F491095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1167 | 432 | 1118 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100048281|Ga0075431_1000482814 |
| Length | 264 |
| Sequence | MQKFLKDLFTKQSYDEKNFFLIAGPCVVESEELAMEVADKVYGICKNLGIPYVFKSSYRKANRTSATSFTGIGDEKALAIVKKTGEKYGVPTTSDIHAHDEAEVAAKYVDILQIPAFLCRQTTGKIVNVKKGQFLSGESMKFAVEKIKAAENNKVILTERGTTFGYHDLVVDYRNIPAMQKFDVPVVMDCTHSLQQPNQTSGVTGGNPQMIGTISKAAIASGADGLFIETHPNPAVAKSDGANMLKLDLLEDLLNKLVKLRKAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 6 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 7 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 8 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 9 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 10 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 11 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 12 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 13 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 14 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 15 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 16 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 17 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 18 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 19 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 20 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 21 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 22 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 23 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 24 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 25 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 26 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 27 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 28 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 29 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 30 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 31 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 32 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 33 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 34 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 35 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 36 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 37 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 38 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 39 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 40 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 41 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 42 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 43 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 44 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 45 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 46 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 47 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 48 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 49 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 50 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 51 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 52 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 53 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 54 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 59 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 60 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 66 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 69 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 100 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 248 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 251 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 252 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 253 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 254 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 255 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 258 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 262 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 263 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 266 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 270 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 271 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 273 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 274 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 275 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 276 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 277 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 278 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 279 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 287 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 294 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 295 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 298 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 299 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 301 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 302 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 303 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 304 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 305 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 306 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 307 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 308 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 309 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 313 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 314 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 319 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 383 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 384 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 385 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 387 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 388 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 390 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 406 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 408 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 409 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 410 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 411 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 412 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 413 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 414 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 424 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 432 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.72 |
| Metatranscriptomes | 0.09 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.43 |
| Nodule | 0 |
| Rhizoplane | 0.86 |
| Rhizosphere | 85.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2039605 | 2162886007 | Bacteria | 2927 |
| 2 | SwRhRL2b_contig_2043181 | 2162886007 | Bacteria | 31792 |
| 3 | SwRhRL2b_contig_2513460 | 2162886007 | Bacteria | 7126 |
| 4 | MRS1b_contig_5332534 | 2162886011 | Unclassified | 1037 |
| 5 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 6 | JGI25152J39213_1000647 | 3300002773 | Bacteria | 18444 |
| 7 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 8 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 9 | JGI25406J46586_10000525 | 3300003203 | Bacteria | 17890 |
| 10 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 11 | JGI25153J46596_10014038 | 3300003215 | Bacteria | 3353 |
| 12 | rootH1_10002677 | 3300003316 | Bacteria | 1348 |
| 13 | rootH1_10068633 | 3300003316 | Unclassified | 2751 |
| 14 | rootH1_10100877 | 3300003316 | Bacteria | 2668 |
| 15 | rootH1_10135481 | 3300003316 | Bacteria | 1892 |
| 16 | rootH2_10040458 | 3300003320 | Bacteria | 6763 |
| 17 | rootH2_10047580 | 3300003320 | Bacteria | 23351 |
| 18 | rootH2_10069535 | 3300003320 | Bacteria | 11638 |
| 19 | rootH2_10086703 | 3300003320 | Bacteria | 2647 |
| 20 | rootH2_10096794 | 3300003320 | Bacteria | 5474 |
| 21 | rootH2_10125569 | 3300003320 | Bacteria | 2987 |
| 22 | rootL2_10010003 | 3300003322 | Bacteria | 3121 |
| 23 | rootL2_10013694 | 3300003322 | Bacteria | 3185 |
| 24 | rootL2_10037159 | 3300003322 | Bacteria | 5236 |
| 25 | rootL2_10106122 | 3300003322 | Bacteria | 1367 |
| 26 | rootL2_10176488 | 3300003322 | Bacteria | 3277 |
| 27 | rootL2_10283503 | 3300003322 | Bacteria | 1558 |
| 28 | rootH1_10002262 | 3300003323 | Bacteria | 13157 |
| 29 | rootH1_10031210 | 3300003323 | Bacteria | 6277 |
| 30 | rootH1_10067892 | 3300003323 | Bacteria | 3886 |
| 31 | rootH1_10081850 | 3300003323 | Bacteria | 5525 |
| 32 | rootH1_10208372 | 3300003323 | Bacteria | 1646 |
| 33 | JGI25160J50197_1001273 | 3300003354 | Bacteria | 12786 |
| 34 | JGI25160J50197_1001820 | 3300003354 | Bacteria | 10281 |
| 35 | JGI25160J50197_1009684 | 3300003354 | Bacteria | 3550 |
| 36 | Ga0055542_1005732 | 3300003762 | Bacteria | 2752 |
| 37 | Ga0055528_1000164 | 3300003790 | Bacteria | 55729 |
| 38 | Ga0055530_10002036 | 3300003791 | Bacteria | 13649 |
| 39 | Ga0055530_10002755 | 3300003791 | Bacteria | 10873 |
| 40 | Ga0055531_10000020 | 3300003794 | Bacteria | 170186 |
| 41 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 42 | Ga0065165_1030900 | 3300005262 | Bacteria | 1699 |
| 43 | Ga0065714_10002310 | 3300005288 | Bacteria | 37379 |
| 44 | Ga0065714_10003657 | 3300005288 | Bacteria | 30790 |
| 45 | Ga0065714_10004769 | 3300005288 | Bacteria | 5412 |
| 46 | Ga0065714_10004961 | 3300005288 | Bacteria | 4727 |
| 47 | Ga0065714_10023632 | 3300005288 | Bacteria | 1672 |
| 48 | Ga0065714_10064664 | 3300005288 | Bacteria | 25064 |
| 49 | Ga0065714_10064897 | 3300005288 | Bacteria | 15960 |
| 50 | Ga0065714_10118971 | 3300005288 | Bacteria | 1365 |
| 51 | Ga0065714_10123017 | 3300005288 | Bacteria | 1326 |
| 52 | Ga0065704_10000193 | 3300005289 | Bacteria | 203271 |
| 53 | Ga0065704_10070350 | 3300005289 | Bacteria | 30787 |
| 54 | Ga0065712_10173878 | 3300005290 | Unclassified | 1228 |
| 55 | Ga0070658_10001041 | 3300005327 | Bacteria | 23743 |
| 56 | Ga0070658_10040671 | 3300005327 | Bacteria | 3751 |
| 57 | Ga0070658_10046802 | 3300005327 | Bacteria | 3500 |
| 58 | Ga0070658_10227153 | 3300005327 | Bacteria | 1580 |
| 59 | Ga0070676_10001302 | 3300005328 | Bacteria | 12549 |
| 60 | Ga0070676_10001325 | 3300005328 | Bacteria | 12443 |
| 61 | Ga0070676_10039691 | 3300005328 | Bacteria | 2723 |
| 62 | Ga0070683_100000163 | 3300005329 | Bacteria | 43905 |
| 63 | Ga0070683_100002968 | 3300005329 | Bacteria | 13603 |
| 64 | Ga0070683_100006525 | 3300005329 | Bacteria | 9797 |
| 65 | Ga0070683_100062783 | 3300005329 | Bacteria | 3454 |
| 66 | Ga0070683_100236447 | 3300005329 | Bacteria | 1737 |
| 67 | Ga0070690_100007549 | 3300005330 | Bacteria | 6224 |
| 68 | Ga0070690_100055790 | 3300005330 | Bacteria | 2531 |
| 69 | Ga0070690_100126964 | 3300005330 | Unclassified | 1718 |
| 70 | Ga0070670_100062169 | 3300005331 | Bacteria | 3206 |
| 71 | Ga0070670_100069074 | 3300005331 | Bacteria | 3033 |
| 72 | Ga0070670_100130431 | 3300005331 | Bacteria | 2170 |
| 73 | Ga0070677_10035784 | 3300005333 | Bacteria | 1927 |
| 74 | Ga0068869_100018339 | 3300005334 | Bacteria | 4762 |
| 75 | Ga0068869_100023955 | 3300005334 | Bacteria | 4223 |
| 76 | Ga0068869_100033372 | 3300005334 | Bacteria | 3633 |
| 77 | Ga0068869_100056074 | 3300005334 | Bacteria | 2873 |
| 78 | Ga0068869_100077989 | 3300005334 | Bacteria | 2466 |
| 79 | Ga0068869_100102195 | 3300005334 | Unclassified | 2169 |
| 80 | Ga0070666_10000470 | 3300005335 | Bacteria | 24388 |
| 81 | Ga0070666_10002147 | 3300005335 | Bacteria | 11985 |
| 82 | Ga0070666_10007390 | 3300005335 | Bacteria | 6770 |
| 83 | Ga0070666_10093615 | 3300005335 | Bacteria | 2066 |
| 84 | Ga0070680_100019950 | 3300005336 | Bacteria | 5313 |
| 85 | Ga0070680_100108378 | 3300005336 | Bacteria | 2310 |
| 86 | Ga0070680_100256235 | 3300005336 | Bacteria | 1480 |
| 87 | Ga0070682_100000125 | 3300005337 | Bacteria | 67243 |
| 88 | Ga0070682_100000763 | 3300005337 | Bacteria | 19108 |
| 89 | Ga0068868_100009542 | 3300005338 | Bacteria | 6993 |
| 90 | Ga0068868_100010057 | 3300005338 | Bacteria | 6836 |
| 91 | Ga0068868_100020797 | 3300005338 | Bacteria | 4938 |
| 92 | Ga0068868_100023201 | 3300005338 | Bacteria | 4694 |
| 93 | Ga0068868_100029528 | 3300005338 | Bacteria | 4199 |
| 94 | Ga0068868_100222541 | 3300005338 | Bacteria | 1580 |
| 95 | Ga0068868_100486689 | 3300005338 | Bacteria | 1079 |
| 96 | Ga0068868_100525858 | 3300005338 | Bacteria | 1039 |
| 97 | Ga0070660_100007237 | 3300005339 | Bacteria | 7723 |
| 98 | Ga0070660_100015655 | 3300005339 | Bacteria | 5481 |
| 99 | Ga0070660_100087378 | 3300005339 | Unclassified | 2454 |
| 100 | Ga0070689_100371436 | 3300005340 | Bacteria | 1203 |
| 101 | Ga0070689_100578495 | 3300005340 | Bacteria | 970 |
| 102 | Ga0070691_10003781 | 3300005341 | Bacteria | 6839 |
| 103 | Ga0070691_10080700 | 3300005341 | Bacteria | 1592 |
| 104 | Ga0070687_100060562 | 3300005343 | Bacteria | 1997 |
| 105 | Ga0070661_100008117 | 3300005344 | Bacteria | 7243 |
| 106 | Ga0070661_100013480 | 3300005344 | Bacteria | 5738 |
| 107 | Ga0070661_100015221 | 3300005344 | Bacteria | 5428 |
| 108 | Ga0070661_100278994 | 3300005344 | Unclassified | 1296 |
| 109 | Ga0070668_100000043 | 3300005347 | Bacteria | 78564 |
| 110 | Ga0070668_100055178 | 3300005347 | Bacteria | 3066 |
| 111 | Ga0070669_100021225 | 3300005353 | Bacteria | 4641 |
| 112 | Ga0070669_100027147 | 3300005353 | Bacteria | 4121 |
| 113 | Ga0070675_100012773 | 3300005354 | Bacteria | 6587 |
| 114 | Ga0070675_100022391 | 3300005354 | Bacteria | 5050 |
| 115 | Ga0070675_100419922 | 3300005354 | Bacteria | 1196 |
| 116 | Ga0070671_100006875 | 3300005355 | Bacteria | 9110 |
