1934
721 Ga0495582_0006801 3300046473 Bacteria 6363
722 Ga0495639_0053130 3300046475 Bacteria 1845
723 Ga0495664_0116619 3300046477 Bacteria 1614
724 Ga0495596_0329117 3300046500 Bacteria 594
725 Ga0495583_0168485 3300046506 Bacteria 901
726 Ga0495608_0193354 3300046511 Bacteria 1284
727 Ga0495618_0595548 3300046514 Bacteria 658
728 Ga0495620_0012529 3300046515 Bacteria 4373
729 Ga0495620_0026015 3300046515 Bacteria 2758
730 Ga0495630_0345860 3300046517 Bacteria 1138
731 Ga0495642_0515727 3300046528 Bacteria 530
732 Ga0495652_1012914 3300046529 Bacteria 543
733 Ga0495665_0130413 3300046531 Bacteria 1316
734 Ga0495587_0370021 3300046536 Bacteria 798
735 Ga0495597_0012789 3300046542 Bacteria 4040
736 Ga0495645_0200776 3300046543 Bacteria 1353
737 Ga0495645_0258893 3300046543 Bacteria 1153
738 Ga0495667_0286764 3300046559 Bacteria 1045
739 Ga0495656_0001865 3300046615 Bacteria 6952
740 Ga0495625_0386740 3300046660 Bacteria 877
741 Ga0495657_0647518 3300046675 Bacteria 609
742 Ga0495599_0204334 3300046678 Bacteria 1213
743 Ga0495646_0195434 3300046680 Bacteria 1104
744 Ga0495647_0163002 3300046681 Bacteria 962
745 Ga0495647_0216957 3300046681 Bacteria 843
746 Ga0495658_0021327 3300046683 Bacteria 3414
747 Ga0495624_0297296 3300046690 Bacteria 974
748 Ga0495660_0146296 3300046810 Bacteria 1171
749 Ga0495581_0079163 3300047315 Bacteria 1902
750 Ga0495581_0261624 3300047315 Bacteria 1012
751 Ga0495674_0243093 3300047319 Bacteria 1483
752 Ga0495674_0356455 3300047319 Bacteria 1187
753 Ga0495683_0005445 3300047323 Bacteria 7065
754 Ga0495687_066428 3300047443 Bacteria 1464
755 Ga0495686_0023221 3300047472 Bacteria 4093
756 Ga0495602_0125516 3300048088 Bacteria 2057
757 Ga0495602_0192246 3300048088 Bacteria 1564
758 Ga0495626_0039747 3300048091 Bacteria 2225
759 Ga0496100_0017862 3300048903 Bacteria 4196
760 Ga0496100_0061986 3300048903 Bacteria 2466
761 Ga0496100_0174448 3300048903 Bacteria 1551
762 Ga0496100_0191056 3300048903 Bacteria 1486
763 Ga0496101_0006111 3300048904 Bacteria 7732
764 Ga0496101_0059923 3300048904 Bacteria 2760
765 Ga0496101_0067611 3300048904 Bacteria 2609
766 Ga0496101_0070758 3300048904 Bacteria 2555
767 Ga0496101_0494880 3300048904 Bacteria 966
768 Ga0496101_1137070 3300048904 Bacteria 613
769 Ga0496102_0017184 3300048905 Bacteria 6334
770 Ga0496102_0091734 3300048905 Bacteria 2812
771 Ga0496102_0152454 3300048905 Bacteria 2172
772 Ga0496102_0340311 3300048905 Bacteria 1413
773 Ga0496103_0005415 3300048906 Bacteria 7641
774 Ga0496103_0027159 3300048906 Bacteria 3466
775 Ga0496103_0096419 3300048906 Bacteria 1869
776 Ga0496104_0056562 3300048907 Bacteria 3710
777 Ga0496104_0292031 3300048907 Bacteria 1543
778 Ga0496104_0558598 3300048907 Bacteria 1055
779 Ga0496104_0581398 3300048907 Bacteria 1030
780 Ga0496104_0889711 3300048907 Bacteria 796
781 Ga0496104_0906569 3300048907 Bacteria 786
782 Ga0496105_0000080 3300048908 Bacteria 70744
783 Ga0496105_0010228 3300048908 Bacteria 7375
784 Ga0496105_0142394 3300048908 Bacteria 1973
785 Ga0496105_0305285 3300048908 Bacteria 1278
786 Ga0496105_1144733 3300048908 Bacteria 575
787 Ga0496106_0017058 3300048909 Bacteria 5374
788 Ga0496106_0063569 3300048909 Bacteria 2805
789 Ga0496106_0064017 3300048909 Bacteria 2797
790 Ga0496107_0002917 3300048910 Bacteria 11308
791 Ga0496107_0009091 3300048910 Bacteria 6888
792 Ga0496107_0015412 3300048910 Bacteria 5356
793 Ga0496107_0611552 3300048910 Bacteria 805
794 Ga0496108_0007173 3300048911 Bacteria 9033
795 Ga0496108_0011741 3300048911 Bacteria 7124
796 Ga0496108_0226900 3300048911 Bacteria 1623
797 Ga0496108_0295537 3300048911 Bacteria 1410
798 Ga0496108_1799845 3300048911 Bacteria 501
799 Ga0496109_0007077 3300048912 Bacteria 9468
800 Ga0496109_0024423 3300048912 Bacteria 5373
801 Ga0496109_0037304 3300048912 Bacteria 4392
802 Ga0496109_0208071 3300048912 Bacteria 1840
803 Ga0496109_0403962 3300048912 Bacteria 1290
804 Ga0496110_0006629 3300048913 Bacteria 9196
805 Ga0496110_0009205 3300048913 Bacteria 7980
806 Ga0496110_0026379 3300048913 Bacteria 4971
807 Ga0496110_0039980 3300048913 Bacteria 4086
808 Ga0496110_0077126 3300048913 Bacteria 2964
809 Ga0496110_0308662 3300048913 Bacteria 1441
810 Ga0496111_0002222 3300048914 Bacteria 11636
811 Ga0496111_0012669 3300048914 Bacteria 5714
812 Ga0496111_0042213 3300048914 Bacteria 3274
813 Ga0496111_0138442 3300048914 Bacteria 1803
814 Ga0496112_0013065 3300048915 Bacteria 7660
815 Ga0496112_0015540 3300048915 Bacteria 7108
816 Ga0496112_0238766 3300048915 Bacteria 1770
817 Ga0496112_0336732 3300048915 Bacteria 1452
818 Ga0496112_0348160 3300048915 Bacteria 1424
819 Ga0496112_0630340 3300048915 Bacteria 1003
820 Ga0496112_0675050 3300048915 Bacteria 962
821 Ga0496113_0032347 3300048916 Bacteria 3802
822 Ga0496113_0068854 3300048916 Bacteria 2686
823 Ga0496113_0075150 3300048916 Bacteria 2578
824 Ga0496113_0304407 3300048916 Bacteria 1276
825 Ga0496114_0009906 3300048917 Bacteria 7574
826 Ga0496114_0022098 3300048917 Bacteria 5181
827 Ga0496114_0071374 3300048917 Bacteria 2918
828 Ga0496114_0078738 3300048917 Bacteria 2781
829 Ga0496114_0370448 3300048917 Bacteria 1268
830 Ga0496115_0031021 3300048918 Bacteria 4210
831 Ga0496115_0096757 3300048918 Bacteria 2417
832 Ga0496115_0121241 3300048918 Bacteria 2152
833 Ga0496115_0129348 3300048918 Bacteria 2081
834 Ga0496115_0446711 3300048918 Bacteria 1045
835 Ga0496115_0613797 3300048918 Bacteria 863
836 Ga0496115_1072203 3300048918 Bacteria 612
837 Ga0496116_0017591 3300048919 Bacteria 5540
838 Ga0496117_0012573 3300048920 Bacteria 7446
839 Ga0496117_0016467 3300048920 Bacteria 6240
840 Ga0496117_0122349 3300048920 Bacteria 1596
841 Ga0496118_0000065 3300048921 Bacteria 211750
842 Ga0496118_0022961 3300048921 Bacteria 5435
843 Ga0496118_0248337 3300048921 Bacteria 1013
844 Ga0496120_0151662 3300048923 Bacteria 1164
845 Ga0496121_0009477 3300048924 Bacteria 11183
846 Ga0496121_0333113 3300048924 Bacteria 1017
847 Ga0496121_0472280 3300048924 Bacteria 803
848 Ga0496122_0000037 3300048925 Bacteria 304495
849 Ga0496122_0018370 3300048925 Bacteria 6468
850 Ga0496123_0000083 3300048926 Bacteria 188730
851 Ga0496123_0019013 3300048926 Bacteria 5428
852 Ga0496123_0123554 3300048926 Bacteria 1450
853 Ga0496124_0022270 3300048927 Bacteria 5814
854 Ga0496125_0064514 3300048928 Bacteria 2910
855 Ga0496125_0080260 3300048928 Bacteria 2497
856 Ga0496126_0027014 3300048929 Bacteria 5493
857 Ga0496126_0230540 3300048929 Bacteria 1552
858 Ga0496126_0326938 3300048929 Bacteria 1259
859 Ga0501292_002778 3300049515 Bacteria 2284
860 Ga0501293_029372 3300049516 Bacteria 581
861 Ga0501295_093728 3300049518 Bacteria 697
862 Ga0501298_004866 3300049521 Bacteria 2138
863 Ga0501301_047182 3300049524 Bacteria 504
864 Ga0501312_079694 3300049528 Bacteria 591
865 Ga0501031_0001171 3300049568 Bacteria 15946
866 Ga0501031_0148047 3300049568 Bacteria 1534
867 Ga0501032_0019455 3300049569 Bacteria 4750
868 Ga0501032_0041573 3300049569 Bacteria 3120
869 Ga0501032_0113849 3300049569 Bacteria 1789
870 Ga0501032_0262813 3300049569 Bacteria 1119
871 Ga0501032_0264790 3300049569 Bacteria 1114
872 Ga0501032_0301938 3300049569 Bacteria 1035
873 Ga0501032_0557083 3300049569 Bacteria 730
874 Ga0501033_0000119 3300049570 Bacteria 75685
875 Ga0501033_0001903 3300049570 Bacteria 18166
876 Ga0501033_0003250 3300049570 Bacteria 13453
877 Ga0501033_0010752 3300049570 Bacteria 7016
878 Ga0501033_0034779 3300049570 Bacteria 3777
879 Ga0501033_0102959 3300049570 Bacteria 2082
880 Ga0501033_0150000 3300049570 Bacteria 1682
881 Ga0501033_0437446 3300049570 Bacteria 910
882 Ga0501034_0003243 3300049571 Bacteria 18603
883 Ga0501034_0003757 3300049571 Bacteria 17152
884 Ga0501034_0010856 3300049571 Bacteria 9462
885 Ga0501034_0050141 3300049571 Bacteria 4210
886 Ga0501034_0157831 3300049571 Bacteria 2241
887 Ga0501034_0176854 3300049571 Bacteria 2100
888 Ga0501036_0031608 3300049572 Bacteria 4474
889 Ga0501036_0229796 3300049572 Bacteria 1557
890 Ga0501036_0409736 3300049572 Bacteria 1131
891 Ga0501036_0723676 3300049572 Bacteria 822
892 Ga0501037_0001095 3300049573 Bacteria 20074
893 Ga0501037_0001996 3300049573 Bacteria 14804
894 Ga0501037_0017927 3300049573 Bacteria 5210
895 Ga0501037_0022321 3300049573 Bacteria 4682
896 Ga0501037_0025177 3300049573 Bacteria 4397
897 Ga0501037_0130115 3300049573 Bacteria 1805
898 Ga0501037_0136727 3300049573 Bacteria 1755
899 Ga0501037_0140106 3300049573 Bacteria 1731
900 Ga0501037_0211043 3300049573 Bacteria 1369
901 Ga0501037_0257021 3300049573 Bacteria 1221
902 Ga0501037_0545061 3300049573 Bacteria 783
903 Ga0501038_0022260 3300049574 Bacteria 5680
904 Ga0501038_0029396 3300049574 Bacteria 4870
905 Ga0501038_0031724 3300049574 Bacteria 4667
906 Ga0501038_0080698 3300049574 Bacteria 2742
907 Ga0501038_0090850 3300049574 Bacteria 2558
908 Ga0501038_0173904 3300049574 Bacteria 1741
909 Ga0501038_0368466 3300049574 Bacteria 1116
910 Ga0501039_0004467 3300049575 Bacteria 10560
911 Ga0501039_0017922 3300049575 Bacteria 5431
912 Ga0501039_0951659 3300049575 Bacteria 668
913 Ga0501040_0001459 3300049576 Bacteria 14989
914 Ga0501040_0011183 3300049576 Bacteria 5870
915 Ga0501042_0017213 3300049578 Bacteria 4981
916 Ga0501042_0039489 3300049578 Bacteria 3354
917 Ga0501042_0169789 3300049578 Bacteria 1574
918 Ga0501042_0425308 3300049578 Bacteria 963
919 Ga0501043_0006122 3300049579 Bacteria 9661
920 Ga0501043_0126453 3300049579 Bacteria 2004
921 Ga0501043_0131240 3300049579 Bacteria 1963
922 Ga0501043_0207349 3300049579 Bacteria 1519
923 Ga0501043_0550178 3300049579 Bacteria 857
924 Ga0501043_0644042 3300049579 Bacteria 779
925 Ga0501046_0002502 3300049580 Bacteria 17209
926 Ga0501046_0006871 3300049580 Bacteria 10034
927 Ga0501046_0172929 3300049580 Bacteria 1619
928 Ga0501046_0339788 3300049580 Bacteria 1091
929 Ga0501046_0343290 3300049580 Bacteria 1085
930 Ga0501046_0420246 3300049580 Bacteria 964
931 Ga0501047_0068927 3300049581 Bacteria 3407
932 Ga0501047_0080356 3300049581 Bacteria 3133
933 Ga0501047_0119099 3300049581 Bacteria 2522
934 Ga0501047_0192642 3300049581 Bacteria 1901
935 Ga0501047_0285851 3300049581 Bacteria 1493
936 Ga0501047_0505263 3300049581 Bacteria 1035
937 Ga0501047_0912082 3300049581 Bacteria 692
938 Ga0501048_0000241 3300049582 Bacteria 36408
939 Ga0501048_0018845 3300049582 Bacteria 5073
940 Ga0501067_0003311 3300049583 Bacteria 8860
941 Ga0501068_0013520 3300049584 Bacteria 4646
942 Ga0501068_0031983 3300049584 Bacteria 3127
943 Ga0501068_0073524 3300049584 Bacteria 2088
944 Ga0501069_0001034 3300049585 Bacteria 13289
945 Ga0501070_0000428 3300049586 Bacteria 38253
946 Ga0501070_0007440 3300049586 Bacteria 9302
947 Ga0501070_0031950 3300049586 Bacteria 4409
948 Ga0501070_0036635 3300049586 Bacteria 4096
949 Ga0501070_0052474 3300049586 Bacteria 3384
950 Ga0501070_0053369 3300049586 Bacteria 3353
951 Ga0501070_1252289 3300049586 Bacteria 568
952 Ga0501071_0006335 3300049587 Bacteria 7675
953 Ga0501072_0007353 3300049588 Bacteria 8354
954 Ga0501072_0376802 3300049588 Bacteria 1126
955 Ga0501073_0002050 3300049589 Bacteria 15050
956 Ga0501073_0040357 3300049589 Bacteria 3303
957 Ga0501073_0049205 3300049589 Bacteria 2956
958 Ga0501073_0238679 3300049589 Bacteria 1255
959 Ga0501073_0439683 3300049589 Bacteria 901
960 Ga0501073_0549882 3300049589 Bacteria 798
961 Ga0501074_0002658 3300049590 Bacteria 12518
962 Ga0501074_0014200 3300049590 Bacteria 5793
963 Ga0501074_0062152 3300049590 Bacteria 2690
964 Ga0501074_0170458 3300049590 Bacteria 1554
965 Ga0501076_0359902 3300049592 Bacteria 1195
966 Ga0501076_1096234 3300049592 Bacteria 656
967 Ga0501077_0107621 3300049593 Bacteria 1767
968 Ga0501198_000051 3300049649 Bacteria 36831
969 Ga0501206_022387 3300049653 Bacteria 906
970 Ga0501206_043217 3300049653 Bacteria 700
971 Ga0501222_000007 3300049662 Bacteria 126703
972 Ga0501079_0000161 3300049741 Bacteria 37103
973 Ga0501079_0317914 3300049741 Bacteria 1219
974 Ga0501079_0408293 3300049741 Bacteria 1065
975 Ga0501080_0000936 3300049742 Bacteria 23861
976 Ga0501080_0004748 3300049742 Bacteria 12117
977 Ga0501080_0012677 3300049742 Bacteria 7730
978 Ga0501080_0214072 3300049742 Bacteria 1765
979 Ga0501080_0255937 3300049742 Bacteria 1596
980 Ga0501080_0309994 3300049742 Bacteria 1430
981 Ga0501080_1059994 3300049742 Bacteria 701
982 Ga0501081_0074979 3300049743 Bacteria 2361
983 Ga0501083_0003232 3300049744 Bacteria 11364
984 Ga0501262_002003 3300049759 Bacteria 2294
985 Ga0501265_001880 3300049762 Bacteria 2387
986 Ga0501035_0001977 3300049822 Bacteria 20520