| 117 | Ga0070671_100075054 | 3300005355 | Unclassified | 2824 |
| 118 | Ga0070671_100098121 | 3300005355 | Bacteria | 2457 |
| 119 | Ga0070671_100116745 | 3300005355 | Bacteria | 2244 |
| 120 | Ga0070671_100347355 | 3300005355 | Bacteria | 1266 |
| 121 | Ga0070674_100007210 | 3300005356 | Bacteria | 6544 |
| 122 | Ga0070674_100048543 | 3300005356 | Bacteria | 2914 |
| 123 | Ga0070674_100093218 | 3300005356 | Unclassified | 2179 |
| 124 | Ga0070674_100108558 | 3300005356 | Bacteria | 2034 |
| 125 | Ga0070674_100545728 | 3300005356 | Unclassified | 972 |
| 126 | Ga0070673_100000327 | 3300005364 | Bacteria | 25035 |
| 127 | Ga0070673_100025591 | 3300005364 | Bacteria | 4347 |
| 128 | Ga0070673_100026841 | 3300005364 | Bacteria | 4259 |
| 129 | Ga0070673_100029665 | 3300005364 | Bacteria | 4081 |
| 130 | Ga0070673_100076951 | 3300005364 | Bacteria | 2695 |
| 131 | Ga0070673_100101829 | 3300005364 | Bacteria | 2367 |
| 132 | Ga0070673_100105793 | 3300005364 | Unclassified | 2325 |
| 133 | Ga0070673_100113300 | 3300005364 | Bacteria | 2252 |
| 134 | Ga0070688_100008996 | 3300005365 | Bacteria | 5443 |
| 135 | Ga0070688_100010503 | 3300005365 | Bacteria | 5109 |
| 136 | Ga0070688_100066198 | 3300005365 | Bacteria | 2299 |
| 137 | Ga0070688_100169717 | 3300005365 | Bacteria | 1504 |
| 138 | Ga0070659_100003048 | 3300005366 | Bacteria | 11911 |
| 139 | Ga0070659_100340092 | 3300005366 | Bacteria | 1257 |
| 140 | Ga0070659_100512500 | 3300005366 | Bacteria | 1023 |
| 141 | Ga0070667_100002415 | 3300005367 | Bacteria | 16338 |
| 142 | Ga0070667_100003720 | 3300005367 | Bacteria | 12949 |
| 143 | Ga0070667_100013202 | 3300005367 | Bacteria | 6827 |
| 144 | Ga0070667_100014132 | 3300005367 | Bacteria | 6596 |
| 145 | Ga0070667_100172908 | 3300005367 | Bacteria | 1908 |
| 146 | Ga0070667_100181840 | 3300005367 | Bacteria | 1859 |
| 147 | Ga0070667_100192966 | 3300005367 | Bacteria | 1805 |
| 148 | Ga0070700_100073234 | 3300005441 | Unclassified | 2192 |
| 149 | Ga0070663_100127377 | 3300005455 | Bacteria | 1930 |
| 150 | Ga0070663_100164210 | 3300005455 | Bacteria | 1711 |
| 151 | Ga0070663_100212572 | 3300005455 | Bacteria | 1515 |
| 152 | Ga0070678_100119132 | 3300005456 | Bacteria | 2079 |
| 153 | Ga0070678_100151186 | 3300005456 | Unclassified | 1870 |
| 154 | Ga0070662_100000634 | 3300005457 | Bacteria | 21289 |
| 155 | Ga0070662_100006198 | 3300005457 | Bacteria | 7700 |
| 156 | Ga0070662_100011578 | 3300005457 | Bacteria | 5821 |
| 157 | Ga0070662_100024164 | 3300005457 | Bacteria | 4183 |
| 158 | Ga0070662_100351813 | 3300005457 | Unclassified | 1207 |
| 159 | Ga0070681_10171808 | 3300005458 | Bacteria | 2089 |
| 160 | Ga0068867_100007977 | 3300005459 | Bacteria | 7480 |
| 161 | Ga0068867_100033229 | 3300005459 | Bacteria | 3734 |
| 162 | Ga0068867_100042668 | 3300005459 | Bacteria | 3319 |
| 163 | Ga0068867_100110092 | 3300005459 | Bacteria | 2115 |
| 164 | Ga0070685_10020801 | 3300005466 | Bacteria | 3556 |
| 165 | Ga0070685_10020953 | 3300005466 | Bacteria | 3546 |
| 166 | Ga0070685_10023651 | 3300005466 | Bacteria | 3367 |
| 167 | Ga0070685_10294017 | 3300005466 | Bacteria | 1092 |
| 168 | Ga0070707_100237998 | 3300005468 | Bacteria | 1772 |
| 169 | Ga0070698_100000297 | 3300005471 | Bacteria | 50707 |
| 170 | Ga0070698_100044656 | 3300005471 | Bacteria | 4536 |
| 171 | Ga0070698_100306542 | 3300005471 | Unclassified | 1519 |
| 172 | Ga0070679_100009706 | 3300005530 | Bacteria | 9105 |
| 173 | Ga0070679_100017964 | 3300005530 | Bacteria | 6854 |
| 174 | Ga0070679_100114743 | 3300005530 | Bacteria | 2679 |
| 175 | Ga0070684_100002223 | 3300005535 | Bacteria | 14311 |
| 176 | Ga0070684_100003255 | 3300005535 | Bacteria | 12160 |
| 177 | Ga0070684_100036799 | 3300005535 | Bacteria | 4195 |
| 178 | Ga0070684_100123368 | 3300005535 | Bacteria | 2331 |
| 179 | Ga0068853_100000393 | 3300005539 | Bacteria | 29967 |
| 180 | Ga0068853_100012039 | 3300005539 | Bacteria | 7037 |
| 181 | Ga0068853_100012865 | 3300005539 | Bacteria | 6819 |
| 182 | Ga0068853_100035117 | 3300005539 | Bacteria | 4258 |
| 183 | Ga0068853_100038576 | 3300005539 | Bacteria | 4069 |
| 184 | Ga0068853_100047147 | 3300005539 | Bacteria | 3698 |
| 185 | Ga0068853_100086173 | 3300005539 | Bacteria | 2754 |
| 186 | Ga0068853_100134818 | 3300005539 | Bacteria | 2213 |
| 187 | Ga0068853_100187668 | 3300005539 | Bacteria | 1877 |
| 188 | Ga0068853_100198341 | 3300005539 | Bacteria | 1826 |
| 189 | Ga0068853_100249885 | 3300005539 | Bacteria | 1627 |
| 190 | Ga0068853_100539848 | 3300005539 | Unclassified | 1104 |
| 191 | Ga0070672_100000109 | 3300005543 | Bacteria | 41435 |
| 192 | Ga0070672_100025040 | 3300005543 | Bacteria | 4420 |
| 193 | Ga0070672_100404349 | 3300005543 | Bacteria | 1171 |
| 194 | Ga0070686_100116157 | 3300005544 | Bacteria | 1831 |
| 195 | Ga0070696_100127934 | 3300005546 | Unclassified | 1845 |
| 196 | Ga0070693_100029934 | 3300005547 | Bacteria | 2973 |
| 197 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 198 | Ga0070665_100000442 | 3300005548 | Bacteria | 60619 |
| 199 | Ga0070665_100033784 | 3300005548 | Bacteria | 5145 |
| 200 | Ga0068855_100000424 | 3300005563 | Bacteria | 52152 |
| 201 | Ga0068855_100007894 | 3300005563 | Bacteria | 12855 |
| 202 | Ga0068855_100042418 | 3300005563 | Bacteria | 5391 |
| 203 | Ga0068855_100043267 | 3300005563 | Bacteria | 5335 |
| 204 | Ga0068855_100125412 | 3300005563 | Bacteria | 2936 |
| 205 | Ga0068855_100129313 | 3300005563 | Bacteria | 2885 |
| 206 | Ga0068855_100260832 | 3300005563 | Bacteria | 1930 |
| 207 | Ga0070664_100003401 | 3300005564 | Bacteria | 12846 |
| 208 | Ga0070664_100014457 | 3300005564 | Bacteria | 6435 |
| 209 | Ga0070664_100154403 | 3300005564 | Bacteria | 2028 |
| 210 | Ga0070664_100181958 | 3300005564 | Bacteria | 1868 |
| 211 | Ga0070664_100246686 | 3300005564 | Bacteria | 1604 |
| 212 | Ga0068857_100026465 | 3300005577 | Bacteria | 5113 |
| 213 | Ga0068857_100041415 | 3300005577 | Bacteria | 4085 |
| 214 | Ga0068857_100164522 | 3300005577 | Unclassified | 2014 |
| 215 | Ga0068857_100295396 | 3300005577 | Bacteria | 1493 |
| 216 | Ga0068854_100058430 | 3300005578 | Bacteria | 2784 |
| 217 | Ga0068854_100068897 | 3300005578 | Bacteria | 2581 |
| 218 | Ga0068854_100092898 | 3300005578 | Bacteria | 2248 |
| 219 | Ga0068854_100298702 | 3300005578 | Bacteria | 1302 |
| 220 | Ga0068854_100447205 | 3300005578 | Bacteria | 1078 |
| 221 | Ga0068854_100681855 | 3300005578 | Bacteria | 885 |
| 222 | Ga0068856_100036956 | 3300005614 | Bacteria | 4790 |
| 223 | Ga0068856_100184238 | 3300005614 | Unclassified | 2101 |
| 224 | Ga0070702_100332360 | 3300005615 | Bacteria | 1063 |
| 225 | Ga0068852_100002256 | 3300005616 | Bacteria | 13229 |
| 226 | Ga0068852_100007763 | 3300005616 | Bacteria | 7853 |
| 227 | Ga0068852_100008104 | 3300005616 | Bacteria | 7711 |
| 228 | Ga0068852_100028525 | 3300005616 | Bacteria | 4570 |
| 229 | Ga0068852_100061314 | 3300005616 | Bacteria | 3269 |
| 230 | Ga0068852_100124699 | 3300005616 | Bacteria | 2363 |
| 231 | Ga0068852_100169367 | 3300005616 | Bacteria | 2046 |
| 232 | Ga0068852_100173333 | 3300005616 | Bacteria | 2024 |
| 233 | Ga0068852_100184267 | 3300005616 | Bacteria | 1965 |
| 234 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 235 | Ga0068859_100009837 | 3300005617 | Bacteria | 9653 |
| 236 | Ga0068859_100291434 | 3300005617 | Bacteria | 1725 |
| 237 | Ga0068859_100330486 | 3300005617 | Bacteria | 1618 |
| 238 | Ga0068859_100411599 | 3300005617 | Bacteria | 1448 |
| 239 | Ga0068864_100002855 | 3300005618 | Bacteria | 14274 |
| 240 | Ga0068864_100002925 | 3300005618 | Bacteria | 14126 |
| 241 | Ga0068864_100038495 | 3300005618 | Bacteria | 4085 |
| 242 | Ga0068864_100334473 | 3300005618 | Bacteria | 1426 |
| 243 | Ga0068864_100414635 | 3300005618 | Bacteria | 1282 |
| 244 | Ga0068864_100434066 | 3300005618 | Bacteria | 1254 |
| 245 | Ga0068866_10031108 | 3300005718 | Unclassified | 2568 |
| 246 | Ga0068866_10039537 | 3300005718 | Bacteria | 2329 |
| 247 | Ga0068861_100096503 | 3300005719 | Bacteria | 2343 |
| 248 | Ga0068851_10000757 | 3300005834 | Bacteria | 13887 |
| 249 | Ga0068851_10023638 | 3300005834 | Unclassified | 3006 |
| 250 | Ga0068851_10033342 | 3300005834 | Bacteria | 2566 |
| 251 | Ga0068851_10061988 | 3300005834 | Unclassified | 1918 |
| 252 | Ga0068851_10099080 | 3300005834 | Bacteria | 1544 |
| 253 | Ga0068851_10123477 | 3300005834 | Bacteria | 1394 |
| 254 | Ga0068870_10086437 | 3300005840 | Bacteria | 1744 |
| 255 | Ga0068863_100000837 | 3300005841 | Bacteria | 30852 |
| 256 | Ga0068863_100004877 | 3300005841 | Bacteria | 13216 |
| 257 | Ga0068863_100031428 | 3300005841 | Bacteria | 5065 |
| 258 | Ga0068863_100167215 | 3300005841 | Bacteria | 2109 |
| 259 | Ga0068863_100241607 | 3300005841 | Bacteria | 1743 |
| 260 | Ga0068863_100912930 | 3300005841 | Bacteria | 879 |
| 261 | Ga0068858_100000199 | 3300005842 | Bacteria | 64607 |
| 262 | Ga0068858_100003623 | 3300005842 | Bacteria | 15279 |
| 263 | Ga0068858_100044704 | 3300005842 | Bacteria | 4105 |
| 264 | Ga0068858_100062898 | 3300005842 | Bacteria | 3433 |
| 265 | Ga0068858_100138918 | 3300005842 | Unclassified | 2281 |
| 266 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 267 | Ga0068860_100001065 | 3300005843 | Bacteria | 30280 |
| 268 | Ga0068860_100002282 | 3300005843 | Bacteria | 20152 |
| 269 | Ga0068860_100006172 | 3300005843 | Bacteria | 12053 |
| 270 | Ga0068860_100015467 | 3300005843 | Bacteria | 7450 |
| 271 | Ga0068860_100024334 | 3300005843 | Bacteria | 5852 |
| 272 | Ga0068860_100078244 | 3300005843 | Bacteria | 3145 |
| 273 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 274 | Ga0081539_10021605 | 3300005985 | Bacteria | 4289 |
| 275 | Ga0075366_10057949 | 3300006195 | Bacteria | 2301 |
| 276 | Ga0075366_10128799 | 3300006195 | Bacteria | 1527 |
| 277 | Ga0075366_10145746 | 3300006195 | Bacteria | 1433 |
| 278 | Ga0075366_10185617 | 3300006195 | Bacteria | 1263 |
| 279 | Ga0075366_10262687 | 3300006195 | Bacteria | 1054 |
| 280 | Ga0097621_100001588 | 3300006237 | Bacteria | 15542 |
| 281 | Ga0097621_100027698 | 3300006237 | Bacteria | 4459 |
| 282 | Ga0097621_100080231 | 3300006237 | Bacteria | 2714 |
| 283 | Ga0097621_100116128 | 3300006237 | Bacteria | 2266 |
| 284 | Ga0097621_100139561 | 3300006237 | Bacteria | 2070 |
| 285 | Ga0097621_100193836 | 3300006237 | Unclassified | 1761 |
| 286 | Ga0097621_100296828 | 3300006237 | Bacteria | 1426 |
| 287 | Ga0068871_100000415 | 3300006358 | Bacteria | 29454 |
| 288 | Ga0068871_100012310 | 3300006358 | Bacteria | 6303 |
| 289 | Ga0068871_100025288 | 3300006358 | Bacteria | 4617 |
| 290 | Ga0068871_100035662 | 3300006358 | Bacteria | 3954 |
| 291 | Ga0068871_100076489 | 3300006358 | Bacteria | 2765 |
| 292 | Ga0068871_100097438 | 3300006358 | Bacteria | 2458 |
| 293 | Ga0068871_100302487 | 3300006358 | Bacteria | 1404 |
| 294 | Ga0075428_100359180 | 3300006844 | Unclassified | 1563 |
| 295 | Ga0075431_100048281 | 3300006847 | Bacteria | 4391 |
| 296 | Ga0068865_100029956 | 3300006881 | Bacteria | 3616 |
| 297 | Ga0068865_100169183 | 3300006881 | Bacteria | 1674 |
| 298 | Ga0068865_100214390 | 3300006881 | Unclassified | 1502 |
| 299 | Ga0068865_100625544 | 3300006881 | Bacteria | 912 |
| 300 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 301 | Ga0097620_100009837 | 3300006931 | Bacteria | 9653 |
| 302 | Ga0097620_100291442 | 3300006931 | Bacteria | 1725 |
| 303 | Ga0097620_100330498 | 3300006931 | Bacteria | 1618 |
| 304 | Ga0097620_100411639 | 3300006931 | Bacteria | 1448 |
| 305 | Ga0105240_10000020 | 3300009093 | Bacteria | 399699 |
| 306 | Ga0105240_10000486 | 3300009093 | Bacteria | 73492 |
| 307 | Ga0105240_10001336 | 3300009093 | Bacteria | 42397 |
| 308 | Ga0105240_10001733 | 3300009093 | Bacteria | 36808 |
| 309 | Ga0105240_10002769 | 3300009093 | Bacteria | 27701 |
| 310 | Ga0105240_10053213 | 3300009093 | Bacteria | 5083 |
| 311 | Ga0105240_10092055 | 3300009093 | Bacteria | 3703 |
| 312 | Ga0105240_10140580 | 3300009093 | Bacteria | 2887 |
| 313 | Ga0105240_10187278 | 3300009093 | Bacteria | 2437 |
| 314 | Ga0105240_10260537 | 3300009093 | Bacteria | 2000 |
| 315 | Ga0105240_10385880 | 3300009093 | Unclassified | 1581 |
| 316 | Ga0105240_10474576 | 3300009093 | Bacteria | 1395 |
| 317 | Ga0111539_10029443 | 3300009094 | Bacteria | 6687 |
| 318 | Ga0111539_10223014 | 3300009094 | Bacteria | 2195 |
| 319 | Ga0105245_10707957 | 3300009098 | Bacteria | 1041 |
| 320 | Ga0105247_10087178 | 3300009101 | Bacteria | 1976 |
| 321 | Ga0105247_10179217 | 3300009101 | Bacteria | 1413 |
| 322 | Ga0114129_10201912 | 3300009147 | Bacteria | 2692 |
| 323 | Ga0105241_10000160 | 3300009174 | Bacteria | 48902 |
| 324 | Ga0105241_10005397 | 3300009174 | Bacteria | 9451 |
| 325 | Ga0105241_10006798 | 3300009174 | Bacteria | 8412 |
| 326 | Ga0105242_10010378 | 3300009176 | Bacteria | 7143 |
| 327 | Ga0105242_10040136 | 3300009176 | Bacteria | 3771 |
| 328 | Ga0105242_10043339 | 3300009176 | Bacteria | 3640 |
| 329 | Ga0105242_10045988 | 3300009176 | Bacteria | 3540 |
| 330 | Ga0105242_10086591 | 3300009176 | Bacteria | 2629 |
| 331 | Ga0105242_10140101 | 3300009176 | Bacteria | 2098 |
| 332 | Ga0105242_10155242 | 3300009176 | Bacteria | 1999 |
| 333 | Ga0105242_10744581 | 3300009176 | Unclassified | 964 |
| 334 | Ga0105248_10004754 | 3300009177 | Bacteria | 15030 |
| 335 | Ga0105248_10031239 | 3300009177 | Bacteria | 5952 |
| 336 | Ga0105237_10000651 | 3300009545 | Bacteria | 48483 |
| 337 | Ga0105237_10001003 | 3300009545 | Bacteria | 37998 |
| 338 | Ga0105237_10006737 | 3300009545 | Bacteria | 12689 |
| 339 | Ga0105237_10010984 | 3300009545 | Bacteria | 9610 |
| 340 | Ga0105237_10012955 | 3300009545 | Bacteria | 8758 |
| 341 | Ga0105237_10031701 | 3300009545 | Bacteria | 5354 |
| 342 | Ga0105237_10061473 | 3300009545 | Bacteria | 3755 |
| 343 | Ga0105237_10096161 | 3300009545 | Bacteria | 2952 |
| 344 | Ga0105237_10229777 | 3300009545 | Bacteria | 1856 |
| 345 | Ga0105237_10327524 | 3300009545 | Bacteria | 1536 |
| 346 | Ga0105238_10006277 | 3300009551 | Bacteria | 11811 |
| 347 | Ga0105238_10035934 | 3300009551 | Bacteria | 5037 |
| 348 | Ga0105238_10041567 | 3300009551 | Bacteria | 4655 |
| 349 | Ga0105249_10003523 | 3300009553 | Bacteria | 13534 |
| 350 | Ga0105249_10018325 | 3300009553 | Bacteria | 6225 |
| 351 | Ga0105249_10034299 | 3300009553 | Bacteria | 4599 |
| 352 | Ga0105249_10056871 | 3300009553 | Bacteria | 3582 |
| 353 | Ga0105249_10095840 | 3300009553 | Bacteria | 2783 |
| 354 | Ga0105249_10170736 | 3300009553 | Bacteria | 2108 |
| 355 | Ga0105249_10208189 | 3300009553 | Bacteria | 1918 |
| 356 | Ga0105249_10283174 | 3300009553 | Bacteria | 1656 |
| 357 | Ga0105249_10294582 | 3300009553 | Bacteria | 1625 |
| 358 | Ga0105239_10000457 | 3300010375 | Bacteria | 59635 |
| 359 | Ga0105239_10001481 | 3300010375 | Bacteria | 31222 |
| 360 | Ga0105239_10014988 | 3300010375 | Bacteria | 8594 |
| 361 | Ga0105239_10018841 | 3300010375 | Bacteria | 7626 |
| 362 | Ga0105239_10046890 | 3300010375 | Bacteria | 4735 |
| 363 | Ga0105239_10049269 | 3300010375 | Bacteria | 4619 |
| 364 | Ga0105239_10098424 | 3300010375 | Bacteria | 3233 |
| 365 | Ga0105239_10123388 | 3300010375 | Bacteria | 2878 |
| 366 | Ga0105239_10169435 | 3300010375 | Bacteria | 2442 |
| 367 | Ga0105239_10207254 | 3300010375 | Bacteria | 2197 |
| 368 | Ga0105246_10013049 | 3300011119 | Bacteria | 5199 |
| 369 | Ga0105246_10034419 | 3300011119 | Bacteria | 3376 |
| 370 | Ga0105246_10145743 | 3300011119 | Unclassified | 1786 |
| 371 | Ga0157373_10000136 | 3300013100 | Bacteria | 57912 |
| 372 | Ga0157373_10010365 | 3300013100 | Bacteria | 6861 |
| 373 | Ga0157373_10011057 | 3300013100 | Bacteria | 6647 |
| 374 | Ga0157373_10011567 | 3300013100 | Bacteria | 6484 |
| 375 | Ga0157373_10044643 | 3300013100 | Bacteria | 3164 |
| 376 | Ga0157373_10127960 | 3300013100 | Bacteria | 1786 |
| 377 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 378 | Ga0157371_10004069 | 3300013102 | Bacteria | 12926 |
| 379 | Ga0157371_10004753 | 3300013102 | Bacteria | 11717 |
| 380 | Ga0157371_10007420 | 3300013102 | Bacteria | 8881 |
| 381 | Ga0157371_10011958 | 3300013102 | Bacteria | 6656 |
| 382 | Ga0157371_10022986 | 3300013102 | Bacteria | 4559 |
| 383 | Ga0157371_10053517 | 3300013102 | Bacteria | 2866 |
| 384 | Ga0157371_10112606 | 3300013102 | Bacteria | 1931 |
| 385 | Ga0157371_10150197 | 3300013102 | Bacteria | 1661 |
| 386 | Ga0157371_10174230 | 3300013102 | Unclassified | 1538 |
| 387 | Ga0157370_10001064 | 3300013104 | Bacteria | 34340 |
| 388 | Ga0157370_10002306 | 3300013104 | Bacteria | 23088 |
| 389 | Ga0157370_10004498 | 3300013104 | Bacteria | 15980 |
| 390 | Ga0157370_10011097 | 3300013104 | Bacteria | 9444 |
| 391 | Ga0157370_10011684 | 3300013104 | Bacteria | 9166 |
| 392 | Ga0157370_10012352 | 3300013104 | Bacteria | 8862 |
| 393 | Ga0157370_10020896 | 3300013104 | Bacteria | 6531 |
| 394 | Ga0157370_10029726 | 3300013104 | Bacteria | 5359 |
| 395 | Ga0157370_10043363 | 3300013104 | Unclassified | 4330 |
| 396 | Ga0157370_10059442 | 3300013104 | Bacteria | 3632 |
| 397 | Ga0157370_10084627 | 3300013104 | Bacteria | 2981 |
| 398 | Ga0157370_10144239 | 3300013104 | Bacteria | 2218 |
| 399 | Ga0157370_10179665 | 3300013104 | Bacteria | 1966 |
| 400 | Ga0157370_10190126 | 3300013104 | Bacteria | 1906 |
| 401 | Ga0157370_10526036 | 3300013104 | Bacteria | 1085 |
| 402 | Ga0157370_10551105 | 3300013104 | Unclassified | 1057 |
| 403 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 404 | Ga0157369_10008134 | 3300013105 | Bacteria | 12027 |
| 405 | Ga0157369_10015578 | 3300013105 | Bacteria | 8567 |
| 406 | Ga0157369_10029590 | 3300013105 | Bacteria | 6051 |
| 407 | Ga0157369_10080689 | 3300013105 | Bacteria | 3483 |
| 408 | Ga0157369_10180230 | 3300013105 | Bacteria | 2223 |
| 409 | Ga0157369_10373796 | 3300013105 | Bacteria | 1479 |
| 410 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 411 | Ga0157374_10000629 | 3300013296 | Bacteria | 31059 |
| 412 | Ga0157374_10029588 | 3300013296 | Bacteria | 4962 |
| 413 | Ga0157374_10059605 | 3300013296 | Bacteria | 3570 |
| 414 | Ga0157374_10065532 | 3300013296 | Bacteria | 3411 |
| 415 | Ga0157374_10075514 | 3300013296 | Bacteria | 3184 |
| 416 | Ga0157374_10180871 | 3300013296 | Bacteria | 2060 |
| 417 | Ga0157374_10214026 | 3300013296 | Bacteria | 1890 |
| 418 | Ga0157374_10242203 | 3300013296 | Bacteria | 1773 |
| 419 | Ga0157374_10470460 | 3300013296 | Bacteria | 1259 |
| 420 | Ga0157374_10954962 | 3300013296 | Bacteria | 876 |
| 421 | Ga0157378_10006049 | 3300013297 | Bacteria | 10601 |
| 422 | Ga0157378_10006118 | 3300013297 | Bacteria | 10537 |
| 423 | Ga0157378_10006926 | 3300013297 | Bacteria | 9899 |
| 424 | Ga0157378_10007878 | 3300013297 | Bacteria | 9298 |
| 425 | Ga0157378_10012427 | 3300013297 | Bacteria | 7456 |
| 426 | Ga0157378_10025320 | 3300013297 | Bacteria | 5226 |
| 427 | Ga0157378_10057639 | 3300013297 | Bacteria | 3462 |
| 428 | Ga0157378_10072304 | 3300013297 | Bacteria | 3099 |
| 429 | Ga0157378_10139500 | 3300013297 | Bacteria | 2250 |
| 430 | Ga0163162_10000140 | 3300013306 | Bacteria | 65811 |
| 431 | Ga0163162_10000177 | 3300013306 | Bacteria | 58576 |
| 432 | Ga0163162_10000213 | 3300013306 | Bacteria | 53744 |
| 433 | Ga0163162_10000371 | 3300013306 | Bacteria | 40778 |
| 434 | Ga0163162_10002125 | 3300013306 | Bacteria | 18615 |
| 435 | Ga0163162_10004487 | 3300013306 | Bacteria | 13448 |
| 436 | Ga0163162_10008778 | 3300013306 | Bacteria | 9826 |
| 437 | Ga0163162_10011211 | 3300013306 | Bacteria | 8738 |
| 438 | Ga0163162_10022548 | 3300013306 | Bacteria | 6206 |
| 439 | Ga0163162_10041859 | 3300013306 | Bacteria | 4583 |
| 440 | Ga0163162_10044729 | 3300013306 | Bacteria | 4435 |
| 441 | Ga0163162_10050767 | 3300013306 | Bacteria | 4160 |
| 442 | Ga0163162_10058353 | 3300013306 | Bacteria | 3888 |
| 443 | Ga0163162_10150916 | 3300013306 | Unclassified | 2441 |
| 444 | Ga0163162_10207695 | 3300013306 | Bacteria | 2088 |
| 445 | Ga0163162_10255070 | 3300013306 | Bacteria | 1886 |
| 446 | Ga0163162_10836372 | 3300013306 | Bacteria | 1036 |
| 447 | Ga0157372_10002277 | 3300013307 | Bacteria | 20793 |
| 448 | Ga0157372_10007751 | 3300013307 | Bacteria | 11407 |
| 449 | Ga0157372_10008222 | 3300013307 | Bacteria | 11088 |
| 450 | Ga0157372_10016773 | 3300013307 | Bacteria | 7863 |
| 451 | Ga0157372_10028931 | 3300013307 | Bacteria | 6046 |
| 452 | Ga0157372_10088920 | 3300013307 | Bacteria | 3508 |
| 453 | Ga0157372_10096272 | 3300013307 | Bacteria | 3373 |
| 454 | Ga0157372_10104649 | 3300013307 | Bacteria | 3236 |
| 455 | Ga0157372_10133614 | 3300013307 | Unclassified | 2856 |
| 456 | Ga0157372_10193945 | 3300013307 | Bacteria | 2353 |
| 457 | Ga0157372_10290381 | 3300013307 | Unclassified | 1902 |
| 458 | Ga0157375_10000553 | 3300013308 | Bacteria | 33598 |
| 459 | Ga0157375_10001313 | 3300013308 | Bacteria | 21428 |
| 460 | Ga0157375_10050973 | 3300013308 | Bacteria | 4062 |
| 461 | Ga0157375_10054532 | 3300013308 | Bacteria | 3937 |
| 462 | Ga0157375_10074533 | 3300013308 | Bacteria | 3415 |
| 463 | Ga0157375_10160367 | 3300013308 | Unclassified | 2390 |
| 464 | Ga0157375_10321264 | 3300013308 | Bacteria | 1713 |
| 465 | Ga0157375_10353298 | 3300013308 | Bacteria | 1636 |
| 466 | Ga0157375_10531593 | 3300013308 | Bacteria | 1338 |
| 467 | Ga0163163_10000332 | 3300014325 | Bacteria | 45415 |
| 468 | Ga0163163_10000457 | 3300014325 | Bacteria | 37238 |
| 469 | Ga0163163_10000677 | 3300014325 | Bacteria | 29135 |
| 470 | Ga0163163_10044180 | 3300014325 | Bacteria | 4370 |
| 471 | Ga0163163_10128627 | 3300014325 | Bacteria | 2572 |
| 472 | Ga0163163_10232691 | 3300014325 | Bacteria | 1892 |
| 473 | Ga0163163_10353516 | 3300014325 | Bacteria | 1526 |
| 474 | Ga0163163_10767535 | 3300014325 | Bacteria | 1027 |
| 475 | Ga0157380_10000022 | 3300014326 | Bacteria | 114070 |
| 476 | Ga0157380_10046770 | 3300014326 | Unclassified | 3400 |
| 477 | Ga0157380_10079325 | 3300014326 | Bacteria | 2681 |
| 478 | Ga0157380_10088288 | 3300014326 | Bacteria | 2551 |
| 479 | Ga0182008_10000018 | 3300014497 | Bacteria | 230609 |
| 480 | Ga0182008_10000378 | 3300014497 | Bacteria | 34433 |
| 481 | Ga0182008_10009414 | 3300014497 | Bacteria | 5271 |
| 482 | Ga0182008_10033160 | 3300014497 | Bacteria | 2592 |
| 483 | Ga0157377_10060152 | 3300014745 | Bacteria | 2168 |
| 484 | Ga0157379_10000340 | 3300014968 | Bacteria | 37587 |
| 485 | Ga0157379_10042488 | 3300014968 | Bacteria | 4059 |
| 486 | Ga0157379_10045025 | 3300014968 | Bacteria | 3939 |
| 487 | Ga0157379_10080869 | 3300014968 | Bacteria | 2911 |
| 488 | Ga0157379_10168863 | 3300014968 | Bacteria | 1975 |
| 489 | Ga0157379_10268519 | 3300014968 | Bacteria | 1551 |
| 490 | Ga0157376_10000491 | 3300014969 | Bacteria | 25555 |
| 491 | Ga0157376_10000771 | 3300014969 | Bacteria | 20899 |
| 492 | Ga0157376_10003394 | 3300014969 | Bacteria | 10966 |
| 493 | Ga0157376_10058992 | 3300014969 | Bacteria | 3217 |
| 494 | Ga0157376_10098268 | 3300014969 | Bacteria | 2552 |
| 495 | Ga0157376_10131972 | 3300014969 | Bacteria | 2230 |
| 496 | Ga0157376_10248818 | 3300014969 | Bacteria | 1659 |
| 497 | Ga0157376_10389068 | 3300014969 | Bacteria | 1345 |
| 498 | Ga0182006_1000322 | 3300015261 | Bacteria | 41718 |
| 499 | Ga0182006_1000382 | 3300015261 | Bacteria | 36661 |
| 500 | Ga0182006_1007681 | 3300015261 | Bacteria | 4925 |
| 501 | Ga0182006_1008844 | 3300015261 | Bacteria | 4548 |
| 502 | Ga0182006_1044752 | 3300015261 | Bacteria | 1725 |
| 503 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 504 | Ga0182005_1000131 | 3300015265 | Bacteria | 53401 |
| 505 | Ga0183373_1006 | 3300015682 | Bacteria | 328276 |
| 506 | Ga0163161_10000153 | 3300017792 | Bacteria | 63614 |
| 507 | Ga0163161_10001740 | 3300017792 | Bacteria | 15937 |
| 508 | Ga0163161_10002015 | 3300017792 | Bacteria | 14700 |
| 509 | Ga0163161_10005625 | 3300017792 | Bacteria | 8693 |
| 510 | Ga0163161_10006269 | 3300017792 | Bacteria | 8233 |
| 511 | Ga0163161_10014448 | 3300017792 | Bacteria | 5497 |
| 512 | Ga0163161_10022817 | 3300017792 | Bacteria | 4409 |
| 513 | Ga0163161_10030675 | 3300017792 | Bacteria | 3828 |
| 514 | Ga0163161_10274892 | 3300017792 | Bacteria | 1319 |
| 515 | Ga0163161_10295845 | 3300017792 | Bacteria | 1274 |
| 516 | Ga0206352_10602261 | 3300020078 | Bacteria | 1002 |
| 517 | Ga0213876_10001070 | 3300021384 | Bacteria | 17605 |
| 518 | Ga0209436_102245 | 3300025208 | Bacteria | 5974 |
| 519 | Ga0209436_103275 | 3300025208 | Bacteria | 4367 |
| 520 | Ga0209258_100219 | 3300025242 | Bacteria | 108974 |
| 521 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 522 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 523 | Ga0209646_1000770 | 3300025246 | Bacteria | 11079 |
| 524 | Ga0209148_1000283 | 3300025254 | Bacteria | 77780 |
| 525 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 526 | Ga0207666_1004201 | 3300025271 | Bacteria | 1799 |
| 527 | Ga0209673_1000082 | 3300025273 | Bacteria | 219716 |
| 528 | Ga0209130_1003990 | 3300025284 | Bacteria | 5888 |
| 529 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 530 | Ga0209564_1008534 | 3300025295 | Bacteria | 5039 |
| 531 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 532 | Ga0209758_1011315 | 3300025297 | Bacteria | 5187 |
| 533 | Ga0209758_1012324 | 3300025297 | Bacteria | 4798 |
| 534 | Ga0209050_1000555 | 3300025298 | Bacteria | 61428 |
| 535 | Ga0207426_1000230 | 3300025302 | Bacteria | 128357 |
| 536 | Ga0207426_1000493 | 3300025302 | Bacteria | 59050 |
| 537 | Ga0207426_1000514 | 3300025302 | Bacteria | 56462 |
| 538 | Ga0207426_1000883 | 3300025302 | Bacteria | 30996 |
| 539 | Ga0209051_1037251 | 3300025303 | Bacteria | 1786 |
| 540 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 541 | Ga0207697_10061167 | 3300025315 | Bacteria | 1566 |
| 542 | Ga0207697_10068184 | 3300025315 | Unclassified | 1488 |
| 543 | Ga0207656_10005150 | 3300025321 | Bacteria | 4596 |
| 544 | Ga0207682_10009398 | 3300025893 | Bacteria | 3860 |
| 545 | Ga0207682_10108183 | 3300025893 | Bacteria | 1222 |
| 546 | Ga0207642_10041343 | 3300025899 | Unclassified | 2018 |
| 547 | Ga0207642_10119113 | 3300025899 | Bacteria | 1358 |
| 548 | Ga0207710_10000804 | 3300025900 | Bacteria | 16999 |
| 549 | Ga0207710_10016472 | 3300025900 | Unclassified | 3128 |
| 550 | Ga0207710_10093631 | 3300025900 | Bacteria | 1409 |
| 551 | Ga0207688_10007738 | 3300025901 | Bacteria | 5853 |
| 552 | Ga0207688_10011124 | 3300025901 | Bacteria | 4896 |
| 553 | Ga0207680_10000031 | 3300025903 | Bacteria | 77871 |
| 554 | Ga0207680_10001651 | 3300025903 | Bacteria | 10542 |
| 555 | Ga0207680_10041946 | 3300025903 | Bacteria | 2673 |
| 556 | Ga0207680_10047382 | 3300025903 | Bacteria | 2547 |
| 557 | Ga0207680_10162839 | 3300025903 | Unclassified | 1497 |
| 558 | Ga0207680_10210022 | 3300025903 | Unclassified | 1330 |
| 559 | Ga0207647_10000288 | 3300025904 | Bacteria | 41316 |
| 560 | Ga0207647_10015219 | 3300025904 | Bacteria | 5282 |
| 561 | Ga0207647_10065300 | 3300025904 | Bacteria | 2210 |
| 562 | Ga0207645_10000713 | 3300025907 | Bacteria | 27669 |
| 563 | Ga0207645_10001819 | 3300025907 | Bacteria | 17206 |
| 564 | Ga0207645_10042582 | 3300025907 | Unclassified | 2906 |
| 565 | Ga0207643_10010031 | 3300025908 | Bacteria | 5092 |
| 566 | Ga0207705_10119645 | 3300025909 | Bacteria | 1953 |