987 Ga0501035_0003316 3300049822 Bacteria 15427
988 Ga0501035_0032433 3300049822 Bacteria 4752
989 Ga0501035_0204802 3300049822 Bacteria 1690
990 Ga0501035_0340231 3300049822 Bacteria 1257
991 Ga0501035_0489548 3300049822 Bacteria 1013
992 Ga0501035_0821460 3300049822 Bacteria 741
993 Ga0501035_0841184 3300049822 Bacteria 730
994 Ga0501044_0000093 3300049823 Bacteria 109832
995 Ga0501044_0013110 3300049823 Bacteria 8974
996 Ga0501044_0013845 3300049823 Bacteria 8719
997 Ga0501044_0056204 3300049823 Bacteria 4040
998 Ga0501044_0066979 3300049823 Bacteria 3659
999 Ga0501044_0088404 3300049823 Bacteria 3127
1000 Ga0501044_0098680 3300049823 Bacteria 2940
1001 Ga0501044_0102897 3300049823 Bacteria 2871
1002 Ga0501044_0137218 3300049823 Bacteria 2436
1003 Ga0501044_0154017 3300049823 Bacteria 2279
1004 Ga0501044_0247185 3300049823 Bacteria 1726
1005 Ga0501044_0384951 3300049823 Bacteria 1317
1006 Ga0501044_0723340 3300049823 Bacteria 879
1007 Ga0501045_0010011 3300049824 Bacteria 6631
1008 Ga0501045_0018784 3300049824 Bacteria 4920
1009 Ga0501045_0692039 3300049824 Bacteria 752
1010 nmdc:mga03n38_268446_c1 3300050490 Bacteria 907
1011 nmdc:mga00v17_405969_c1 3300050491 Bacteria 885
1012 nmdc:mga0yw44_494019_c1 3300050492 Bacteria 830
1013 nmdc:mga0k408_231895_c1 3300050493 Bacteria 1102
1014 nmdc:mga0k408_3923_c1 3300050493 Bacteria 7887
1015 nmdc:mga0k408_409795_c1 3300050493 Bacteria 806
1016 nmdc:mga0k408_432122_c1 3300050493 Bacteria 782
1017 nmdc:mga0k408_687952_c1 3300050493 Bacteria 600
1018 nmdc:mga0k408_77497_c1 3300050493 Bacteria 1944
1019 nmdc:mga06z11_9354_c1 3300050494 Bacteria 4128
1020 nmdc:mga04h51_11100_c1 3300050495 Bacteria 2492
1021 nmdc:mga07m45_566_c1 3300050496 Bacteria 15704
1022 nmdc:mga09592_695_c1 3300050508 Bacteria 25743
1023 nmdc:mga0qj67_37172_c1 3300050509 Bacteria 3813
1024 nmdc:mga06r32_607241_c1 3300050510 Bacteria 1064
1025 nmdc:mga08y16_22681_c1 3300050511 Bacteria 6628
1026 nmdc:mga0n895_1195261_c1 3300050512 Bacteria 734
1027 nmdc:mga0n895_514648_c1 3300050512 Bacteria 1205
1028 nmdc:mga0n895_978329_c1 3300050512 Bacteria 828
1029 nmdc:mga0rr50_114656_c1 3300050513 Bacteria 2137
1030 nmdc:mga0rr50_213045_c1 3300050513 Bacteria 1592
1031 nmdc:mga08x19_171003_c1 3300050514 Bacteria 1480
1032 nmdc:mga08x19_71321_c1 3300050514 Bacteria 2265
1033 Ga0495601_0111607 3300053077 Bacteria 1771
1034 Ga0495601_0239480 3300053077 Bacteria 1185
1035 Ga0495612_0105680 3300053078 Bacteria 1202
1036 Ga0495619_0158811 3300053085 Bacteria 1561
1037 Ga0500643_010278 3300053087 Bacteria 3496
1038 Ga0500643_011018 3300053087 Bacteria 3327
1039 Ga0500644_0162350 3300053088 Bacteria 904
1040 Ga0500651_0037846 3300053093 Bacteria 3040
1041 Ga0500651_0078326 3300053093 Bacteria 2050
1042 Ga0500593_212413 3300053117 Bacteria 688
1043 Ga0500594_0006885 3300053118 Bacteria 2562
1044 Ga0500597_000163 3300053120 Bacteria 13574
1045 Ga0500655_028976 3300053133 Bacteria 1061
1046 Ga0500559_0000109 3300053136 Bacteria 65246
1047 Ga0500561_0007598 3300053137 Bacteria 2120
1048 Ga0500568_0000488 3300053139 Bacteria 29209
1049 Ga0500622_0004240 3300053156 Bacteria 9119
1050 Ga0500645_073221 3300053730 Bacteria 982
1051 Ga0500587_009531 3300053739 Bacteria 1239
1052 Ga0501084_0024823 3300054114 Bacteria 5003
1053 Ga0501084_0120148 3300054114 Bacteria 2209
1054 Ga0590071_002496 3300059421 Bacteria 4628
1055 Ga0587073_0103746 3300059492 Bacteria 743
1056 Ga0587077_104311 3300059493 Bacteria 685
1057 Ga0587085_024358 3300059506 Bacteria 948
1058 Ga0587109_148500 3300059624 Bacteria 578
1059 Ga0587076_049623 3300059645 Bacteria 814
1060 Ga0587071_135435 3300060344 Bacteria 601
1061 Ga0501082_0000666 3300060353 Bacteria 30194
1062 Ga0501082_0013706 3300060353 Bacteria 6968
1063 Ga0501082_0166122 3300060353 Bacteria 1918
1064 Ga0501082_0689536 3300060353 Bacteria 894
1065 2510317718 2510065059 Bacteria 6847884
1066 2512963812 2512875024 Bacteria 7195110
1067 2514588476 2513237351 Bacteria 6968952
1068 2597812540 2597489875 Bacteria 7010078
1069 2644305769 2643221654 Bacteria 5273570
1070 2688599639 2687453392 Bacteria 6880454
1071 2841738540 2841734538 Bacteria 6784580
1072 2844014935 2844009547 Bacteria 6728125
1073 2856334161 2856328259 Bacteria 6528202
1074 2856341120 2856334872 Bacteria 7037011
1075 2856347063 2856342000 Bacteria 7176905
1076 2857371748 2857367948 Bacteria 6965560
1077 2869171325 2869169390 Bacteria 6659796
1078 2869236469 2869234852 Bacteria 6654993
1079 2869246102 2869242130 Bacteria 6609239
1080 2869255614 2869249662 Bacteria 6868783
1081 2869260854 2869256925 Bacteria 6981691
1082 2869265987 2869264136 Bacteria 6880765
1083 2869274575 2869271264 Bacteria 6908218
1084 2871436665 2871435913 Bacteria 6880295
1085 2871456951 2871451962 Bacteria 7336357
1086 2871466421 2871459585 Bacteria 6866887
1087 2871479880 2871474448 Bacteria 6806570
1088 2871483791 2871481445 Bacteria 6700002
1089 2874114305 2874109183 Bacteria 6517025
1090 2874117104 2874116593 Bacteria 6674494
1091 2874133570 2874131515 Bacteria 6820270
1092 2874164861 2874162495 Bacteria 6174670
1093 2876392629 2876386047 Bacteria 6698674
1094 2876406762 2876399893 Bacteria 6927900
1095 2876409857 2876406927 Bacteria 6191900
1096 2876426168 2876420981 Bacteria 6687741
1097 2878735147 2878730984 Bacteria 6380721
1098 2878778967 2878774303 Bacteria 6108671
1099 2878783484 2878781027 Bacteria 6834456
1100 2878788897 2878788777 Bacteria 6567085
1101 2888346496 2888343758 Bacteria 6611049
1102 2903514227 2903513507 Bacteria 6344008
1103 2906363519 2906363423 Bacteria 6856682
1104 2906371368 2906370794 Bacteria 6881062
1105 2906395538 2906393657 Bacteria 6790866
1106 2906401737 2906401398 Bacteria 6693206
1107 2906410768 2906408224 Bacteria 6162342
1108 2906432849 2906427513 Bacteria 6375796
1109 2922155997 2922151315 Bacteria 6902399
1110 2922177392 2922172374 Bacteria 6167644
1111 2922181394 2922178524 Bacteria 6025201
1112 2924711288 2924710171 Bacteria 6752351
1113 2924733746 2924733363 Bacteria 7574837
1114 2924741848 2924741084 Bacteria 6661321
1115 2924752325 2924748358 Bacteria 6154725
1116 2924761584 2924754689 Bacteria 6774424
1117 2937841822 2937836603 Bacteria 6811263
1118 2937866040 2937861824 Bacteria 6660327
1119 2937869027 2937868953 Bacteria 6639878