| 567 | Ga0207705_10195836 | 3300025909 | Bacteria | 1530 |
| 568 | Ga0207654_10001314 | 3300025911 | Bacteria | 13252 |
| 569 | Ga0207654_10003003 | 3300025911 | Bacteria | 8561 |
| 570 | Ga0207707_10000323 | 3300025912 | Bacteria | 50505 |
| 571 | Ga0207695_10000130 | 3300025913 | Bacteria | 224214 |
| 572 | Ga0207695_10000170 | 3300025913 | Bacteria | 192469 |
| 573 | Ga0207695_10003034 | 3300025913 | Bacteria | 24093 |
| 574 | Ga0207695_10004097 | 3300025913 | Bacteria | 20033 |
| 575 | Ga0207695_10011079 | 3300025913 | Bacteria | 10950 |
| 576 | Ga0207695_10012565 | 3300025913 | Bacteria | 10148 |
| 577 | Ga0207695_10037565 | 3300025913 | Bacteria | 5225 |
| 578 | Ga0207695_10047325 | 3300025913 | Bacteria | 4553 |
| 579 | Ga0207695_10130257 | 3300025913 | Bacteria | 2473 |
| 580 | Ga0207695_10173850 | 3300025913 | Bacteria | 2077 |
| 581 | Ga0207695_10179390 | 3300025913 | Bacteria | 2039 |
| 582 | Ga0207671_10000030 | 3300025914 | Bacteria | 248197 |
| 583 | Ga0207671_10004377 | 3300025914 | Bacteria | 13538 |
| 584 | Ga0207671_10005384 | 3300025914 | Bacteria | 11818 |
| 585 | Ga0207671_10011928 | 3300025914 | Bacteria | 7027 |
| 586 | Ga0207671_10012131 | 3300025914 | Bacteria | 6955 |
| 587 | Ga0207671_10020567 | 3300025914 | Bacteria | 5022 |
| 588 | Ga0207671_10124741 | 3300025914 | Bacteria | 1971 |
| 589 | Ga0207671_10275579 | 3300025914 | Bacteria | 1326 |
| 590 | Ga0207660_10017192 | 3300025917 | Bacteria | 4799 |
| 591 | Ga0207660_10174603 | 3300025917 | Bacteria | 1665 |
| 592 | Ga0207662_10011934 | 3300025918 | Bacteria | 4832 |
| 593 | Ga0207657_10003020 | 3300025919 | Bacteria | 18018 |
| 594 | Ga0207657_10007892 | 3300025919 | Bacteria | 10857 |
| 595 | Ga0207657_10013457 | 3300025919 | Bacteria | 8026 |
| 596 | Ga0207657_10058434 | 3300025919 | Bacteria | 3319 |
| 597 | Ga0207657_10107784 | 3300025919 | Bacteria | 2304 |
| 598 | Ga0207657_10203664 | 3300025919 | Bacteria | 1591 |
| 599 | Ga0207649_10013964 | 3300025920 | Bacteria | 4493 |
| 600 | Ga0207649_10111205 | 3300025920 | Unclassified | 1830 |
| 601 | Ga0207652_10000942 | 3300025921 | Bacteria | 27351 |
| 602 | Ga0207652_10015975 | 3300025921 | Bacteria | 6120 |
| 603 | Ga0207652_10031715 | 3300025921 | Bacteria | 4439 |
| 604 | Ga0207681_10109044 | 3300025923 | Bacteria | 2011 |
| 605 | Ga0207681_10179303 | 3300025923 | Unclassified | 1612 |
| 606 | Ga0207694_10020325 | 3300025924 | Bacteria | 5022 |
| 607 | Ga0207694_10031981 | 3300025924 | Bacteria | 4024 |
| 608 | Ga0207650_10105187 | 3300025925 | Bacteria | 2178 |
| 609 | Ga0207650_10200158 | 3300025925 | Bacteria | 1599 |
| 610 | Ga0207650_10272361 | 3300025925 | Bacteria | 1376 |
| 611 | Ga0207659_10014768 | 3300025926 | Bacteria | 5047 |
| 612 | Ga0207659_10057168 | 3300025926 | Bacteria | 2796 |
| 613 | Ga0207659_10115671 | 3300025926 | Bacteria | 2046 |
| 614 | Ga0207659_10130354 | 3300025926 | Bacteria | 1940 |
| 615 | Ga0207659_10483281 | 3300025926 | Bacteria | 1047 |
| 616 | Ga0207644_10003616 | 3300025931 | Bacteria | 10019 |
| 617 | Ga0207644_10024353 | 3300025931 | Bacteria | 4154 |
| 618 | Ga0207644_10219411 | 3300025931 | Bacteria | 1507 |
| 619 | Ga0207644_10296907 | 3300025931 | Unclassified | 1301 |
| 620 | Ga0207690_10044183 | 3300025932 | Bacteria | 2935 |
| 621 | Ga0207706_10001885 | 3300025933 | Bacteria | 20569 |
| 622 | Ga0207706_10002590 | 3300025933 | Bacteria | 17616 |
| 623 | Ga0207706_10024967 | 3300025933 | Bacteria | 5358 |
| 624 | Ga0207706_10096610 | 3300025933 | Bacteria | 2598 |
| 625 | Ga0207706_10574188 | 3300025933 | Bacteria | 970 |
| 626 | Ga0207686_10003787 | 3300025934 | Bacteria | 8121 |
| 627 | Ga0207686_10043510 | 3300025934 | Unclassified | 2752 |
| 628 | Ga0207686_10113308 | 3300025934 | Bacteria | 1833 |
| 629 | Ga0207686_10139321 | 3300025934 | Bacteria | 1675 |
| 630 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 631 | Ga0207670_10023950 | 3300025936 | Bacteria | 3808 |
| 632 | Ga0207670_10056611 | 3300025936 | Bacteria | 2655 |
| 633 | Ga0207669_10194024 | 3300025937 | Unclassified | 1468 |
| 634 | Ga0207669_10195968 | 3300025937 | Bacteria | 1462 |
| 635 | Ga0207704_10004827 | 3300025938 | Bacteria | 6186 |
| 636 | Ga0207704_10106478 | 3300025938 | Bacteria | 1884 |
| 637 | Ga0207704_10138656 | 3300025938 | Bacteria | 1697 |
| 638 | Ga0207691_10000228 | 3300025940 | Bacteria | 54500 |
| 639 | Ga0207691_10005384 | 3300025940 | Bacteria | 12354 |
| 640 | Ga0207691_10121506 | 3300025940 | Bacteria | 2314 |
| 641 | Ga0207691_10138922 | 3300025940 | Bacteria | 2142 |
| 642 | Ga0207691_10344927 | 3300025940 | Bacteria | 1274 |
| 643 | Ga0207689_10001966 | 3300025942 | Bacteria | 19411 |
| 644 | Ga0207689_10003756 | 3300025942 | Bacteria | 13835 |
| 645 | Ga0207689_10008218 | 3300025942 | Bacteria | 9094 |
| 646 | Ga0207689_10010467 | 3300025942 | Bacteria | 7988 |
| 647 | Ga0207689_10018291 | 3300025942 | Bacteria | 5914 |
| 648 | Ga0207689_10018417 | 3300025942 | Bacteria | 5892 |
| 649 | Ga0207689_10026108 | 3300025942 | Bacteria | 4891 |
| 650 | Ga0207689_10032751 | 3300025942 | Bacteria | 4321 |
| 651 | Ga0207689_10155145 | 3300025942 | Unclassified | 1887 |
| 652 | Ga0207689_10570749 | 3300025942 | Bacteria | 951 |
| 653 | Ga0207661_10046137 | 3300025944 | Bacteria | 3454 |
| 654 | Ga0207661_10151429 | 3300025944 | Bacteria | 2005 |
| 655 | Ga0207661_10176161 | 3300025944 | Bacteria | 1865 |
| 656 | Ga0207679_10001677 | 3300025945 | Bacteria | 13793 |
| 657 | Ga0207679_10011282 | 3300025945 | Bacteria | 5779 |
| 658 | Ga0207679_10385025 | 3300025945 | Bacteria | 1230 |
| 659 | Ga0207679_10543041 | 3300025945 | Bacteria | 1042 |
| 660 | Ga0207667_10004780 | 3300025949 | Bacteria | 16560 |
| 661 | Ga0207667_10005051 | 3300025949 | Bacteria | 16114 |
| 662 | Ga0207667_10024155 | 3300025949 | Bacteria | 6679 |
| 663 | Ga0207667_10035134 | 3300025949 | Bacteria | 5378 |
| 664 | Ga0207667_10035973 | 3300025949 | Bacteria | 5310 |
| 665 | Ga0207667_10762084 | 3300025949 | Bacteria | 966 |
| 666 | Ga0207651_10000190 | 3300025960 | Bacteria | 26708 |
| 667 | Ga0207651_10154886 | 3300025960 | Bacteria | 1789 |
| 668 | Ga0207651_10203249 | 3300025960 | Unclassified | 1589 |
| 669 | Ga0207651_10250917 | 3300025960 | Bacteria | 1448 |
| 670 | Ga0207651_10258081 | 3300025960 | Bacteria | 1429 |
| 671 | Ga0207712_10014998 | 3300025961 | Bacteria | 4993 |
| 672 | Ga0207712_10032303 | 3300025961 | Bacteria | 3533 |
| 673 | Ga0207712_10045084 | 3300025961 | Bacteria | 3052 |
| 674 | Ga0207712_10062100 | 3300025961 | Unclassified | 2654 |
| 675 | Ga0207712_10132946 | 3300025961 | Bacteria | 1898 |
| 676 | Ga0207712_10225630 | 3300025961 | Bacteria | 1500 |
| 677 | Ga0207712_10266743 | 3300025961 | Bacteria | 1391 |
| 678 | Ga0207712_10365795 | 3300025961 | Unclassified | 1203 |
| 679 | Ga0207712_10412282 | 3300025961 | Bacteria | 1138 |
| 680 | Ga0207668_10012446 | 3300025972 | Bacteria | 5208 |
| 681 | Ga0207668_10421421 | 3300025972 | Bacteria | 1133 |
| 682 | Ga0207640_10021295 | 3300025981 | Bacteria | 3863 |
| 683 | Ga0207640_10057686 | 3300025981 | Unclassified | 2555 |
| 684 | Ga0207640_10064402 | 3300025981 | Bacteria | 2440 |
| 685 | Ga0207640_10126770 | 3300025981 | Bacteria | 1839 |
| 686 | Ga0207640_10580324 | 3300025981 | Unclassified | 946 |
| 687 | Ga0207658_10000176 | 3300025986 | Bacteria | 68501 |
| 688 | Ga0207658_10031222 | 3300025986 | Bacteria | 3781 |
| 689 | Ga0207658_10033227 | 3300025986 | Bacteria | 3679 |
| 690 | Ga0207658_10155566 | 3300025986 | Bacteria | 1868 |
| 691 | Ga0207658_10296265 | 3300025986 | Bacteria | 1392 |
| 692 | Ga0207677_10005124 | 3300026023 | Bacteria | 7090 |
| 693 | Ga0207677_10107854 | 3300026023 | Bacteria | 2066 |
| 694 | Ga0207677_10282990 | 3300026023 | Bacteria | 1362 |
| 695 | Ga0207677_10292051 | 3300026023 | Bacteria | 1343 |
| 696 | Ga0207677_10324851 | 3300026023 | Unclassified | 1280 |
| 697 | Ga0207703_10000433 | 3300026035 | Bacteria | 44015 |
| 698 | Ga0207703_10036338 | 3300026035 | Bacteria | 3921 |
| 699 | Ga0207703_10187141 | 3300026035 | Bacteria | 1831 |
| 700 | Ga0207639_10028406 | 3300026041 | Bacteria | 4083 |
| 701 | Ga0207639_10029884 | 3300026041 | Bacteria | 3994 |
| 702 | Ga0207639_10035919 | 3300026041 | Bacteria | 3669 |
| 703 | Ga0207639_10104095 | 3300026041 | Bacteria | 2301 |
| 704 | Ga0207639_10111906 | 3300026041 | Bacteria | 2227 |
| 705 | Ga0207639_10118486 | 3300026041 | Bacteria | 2171 |
| 706 | Ga0207639_10143323 | 3300026041 | Bacteria | 1993 |
| 707 | Ga0207639_10224074 | 3300026041 | Bacteria | 1626 |
| 708 | Ga0207639_10316101 | 3300026041 | Bacteria | 1385 |
| 709 | Ga0207678_10088678 | 3300026067 | Bacteria | 2644 |
| 710 | Ga0207702_10041909 | 3300026078 | Bacteria | 3839 |
| 711 | Ga0207702_10062526 | 3300026078 | Bacteria | 3180 |
| 712 | Ga0207702_10139589 | 3300026078 | Bacteria | 2191 |
| 713 | Ga0207641_10000048 | 3300026088 | Bacteria | 178206 |
| 714 | Ga0207641_10000601 | 3300026088 | Bacteria | 39530 |
| 715 | Ga0207641_10002006 | 3300026088 | Bacteria | 19406 |
| 716 | Ga0207641_10037149 | 3300026088 | Bacteria | 4067 |
| 717 | Ga0207641_10037593 | 3300026088 | Bacteria | 4044 |
| 718 | Ga0207641_10142918 | 3300026088 | Bacteria | 2161 |
| 719 | Ga0207641_10220204 | 3300026088 | Bacteria | 1760 |
| 720 | Ga0207641_10289879 | 3300026088 | Bacteria | 1542 |
| 721 | Ga0207641_10805310 | 3300026088 | Bacteria | 929 |
| 722 | Ga0207648_10006817 | 3300026089 | Bacteria | 11319 |
| 723 | Ga0207648_10020665 | 3300026089 | Bacteria | 5927 |
| 724 | Ga0207648_10028862 | 3300026089 | Bacteria | 4917 |
| 725 | Ga0207648_10067423 | 3300026089 | Bacteria | 3119 |
| 726 | Ga0207648_10273293 | 3300026089 | Bacteria | 1510 |
| 727 | Ga0207676_10001236 | 3300026095 | Bacteria | 19009 |
| 728 | Ga0207676_10044893 | 3300026095 | Unclassified | 3411 |
| 729 | Ga0207676_10093368 | 3300026095 | Bacteria | 2477 |
| 730 | Ga0207676_10196680 | 3300026095 | Bacteria | 1778 |
| 731 | Ga0207676_10197912 | 3300026095 | Bacteria | 1773 |
| 732 | Ga0207676_10225999 | 3300026095 | Bacteria | 1670 |
| 733 | Ga0207676_10464196 | 3300026095 | Bacteria | 1196 |
| 734 | Ga0207676_10680237 | 3300026095 | Bacteria | 995 |
| 735 | Ga0207674_10007789 | 3300026116 | Bacteria | 12460 |
| 736 | Ga0207674_10015679 | 3300026116 | Bacteria | 8319 |
| 737 | Ga0207674_10106874 | 3300026116 | Bacteria | 2775 |
| 738 | Ga0207674_10111062 | 3300026116 | Bacteria | 2716 |
| 739 | Ga0207675_100007107 | 3300026118 | Bacteria | 10580 |
| 740 | Ga0207675_100038046 | 3300026118 | Bacteria | 4490 |
| 741 | Ga0207675_100130205 | 3300026118 | Bacteria | 2385 |
| 742 | Ga0207683_10008436 | 3300026121 | Bacteria | 8820 |
| 743 | Ga0207683_10013033 | 3300026121 | Bacteria | 7095 |
| 744 | Ga0207683_10152583 | 3300026121 | Bacteria | 2085 |
| 745 | Ga0207698_10021707 | 3300026142 | Bacteria | 4447 |
| 746 | Ga0207698_10026986 | 3300026142 | Bacteria | 4071 |
| 747 | Ga0207698_10049049 | 3300026142 | Bacteria | 3210 |
| 748 | Ga0207698_10132979 | 3300026142 | Bacteria | 2129 |
| 749 | Ga0207698_10257712 | 3300026142 | Bacteria | 1600 |
| 750 | Ga0207698_10323409 | 3300026142 | Bacteria | 1445 |
| 751 | Ga0207698_10372766 | 3300026142 | Bacteria | 1355 |
| 752 | Ga0207698_10454248 | 3300026142 | Unclassified | 1237 |
| 753 | Ga0207698_10456237 | 3300026142 | Bacteria | 1235 |
| 754 | Ga0210000_1022266 | 3300027462 | Bacteria | 972 |
| 755 | Ga0209995_1005032 | 3300027471 | Unclassified | 2122 |
| 756 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 757 | Ga0268266_10007977 | 3300028379 | Bacteria | 9463 |
| 758 | Ga0268266_10013344 | 3300028379 | Bacteria | 7078 |
| 759 | Ga0268265_10087313 | 3300028380 | Bacteria | 2481 |
| 760 | Ga0268265_10226556 | 3300028380 | Bacteria | 1640 |
| 761 | Ga0268264_10000109 | 3300028381 | Bacteria | 208477 |
| 762 | Ga0268264_10001271 | 3300028381 | Bacteria | 23942 |
| 763 | Ga0268264_10001954 | 3300028381 | Bacteria | 18515 |
| 764 | Ga0268264_10004274 | 3300028381 | Bacteria | 12193 |
| 765 | Ga0268264_10060376 | 3300028381 | Bacteria | 3178 |
| 766 | Ga0265318_10005180 | 3300028577 | Bacteria | 6156 |
| 767 | Ga0265323_10000975 | 3300028653 | Bacteria | 14931 |
| 768 | Ga0307517_10006013 | 3300028786 | Bacteria | 18085 |
| 769 | Ga0307517_10088779 | 3300028786 | Bacteria | 2552 |
| 770 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 771 | Ga0307515_10000072 | 3300028794 | Bacteria | 237798 |
| 772 | Ga0307515_10249372 | 3300028794 | Bacteria | 1531 |
| 773 | Ga0265338_10000319 | 3300028800 | Bacteria | 87159 |
| 774 | Ga0265338_10128534 | 3300028800 | Bacteria | 2006 |
| 775 | Ga0307511_10004747 | 3300030521 | Bacteria | 13895 |
| 776 | Ga0316177_1057164 | 3300030731 | Bacteria | 9539 |
| 777 | Ga0316176_1020373 | 3300030732 | Bacteria | 27096 |
| 778 | Ga0316183_1111132 | 3300030742 | Bacteria | 56687 |
| 779 | Ga0316181_1134699 | 3300030744 | Bacteria | 10028 |
| 780 | Ga0316182_1300351 | 3300030745 | Bacteria | 1293 |
| 781 | Ga0265332_10002898 | 3300031238 | Bacteria | 8474 |
| 782 | Ga0265325_10086235 | 3300031241 | Bacteria | 1554 |
| 783 | Ga0265340_10126731 | 3300031247 | Bacteria | 1173 |
| 784 | Ga0265339_10051425 | 3300031249 | Bacteria | 2248 |
| 785 | Ga0265331_10007182 | 3300031250 | Bacteria | 6475 |
| 786 | Ga0265327_10000093 | 3300031251 | Bacteria | 195220 |
| 787 | Ga0265327_10000148 | 3300031251 | Bacteria | 151952 |
| 788 | Ga0265327_10105839 | 3300031251 | Bacteria | 1351 |
| 789 | Ga0265316_10000618 | 3300031344 | Bacteria | 39590 |
| 790 | Ga0265316_10001145 | 3300031344 | Bacteria | 28776 |
| 791 | Ga0265316_10005421 | 3300031344 | Bacteria | 12395 |
| 792 | Ga0307509_10025075 | 3300031507 | Bacteria | 6666 |