1120 2937983883 2937980651 Bacteria 6517427
1121 2958077838 2958071322 Bacteria 6815895
1122 2958111772 2958108152 Bacteria 6681128
1123 2958127236 2958122699 Bacteria 7280457
1124 2958138826 2958137437 Bacteria 6050276
1125 2958164636 2958158011 Bacteria 6058449
1126 2961140319 2961136820 Bacteria 6775228
1127 2961189470 2961183825 Bacteria 6688536
1128 2965027880 2965025482 Bacteria 6532201
1129 2965054889 2965047637 Bacteria 6623551
1130 2965091373 2965089291 Bacteria 6866420
1131 2965107713 2965102966 Bacteria 6800987
1132 2965114673 2965110997 Bacteria 6693150
1133 2968139276 2968138860 Bacteria 6605449
1134 2970490342 2970489779 Bacteria 6517260
1135 2970512916 2970510686 Bacteria 7006402
1136 2970528051 2970524798 Bacteria 6840927
1137 2970533690 2970532167 Bacteria 6553173
1138 2970541157 2970540015 Bacteria 6977556
1139 2970552847 2970547951 Bacteria 6931819
1140 2970622512 2970619444 Bacteria 6986144
1141 2970633326 2970627176 Bacteria 6680862
1142 2977851687 2977851361 Bacteria 6694324
1143 2977879200 2977872689 Bacteria 7270173
1144 2977905132 2977898635 Bacteria 6675551
1145 2977921136 2977915119 Bacteria 6829656
1146 2977936168 2977935797 Bacteria 6252826
1147 2977954773 2977950692 Bacteria 6893264
1148 2977961073 2977957713 Bacteria 6877875
1149 2979767460 2979764755 Bacteria 6610066
1150 2979774129 2979772303 Bacteria 6618277
1151 2979797586 2979793036 Bacteria 6808957
1152 2987646488 2987645492 Bacteria 6117018
1153 2987676876 2987673487 Bacteria 6884027
1154 2996314366 2996310559 Bacteria 6357320
1155 2996393180 2996386984 Bacteria 6978667
1156 3004197786 3004195979 Bacteria 6776956
1157 3004235520 3004232784 Bacteria 6662140
1158 3004247868 3004239961 Bacteria 6892290
1159 3004251761 3004248173 Bacteria 6563236
1160 3004274501 3004268573 Bacteria 7043476
1161 649874143 649633066 Bacteria 6690028
1162 8004302372 8004300914 Bacteria 6132239
1163 8004315974 8004312739 Bacteria 7444653
1164 8004363149 8004361976 Bacteria 6858373
1165 8004397613 8004395343 Bacteria 6620908
1166 8004634163 8004633249 Bacteria 6723080
1167 8004700102 8004695233 Bacteria 6731676
1168 8004731056 8004727605 Bacteria 6643904
1169 8055620167 8055617313 Bacteria 7548464
1170 Ga0075365_10480633
1171 JGI24736J21556_1007436
1172 JGI24740J21852_10100024
1173 JGI24739J22299_10016922
1174 JGI24735J21928_10002119
1175 Ga0055534_1004115
1176 Ga0058861_12066902
1177 Ga0058862_12526120
1178 Ga0065715_10032408
1179 Ga0065707_10000803
1180 Ga0070658_10925235
1181 Ga0070658_11557118
1182 Ga0070676_10017904
1183 Ga0070676_10075424
1184 Ga0070690_100050635
1185 Ga0070690_100250419
1186 Ga0070670_100006378
1187 Ga0070670_101289223
1188 Ga0068869_100068203
1189 Ga0068869_100441575
1190 Ga0068869_101057373
1191 Ga0068869_101523328
1192 Ga0070666_10001775
1193 Ga0070666_10004360
1194 Ga0070666_10043847
1195 Ga0070680_100404963
1196 Ga0070680_100813641
1197 Ga0070682_100144442
1198 Ga0068868_100104028
1199 Ga0068868_100196963
1200 Ga0068868_101091021
1201 Ga0070660_100277389
1202 Ga0070660_100295014
1203 Ga0070660_100560139
1204 Ga0070687_100125438
1205 Ga0070661_100260163
1206 Ga0070668_100019969
1207 Ga0070668_100236002
1208 Ga0070668_100491751
1209 Ga0070675_101036010
1210 Ga0070671_100180519
1211 Ga0070671_100583007
1212 Ga0070671_100663115
1213 Ga0070671_101911823
1214 Ga0070674_100183682
1215 Ga0070674_100400189
1216 Ga0070674_100411013
1217 Ga0070674_100660285
1218 Ga0070673_100138381
1219 Ga0070673_100445116
1220 Ga0070673_100647918
1221 Ga0070659_100018342
1222 Ga0070659_100939487
1223 Ga0070667_100000093
1224 Ga0070667_100015768
1225 Ga0070667_100030089
1226 Ga0070667_100037240
1227 Ga0070667_100135420
1228 Ga0070667_100178445
1229 Ga0070667_100656347
1230 Ga0070667_100714562
1231 Ga0070667_100988563
1232 Ga0070709_10036799
1233 Ga0070709_10662112
1234 Ga0070709_10811252
1235 Ga0070714_100012455
1236 Ga0070714_100017974
1237 Ga0070714_100209133
1238 Ga0070714_101712751
1239 Ga0070713_100000685
1240 Ga0070713_100006493
1241 Ga0070713_100168451
1242 Ga0070710_10022315
1243 Ga0070710_10082186
1244 Ga0070710_10256624
1245 Ga0070710_10316057
1246 Ga0070711_100013034
1247 Ga0070711_100076600
1248 Ga0070711_100191959
1249 Ga0070711_100207682
1250 Ga0070705_100380101
1251 Ga0070700_100039035
1252 Ga0070663_100000032
1253 Ga0070663_100026851
1254 Ga0070663_100044703
1255 Ga0070663_100427101
1256 Ga0070663_100515492
1257 Ga0070663_100603667
1258 Ga0070663_101116662
1259 Ga0070678_100031443
1260 Ga0070678_100173200
1261 Ga0070678_100228280
1262 Ga0070678_100304224
1263 Ga0070678_100314635
1264 Ga0070678_101610308
1265 Ga0070678_101958351
1266 Ga0070662_100024585
1267 Ga0070662_100291348
1268 Ga0070681_10003267
1269 Ga0070681_10011892
1270 Ga0070681_10927157
1271 Ga0068867_100005073
1272 Ga0068867_100051842
1273 Ga0068867_100132254
1274 Ga0068867_100434831
1275 Ga0068867_101758870
1276 Ga0070685_11003596
1277 Ga0070707_101962369
1278 Ga0070679_100057111
1279 Ga0070679_100235803
1280 Ga0070679_101687356
1281 Ga0070684_100410922
1282 Ga0068853_100004507
1283 Ga0068853_100027988
1284 Ga0068853_100366376
1285 Ga0068853_100384769
1286 Ga0068853_101344825
1287 Ga0068853_101592476
1288 Ga0070672_100007230
1289 Ga0070672_100063532
1290 Ga0070672_100942088
1291 Ga0070672_101064120
1292 Ga0070686_100067137
1293 Ga0070695_100405074
1294 Ga0070696_100500481
1295 Ga0070693_100031554
1296 Ga0070693_100299072
1297 Ga0070665_100000065
1298 Ga0070665_100013533
1299 Ga0070665_100021742
1300 Ga0070665_100024362
1301 Ga0070665_100033044
1302 Ga0070665_100071381
1303 Ga0070665_100089749
1304 Ga0070665_100418351
1305 Ga0070665_100553541
1306 Ga0070665_100940453
1307 Ga0070665_100961378
1308 Ga0070665_101585939
1309 Ga0070704_100570899
1310 Ga0068855_100042304
1311 Ga0068855_100347684
1312 Ga0068855_100670190
1313 Ga0068855_101097669
1314 Ga0070664_100462330
1315 Ga0068854_100096521
1316 Ga0068856_100146118
1317 Ga0068856_100294116
1318 Ga0068856_100431063
1319 Ga0068856_100453433
1320 Ga0068856_100566740
1321 Ga0068856_101090544
1322 Ga0068856_101434808
1323 Ga0068856_101769711
1324 Ga0068852_100037728
1325 Ga0068852_100071507
1326 Ga0068852_100256278
1327 Ga0068852_101492301
1328 Ga0068859_100000070
1329 Ga0068859_100224705
1330 Ga0068859_100825600
1331 Ga0068859_101248223
1332 Ga0068864_100954493
1333 Ga0068864_101199439
1334 Ga0068864_101841010
1335 Ga0068866_10062250
1336 Ga0068861_100003543
1337 Ga0068861_100009492
1338 Ga0068851_10018980
1339 Ga0068851_10871204
1340 Ga0068863_100196184
1341 Ga0068863_100242827
1342 Ga0068863_100391841
1343 Ga0068863_100404990
1344 Ga0068863_100563235
1345 Ga0068858_100003907
1346 Ga0068858_100015311
1347 Ga0068858_100130761
1348 Ga0068858_100465824
1349 Ga0068860_100002268
1350 Ga0068860_100062495
1351 Ga0068860_100315074
1352 Ga0068860_100712708
1353 Ga0068862_100000041
1354 Ga0068862_100039926
1355 Ga0068862_100083515
1356 Ga0068862_100845412
1357 Ga0068862_101266828
1358 Ga0081455_10080955
1359 Ga0081455_10121862
1360 Ga0081540_1011727
1361 Ga0081540_1015034
1362 Ga0070717_10000814
1363 Ga0070717_10124938
1364 Ga0075368_10154105
1365 Ga0075363_100031120
1366 Ga0075364_10169639
1367 Ga0070715_10007032
1368 Ga0070715_10299341
1369 Ga0070715_10627156
1370 Ga0070715_11071613
1371 Ga0070716_100017024
1372 Ga0070716_100029503
1373 Ga0070716_101684933
1374 Ga0070712_100009205
1375 Ga0070712_100018789
1376 Ga0070712_100099596
1377 Ga0070712_100240266
1378 Ga0075367_10143760
1379 Ga0075366_10026333
1380 Ga0075366_10138130
1381 Ga0075366_10256786
1382 Ga0075366_10319170
1383 Ga0075366_10380523
1384 Ga0075366_10511477
1385 Ga0097621_100046041
1386 Ga0097621_100267826
1387 Ga0097621_100542722
1388 Ga0097621_100584282
1389 Ga0097621_101251852
1390 Ga0075370_10000125
1391 Ga0068871_100122204
1392 Ga0068871_100234885
1393 Ga0068871_100386708
1394 Ga0068871_100497282
1395 Ga0068871_101009652
1396 Ga0068871_101074246
1397 Ga0068871_101489570
1398 Ga0075428_100380664
1399 Ga0075430_100046015
1400 Ga0075434_100515446
1401 Ga0075434_101050381
1402 Ga0075429_100004520
1403 Ga0068865_100014391
1404 Ga0068865_100047454
1405 Ga0068865_100123750
1406 Ga0068865_100308774
1407 Ga0068865_101286169
1408 Ga0075436_100024062
1409 Ga0075436_100099007
1410 Ga0097620_100000070
1411 Ga0097620_100224701
1412 Ga0097620_100825600
1413 Ga0097620_101248241
1414 Ga0075435_100388011
1415 Ga0075435_100536029
1416 Ga0099795_10000192
1417 Ga0105244_10009239
1418 Ga0105250_10038856
1419 Ga0105250_10116508
1420 Ga0105240_10013944
1421 Ga0105240_10287177
1422 Ga0111539_10057983
1423 Ga0111539_10139972
1424 Ga0105245_10002177
1425 Ga0105245_10265585
1426 Ga0105245_10597262
1427 Ga0105247_10003807
1428 Ga0105247_10121477
1429 Ga0105247_10373498
1430 Ga0105247_10498343
1431 Ga0105243_10044965
1432 Ga0105243_10129905
1433 Ga0105243_10375202
1434 Ga0105241_10009761
1435 Ga0105241_10099570
1436 Ga0105241_10360243
1437 Ga0105241_10503864
1438 Ga0105241_11022523
1439 Ga0105242_10002301
1440 Ga0105242_10004392
1441 Ga0105242_10436943
1442 Ga0105242_10635332
1443 Ga0105242_11909669
1444 Ga0105242_11989660
1445 Ga0105248_10002111
1446 Ga0105248_10038865
1447 Ga0105248_10473001
1448 Ga0105248_10508775
1449 Ga0105248_10552277
1450 Ga0105248_10678870
1451 Ga0105248_10820021
1452 Ga0105237_10016690
1453 Ga0105237_10146176
1454 Ga0105237_10311568
1455 Ga0105237_10703642
1456 Ga0105237_11482502
1457 Ga0105238_10062185
1458 Ga0105238_10303444
1459 Ga0105238_10333358
1460 Ga0105238_10758448
1461 Ga0105238_11266315
1462 Ga0105249_10000394
1463 Ga0105249_10028985
1464 Ga0105249_10889331
1465 Ga0105249_11470458
1466 Ga0099796_10000158
1467 Ga0105239_10057725
1468 Ga0105239_10115296
1469 Ga0105239_10345479
1470 Ga0105239_10448529
1471 Ga0105239_10759839
1472 Ga0105239_10927649
1473 Ga0105239_12533388
1474 Ga0105246_10050555
1475 Ga0105246_10796713
1476 Ga0157327_1003260
1477 Ga0157373_10123963
1478 Ga0157373_10149500
1479 Ga0157371_11003566
1480 Ga0157370_10111268
1481 Ga0157370_10112382
1482 Ga0157370_10836613
1483 Ga0157369_10392167
1484 Ga0157369_10830659
1485 Ga0157374_10008134
1486 Ga0157374_10008293
1487 Ga0157374_10064875
1488 Ga0157374_10269835
1489 Ga0157374_10704962
1490 Ga0157374_12659743
1491 Ga0157378_10001565
1492 Ga0157378_10004721
1493 Ga0157378_10293254
1494 Ga0157378_10863564
1495 Ga0163162_10029905
1496 Ga0163162_10172753
1497 Ga0163162_10453435
1498 Ga0163162_10488736
1499 Ga0163162_10629544
1500 Ga0163162_11204204
1501 Ga0163162_12130504
1502 Ga0157372_10059970
1503 Ga0157372_10397688
1504 Ga0157375_10000948
1505 Ga0157375_10074252
1506 Ga0157375_10343217
1507 Ga0157375_10489604
1508 Ga0157375_10765112
1509 Ga0163163_10026109
1510 Ga0163163_10041754
1511 Ga0163163_10159059
1512 Ga0163163_10311885
1513 Ga0163163_11023989
1514 Ga0163163_11986717
1515 Ga0157380_10032011
1516 Ga0157380_10742773
1517 Ga0157380_11312766
1518 Ga0182008_10151380
1519 Ga0157379_10077258
1520 Ga0157379_10336291
1521 Ga0157379_10372351
1522 Ga0157379_10820234
1523 Ga0157376_10014847
1524 Ga0157376_10148780
1525 Ga0157376_10153728
1526 Ga0157376_10643819
1527 Ga0157376_10709419
1528 Ga0157376_10713645
1529 Ga0157376_11042362
1530 Ga0163161_10156287
1531 Ga0163161_10377699
1532 Ga0163161_10913340
1533 Ga0206356_10568014
1534 Ga0207427_100158
1535 Ga0209130_1003425
1536 Ga0209675_1006592
1537 Ga0209676_1010982
1538 Ga0209025_1067864
1539 Ga0209564_1027276
1540 Ga0209050_1062310
1541 Ga0207426_1002416
1542 Ga0209051_1009603
1543 Ga0209051_1039391
1544 Ga0209051_1046380
1545 Ga0209257_1102878
1546 Ga0207697_10182817
1547 Ga0207656_10007225
1548 Ga0207713_1005978
1549 Ga0207692_10235097
1550 Ga0207692_10761859
1551 Ga0207642_10048391
1552 Ga0207642_10166567
1553 Ga0207710_10065981
1554 Ga0207688_10517267
1555 Ga0207680_10012058
1556 Ga0207680_10031290
1557 Ga0207680_10094061
1558 Ga0207680_10579696
1559 Ga0207680_10589432
1560 Ga0207680_10718197
1561 Ga0207647_10000023
1562 Ga0207685_10013506
1563 Ga0207685_10514333
1564 Ga0207685_10578114
1565 Ga0207699_10059384
1566 Ga0207645_10041741
1567 Ga0207645_10076851
1568 Ga0207705_10914426
1569 Ga0207654_10016769
1570 Ga0207654_10019088
1571 Ga0207654_10078914
1572 Ga0207654_10640961
1573 Ga0207707_10002957
1574 Ga0207707_10043393
1575 Ga0207707_10987409
1576 Ga0207695_10010030
1577 Ga0207695_10081843
1578 Ga0207695_10104708
1579 Ga0207695_10158019
1580 Ga0207671_10000929
1581 Ga0207671_10011778
1582 Ga0207671_10100850
1583 Ga0207671_10585154
1584 Ga0207693_10001689
1585 Ga0207693_10026865
1586 Ga0207693_10514204
1587 Ga0207663_10025632
1588 Ga0207663_10083792
1589 Ga0207663_10208455