| 793 | Ga0307408_100000305 | 3300031548 | Bacteria | 47032 |
| 794 | Ga0307508_10001286 | 3300031616 | Bacteria | 28488 |
| 795 | Ga0316579_10068300 | 3300031691 | Bacteria | 1681 |
| 796 | Ga0265314_10058229 | 3300031711 | Bacteria | 2648 |
| 797 | Ga0265342_10016089 | 3300031712 | Bacteria | 4898 |
| 798 | Ga0316576_10099200 | 3300031727 | Bacteria | 2175 |
| 799 | Ga0316576_10146162 | 3300031727 | Bacteria | 1781 |
| 800 | Ga0316578_10110364 | 3300031728 | Bacteria | 1652 |
| 801 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 802 | Ga0316577_10099416 | 3300031733 | Unclassified | 1630 |
| 803 | Ga0307410_10140025 | 3300031852 | Unclassified | 1789 |
| 804 | Ga0307407_10000042 | 3300031903 | Bacteria | 65025 |
| 805 | Ga0307412_10000077 | 3300031911 | Bacteria | 96375 |
| 806 | Ga0307412_10003261 | 3300031911 | Bacteria | 9011 |
| 807 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 808 | Ga0307414_10002825 | 3300032004 | Bacteria | 9156 |
| 809 | Ga0307414_10011145 | 3300032004 | Bacteria | 5259 |
| 810 | Ga0307414_10054109 | 3300032004 | Bacteria | 2803 |
| 811 | Ga0307414_10055748 | 3300032004 | Bacteria | 2769 |
| 812 | Ga0307414_10491851 | 3300032004 | Bacteria | 1084 |
| 813 | Ga0307414_10634722 | 3300032004 | Bacteria | 961 |
| 814 | Ga0316585_10019775 | 3300032137 | Bacteria | 2056 |
| 815 | Ga0373946_0212995 | 3300035171 | Bacteria | 930 |
| 816 | Ga0373955_0039844 | 3300035172 | Bacteria | 2510 |
| 817 | Ga0316574_0132073 | 3300035398 | Bacteria | 1607 |
| 818 | Ga0373924_0007228 | 3300035410 | Bacteria | 4003 |
| 819 | Ga0373933_0062270 | 3300035724 | Bacteria | 2253 |
| 820 | Ga0373947_0021674 | 3300035725 | Bacteria | 3721 |
| 821 | Ga0373947_0058903 | 3300035725 | Bacteria | 2328 |
| 822 | Ga0373937_0005153 | 3300036401 | Bacteria | 11144 |
| 823 | Ga0373937_0168582 | 3300036401 | Bacteria | 2054 |
| 824 | Ga0316582_0053693 | 3300036647 | Bacteria | 2564 |
| 825 | Ga0316584_0001570 | 3300036712 | Bacteria | 13862 |
| 826 | Ga0316584_0005044 | 3300036712 | Bacteria | 8799 |
| 827 | Ga0395899_0003607 | 3300037312 | Bacteria | 12242 |
| 828 | Ga0395899_0180455 | 3300037312 | Bacteria | 1482 |
| 829 | Ga0395900_0016503 | 3300037418 | Bacteria | 7532 |
| 830 | Ga0395900_0046549 | 3300037418 | Bacteria | 4467 |
| 831 | Ga0395900_0109393 | 3300037418 | Bacteria | 2839 |
| 832 | Ga0395900_0321332 | 3300037418 | Bacteria | 1528 |
| 833 | Ga0395900_0337680 | 3300037418 | Bacteria | 1483 |
| 834 | Ga0395900_0814931 | 3300037418 | Bacteria | 861 |
| 835 | Ga0395898_0001425 | 3300037466 | Bacteria | 34011 |
| 836 | Ga0395898_0071097 | 3300037466 | Unclassified | 3363 |
| 837 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 838 | Ga0395905_0073040 | 3300037471 | Bacteria | 3215 |
| 839 | Ga0395905_0092206 | 3300037471 | Bacteria | 2841 |
| 840 | Ga0395901_0006414 | 3300038443 | Bacteria | 11920 |
| 841 | Ga0395901_0329352 | 3300038443 | Bacteria | 1579 |
| 842 | Ga0400488_57128 | 3300038741 | Bacteria | 1089 |
| 843 | Ga0400483_094790 | 3300039062 | Bacteria | 31668 |
| 844 | Ga0400489_27519 | 3300039093 | Bacteria | 3718 |
| 845 | Ga0436365_0480954 | 3300039437 | Bacteria | 25378 |
| 846 | Ga0436365_0785409 | 3300039437 | Bacteria | 17126 |
| 847 | Ga0439436_0013332 | 3300041404 | Bacteria | 2486 |
| 848 | Ga0439465_0063206 | 3300041413 | Bacteria | 1229 |
| 849 | Ga0451795_0125519 | 3300041456 | Bacteria | 1716 |
| 850 | Ga0451843_1146337 | 3300041509 | Bacteria | 1367 |
| 851 | Ga0451855_0550985 | 3300041511 | Bacteria | 2393 |
| 852 | Ga0439431_0004736 | 3300041997 | Bacteria | 2994 |
| 853 | Ga0439431_0035757 | 3300041997 | Bacteria | 1249 |
| 854 | Ga0439449_0118971 | 3300042007 | Bacteria | 980 |
| 855 | Ga0439457_001586 | 3300042014 | Bacteria | 6789 |
| 856 | Ga0439462_0023582 | 3300042015 | Bacteria | 1613 |
| 857 | Ga0451577_0000754 | 3300042876 | Bacteria | 49345 |
| 858 | Ga0451577_0010712 | 3300042876 | Bacteria | 8730 |
| 859 | Ga0451577_0038696 | 3300042876 | Bacteria | 4289 |
| 860 | Ga0451577_0043507 | 3300042876 | Bacteria | 4023 |
| 861 | Ga0451577_0053904 | 3300042876 | Bacteria | 3590 |
| 862 | Ga0451577_0090796 | 3300042876 | Unclassified | 2726 |
| 863 | Ga0451577_0153065 | 3300042876 | Bacteria | 2075 |
| 864 | Ga0451577_0252122 | 3300042876 | Bacteria | 1598 |
| 865 | Ga0451577_0400323 | 3300042876 | Bacteria | 1246 |
| 866 | Ga0451577_0604840 | 3300042876 | Bacteria | 995 |
| 867 | Ga0451577_0640499 | 3300042876 | Bacteria | 964 |
| 868 | Ga0466969_0000665 | 3300044656 | Bacteria | 18684 |
| 869 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 870 | Ga0466972_0000064 | 3300044658 | Bacteria | 104558 |
| 871 | Ga0466972_0000347 | 3300044658 | Bacteria | 25337 |
| 872 | Ga0466972_0032268 | 3300044658 | Bacteria | 2572 |
| 873 | Ga0466972_0058744 | 3300044658 | Bacteria | 1846 |
| 874 | Ga0453683_0000227 | 3300044673 | Bacteria | 75124 |
| 875 | Ga0453683_0001274 | 3300044673 | Bacteria | 22351 |
| 876 | Ga0453683_0116716 | 3300044673 | Bacteria | 1679 |
| 877 | Ga0466965_0028230 | 3300044683 | Bacteria | 2726 |
| 878 | Ga0466966_0000806 | 3300044684 | Bacteria | 19961 |
| 879 | Ga0453684_0000724 | 3300044712 | Bacteria | 116382 |
| 880 | Ga0453684_0001194 | 3300044712 | Bacteria | 80254 |
| 881 | Ga0453684_0001431 | 3300044712 | Bacteria | 68233 |
| 882 | Ga0453684_0002120 | 3300044712 | Bacteria | 49982 |
| 883 | Ga0453684_0004008 | 3300044712 | Bacteria | 32105 |
| 884 | Ga0453684_0004378 | 3300044712 | Bacteria | 29932 |
| 885 | Ga0453684_0004818 | 3300044712 | Bacteria | 27744 |
| 886 | Ga0453684_0007236 | 3300044712 | Bacteria | 20571 |
| 887 | Ga0453684_0019698 | 3300044712 | Bacteria | 10244 |
| 888 | Ga0453684_0024450 | 3300044712 | Bacteria | 8828 |
| 889 | Ga0453684_0040458 | 3300044712 | Bacteria | 6329 |
| 890 | Ga0453684_0041364 | 3300044712 | Bacteria | 6235 |
| 891 | Ga0453684_0047360 | 3300044712 | Bacteria | 5703 |
| 892 | Ga0453684_0050218 | 3300044712 | Bacteria | 5490 |
| 893 | Ga0453684_0064241 | 3300044712 | Bacteria | 4689 |
| 894 | Ga0453684_0071263 | 3300044712 | Bacteria | 4395 |
| 895 | Ga0453684_0096856 | 3300044712 | Bacteria | 3623 |
| 896 | Ga0453684_0143346 | 3300044712 | Unclassified | 2849 |
| 897 | Ga0453684_0144695 | 3300044712 | Bacteria | 2833 |
| 898 | Ga0453684_0179836 | 3300044712 | Bacteria | 2484 |
| 899 | Ga0453684_0189010 | 3300044712 | Unclassified | 2410 |
| 900 | Ga0453684_0262231 | 3300044712 | Bacteria | 1979 |
| 901 | Ga0453684_0275112 | 3300044712 | Bacteria | 1922 |
| 902 | Ga0453684_0315998 | 3300044712 | Bacteria | 1770 |
| 903 | Ga0453684_0469802 | 3300044712 | Bacteria | 1397 |
| 904 | Ga0453684_0707475 | 3300044712 | Unclassified | 1094 |
| 905 | Ga0453684_0858102 | 3300044712 | Bacteria | 975 |
| 906 | Ga0466968_0010784 | 3300044735 | Bacteria | 3550 |
| 907 | Ga0466970_0000094 | 3300044765 | Bacteria | 37832 |
| 908 | Ga0466970_0028240 | 3300044765 | Bacteria | 2947 |
| 909 | Ga0466957_0000070 | 3300044842 | Bacteria | 39824 |
| 910 | Ga0466957_0009587 | 3300044842 | Bacteria | 5530 |
| 911 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 912 | Ga0466959_0071946 | 3300045049 | Bacteria | 2503 |
| 913 | Ga0451576_0001102 | 3300045051 | Bacteria | 49331 |
| 914 | Ga0451576_0002021 | 3300045051 | Bacteria | 32067 |
| 915 | Ga0451576_0005479 | 3300045051 | Bacteria | 15888 |
| 916 | Ga0451576_0042016 | 3300045051 | Bacteria | 4827 |
| 917 | Ga0451576_0074409 | 3300045051 | Bacteria | 3535 |
| 918 | Ga0451576_0108417 | 3300045051 | Bacteria | 2889 |
| 919 | Ga0451576_0190156 | 3300045051 | Unclassified | 2144 |
| 920 | Ga0451576_0198816 | 3300045051 | Unclassified | 2094 |
| 921 | Ga0451576_0207112 | 3300045051 | Bacteria | 2048 |
| 922 | Ga0451576_0797954 | 3300045051 | Bacteria | 991 |
| 923 | Ga0466967_0059978 | 3300045976 | Bacteria | 3370 |
| 924 | Ga0495627_001544 | 3300046453 | Bacteria | 13158 |
| 925 | Ga0495627_089317 | 3300046453 | Bacteria | 887 |
| 926 | Ga0495638_0116054 | 3300046460 | Bacteria | 1586 |
| 927 | Ga0495653_0112063 | 3300046463 | Bacteria | 1959 |
| 928 | Ga0495650_0067874 | 3300046471 | Unclassified | 1408 |
| 929 | Ga0495580_0143758 | 3300046472 | Bacteria | 1653 |
| 930 | Ga0495580_0253227 | 3300046472 | Bacteria | 1205 |
| 931 | Ga0495582_0087882 | 3300046473 | Bacteria | 1731 |
| 932 | Ga0495662_0142510 | 3300046476 | Bacteria | 1180 |
| 933 | Ga0495606_0005411 | 3300046507 | Bacteria | 12235 |
| 934 | Ga0495610_0001760 | 3300046512 | Bacteria | 18954 |
| 935 | Ga0495610_0003107 | 3300046512 | Bacteria | 13229 |
| 936 | Ga0495618_0012660 | 3300046514 | Bacteria | 5125 |
| 937 | Ga0495630_0021010 | 3300046517 | Bacteria | 4819 |
| 938 | Ga0495632_0092237 | 3300046519 | Bacteria | 1435 |
| 939 | Ga0495648_0006590 | 3300046524 | Bacteria | 9440 |
| 940 | Ga0495586_0048106 | 3300046535 | Unclassified | 2304 |
| 941 | Ga0495586_0123057 | 3300046535 | Bacteria | 1450 |
| 942 | Ga0495587_0118595 | 3300046536 | Unclassified | 1516 |
| 943 | Ga0495633_0000154 | 3300046558 | Bacteria | 90209 |
| 944 | Ga0495667_0068369 | 3300046559 | Unclassified | 2320 |
| 945 | Ga0495668_0000191 | 3300046616 | Bacteria | 90923 |
| 946 | Ga0495668_0000361 | 3300046616 | Bacteria | 60120 |
| 947 | Ga0495668_0002342 | 3300046616 | Bacteria | 15781 |
| 948 | Ga0495634_0052705 | 3300046642 | Bacteria | 2727 |
| 949 | Ga0495634_0304744 | 3300046642 | Bacteria | 962 |
| 950 | Ga0495611_0000252 | 3300046648 | Bacteria | 36998 |
| 951 | Ga0495611_0025805 | 3300046648 | Bacteria | 2563 |
| 952 | Ga0495658_0036056 | 3300046683 | Bacteria | 2726 |
| 953 | Ga0495670_0078629 | 3300046691 | Bacteria | 1678 |
| 954 | Ga0495600_0094655 | 3300046809 | Bacteria | 1948 |
| 955 | Ga0495636_0000049 | 3300047318 | Bacteria | 51760 |
| 956 | Ga0495674_0012090 | 3300047319 | Bacteria | 8134 |
| 957 | Ga0495672_0031702 | 3300047320 | Bacteria | 3298 |
| 958 | Ga0495672_0047219 | 3300047320 | Bacteria | 2562 |
| 959 | Ga0495672_0120137 | 3300047320 | Bacteria | 1398 |
| 960 | Ga0495676_0081222 | 3300047321 | Bacteria | 2458 |
| 961 | Ga0495676_0315195 | 3300047321 | Bacteria | 1052 |
| 962 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 963 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 964 | Ga0495686_0001210 | 3300047472 | Bacteria | 29692 |
| 965 | Ga0495686_0031850 | 3300047472 | Bacteria | 3416 |
| 966 | Ga0495686_0126490 | 3300047472 | Bacteria | 1519 |
| 967 | Ga0495686_0148618 | 3300047472 | Bacteria | 1377 |
| 968 | Ga0496101_0028716 | 3300048904 | Bacteria | 3886 |
| 969 | Ga0496105_0353723 | 3300048908 | Unclassified | 1173 |
| 970 | Ga0496106_0343792 | 3300048909 | Bacteria | 1198 |
| 971 | Ga0496108_0286981 | 3300048911 | Bacteria | 1433 |
| 972 | Ga0496109_0159922 | 3300048912 | Bacteria | 2110 |
| 973 | Ga0496109_0494019 | 3300048912 | Bacteria | 1155 |
| 974 | Ga0496110_0543207 | 3300048913 | Bacteria | 1056 |
| 975 | Ga0496115_0025603 | 3300048918 | Bacteria | 4595 |
| 976 | Ga0496115_0369102 | 3300048918 | Unclassified | 1168 |
| 977 | Ga0496116_0001546 | 3300048919 | Bacteria | 25478 |
| 978 | Ga0496117_0007089 | 3300048920 | Bacteria | 11078 |
| 979 | Ga0496118_0195100 | 3300048921 | Bacteria | 1206 |
| 980 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 981 | Ga0496122_0000746 | 3300048925 | Bacteria | 63466 |
| 982 | Ga0496122_0008031 | 3300048925 | Bacteria | 11521 |
| 983 | Ga0496123_0030182 | 3300048926 | Bacteria | 3972 |
| 984 | Ga0496123_0096201 | 3300048926 | Bacteria | 1739 |
| 985 | Ga0496124_0028833 | 3300048927 | Bacteria | 4958 |
| 986 | Ga0496124_0113530 | 3300048927 | Bacteria | 2177 |
| 987 | Ga0496125_0211980 | 3300048928 | Bacteria | 1257 |
| 988 | Ga0496126_0003667 | 3300048929 | Bacteria | 19179 |
| 989 | Ga0501031_0008920 | 3300049568 | Bacteria | 6520 |
| 990 | Ga0501032_0006744 | 3300049569 | Bacteria | 8429 |
| 991 | Ga0501032_0056211 | 3300049569 | Bacteria | 2646 |
| 992 | Ga0501033_0035991 | 3300049570 | Bacteria | 3711 |
| 993 | Ga0501033_0062187 | 3300049570 | Bacteria | 2750 |
| 994 | Ga0501033_0176559 | 3300049570 | Bacteria | 1532 |
| 995 | Ga0501034_0000399 | 3300049571 | Bacteria | 73348 |
| 996 | Ga0501034_0007132 | 3300049571 | Bacteria | 11922 |
| 997 | Ga0501034_0027512 | 3300049571 | Bacteria | 5785 |
| 998 | Ga0501034_0034359 | 3300049571 | Bacteria | 5139 |
| 999 | Ga0501034_0078744 | 3300049571 | Bacteria | 3299 |
| 1000 | Ga0501034_0095890 | 3300049571 | Bacteria | 2962 |
| 1001 | Ga0501034_0114355 | 3300049571 | Bacteria | 2687 |
| 1002 | Ga0501034_0155149 | 3300049571 | Bacteria | 2264 |
| 1003 | Ga0501034_0315125 | 3300049571 | Bacteria | 1498 |
| 1004 | Ga0501034_0316000 | 3300049571 | Bacteria | 1495 |
| 1005 | Ga0501036_0021107 | 3300049572 | Bacteria | 5471 |
| 1006 | Ga0501036_0031265 | 3300049572 | Bacteria | 4498 |
| 1007 | Ga0501036_0031936 | 3300049572 | Bacteria | 4448 |
| 1008 | Ga0501037_0004614 | 3300049573 | Bacteria | 10014 |
| 1009 | Ga0501037_0037569 | 3300049573 | Bacteria | 3570 |
| 1010 | Ga0501038_0008621 | 3300049574 | Bacteria | 9360 |
| 1011 | Ga0501038_0009237 | 3300049574 | Bacteria | 9047 |
| 1012 | Ga0501038_0014450 | 3300049574 | Bacteria | 7196 |
| 1013 | Ga0501039_0082895 | 3300049575 | Bacteria | 2497 |
| 1014 | Ga0501039_0083623 | 3300049575 | Bacteria | 2485 |
| 1015 | Ga0501043_0006099 | 3300049579 | Bacteria | 9683 |
| 1016 | Ga0501043_0011618 | 3300049579 | Bacteria | 6893 |
| 1017 | Ga0501043_0033806 | 3300049579 | Bacteria | 4023 |
| 1018 | Ga0501043_0072677 | 3300049579 | Bacteria | 2702 |
| 1019 | Ga0501043_0076043 | 3300049579 | Bacteria | 2638 |
| 1020 | Ga0501043_0362232 | 3300049579 | Bacteria | 1100 |
| 1021 | Ga0501046_0007340 | 3300049580 | Bacteria | 9697 |
| 1022 | Ga0501047_0021899 | 3300049581 | Bacteria | 6136 |