1590 Ga0207663_10467677
1591 Ga0207660_10719809
1592 Ga0207660_11108272
1593 Ga0207662_10326671
1594 Ga0207657_10145429
1595 Ga0207649_10462676
1596 Ga0207649_10679841
1597 Ga0207649_10817584
1598 Ga0207652_10054792
1599 Ga0207681_10081260
1600 Ga0207681_10084547
1601 Ga0207681_10440498
1602 Ga0207681_10542115
1603 Ga0207694_10414659
1604 Ga0207650_10024055
1605 Ga0207650_10242540
1606 Ga0207687_10037950
1607 Ga0207687_10853595
1608 Ga0207700_10088146
1609 Ga0207700_10153328
1610 Ga0207700_10197190
1611 Ga0207664_10037381
1612 Ga0207664_10100991
1613 Ga0207664_10374008
1614 Ga0207644_10105748
1615 Ga0207644_10145853
1616 Ga0207644_10231254
1617 Ga0207690_10087522
1618 Ga0207690_11594588
1619 Ga0207706_10002543
1620 Ga0207706_10092120
1621 Ga0207706_10506427
1622 Ga0207686_10147050
1623 Ga0207686_10280585
1624 Ga0207686_10689411
1625 Ga0207686_10994451
1626 Ga0207709_10149103
1627 Ga0207669_10143318
1628 Ga0207669_10861237
1629 Ga0207704_10048960
1630 Ga0207704_10061757
1631 Ga0207704_10166441
1632 Ga0207665_10001560
1633 Ga0207665_10013681
1634 Ga0207691_10013978
1635 Ga0207711_10001156
1636 Ga0207711_10217817
1637 Ga0207711_10244437
1638 Ga0207711_10358182
1639 Ga0207689_10110716
1640 Ga0207689_10130815
1641 Ga0207689_10324490
1642 Ga0207689_10351873
1643 Ga0207689_10985436
1644 Ga0207679_10394142
1645 Ga0207679_10497371
1646 Ga0207679_10839500
1647 Ga0207667_10338935
1648 Ga0207651_10197611
1649 Ga0207651_10639864
1650 Ga0207712_10000228
1651 Ga0207712_10000345
1652 Ga0207712_10893126
1653 Ga0207712_10967274
1654 Ga0207668_10041101
1655 Ga0207668_10311917
1656 Ga0207640_10095297
1657 Ga0207658_10000020
1658 Ga0207658_10019220
1659 Ga0207658_10057948
1660 Ga0207658_10128742
1661 Ga0207658_10168481
1662 Ga0207658_10208875
1663 Ga0207658_10457342
1664 Ga0207658_10854596
1665 Ga0207658_11019182
1666 Ga0207658_11414647
1667 Ga0207677_10217653
1668 Ga0207677_10289434
1669 Ga0207677_10337959
1670 Ga0207677_10429316
1671 Ga0207677_10566905
1672 Ga0207703_10002854
1673 Ga0207703_10102252
1674 Ga0207703_10205502
1675 Ga0207703_11244141
1676 Ga0207703_11676247
1677 Ga0207639_10000405
1678 Ga0207639_10026683
1679 Ga0207639_10190287
1680 Ga0207639_10337375
1681 Ga0207639_10339752
1682 Ga0207639_10342494
1683 Ga0207639_10394079
1684 Ga0207678_10000010
1685 Ga0207678_10013505
1686 Ga0207678_11342139
1687 Ga0207708_10009588
1688 Ga0207702_10057451
1689 Ga0207702_10206754
1690 Ga0207702_10334280
1691 Ga0207702_10469533
1692 Ga0207702_10916315
1693 Ga0207702_12213726
1694 Ga0207641_10113987
1695 Ga0207641_10142348
1696 Ga0207641_10610878
1697 Ga0207641_10710383
1698 Ga0207641_10774288
1699 Ga0207648_10001067
1700 Ga0207648_10030844
1701 Ga0207648_10044786
1702 Ga0207648_10083622
1703 Ga0207676_10189897
1704 Ga0207676_10306071
1705 Ga0207676_10635479
1706 Ga0207674_11219568
1707 Ga0207675_100000393
1708 Ga0207675_100010527
1709 Ga0207675_101366704
1710 Ga0207683_10103520
1711 Ga0207683_10104979
1712 Ga0207683_10207272
1713 Ga0207683_10226302
1714 Ga0207683_10309386
1715 Ga0207698_10234682
1716 Ga0207698_10536126
1717 Ga0207698_11145356
1718 Ga0207698_11387585
1719 Ga0209179_1017778
1720 Ga0209813_10008637
1721 Ga0207428_10382011
1722 Ga0268266_10000001
1723 Ga0268266_10000013
1724 Ga0268266_10052426
1725 Ga0268266_10155888
1726 Ga0268266_10562249
1727 Ga0268266_10593665
1728 Ga0268265_10000137
1729 Ga0268265_10018829
1730 Ga0268265_10036752
1731 Ga0268265_10084184
1732 Ga0268265_11990173
1733 Ga0268264_10001497
1734 Ga0268264_10468084
1735 Ga0268264_10809535
1736 Ga0265326_10023708
1737 Ga0265319_1011783
1738 Ga0265334_10000686
1739 Ga0265318_10002965
1740 Ga0307517_10049020
1741 Ga0307515_10000030
1742 Ga0307515_10176759
1743 Ga0265338_10009041
1744 Ga0265338_10132868
1745 Ga0265767_101674
1746 Ga0265769_110927
1747 Ga0265330_10072924
1748 Ga0265332_10056646
1749 Ga0265328_10070910
1750 Ga0265320_10020389
1751 Ga0265325_10043888
1752 Ga0265340_10151579
1753 Ga0265331_10005291
1754 Ga0265331_10007111
1755 Ga0265331_10080610
1756 Ga0265327_10000217
1757 Ga0265327_10000923
1758 Ga0265316_10197716
1759 Ga0307513_10037093
1760 Ga0307513_10623189
1761 Ga0307509_10251736
1762 Ga0307509_10512826
1763 Ga0307509_10621751
1764 Ga0307408_100159070
1765 Ga0307408_100281305
1766 Ga0307408_100742666
1767 Ga0307408_101092041
1768 Ga0265313_10013741
1769 Ga0316575_10023148
1770 Ga0316579_10000335
1771 Ga0316579_10036051
1772 Ga0316579_10056016
1773 Ga0265314_10046888
1774 Ga0265342_10025329
1775 Ga0316576_10501143
1776 Ga0316578_10005901
1777 Ga0316578_10123723
1778 Ga0307516_10008706
1779 Ga0307516_10192768
1780 Ga0316577_10290875
1781 Ga0307413_10690716
1782 Ga0307413_11018302
1783 Ga0307413_11084135
1784 Ga0307410_10269118
1785 Ga0307410_10580325
1786 Ga0307410_10868954
1787 Ga0307412_10380154
1788 Ga0307412_10577018
1789 Ga0307412_11502820
1790 Ga0307414_10073307
1791 Ga0307414_10603819
1792 Ga0307414_11985021
1793 Ga0307411_10376212
1794 Ga0307411_10741296
1795 Ga0307415_100800222
1796 Ga0316583_10012201
1797 Ga0316583_10019818
1798 Ga0307507_10166340
1799 Ga0307510_10014225
1800 Ga0373923_0169290
1801 Ga0373923_0279400
1802 Ga0373923_0381825
1803 Ga0373936_0049743
1804 Ga0373936_0122300
1805 Ga0373939_0312432
1806 Ga0373945_0075432
1807 Ga0373957_0100589
1808 Ga0373957_0292915
1809 Ga0373943_0169191
1810 Ga0373943_0404926
1811 Ga0373946_0116842
1812 Ga0373946_0138135
1813 Ga0373955_0015873
1814 Ga0316574_0018381
1815 Ga0373924_0414075
1816 Ga0373931_0240633
1817 Ga0373935_1316134
1818 Ga0373927_0008876
1819 Ga0373927_0008998
1820 Ga0373933_0137840
1821 Ga0373933_0759234
1822 Ga0373937_0007789
1823 Ga0373937_0044059
1824 Ga0373937_0226658
1825 Ga0373937_0354444
1826 Ga0316582_0131502
1827 Ga0316584_0002853
1828 Ga0316584_1137019
1829 Ga0373925_0019765
1830 Ga0373925_0297118
1831 Ga0395899_0160092
1832 Ga0395900_0062240
1833 Ga0395900_0529314
1834 Ga0395905_0091825
1835 Ga0395905_0321319
1836 Ga0395905_0814794
1837 Ga0316581_0113039
1838 Ga0395901_0592085
1839 Ga0400485_20664
1840 Ga0400486_05964
1841 Ga0400486_24080
1842 Ga0400487_64253
1843 Ga0436363_1408620
1844 Ga0436363_1696509
1845 Ga0439436_0193526
1846 Ga0439461_0054247
1847 Ga0439465_0179017
1848 Ga0451787_090787
1849 Ga0451789_0077899
1850 Ga0451789_0844787
1851 Ga0451791_1373322
1852 Ga0451793_0165339
1853 Ga0451793_0173052
1854 Ga0451793_1258784
1855 Ga0451795_1351381
1856 Ga0451800_1428091
1857 Ga0451804_0833077
1858 Ga0451807_2726366
1859 Ga0451835_0574946
1860 Ga0451841_1204341
1861 Ga0451847_0397701
1862 Ga0451851_0422575
1863 Ga0451851_1233695
1864 Ga0451843_1018122
1865 Ga0451853_0843378
1866 Ga0439462_0083638
1867 Ga0450893_0018963
1868 Ga0451577_0093636
1869 Ga0451577_0324788
1870 Ga0451577_1539865
1871 Ga0453684_0003473
1872 Ga0453684_0214192
1873 Ga0453684_1426442
1874 Ga0451576_0529544
1875 Ga0451576_0834716
1876 Ga0466967_0320759
1877 Ga0466967_0329752
1878 Ga0466967_0430551
1879 Ga0495603_0607818
1880 Ga0495590_0002486
1881 Ga0495629_0380930
1882 Ga0495629_0630211
1883 Ga0495638_0061927
1884 Ga0495641_0194236
1885 Ga0495650_0007591
1886 Ga0495650_0031451
1887 Ga0495650_0092512
1888 Ga0495580_0000952
1889 Ga0495580_0107786
1890 Ga0495582_0006801
1891 Ga0495639_0053130
1892 Ga0495664_0116619
1893 Ga0495596_0329117
1894 Ga0495583_0168485
1895 Ga0495608_0193354
1896 Ga0495618_0595548
1897 Ga0495620_0012529
1898 Ga0495620_0026015
1899 Ga0495630_0345860
1900 Ga0495642_0515727
1901 Ga0495652_1012914
1902 Ga0495665_0130413
1903 Ga0495587_0370021
1904 Ga0495597_0012789
1905 Ga0495645_0200776
1906 Ga0495645_0258893
1907 Ga0495667_0286764
1908 Ga0495656_0001865
1909 Ga0495625_0386740
1910 Ga0495657_0647518
1911 Ga0495599_0204334
1912 Ga0495646_0195434
1913 Ga0495647_0163002
1914 Ga0495647_0216957
1915 Ga0495658_0021327
1916 Ga0495624_0297296
1917 Ga0495660_0146296
1918 Ga0495581_0079163
1919 Ga0495581_0261624
1920 Ga0495674_0243093
1921 Ga0495674_0356455
1922 Ga0495683_0005445
1923 Ga0495687_066428
1924 Ga0495686_0023221
1925 Ga0495602_0125516
1926 Ga0495602_0192246
1927 Ga0495626_0039747
1928 Ga0496100_0017862
1929 Ga0496100_0061986
1930 Ga0496100_0174448
1931 Ga0496100_0191056
1932 Ga0496101_0006111
1933 Ga0496101_0059923
1934 Ga0496101_0067611
1935 Ga0496101_0070758
1936 Ga0496101_0494880
1937 Ga0496101_1137070
1938 Ga0496102_0017184
1939 Ga0496102_0091734
1940 Ga0496102_0152454
1941 Ga0496102_0340311
1942 Ga0496103_0005415
1943 Ga0496103_0027159
1944 Ga0496103_0096419
1945 Ga0496104_0056562
1946 Ga0496104_0292031
1947 Ga0496104_0558598
1948 Ga0496104_0581398
1949 Ga0496104_0889711
1950 Ga0496104_0906569
1951 Ga0496105_0000080
1952 Ga0496105_0010228
1953 Ga0496105_0142394
1954 Ga0496105_0305285
1955 Ga0496105_1144733
1956 Ga0496106_0017058
1957 Ga0496106_0063569
1958 Ga0496106_0064017
1959 Ga0496107_0002917
1960 Ga0496107_0009091
1961 Ga0496107_0015412
1962 Ga0496107_0611552
1963 Ga0496108_0007173
1964 Ga0496108_0011741
1965 Ga0496108_0226900
1966 Ga0496108_0295537
1967 Ga0496108_1799845
1968 Ga0496109_0007077
1969 Ga0496109_0024423
1970 Ga0496109_0037304
1971 Ga0496109_0208071
1972 Ga0496109_0403962
1973 Ga0496110_0006629
1974 Ga0496110_0009205
1975 Ga0496110_0026379
1976 Ga0496110_0039980
1977 Ga0496110_0077126
1978 Ga0496110_0308662
1979 Ga0496111_0002222
1980 Ga0496111_0012669
1981 Ga0496111_0042213
1982 Ga0496111_0138442
1983 Ga0496112_0013065
1984 Ga0496112_0015540
1985 Ga0496112_0238766
1986 Ga0496112_0336732
1987 Ga0496112_0348160
1988 Ga0496112_0630340
1989 Ga0496112_0675050
1990 Ga0496113_0032347
1991 Ga0496113_0068854
1992 Ga0496113_0075150
1993 Ga0496113_0304407
1994 Ga0496114_0009906
1995 Ga0496114_0022098
1996 Ga0496114_0071374
1997 Ga0496114_0078738
1998 Ga0496114_0370448
1999 Ga0496115_0031021
2000 Ga0496115_0096757
2001 Ga0496115_0121241
2002 Ga0496115_0129348
2003 Ga0496115_0446711
2004 Ga0496115_0613797
2005 Ga0496115_1072203
2006 Ga0496116_0017591
2007 Ga0496117_0012573
2008 Ga0496117_0016467
2009 Ga0496117_0122349
2010 Ga0496118_0000065
2011 Ga0496118_0022961
2012 Ga0496118_0248337
2013 Ga0496120_0151662
2014 Ga0496121_0009477
2015 Ga0496121_0333113
2016 Ga0496121_0472280
2017 Ga0496122_0000037
2018 Ga0496122_0018370
2019 Ga0496123_0000083
2020 Ga0496123_0019013
2021 Ga0496123_0123554
2022 Ga0496124_0022270
2023 Ga0496125_0064514
2024 Ga0496125_0080260
2025 Ga0496126_0027014
2026 Ga0496126_0230540
2027 Ga0496126_0326938
2028 Ga0501292_002778
2029 Ga0501293_029372
2030 Ga0501295_093728
2031 Ga0501298_004866
2032 Ga0501301_047182
2033 Ga0501312_079694
2034 Ga0501031_0001171
2035 Ga0501031_0148047
2036 Ga0501032_0019455
2037 Ga0501032_0041573
2038 Ga0501032_0113849
2039 Ga0501032_0262813
2040 Ga0501032_0264790
2041 Ga0501032_0301938
2042 Ga0501032_0557083
2043 Ga0501033_0000119
2044 Ga0501033_0001903
2045 Ga0501033_0003250
2046 Ga0501033_0010752
2047 Ga0501033_0034779
2048 Ga0501033_0102959
2049 Ga0501033_0150000
2050 Ga0501033_0437446
2051 Ga0501034_0003243
2052 Ga0501034_0003757
2053 Ga0501034_0010856
2054 Ga0501034_0050141
2055 Ga0501034_0157831
2056 Ga0501034_0176854
2057 Ga0501036_0031608
2058 Ga0501036_0229796
2059 Ga0501036_0409736
2060 Ga0501036_0723676
2061 Ga0501037_0001095
2062 Ga0501037_0001996
2063 Ga0501037_0017927
2064 Ga0501037_0022321
2065 Ga0501037_0025177
2066 Ga0501037_0130115
2067 Ga0501037_0136727
2068 Ga0501037_0140106
2069 Ga0501037_0211043
2070 Ga0501037_0257021
2071 Ga0501037_0545061
2072 Ga0501038_0022260
2073 Ga0501038_0029396
2074 Ga0501038_0031724
2075 Ga0501038_0080698
2076 Ga0501038_0090850
2077 Ga0501038_0173904
2078 Ga0501038_0368466
2079 Ga0501039_0004467
2080 Ga0501039_0017922
2081 Ga0501039_0951659
2082 Ga0501040_0001459
2083 Ga0501040_0011183
2084 Ga0501042_0017213
2085 Ga0501042_0039489
2086 Ga0501042_0169789
2087 Ga0501042_0425308
2088 Ga0501043_0006122
2089 Ga0501043_0126453
2090 Ga0501043_0131240
2091 Ga0501043_0207349
2092 Ga0501043_0550178
2093 Ga0501043_0644042
2094 Ga0501046_0002502
2095 Ga0501046_0006871
2096 Ga0501046_0172929
2097 Ga0501046_0339788
2098 Ga0501046_0343290
2099 Ga0501046_0420246
2100 Ga0501047_0068927
2101 Ga0501047_0080356
2102 Ga0501047_0119099
2103 Ga0501047_0192642
2104 Ga0501047_0285851
2105 Ga0501047_0505263
2106 Ga0501047_0912082
2107 Ga0501048_0000241
2108 Ga0501048_0018845
2109 Ga0501067_0003311
2110 Ga0501068_0013520
2111 Ga0501068_0031983
2112 Ga0501068_0073524
2113 Ga0501069_0001034
2114 Ga0501070_0000428
2115 Ga0501070_0007440
2116 Ga0501070_0031950
2117 Ga0501070_0036635
2118 Ga0501070_0052474
2119 Ga0501070_0053369
2120 Ga0501070_1252289
2121 Ga0501071_0006335
2122 Ga0501072_0007353
2123 Ga0501072_0376802
2124 Ga0501073_0002050