| 1023 | Ga0501047_0040807 | 3300049581 | Bacteria | 4487 |
| 1024 | Ga0501047_0049782 | 3300049581 | Bacteria | 4045 |
| 1025 | Ga0501047_0054822 | 3300049581 | Bacteria | 3856 |
| 1026 | Ga0501047_0204429 | 3300049581 | Bacteria | 1835 |
| 1027 | Ga0501048_0116127 | 3300049582 | Bacteria | 1891 |
| 1028 | Ga0501067_0009624 | 3300049583 | Bacteria | 5352 |
| 1029 | Ga0501067_0039532 | 3300049583 | Bacteria | 2619 |
| 1030 | Ga0501068_0162628 | 3300049584 | Bacteria | 1407 |
| 1031 | Ga0501070_0083168 | 3300049586 | Bacteria | 2650 |
| 1032 | Ga0501071_0202825 | 3300049587 | Bacteria | 1490 |
| 1033 | Ga0501073_0001901 | 3300049589 | Bacteria | 15565 |
| 1034 | Ga0501073_0081407 | 3300049589 | Bacteria | 2252 |
| 1035 | Ga0501074_0001080 | 3300049590 | Bacteria | 17807 |
| 1036 | Ga0501202_000051 | 3300049652 | Bacteria | 12160 |
| 1037 | Ga0501202_005033 | 3300049652 | Bacteria | 2331 |
| 1038 | Ga0501216_020232 | 3300049660 | Bacteria | 1161 |
| 1039 | Ga0501217_022286 | 3300049661 | Bacteria | 1501 |
| 1040 | Ga0501223_003413 | 3300049663 | Bacteria | 3464 |
| 1041 | Ga0501223_004449 | 3300049663 | Bacteria | 3000 |
| 1042 | Ga0501240_016844 | 3300049673 | Bacteria | 1056 |
| 1043 | Ga0501257_001076 | 3300049686 | Bacteria | 5535 |
| 1044 | Ga0501259_000915 | 3300049688 | Bacteria | 4868 |
| 1045 | Ga0501219_000752 | 3300049703 | Bacteria | 4382 |
| 1046 | Ga0501225_0011343 | 3300049705 | Bacteria | 2508 |
| 1047 | Ga0501245_002468 | 3300049708 | Bacteria | 2471 |
| 1048 | Ga0501079_0200118 | 3300049741 | Bacteria | 1560 |
| 1049 | Ga0501080_0033602 | 3300049742 | Bacteria | 4787 |
| 1050 | Ga0501080_0133390 | 3300049742 | Bacteria | 2299 |
| 1051 | Ga0501083_0008410 | 3300049744 | Bacteria | 7296 |
| 1052 | Ga0501083_0014634 | 3300049744 | Bacteria | 5484 |
| 1053 | Ga0501241_000580 | 3300049758 | Bacteria | 7859 |
| 1054 | Ga0501266_004672 | 3300049763 | Bacteria | 1701 |
| 1055 | Ga0501035_0015725 | 3300049822 | Bacteria | 6984 |
| 1056 | Ga0501035_0017194 | 3300049822 | Bacteria | 6666 |
| 1057 | Ga0501035_0023744 | 3300049822 | Bacteria | 5626 |
| 1058 | Ga0501035_0135363 | 3300049822 | Bacteria | 2146 |
| 1059 | Ga0501035_0360903 | 3300049822 | Bacteria | 1214 |
| 1060 | Ga0501035_0540226 | 3300049822 | Bacteria | 956 |
| 1061 | Ga0501044_0003839 | 3300049823 | Bacteria | 16859 |
| 1062 | Ga0501044_0008687 | 3300049823 | Bacteria | 11117 |
| 1063 | Ga0501044_0009313 | 3300049823 | Bacteria | 10716 |
| 1064 | Ga0501044_0018183 | 3300049823 | Bacteria | 7540 |
| 1065 | Ga0501044_0067496 | 3300049823 | Bacteria | 3644 |
| 1066 | Ga0501044_0077352 | 3300049823 | Bacteria | 3375 |
| 1067 | Ga0501044_0165444 | 3300049823 | Unclassified | 2186 |
| 1068 | Ga0501044_0389642 | 3300049823 | Bacteria | 1307 |
| 1069 | Ga0501044_0403448 | 3300049823 | Bacteria | 1279 |
| 1070 | Ga0501284_00019 | 3300050005 | Bacteria | 92576 |
| 1071 | nmdc:mga0k408_7375_c1 | 3300050493 | Bacteria | 5871 |
| 1072 | nmdc:mga05p37_288459_c1 | 3300050507 | Bacteria | 1954 |
| 1073 | nmdc:mga05p37_3288_c1 | 3300050507 | Bacteria | 18845 |
| 1074 | nmdc:mga05p37_70934_c1 | 3300050507 | Bacteria | 4285 |
| 1075 | nmdc:mga09592_108348_c1 | 3300050508 | Unclassified | 2383 |
| 1076 | nmdc:mga08y16_160301_c1 | 3300050511 | Bacteria | 2337 |
| 1077 | nmdc:mga08y16_22514_c1 | 3300050511 | Bacteria | 6652 |
| 1078 | nmdc:mga08y16_511295_c1 | 3300050511 | Bacteria | 1219 |
| 1079 | nmdc:mga08y16_783501_c1 | 3300050511 | Bacteria | 947 |
| 1080 | Ga0495601_0179435 | 3300053077 | Bacteria | 1385 |
| 1081 | Ga0500578_0000150 | 3300053086 | Bacteria | 83541 |
| 1082 | Ga0500644_0000108 | 3300053088 | Bacteria | 52348 |
| 1083 | Ga0500646_0000820 | 3300053090 | Bacteria | 8616 |
| 1084 | Ga0500583_0000108 | 3300053092 | Bacteria | 41760 |
| 1085 | Ga0500583_0002339 | 3300053092 | Bacteria | 5674 |
| 1086 | Ga0500583_0004734 | 3300053092 | Bacteria | 4476 |
| 1087 | Ga0500651_0000127 | 3300053093 | Bacteria | 47010 |
| 1088 | Ga0500594_0008751 | 3300053118 | Bacteria | 2315 |
| 1089 | Ga0500594_0041262 | 3300053118 | Bacteria | 1263 |
| 1090 | Ga0500607_081521 | 3300053121 | Bacteria | 1649 |
| 1091 | Ga0500642_0003779 | 3300053130 | Bacteria | 4635 |
| 1092 | Ga0500642_0034331 | 3300053130 | Bacteria | 2145 |
| 1093 | Ga0500652_011727 | 3300053131 | Bacteria | 3048 |
| 1094 | Ga0500658_0005805 | 3300053134 | Bacteria | 4598 |
| 1095 | Ga0500568_0000789 | 3300053139 | Bacteria | 22357 |
| 1096 | Ga0500577_0008558 | 3300053142 | Bacteria | 2925 |
| 1097 | Ga0500590_042656 | 3300053148 | Bacteria | 2329 |
| 1098 | Ga0500603_068004 | 3300053150 | Unclassified | 1010 |
| 1099 | Ga0500604_0000484 | 3300053151 | Bacteria | 10975 |
| 1100 | Ga0500616_0001887 | 3300053153 | Bacteria | 18863 |
| 1101 | Ga0500616_0013004 | 3300053153 | Bacteria | 4847 |
| 1102 | Ga0500616_0075315 | 3300053153 | Bacteria | 1709 |
| 1103 | Ga0500616_0104336 | 3300053153 | Bacteria | 1380 |
| 1104 | Ga0500622_0000077 | 3300053156 | Bacteria | 108558 |
| 1105 | Ga0500622_0000304 | 3300053156 | Bacteria | 50299 |
| 1106 | Ga0500622_0007889 | 3300053156 | Bacteria | 5994 |
| 1107 | Ga0500622_0008720 | 3300053156 | Bacteria | 5655 |
| 1108 | Ga0500622_0023113 | 3300053156 | Bacteria | 3294 |
| 1109 | Ga0500633_0006718 | 3300053160 | Bacteria | 2842 |
| 1110 | Ga0500634_0015518 | 3300053161 | Bacteria | 4047 |
| 1111 | Ga0500636_0002666 | 3300053177 | Bacteria | 9922 |
| 1112 | Ga0500637_0157527 | 3300053178 | Bacteria | 1310 |
| 1113 | Ga0500645_004553 | 3300053730 | Bacteria | 5286 |
| 1114 | Ga0501084_0069145 | 3300054114 | Bacteria | 2956 |
| 1115 | Ga0501084_0307219 | 3300054114 | Bacteria | 1339 |
| 1116 | Ga0500661_005721 | 3300055283 | Bacteria | 2317 |
| 1117 | Ga0501082_0366013 | 3300060353 | Bacteria | 1258 |
| 1118 | Ga0466962_0136586 | 3300061719 | Bacteria | 1187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005618 | Ga0068864_100038495 | Ga0068864_1000384952 | 249 |
| 2 | 3300026095 | Ga0207676_10197912 | Ga0207676_101979122 | 249 |
| 3 | 3300003320 | rootH2_10125569 | rootH2_101255695 | 256 |
| 4 | 3300049581 | Ga0501047_0049782 | Ga0501047_0049782_529_1368 | 257 |
| 5 | 3300006844 | Ga0075428_100359180 | Ga0075428_1003591801 | 261 |
| 6 | 3300006847 | Ga0075431_100048281 | Ga0075431_1000482814 | 261 |
| 7 | 3300009093 | Ga0105240_10000020 | Ga0105240_10000020247 | 261 |
| 8 | 3300050507 | nmdc:mga05p37_70934_c1 | nmdc:mga05p37_70934_c1_2020_2940 | 261 |
| 9 | 3300028577 | Ga0265318_10005180 | Ga0265318_100051805 | 262 |
| 10 | 3300028800 | Ga0265338_10128534 | Ga0265338_101285342 | 262 |
| 11 | 3300031238 | Ga0265332_10002898 | Ga0265332_100028989 | 262 |
| 12 | 3300031241 | Ga0265325_10086235 | Ga0265325_100862352 | 262 |
| 13 | 3300031247 | Ga0265340_10126731 | Ga0265340_101267312 | 262 |
| 14 | 3300031249 | Ga0265339_10051425 | Ga0265339_100514252 | 262 |
| 15 | 3300031250 | Ga0265331_10007182 | Ga0265331_100071826 | 262 |
| 16 | 3300031344 | Ga0265316_10005421 | Ga0265316_1000542111 | 262 |
| 17 | 3300031711 | Ga0265314_10058229 | Ga0265314_100582292 | 262 |
| 18 | 3300031712 | Ga0265342_10016089 | Ga0265342_100160894 | 262 |
| 19 | 3300031728 | Ga0316578_10110364 | Ga0316578_101103642 | 262 |
| 20 | 3300031691 | Ga0316579_10068300 | Ga0316579_100683001 | 263 |
| 21 | 3300032137 | Ga0316585_10019775 | Ga0316585_100197752 | 263 |
| 22 | 3300036647 | Ga0316582_0053693 | Ga0316582_0053693_368_1171 | 263 |
| 23 | 3300036712 | Ga0316584_0001570 | Ga0316584_0001570_10088_10891 | 263 |
| 24 | iso_pu_bacteria | 2895498888 | 2895502712 | 264 |
| 25 | 3300038741 | Ga0400488_57128 | Ga0400488_57128_23_838 | 265 |
| 26 | 3300039062 | Ga0400483_094790 | Ga0400483_094790_6831_7646 | 265 |
| 27 | iso_pu_bacteria | 2839989709 | 2839991192 | 265 |
| 28 | iso_pu_bacteria | 2840677318 | 2840677545 | 265 |
| 29 | iso_pu_bacteria | 2896085136 | 2896085363 | 265 |
| 30 | iso_pu_bacteria | 2910245624 | 2910247133 | 265 |
| 31 | 3300041456 | Ga0451795_0125519 | Ga0451795_0125519_577_1377 | 266 |
| 32 | 3300042876 | Ga0451577_0000754 | Ga0451577_0000754_9013_9819 | 266 |
| 33 | 3300042876 | Ga0451577_0010712 | Ga0451577_0010712_1211_2017 | 266 |
| 34 | 3300042876 | Ga0451577_0090796 | Ga0451577_0090796_575_1381 | 266 |
| 35 | 3300042876 | Ga0451577_0153065 | Ga0451577_0153065_980_1786 | 266 |
| 36 | 3300042876 | Ga0451577_0640499 | Ga0451577_0640499_45_854 | 266 |
| 37 | 3300044673 | Ga0453683_0000227 | Ga0453683_0000227_9860_10666 | 266 |
| 38 | 3300044673 | Ga0453683_0001274 | Ga0453683_0001274_8100_8906 | 266 |
| 39 | 3300044673 | Ga0453683_0116716 | Ga0453683_0116716_343_1149 | 266 |
| 40 | 3300044712 | Ga0453684_0001194 | Ga0453684_0001194_6590_7396 | 266 |
| 41 | 3300044712 | Ga0453684_0001431 | Ga0453684_0001431_51073_51879 | 266 |
| 42 | 3300044712 | Ga0453684_0002120 | Ga0453684_0002120_9013_9819 | 266 |
| 43 | 3300044712 | Ga0453684_0004008 | Ga0453684_0004008_11571_12377 | 266 |
| 44 | 3300044712 | Ga0453684_0040458 | Ga0453684_0040458_559_1365 | 266 |
| 45 | 3300044712 | Ga0453684_0064241 | Ga0453684_0064241_1023_1829 | 266 |
| 46 | 3300044712 | Ga0453684_0144695 | Ga0453684_0144695_1183_1989 | 266 |
| 47 | 3300045051 | Ga0451576_0001102 | Ga0451576_0001102_9007_9813 | 266 |
| 48 | 3300045051 | Ga0451576_0002021 | Ga0451576_0002021_11574_12380 | 266 |
| 49 | 3300045051 | Ga0451576_0074409 | Ga0451576_0074409_1301_2107 | 266 |
| 50 | 3300045051 | Ga0451576_0108417 | Ga0451576_0108417_466_1275 | 266 |
| 51 | iso_pu_bacteria | 2585427687 | 2586207414 | 266 |
| 52 | iso_pu_bacteria | 2738541302 | 2738854005 | 266 |
| 53 | iso_pu_bacteria | 2739367651 | 2739588605 | 266 |
| 54 | iso_pu_bacteria | 2739367656 | 2739615900 | 266 |
| 55 | iso_pu_bacteria | 2739367663 | 2739644991 | 266 |
| 56 | iso_pu_bacteria | 2818991437 | 2819548144 | 266 |
| 57 | iso_pu_bacteria | 2842722452 | 2842723742 | 266 |
| 58 | iso_pu_bacteria | 2842909656 | 2842910248 | 266 |
| 59 | iso_pu_bacteria | 2849281842 | 2849284297 | 266 |
| 60 | iso_pu_bacteria | 2896109856 | 2896113539 | 266 |
| 61 | iso_pu_bacteria | 2904445276 | 2904445700 | 266 |
| 62 | iso_pu_bacteria | 2945997725 | 2946000602 | 266 |
| 63 | iso_pu_bacteria | 2954016120 | 2954017484 | 266 |
| 64 | 3300028800 | Ga0265338_10000319 | Ga0265338_1000031970 | 267 |
| 65 | 3300044712 | Ga0453684_0007236 | Ga0453684_0007236_11154_11975 | 267 |
| 66 | 3300044712 | Ga0453684_0262231 | Ga0453684_0262231_202_1020 | 267 |
| 67 | 3300045051 | Ga0451576_0198816 | Ga0451576_0198816_387_1205 | 267 |
| 68 | 3300045051 | Ga0451576_0207112 | Ga0451576_0207112_526_1344 | 267 |
| 69 | iso_pu_bacteria | 2721755487 | 2722728749 | 267 |
| 70 | iso_pu_bacteria | 2738541283 | 2738755049 | 267 |
| 71 | iso_pu_bacteria | 2738541284 | 2738760984 | 267 |
| 72 | iso_pu_bacteria | 2738543023 | 2739301203 | 267 |
| 73 | iso_pu_bacteria | 2775506987 | 2776613170 | 267 |
| 74 | iso_pu_bacteria | 2842903701 | 2842906612 | 267 |
| 75 | iso_pu_bacteria | 2852627209 | 2852631320 | 267 |
| 76 | iso_pu_bacteria | 2884791551 | 2884798168 | 267 |
| 77 | iso_pu_bacteria | 2890737413 | 2890738542 | 267 |
| 78 | iso_pu_bacteria | 2896317667 | 2896318366 | 267 |
| 79 | iso_pu_bacteria | 2896344016 | 2896345961 | 267 |
| 80 | iso_pu_bacteria | 2898713307 | 2898714981 | 267 |
| 81 | iso_pu_bacteria | 2904780799 | 2904784262 | 267 |
| 82 | iso_pu_bacteria | 2919177583 | 2919179114 | 267 |
| 83 | iso_pu_bacteria | 2919186247 | 2919187241 | 267 |
| 84 | iso_pu_bacteria | 2929177148 | 2929182751 | 267 |
| 85 | iso_pu_bacteria | 2929921140 | 2929923463 | 267 |
| 86 | iso_pu_bacteria | 2939664404 | 2939665490 | 267 |
| 87 | iso_pu_bacteria | 2945977869 | 2945978704 | 267 |
| 88 | iso_pu_bacteria | 2946013367 | 2946015428 | 267 |
| 89 | iso_pu_bacteria | 8003151029 | 8003152865 | 267 |
| 90 | iso_pu_bacteria | 8055588893 | 8055589358 | 267 |
| 91 | 3300003322 | rootL2_10106122 | rootL2_101061222 | 268 |
| 92 | 3300010375 | Ga0105239_10123388 | Ga0105239_101233882 | 268 |
| 93 | 3300041511 | Ga0451855_0550985 | Ga0451855_0550985_1310_2125 | 268 |
| 94 | 3300046616 | Ga0495668_0000361 | Ga0495668_0000361_18361_19173 | 268 |
| 95 | 3300047472 | Ga0495686_0001210 | Ga0495686_0001210_9168_9980 | 268 |
| 96 | 3300049570 | Ga0501033_0176559 | Ga0501033_0176559_189_1007 | 268 |
| 97 | 3300049571 | Ga0501034_0078744 | Ga0501034_0078744_1616_2434 | 268 |
| 98 | 3300049822 | Ga0501035_0135363 | Ga0501035_0135363_1254_2069 | 268 |
| 99 | 3300049823 | Ga0501044_0008687 | Ga0501044_0008687_1331_2149 | 268 |
| 100 | 3300049823 | Ga0501044_0077352 | Ga0501044_0077352_969_1784 | 268 |
| 101 | 3300049823 | Ga0501044_0165444 | Ga0501044_0165444_474_1301 | 268 |
| 102 | 3300053130 | Ga0500642_0003779 | Ga0500642_0003779_2618_3430 | 268 |
| 103 | 3300053153 | Ga0500616_0001887 | Ga0500616_0001887_8348_9163 | 268 |
| 104 | 2162886007 | SwRhRL2b_contig_2043181 | SwRhRL2b_0193.00004740 | 269 |
| 105 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_1000007132 | 269 |
| 106 | 3300003215 | JGI25153J46596_10014038 | JGI25153J46596_100140382 | 269 |
| 107 | 3300003316 | rootH1_10100877 | rootH1_101008772 | 269 |
| 108 | 3300003320 | rootH2_10086703 | rootH2_100867032 | 269 |
| 109 | 3300003322 | rootL2_10010003 | rootL2_100100032 | 269 |
| 110 | 3300003322 | rootL2_10013694 | rootL2_100136941 | 269 |
| 111 | 3300003323 | rootH1_10031210 | rootH1_100312103 | 269 |
| 112 | 3300003323 | rootH1_10067892 | rootH1_100678921 | 269 |
| 113 | 3300003323 | rootH1_10081850 | rootH1_100818502 | 269 |
| 114 | 3300003354 | JGI25160J50197_1001820 | JGI25160J50197_10018205 | 269 |
| 115 | 3300003354 | JGI25160J50197_1009684 | JGI25160J50197_10096842 | 269 |
| 116 | 3300003762 | Ga0055542_1005732 | Ga0055542_10057324 | 269 |