2125 Ga0501073_0040357
2126 Ga0501073_0049205
2127 Ga0501073_0238679
2128 Ga0501073_0439683
2129 Ga0501073_0549882
2130 Ga0501074_0002658
2131 Ga0501074_0014200
2132 Ga0501074_0062152
2133 Ga0501074_0170458
2134 Ga0501076_0359902
2135 Ga0501076_1096234
2136 Ga0501077_0107621
2137 Ga0501198_000051
2138 Ga0501206_022387
2139 Ga0501206_043217
2140 Ga0501222_000007
2141 Ga0501079_0000161
2142 Ga0501079_0317914
2143 Ga0501079_0408293
2144 Ga0501080_0000936
2145 Ga0501080_0004748
2146 Ga0501080_0012677
2147 Ga0501080_0214072
2148 Ga0501080_0255937
2149 Ga0501080_0309994
2150 Ga0501080_1059994
2151 Ga0501081_0074979
2152 Ga0501083_0003232
2153 Ga0501262_002003
2154 Ga0501265_001880
2155 Ga0501035_0001977
2156 Ga0501035_0003316
2157 Ga0501035_0032433
2158 Ga0501035_0204802
2159 Ga0501035_0340231
2160 Ga0501035_0489548
2161 Ga0501035_0821460
2162 Ga0501035_0841184
2163 Ga0501044_0000093
2164 Ga0501044_0013110
2165 Ga0501044_0013845
2166 Ga0501044_0056204
2167 Ga0501044_0066979
2168 Ga0501044_0088404
2169 Ga0501044_0098680
2170 Ga0501044_0102897
2171 Ga0501044_0137218
2172 Ga0501044_0154017
2173 Ga0501044_0247185
2174 Ga0501044_0384951
2175 Ga0501044_0723340
2176 Ga0501045_0010011
2177 Ga0501045_0018784
2178 Ga0501045_0692039
2179 nmdc:mga03n38_268446_c1
2180 nmdc:mga00v17_405969_c1
2181 nmdc:mga0yw44_494019_c1
2182 nmdc:mga0k408_231895_c1
2183 nmdc:mga0k408_3923_c1
2184 nmdc:mga0k408_409795_c1
2185 nmdc:mga0k408_432122_c1
2186 nmdc:mga0k408_687952_c1
2187 nmdc:mga0k408_77497_c1
2188 nmdc:mga06z11_9354_c1
2189 nmdc:mga04h51_11100_c1
2190 nmdc:mga07m45_566_c1
2191 nmdc:mga09592_695_c1
2192 nmdc:mga0qj67_37172_c1
2193 nmdc:mga06r32_607241_c1
2194 nmdc:mga08y16_22681_c1
2195 nmdc:mga0n895_1195261_c1
2196 nmdc:mga0n895_514648_c1
2197 nmdc:mga0n895_978329_c1
2198 nmdc:mga0rr50_114656_c1
2199 nmdc:mga0rr50_213045_c1
2200 nmdc:mga08x19_171003_c1
2201 nmdc:mga08x19_71321_c1
2202 Ga0495601_0111607
2203 Ga0495601_0239480
2204 Ga0495612_0105680
2205 Ga0495619_0158811
2206 Ga0500643_010278
2207 Ga0500643_011018
2208 Ga0500644_0162350
2209 Ga0500651_0037846
2210 Ga0500651_0078326
2211 Ga0500593_212413
2212 Ga0500594_0006885
2213 Ga0500597_000163
2214 Ga0500655_028976
2215 Ga0500559_0000109
2216 Ga0500561_0007598
2217 Ga0500568_0000488
2218 Ga0500622_0004240
2219 Ga0500645_073221
2220 Ga0500587_009531
2221 Ga0501084_0024823
2222 Ga0501084_0120148
2223 Ga0590071_002496
2224 Ga0587073_0103746
2225 Ga0587077_104311
2226 Ga0587085_024358
2227 Ga0587109_148500
2228 Ga0587076_049623
2229 Ga0587071_135435
2230 Ga0501082_0000666
2231 Ga0501082_0013706
2232 Ga0501082_0166122
2233 Ga0501082_0689536
2234 2510317718
2235 2512963812
2236 2514588476
2237 2597812540
2238 2644305769
2239 2688599639
2240 2841738540
2241 2844014935
2242 2856334161
2243 2856341120
2244 2856347063
2245 2857371748
2246 2869171325
2247 2869236469
2248 2869246102
2249 2869255614
2250 2869260854
2251 2869265987
2252 2869274575
2253 2871436665
2254 2871456951
2255 2871466421
2256 2871479880
2257 2871483791
2258 2874114305
2259 2874117104
2260 2874133570
2261 2874164861
2262 2876392629
2263 2876406762
2264 2876409857
2265 2876426168
2266 2878735147
2267 2878778967
2268 2878783484
2269 2878788897
2270 2888346496
2271 2903514227
2272 2906363519
2273 2906371368
2274 2906395538
2275 2906401737
2276 2906410768
2277 2906432849
2278 2922155997
2279 2922177392
2280 2922181394
2281 2924711288
2282 2924733746
2283 2924741848
2284 2924752325
2285 2924761584
2286 2937841822
2287 2937866040
2288 2937869027
2289 2937983883
2290 2958077838
2291 2958111772
2292 2958127236
2293 2958138826
2294 2958164636
2295 2961140319
2296 2961189470
2297 2965027880
2298 2965054889
2299 2965091373
2300 2965107713
2301 2965114673
2302 2968139276
2303 2970490342
2304 2970512916
2305 2970528051
2306 2970533690
2307 2970541157
2308 2970552847
2309 2970622512
2310 2970633326
2311 2977851687
2312 2977879200
2313 2977905132
2314 2977921136
2315 2977936168
2316 2977954773
2317 2977961073
2318 2979767460
2319 2979774129
2320 2979797586
2321 2987646488
2322 2987676876
2323 2996314366
2324 2996393180
2325 3004197786
2326 3004235520
2327 3004247868
2328 3004251761
2329 3004274501
2330 649874143
2331 8004302372
2332 8004315974
2333 8004363149
2334 8004397613
2335 8004634163
2336 8004700102
2337 8004731056
2338 8055620167

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00101

RuBisCO_small

Ribulose bisphosphate carboxylase, small chain

5

104

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsw-assembly1.cif.gz_B-2 l8s8-complex forming rubisco derived from ancestral sequence reconstruction of the last common ancestor of ssu-bearing form i rubiscos 0.9356 14 110
1rbl-assembly1.cif.gz_M structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301 0.9217 14 111
1rsc-assembly1.cif.gz_M structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate 0.9206 14 111
3zxw-assembly1.cif.gz_B structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate 0.9199 15 109
3zxw-assembly1.cif.gz_B structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate 0.9108 15 109
ID Description Score Start End Superfamily
3zxwD00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9201 15 109 3.30.190.10
3zxwD00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.9109 15 109 3.30.190.10
2ybvN00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.8864 8 109 3.30.190.10
2ybvN00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.8307 8 109 3.30.190.10
5mz2I00 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribulose bisphosphate carboxylase, small subunit 0.8244 8 144 3.30.190.10
ID Description Score Start End GO Terms
AF-A0A218QH27-F1-model_v4 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) 0.9329 15 111 GO:0009853
GO:0016984
GO:0019253
GO:0031470
AF-A0A0A2AQ53-F1-model_v4 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) 0.9294 20 109 GO:0009853
GO:0016984
GO:0019253
GO:0031470
AF-A0A354B4H2-F1-model_v4 Ribulose bisphosphate carboxylase small subunit 0.9247 20 93 GO:0019253
GO:0031469
AF-A0A7T5JEG5-F1-model_v4 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) 0.9246 14 110 GO:0009853
GO:0016984
GO:0019253
GO:0031470
AF-A0A1Y1QBE6-F1-model_v4 Ribulose bisphosphate carboxylase small subunit 0.9161 25 111 GO:0019253

Map