| 117 | 3300003790 | Ga0055528_1000164 | Ga0055528_100016426 | 269 |
| 118 | 3300003791 | Ga0055530_10002036 | Ga0055530_100020368 | 269 |
| 119 | 3300003794 | Ga0055531_10000020 | Ga0055531_10000020140 | 269 |
| 120 | 3300005262 | Ga0065165_1000010 | Ga0065165_1000010133 | 269 |
| 121 | 3300005262 | Ga0065165_1030900 | Ga0065165_10309003 | 269 |
| 122 | 3300005289 | Ga0065704_10070350 | Ga0065704_100703508 | 269 |
| 123 | 3300005327 | Ga0070658_10040671 | Ga0070658_100406711 | 269 |
| 124 | 3300005327 | Ga0070658_10227153 | Ga0070658_102271531 | 269 |
| 125 | 3300005335 | Ga0070666_10093615 | Ga0070666_100936152 | 269 |
| 126 | 3300005337 | Ga0070682_100000125 | Ga0070682_10000012519 | 269 |
| 127 | 3300005339 | Ga0070660_100087378 | Ga0070660_1000873782 | 269 |
| 128 | 3300005355 | Ga0070671_100006875 | Ga0070671_1000068754 | 269 |
| 129 | 3300005459 | Ga0068867_100042668 | Ga0068867_1000426684 | 269 |
| 130 | 3300005530 | Ga0070679_100114743 | Ga0070679_1001147432 | 269 |
| 131 | 3300005548 | Ga0070665_100000442 | Ga0070665_1000004422 | 269 |
| 132 | 3300005564 | Ga0070664_100154403 | Ga0070664_1001544031 | 269 |
| 133 | 3300005578 | Ga0068854_100058430 | Ga0068854_1000584301 | 269 |
| 134 | 3300005578 | Ga0068854_100092898 | Ga0068854_1000928981 | 269 |
| 135 | 3300005578 | Ga0068854_100447205 | Ga0068854_1004472051 | 269 |
| 136 | 3300005843 | Ga0068860_100078244 | Ga0068860_1000782442 | 269 |
| 137 | 3300006195 | Ga0075366_10057949 | Ga0075366_100579492 | 269 |
| 138 | 3300006237 | Ga0097621_100001588 | Ga0097621_1000015881 | 269 |
| 139 | 3300006358 | Ga0068871_100000415 | Ga0068871_1000004153 | 269 |
| 140 | 3300009093 | Ga0105240_10053213 | Ga0105240_100532132 | 269 |
| 141 | 3300009176 | Ga0105242_10744581 | Ga0105242_107445811 | 269 |
| 142 | 3300009177 | Ga0105248_10004754 | Ga0105248_100047542 | 269 |
| 143 | 3300009553 | Ga0105249_10018325 | Ga0105249_100183255 | 269 |
| 144 | 3300010375 | Ga0105239_10169435 | Ga0105239_101694352 | 269 |
| 145 | 3300013104 | Ga0157370_10043363 | Ga0157370_100433632 | 269 |
| 146 | 3300013105 | Ga0157369_10029590 | Ga0157369_100295904 | 269 |
| 147 | 3300013296 | Ga0157374_10470460 | Ga0157374_104704602 | 269 |
| 148 | 3300013297 | Ga0157378_10012427 | Ga0157378_100124276 | 269 |
| 149 | 3300013306 | Ga0163162_10000371 | Ga0163162_1000037134 | 269 |
| 150 | 3300013306 | Ga0163162_10002125 | Ga0163162_1000212510 | 269 |
| 151 | 3300013306 | Ga0163162_10044729 | Ga0163162_100447292 | 269 |
| 152 | 3300013306 | Ga0163162_10255070 | Ga0163162_102550703 | 269 |
| 153 | 3300013306 | Ga0163162_10836372 | Ga0163162_108363722 | 269 |
| 154 | 3300013307 | Ga0157372_10104649 | Ga0157372_101046493 | 269 |
| 155 | 3300013307 | Ga0157372_10290381 | Ga0157372_102903812 | 269 |
| 156 | 3300013308 | Ga0157375_10000553 | Ga0157375_100005535 | 269 |
| 157 | 3300014325 | Ga0163163_10000677 | Ga0163163_1000067713 | 269 |
| 158 | 3300014968 | Ga0157379_10045025 | Ga0157379_100450251 | 269 |
| 159 | 3300014969 | Ga0157376_10000491 | Ga0157376_100004911 | 269 |
| 160 | 3300014969 | Ga0157376_10098268 | Ga0157376_100982682 | 269 |
| 161 | 3300015265 | Ga0182005_1000131 | Ga0182005_100013120 | 269 |
| 162 | 3300017792 | Ga0163161_10030675 | Ga0163161_100306754 | 269 |
| 163 | 3300021384 | Ga0213876_10001070 | Ga0213876_1000107014 | 269 |
| 164 | 3300025208 | Ga0209436_102245 | Ga0209436_1022454 | 269 |
| 165 | 3300025208 | Ga0209436_103275 | Ga0209436_1032754 | 269 |
| 166 | 3300025242 | Ga0209258_100219 | Ga0209258_10021946 | 269 |
| 167 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002737 | 269 |
| 168 | 3300025254 | Ga0209148_1000283 | Ga0209148_100028316 | 269 |
| 169 | 3300025273 | Ga0209673_1000082 | Ga0209673_1000082107 | 269 |
| 170 | 3300025284 | Ga0209130_1003990 | Ga0209130_10039905 | 269 |
| 171 | 3300025295 | Ga0209564_1008534 | Ga0209564_10085343 | 269 |
| 172 | 3300025297 | Ga0209758_1011315 | Ga0209758_10113156 | 269 |
| 173 | 3300025297 | Ga0209758_1012324 | Ga0209758_10123243 | 269 |
| 174 | 3300025298 | Ga0209050_1000555 | Ga0209050_100055526 | 269 |
| 175 | 3300025302 | Ga0207426_1000493 | Ga0207426_100049326 | 269 |
| 176 | 3300025302 | Ga0207426_1000514 | Ga0207426_100051421 | 269 |
| 177 | 3300025302 | Ga0207426_1000883 | Ga0207426_10008839 | 269 |
| 178 | 3300025303 | Ga0209051_1037251 | Ga0209051_10372512 | 269 |
| 179 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011245 | 269 |
| 180 | 3300025903 | Ga0207680_10047382 | Ga0207680_100473824 | 269 |
| 181 | 3300025903 | Ga0207680_10210022 | Ga0207680_102100222 | 269 |
| 182 | 3300025904 | Ga0207647_10015219 | Ga0207647_100152194 | 269 |
| 183 | 3300025909 | Ga0207705_10195836 | Ga0207705_101958361 | 269 |
| 184 | 3300025913 | Ga0207695_10012565 | Ga0207695_100125652 | 269 |
| 185 | 3300025914 | Ga0207671_10000030 | Ga0207671_1000003080 | 269 |
| 186 | 3300025919 | Ga0207657_10007892 | Ga0207657_1000789210 | 269 |
| 187 | 3300025919 | Ga0207657_10203664 | Ga0207657_102036642 | 269 |
| 188 | 3300025921 | Ga0207652_10000942 | Ga0207652_1000094223 | 269 |
| 189 | 3300025931 | Ga0207644_10003616 | Ga0207644_100036164 | 269 |
| 190 | 3300025931 | Ga0207644_10296907 | Ga0207644_102969071 | 269 |
| 191 | 3300025940 | Ga0207691_10344927 | Ga0207691_103449272 | 269 |
| 192 | 3300025942 | Ga0207689_10018291 | Ga0207689_100182911 | 269 |
| 193 | 3300025960 | Ga0207651_10258081 | Ga0207651_102580812 | 269 |
| 194 | 3300025961 | Ga0207712_10045084 | Ga0207712_100450842 | 269 |
| 195 | 3300025981 | Ga0207640_10057686 | Ga0207640_100576862 | 269 |
| 196 | 3300025981 | Ga0207640_10064402 | Ga0207640_100644022 | 269 |
| 197 | 3300026088 | Ga0207641_10037149 | Ga0207641_100371494 | 269 |
| 198 | 3300026089 | Ga0207648_10028862 | Ga0207648_100288624 | 269 |
| 199 | 3300026095 | Ga0207676_10464196 | Ga0207676_104641961 | 269 |
| 200 | 3300028379 | Ga0268266_10013344 | Ga0268266_100133445 | 269 |
| 201 | 3300028381 | Ga0268264_10060376 | Ga0268264_100603763 | 269 |
| 202 | 3300037418 | Ga0395900_0046549 | Ga0395900_0046549_2772_3590 | 269 |
| 203 | 3300039437 | Ga0436365_0785409 | Ga0436365_0785409_7735_8556 | 269 |
| 204 | 3300041997 | Ga0439431_0004736 | Ga0439431_0004736_1048_1872 | 269 |
| 205 | 3300042876 | Ga0451577_0043507 | Ga0451577_0043507_1347_2165 | 269 |
| 206 | 3300044658 | Ga0466972_0058744 | Ga0466972_0058744_639_1454 | 269 |
| 207 | 3300044683 | Ga0466965_0028230 | Ga0466965_0028230_382_1257 | 269 |
| 208 | 3300044712 | Ga0453684_0050218 | Ga0453684_0050218_1602_2417 | 269 |
| 209 | 3300045049 | Ga0466959_0071946 | Ga0466959_0071946_332_1147 | 269 |
| 210 | 3300045051 | Ga0451576_0190156 | Ga0451576_0190156_364_1179 | 269 |
| 211 | 3300046453 | Ga0495627_001544 | Ga0495627_001544_2876_3700 | 269 |
| 212 | 3300046519 | Ga0495632_0092237 | Ga0495632_0092237_427_1254 | 269 |
| 213 | 3300046558 | Ga0495633_0000154 | Ga0495633_0000154_5798_6622 | 269 |
| 214 | 3300048904 | Ga0496101_0028716 | Ga0496101_0028716_2937_3755 | 269 |
| 215 | 3300048924 | Ga0496121_0000020 | Ga0496121_0000020_273577_274398 | 269 |
| 216 | 3300048929 | Ga0496126_0003667 | Ga0496126_0003667_767_1591 | 269 |
| 217 | 3300049571 | Ga0501034_0095890 | Ga0501034_0095890_406_1224 | 269 |
| 218 | 3300049579 | Ga0501043_0072677 | Ga0501043_0072677_1731_2549 | 269 |
| 219 | 3300049581 | Ga0501047_0204429 | Ga0501047_0204429_843_1661 | 269 |
| 220 | 3300049673 | Ga0501240_016844 | Ga0501240_016844_165_989 | 269 |
| 221 | 3300049758 | Ga0501241_000580 | Ga0501241_000580_6558_7382 | 269 |
| 222 | 3300053088 | Ga0500644_0000108 | Ga0500644_0000108_497_1324 | 269 |
| 223 | 3300053092 | Ga0500583_0002339 | Ga0500583_0002339_3510_4337 | 269 |
| 224 | 3300053121 | Ga0500607_081521 | Ga0500607_081521_773_1600 | 269 |
| 225 | 3300053131 | Ga0500652_011727 | Ga0500652_011727_396_1241 | 269 |
| 226 | 3300053134 | Ga0500658_0005805 | Ga0500658_0005805_3162_3989 | 269 |
| 227 | 3300053142 | Ga0500577_0008558 | Ga0500577_0008558_1744_2571 | 269 |
| 228 | 3300053148 | Ga0500590_042656 | Ga0500590_042656_261_1088 | 269 |
| 229 | 3300053153 | Ga0500616_0013004 | Ga0500616_0013004_1915_2742 | 269 |
| 230 | 3300053156 | Ga0500622_0000077 | Ga0500622_0000077_75672_76496 | 269 |
| 231 | 3300053160 | Ga0500633_0006718 | Ga0500633_0006718_304_1131 | 269 |
| 232 | 3300053161 | Ga0500634_0015518 | Ga0500634_0015518_1576_2403 | 269 |
| 233 | 3300053177 | Ga0500636_0002666 | Ga0500636_0002666_3387_4214 | 269 |
| 234 | iso_pu_bacteria | 2738541278 | 2738726384 | 269 |
| 235 | iso_pu_bacteria | 2818991442 | 2819573817 | 269 |
| 236 | iso_pu_bacteria | 2818991460 | 2819680452 | 269 |
| 237 | iso_pu_bacteria | 2821136567 | 2821137151 | 269 |
| 238 | iso_pu_bacteria | 2904467357 | 2904468107 | 269 |
| 239 | iso_pu_bacteria | 2929239360 | 2929241434 | 269 |
| 240 | 2162886011 | MRS1b_contig_5332534 | MRS1b_0461.00002540 | 270 |
| 241 | 3300002773 | JGI25152J39213_1000647 | JGI25152J39213_100064713 | 270 |
| 242 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_1000009226 | 270 |
| 243 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_10000017226 | 270 |
| 244 | 3300003203 | JGI25406J46586_10000525 | JGI25406J46586_1000052518 | 270 |
| 245 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_1000002313 | 270 |
| 246 | 3300003316 | rootH1_10002677 | rootH1_100026772 | 270 |
| 247 | 3300003316 | rootH1_10068633 | rootH1_100686332 | 270 |
| 248 | 3300003316 | rootH1_10135481 | rootH1_101354812 | 270 |
| 249 | 3300003320 | rootH2_10040458 | rootH2_100404584 | 270 |
| 250 | 3300003320 | rootH2_10047580 | rootH2_1004758014 | 270 |
| 251 | 3300003320 | rootH2_10069535 | rootH2_1006953513 | 270 |
| 252 | 3300003320 | rootH2_10096794 | rootH2_100967947 | 270 |
| 253 | 3300003322 | rootL2_10037159 | rootL2_100371593 | 270 |
| 254 | 3300003322 | rootL2_10176488 | rootL2_101764882 | 270 |
| 255 | 3300003322 | rootL2_10283503 | rootL2_102835031 | 270 |
| 256 | 3300003323 | rootH1_10002262 | rootH1_100022626 | 270 |
| 257 | 3300003323 | rootH1_10208372 | rootH1_102083722 | 270 |
| 258 | 3300003354 | JGI25160J50197_1001273 | JGI25160J50197_10012738 | 270 |
| 259 | 3300003791 | Ga0055530_10002755 | Ga0055530_100027555 | 270 |
| 260 | 3300005288 | Ga0065714_10002310 | Ga0065714_100023102 | 270 |
| 261 | 3300005288 | Ga0065714_10004769 | Ga0065714_100047691 | 270 |
| 262 | 3300005288 | Ga0065714_10023632 | Ga0065714_100236321 | 270 |
| 263 | 3300005288 | Ga0065714_10123017 | Ga0065714_101230173 | 270 |
| 264 | 3300005290 | Ga0065712_10173878 | Ga0065712_101738782 | 270 |
| 265 | 3300005327 | Ga0070658_10001041 | Ga0070658_100010416 | 270 |
| 266 | 3300005327 | Ga0070658_10046802 | Ga0070658_100468021 | 270 |
| 267 | 3300005328 | Ga0070676_10001302 | Ga0070676_1000130211 | 270 |
| 268 | 3300005328 | Ga0070676_10001325 | Ga0070676_100013256 | 270 |
| 269 | 3300005328 | Ga0070676_10039691 | Ga0070676_100396912 | 270 |
| 270 | 3300005329 | Ga0070683_100000163 | Ga0070683_10000016313 | 270 |
| 271 | 3300005329 | Ga0070683_100002968 | Ga0070683_1000029689 | 270 |
| 272 | 3300005329 | Ga0070683_100006525 | Ga0070683_1000065254 | 270 |
| 273 | 3300005329 | Ga0070683_100062783 | Ga0070683_1000627832 | 270 |
| 274 | 3300005329 | Ga0070683_100236447 | Ga0070683_1002364472 | 270 |
| 275 | 3300005330 | Ga0070690_100007549 | Ga0070690_1000075494 | 270 |
| 276 | 3300005330 | Ga0070690_100055790 | Ga0070690_1000557902 | 270 |
| 277 | 3300005330 | Ga0070690_100126964 | Ga0070690_1001269641 | 270 |
| 278 | 3300005331 | Ga0070670_100062169 | Ga0070670_1000621691 | 270 |
| 279 | 3300005331 | Ga0070670_100069074 | Ga0070670_1000690742 | 270 |
| 280 | 3300005331 | Ga0070670_100130431 | Ga0070670_1001304312 | 270 |
| 281 | 3300005333 | Ga0070677_10035784 | Ga0070677_100357842 | 270 |
| 282 | 3300005334 | Ga0068869_100018339 | Ga0068869_1000183392 | 270 |
| 283 | 3300005334 | Ga0068869_100023955 | Ga0068869_1000239552 | 270 |
| 284 | 3300005334 | Ga0068869_100033372 | Ga0068869_1000333722 | 270 |
| 285 | 3300005334 | Ga0068869_100056074 | Ga0068869_1000560743 | 270 |
| 286 | 3300005334 | Ga0068869_100077989 | Ga0068869_1000779893 | 270 |
| 287 | 3300005334 | Ga0068869_100102195 | Ga0068869_1001021952 | 270 |
| 288 | 3300005335 | Ga0070666_10000470 | Ga0070666_100004703 | 270 |
| 289 | 3300005335 | Ga0070666_10002147 | Ga0070666_100021473 | 270 |
| 290 | 3300005335 | Ga0070666_10007390 | Ga0070666_100073902 | 270 |
| 291 | 3300005336 | Ga0070680_100019950 | Ga0070680_1000199504 | 270 |
| 292 | 3300005336 | Ga0070680_100108378 | Ga0070680_1001083782 | 270 |
| 293 | 3300005336 | Ga0070680_100256235 | Ga0070680_1002562352 | 270 |
| 294 | 3300005337 | Ga0070682_100000763 | Ga0070682_10000076314 | 270 |
| 295 | 3300005338 | Ga0068868_100009542 | Ga0068868_1000095424 | 270 |
| 296 | 3300005338 | Ga0068868_100010057 | Ga0068868_1000100572 | 270 |
| 297 | 3300005338 | Ga0068868_100020797 | Ga0068868_1000207973 | 270 |
| 298 | 3300005338 | Ga0068868_100023201 | Ga0068868_1000232011 | 270 |
| 299 | 3300005338 | Ga0068868_100029528 | Ga0068868_1000295285 | 270 |
| 300 | 3300005338 | Ga0068868_100222541 | Ga0068868_1002225411 | 270 |
| 301 | 3300005338 | Ga0068868_100486689 | Ga0068868_1004866891 | 270 |
| 302 | 3300005338 | Ga0068868_100525858 | Ga0068868_1005258581 | 270 |
| 303 | 3300005339 | Ga0070660_100007237 | Ga0070660_1000072374 | 270 |
| 304 | 3300005339 | Ga0070660_100015655 | Ga0070660_1000156553 | 270 |
| 305 | 3300005340 | Ga0070689_100371436 | Ga0070689_1003714362 | 270 |
| 306 | 3300005340 | Ga0070689_100578495 | Ga0070689_1005784951 | 270 |
| 307 | 3300005341 | Ga0070691_10003781 | Ga0070691_100037815 | 270 |
| 308 | 3300005341 | Ga0070691_10080700 | Ga0070691_100807002 | 270 |
| 309 | 3300005343 | Ga0070687_100060562 | Ga0070687_1000605622 | 270 |
| 310 | 3300005344 | Ga0070661_100008117 | Ga0070661_1000081174 | 270 |
| 311 | 3300005344 | Ga0070661_100013480 | Ga0070661_1000134804 | 270 |
| 312 | 3300005344 | Ga0070661_100015221 | Ga0070661_1000152215 | 270 |
| 313 | 3300005344 | Ga0070661_100278994 | Ga0070661_1002789942 | 270 |
| 314 | 3300005347 | Ga0070668_100000043 | Ga0070668_1000000436 | 270 |
| 315 | 3300005347 | Ga0070668_100055178 | Ga0070668_1000551783 | 270 |
| 316 | 3300005353 | Ga0070669_100021225 | Ga0070669_1000212252 | 270 |
| 317 | 3300005353 | Ga0070669_100027147 | Ga0070669_1000271472 | 270 |
| 318 | 3300005354 | Ga0070675_100012773 | Ga0070675_1000127736 | 270 |
| 319 | 3300005354 | Ga0070675_100022391 | Ga0070675_1000223914 | 270 |
| 320 | 3300005354 | Ga0070675_100419922 | Ga0070675_1004199221 | 270 |
| 321 | 3300005355 | Ga0070671_100075054 | Ga0070671_1000750541 | 270 |
| 322 | 3300005355 | Ga0070671_100098121 | Ga0070671_1000981212 | 270 |
| 323 | 3300005355 | Ga0070671_100116745 | Ga0070671_1001167452 | 270 |
| 324 | 3300005355 | Ga0070671_100347355 | Ga0070671_1003473552 | 270 |
| 325 | 3300005356 | Ga0070674_100007210 | Ga0070674_1000072103 | 270 |
| 326 | 3300005356 | Ga0070674_100048543 | Ga0070674_1000485432 | 270 |
| 327 | 3300005356 | Ga0070674_100093218 | Ga0070674_1000932183 | 270 |
| 328 | 3300005356 | Ga0070674_100108558 | Ga0070674_1001085583 | 270 |
| 329 | 3300005356 | Ga0070674_100545728 | Ga0070674_1005457281 | 270 |
| 330 | 3300005364 | Ga0070673_100000327 | Ga0070673_10000032718 | 270 |
| 331 | 3300005364 | Ga0070673_100025591 | Ga0070673_1000255913 | 270 |
| 332 | 3300005364 | Ga0070673_100026841 | Ga0070673_1000268414 | 270 |
| 333 | 3300005364 | Ga0070673_100029665 | Ga0070673_1000296655 | 270 |
| 334 | 3300005364 | Ga0070673_100076951 | Ga0070673_1000769513 | 270 |
| 335 | 3300005364 | Ga0070673_100101829 | Ga0070673_1001018293 | 270 |
| 336 | 3300005364 | Ga0070673_100105793 | Ga0070673_1001057933 | 270 |
| 337 | 3300005364 | Ga0070673_100113300 | Ga0070673_1001133001 | 270 |
| 338 | 3300005365 | Ga0070688_100008996 | Ga0070688_1000089962 | 270 |
| 339 | 3300005365 | Ga0070688_100010503 | Ga0070688_1000105033 | 270 |
| 340 | 3300005365 | Ga0070688_100066198 | Ga0070688_1000661982 | 270 |
| 341 | 3300005365 | Ga0070688_100169717 | Ga0070688_1001697172 | 270 |
| 342 | 3300005366 | Ga0070659_100003048 | Ga0070659_1000030485 | 270 |
| 343 | 3300005366 | Ga0070659_100340092 | Ga0070659_1003400922 | 270 |
| 344 | 3300005366 | Ga0070659_100512500 | Ga0070659_1005125001 | 270 |
| 345 | 3300005367 | Ga0070667_100002415 | Ga0070667_1000024159 | 270 |
| 346 | 3300005367 | Ga0070667_100003720 | Ga0070667_10000372011 | 270 |
| 347 | 3300005367 | Ga0070667_100013202 | Ga0070667_1000132022 | 270 |
| 348 | 3300005367 | Ga0070667_100014132 | Ga0070667_1000141323 | 270 |
| 349 | 3300005367 | Ga0070667_100172908 | Ga0070667_1001729082 | 270 |
| 350 | 3300005367 | Ga0070667_100181840 | Ga0070667_1001818402 | 270 |
| 351 | 3300005367 | Ga0070667_100192966 | Ga0070667_1001929662 | 270 |
| 352 | 3300005441 | Ga0070700_100073234 | Ga0070700_1000732342 | 270 |
| 353 | 3300005455 | Ga0070663_100127377 | Ga0070663_1001273772 | 270 |
| 354 | 3300005455 | Ga0070663_100164210 | Ga0070663_1001642101 | 270 |
| 355 | 3300005455 | Ga0070663_100212572 | Ga0070663_1002125722 | 270 |
| 356 | 3300005456 | Ga0070678_100119132 | Ga0070678_1001191322 | 270 |
| 357 | 3300005456 | Ga0070678_100151186 | Ga0070678_1001511862 | 270 |
| 358 | 3300005457 | Ga0070662_100000634 | Ga0070662_10000063410 | 270 |
| 359 | 3300005457 | Ga0070662_100006198 | Ga0070662_1000061983 | 270 |
| 360 | 3300005457 | Ga0070662_100011578 | Ga0070662_1000115782 | 270 |
| 361 | 3300005457 | Ga0070662_100024164 | Ga0070662_1000241642 | 270 |
| 362 | 3300005457 | Ga0070662_100351813 | Ga0070662_1003518132 | 270 |
| 363 | 3300005458 | Ga0070681_10171808 | Ga0070681_101718081 | 270 |
| 364 | 3300005459 | Ga0068867_100007977 | Ga0068867_1000079776 | 270 |
| 365 | 3300005459 | Ga0068867_100033229 | Ga0068867_1000332292 | 270 |
| 366 | 3300005459 | Ga0068867_100110092 | Ga0068867_1001100922 | 270 |
| 367 | 3300005466 | Ga0070685_10020801 | Ga0070685_100208014 | 270 |
| 368 | 3300005466 | Ga0070685_10020953 | Ga0070685_100209534 | 270 |
| 369 | 3300005466 | Ga0070685_10023651 | Ga0070685_100236514 | 270 |
| 370 | 3300005466 | Ga0070685_10294017 | Ga0070685_102940171 | 270 |
| 371 | 3300005468 | Ga0070707_100237998 | Ga0070707_1002379982 | 270 |
| 372 | 3300005471 | Ga0070698_100000297 | Ga0070698_10000029748 | 270 |
| 373 | 3300005471 | Ga0070698_100044656 | Ga0070698_1000446565 | 270 |
| 374 | 3300005471 | Ga0070698_100306542 | Ga0070698_1003065422 | 270 |
| 375 | 3300005530 | Ga0070679_100009706 | Ga0070679_1000097066 | 270 |
| 376 | 3300005530 | Ga0070679_100017964 | Ga0070679_1000179647 | 270 |
| 377 | 3300005535 | Ga0070684_100002223 | Ga0070684_1000022235 | 270 |
| 378 | 3300005535 | Ga0070684_100003255 | Ga0070684_1000032556 | 270 |
| 379 | 3300005535 | Ga0070684_100036799 | Ga0070684_1000367995 | 270 |
| 380 | 3300005535 | Ga0070684_100123368 | Ga0070684_1001233682 | 270 |
| 381 | 3300005539 | Ga0068853_100000393 | Ga0068853_10000039323 | 270 |
| 382 | 3300005539 | Ga0068853_100012039 | Ga0068853_1000120393 | 270 |
| 383 | 3300005539 | Ga0068853_100012865 | Ga0068853_1000128657 | 270 |
| 384 | 3300005539 | Ga0068853_100035117 | Ga0068853_1000351173 | 270 |
| 385 | 3300005539 | Ga0068853_100038576 | Ga0068853_1000385764 | 270 |
| 386 | 3300005539 | Ga0068853_100047147 | Ga0068853_1000471474 | 270 |
| 387 | 3300005539 | Ga0068853_100086173 | Ga0068853_1000861732 | 270 |
| 388 | 3300005539 | Ga0068853_100134818 | Ga0068853_1001348182 | 270 |
| 389 | 3300005539 | Ga0068853_100187668 | Ga0068853_1001876682 | 270 |
| 390 | 3300005539 | Ga0068853_100198341 | Ga0068853_1001983412 | 270 |
| 391 | 3300005539 | Ga0068853_100249885 | Ga0068853_1002498853 | 270 |
| 392 | 3300005539 | Ga0068853_100539848 | Ga0068853_1005398481 | 270 |
| 393 | 3300005543 | Ga0070672_100000109 | Ga0070672_10000010929 | 270 |
| 394 | 3300005543 | Ga0070672_100025040 | Ga0070672_1000250403 | 270 |
| 395 | 3300005543 | Ga0070672_100404349 | Ga0070672_1004043492 | 270 |
| 396 | 3300005544 | Ga0070686_100116157 | Ga0070686_1001161572 | 270 |
| 397 | 3300005546 | Ga0070696_100127934 | Ga0070696_1001279342 | 270 |
| 398 | 3300005547 | Ga0070693_100029934 | Ga0070693_1000299343 | 270 |
| 399 | 3300005548 | Ga0070665_100000013 | Ga0070665_100000013222 | 270 |
| 400 | 3300005548 | Ga0070665_100033784 | Ga0070665_1000337843 | 270 |
| 401 | 3300005563 | Ga0068855_100000424 | Ga0068855_10000042438 | 270 |
| 402 | 3300005563 | Ga0068855_100007894 | Ga0068855_1000078943 | 270 |
| 403 | 3300005563 | Ga0068855_100042418 | Ga0068855_1000424184 | 270 |
| 404 | 3300005563 | Ga0068855_100043267 | Ga0068855_1000432672 | 270 |
| 405 | 3300005563 | Ga0068855_100125412 | Ga0068855_1001254123 | 270 |
| 406 | 3300005563 | Ga0068855_100129313 | Ga0068855_1001293133 | 270 |
| 407 | 3300005563 | Ga0068855_100260832 | Ga0068855_1002608321 | 270 |
| 408 | 3300005564 | Ga0070664_100003401 | Ga0070664_10000340110 | 270 |
| 409 | 3300005564 | Ga0070664_100014457 | Ga0070664_1000144572 | 270 |
| 410 | 3300005564 | Ga0070664_100181958 | Ga0070664_1001819582 | 270 |
| 411 | 3300005564 | Ga0070664_100246686 | Ga0070664_1002466863 | 270 |
| 412 | 3300005577 | Ga0068857_100026465 | Ga0068857_1000264653 | 270 |
| 413 | 3300005577 | Ga0068857_100041415 | Ga0068857_1000414152 | 270 |
| 414 | 3300005577 | Ga0068857_100164522 | Ga0068857_1001645222 | 270 |
| 415 | 3300005577 | Ga0068857_100295396 | Ga0068857_1002953962 | 270 |
| 416 | 3300005578 | Ga0068854_100068897 | Ga0068854_1000688973 | 270 |
| 417 | 3300005578 | Ga0068854_100298702 | Ga0068854_1002987021 | 270 |
| 418 | 3300005578 | Ga0068854_100681855 | Ga0068854_1006818551 | 270 |
| 419 | 3300005614 | Ga0068856_100036956 | Ga0068856_1000369563 | 270 |
| 420 | 3300005614 | Ga0068856_100184238 | Ga0068856_1001842381 | 270 |
| 421 | 3300005615 | Ga0070702_100332360 | Ga0070702_1003323601 | 270 |
| 422 | 3300005616 | Ga0068852_100002256 | Ga0068852_1000022569 | 270 |
| 423 | 3300005616 | Ga0068852_100007763 | Ga0068852_1000077636 | 270 |
| 424 | 3300005616 | Ga0068852_100008104 | Ga0068852_1000081041 | 270 |
| 425 | 3300005616 | Ga0068852_100028525 | Ga0068852_1000285253 | 270 |
| 426 | 3300005616 | Ga0068852_100061314 | Ga0068852_1000613143 | 270 |
| 427 | 3300005616 | Ga0068852_100124699 | Ga0068852_1001246992 | 270 |
| 428 | 3300005616 | Ga0068852_100169367 | Ga0068852_1001693672 | 270 |
| 429 | 3300005616 | Ga0068852_100173333 | Ga0068852_1001733333 | 270 |
| 430 | 3300005616 | Ga0068852_100184267 | Ga0068852_1001842673 | 270 |
| 431 | 3300005617 | Ga0068859_100000012 | Ga0068859_10000001215 | 270 |
| 432 | 3300005617 | Ga0068859_100009837 | Ga0068859_10000983710 | 270 |
| 433 | 3300005617 | Ga0068859_100291434 | Ga0068859_1002914342 | 270 |
| 434 | 3300005617 | Ga0068859_100330486 | Ga0068859_1003304862 | 270 |
| 435 | 3300005617 | Ga0068859_100411599 | Ga0068859_1004115992 | 270 |
| 436 | 3300005618 | Ga0068864_100002855 | Ga0068864_1000028552 | 270 |
| 437 | 3300005618 | Ga0068864_100002925 | Ga0068864_1000029255 | 270 |
| 438 | 3300005618 | Ga0068864_100334473 | Ga0068864_1003344731 | 270 |
| 439 | 3300005618 | Ga0068864_100414635 | Ga0068864_1004146352 | 270 |
| 440 | 3300005618 | Ga0068864_100434066 | Ga0068864_1004340662 | 270 |
| 441 | 3300005718 | Ga0068866_10031108 | Ga0068866_100311082 | 270 |
| 442 | 3300005718 | Ga0068866_10039537 | Ga0068866_100395373 | 270 |
| 443 | 3300005719 | Ga0068861_100096503 | Ga0068861_1000965032 | 270 |
| 444 | 3300005834 | Ga0068851_10000757 | Ga0068851_100007579 | 270 |
| 445 | 3300005834 | Ga0068851_10023638 | Ga0068851_100236382 | 270 |
| 446 | 3300005834 | Ga0068851_10033342 | Ga0068851_100333422 | 270 |
| 447 | 3300005834 | Ga0068851_10061988 | Ga0068851_100619882 | 270 |
| 448 | 3300005834 | Ga0068851_10099080 | Ga0068851_100990802 | 270 |
| 449 | 3300005834 | Ga0068851_10123477 | Ga0068851_101234772 | 270 |
| 450 | 3300005840 | Ga0068870_10086437 | Ga0068870_100864372 | 270 |
| 451 | 3300005841 | Ga0068863_100000837 | Ga0068863_10000083715 | 270 |
| 452 | 3300005841 | Ga0068863_100004877 | Ga0068863_1000048773 | 270 |
| 453 | 3300005841 | Ga0068863_100031428 | Ga0068863_1000314285 | 270 |
| 454 | 3300005841 | Ga0068863_100167215 | Ga0068863_1001672153 | 270 |
| 455 | 3300005841 | Ga0068863_100241607 | Ga0068863_1002416072 | 270 |
| 456 | 3300005841 | Ga0068863_100912930 | Ga0068863_1009129301 | 270 |
| 457 | 3300005842 | Ga0068858_100000199 | Ga0068858_10000019910 | 270 |
| 458 | 3300005842 | Ga0068858_100003623 | Ga0068858_10000362310 | 270 |
| 459 | 3300005842 | Ga0068858_100044704 | Ga0068858_1000447041 | 270 |
| 460 | 3300005842 | Ga0068858_100062898 | Ga0068858_1000628982 | 270 |
| 461 | 3300005842 | Ga0068858_100138918 | Ga0068858_1001389183 | 270 |
| 462 | 3300005843 | Ga0068860_100000060 | Ga0068860_100000060141 | 270 |
| 463 | 3300005843 | Ga0068860_100001065 | Ga0068860_10000106526 | 270 |
| 464 | 3300005843 | Ga0068860_100002282 | Ga0068860_10000228214 | 270 |
| 465 | 3300005843 | Ga0068860_100006172 | Ga0068860_1000061726 | 270 |
| 466 | 3300005843 | Ga0068860_100015467 | Ga0068860_1000154672 | 270 |
| 467 | 3300005843 | Ga0068860_100024334 | Ga0068860_1000243341 | 270 |
| 468 | 3300005985 | Ga0081539_10000037 | Ga0081539_10000037167 | 270 |
| 469 | 3300005985 | Ga0081539_10021605 | Ga0081539_100216053 | 270 |
| 470 | 3300006195 | Ga0075366_10128799 | Ga0075366_101287992 | 270 |
| 471 | 3300006195 | Ga0075366_10145746 | Ga0075366_101457462 | 270 |
| 472 | 3300006195 | Ga0075366_10185617 | Ga0075366_101856171 | 270 |
| 473 | 3300006195 | Ga0075366_10262687 | Ga0075366_102626871 | 270 |
| 474 | 3300006237 | Ga0097621_100027698 | Ga0097621_1000276984 | 270 |
| 475 | 3300006237 | Ga0097621_100080231 | Ga0097621_1000802312 | 270 |
| 476 | 3300006237 | Ga0097621_100116128 | Ga0097621_1001161282 | 270 |
| 477 | 3300006237 | Ga0097621_100139561 | Ga0097621_1001395612 | 270 |
| 478 | 3300006237 | Ga0097621_100193836 | Ga0097621_1001938361 | 270 |
| 479 | 3300006237 | Ga0097621_100296828 | Ga0097621_1002968282 | 270 |
| 480 | 3300006358 | Ga0068871_100012310 | Ga0068871_1000123103 | 270 |
| 481 | 3300006358 | Ga0068871_100025288 | Ga0068871_1000252883 | 270 |
| 482 | 3300006358 | Ga0068871_100035662 | Ga0068871_1000356626 | 270 |
| 483 | 3300006358 | Ga0068871_100076489 | Ga0068871_1000764892 | 270 |
| 484 | 3300006358 | Ga0068871_100097438 | Ga0068871_1000974383 | 270 |
| 485 | 3300006358 | Ga0068871_100302487 | Ga0068871_1003024872 | 270 |
| 486 | 3300006881 | Ga0068865_100029956 | Ga0068865_1000299563 | 270 |
| 487 | 3300006881 | Ga0068865_100169183 | Ga0068865_1001691832 | 270 |
| 488 | 3300006881 | Ga0068865_100214390 | Ga0068865_1002143902 | 270 |
| 489 | 3300006881 | Ga0068865_100625544 | Ga0068865_1006255441 | 270 |
| 490 | 3300006931 | Ga0097620_100000012 | Ga0097620_10000001215 | 270 |
| 491 | 3300006931 | Ga0097620_100009837 | Ga0097620_10000983710 | 270 |
| 492 | 3300006931 | Ga0097620_100291442 | Ga0097620_1002914422 | 270 |
| 493 | 3300006931 | Ga0097620_100330498 | Ga0097620_1003304982 | 270 |
| 494 | 3300006931 | Ga0097620_100411639 | Ga0097620_1004116392 | 270 |
| 495 | 3300009093 | Ga0105240_10000486 | Ga0105240_1000048662 | 270 |
| 496 | 3300009093 | Ga0105240_10001336 | Ga0105240_1000133634 | 270 |
| 497 | 3300009093 | Ga0105240_10001733 | Ga0105240_1000173316 | 270 |
| 498 | 3300009093 | Ga0105240_10002769 | Ga0105240_1000276913 | 270 |
| 499 | 3300009093 | Ga0105240_10092055 | Ga0105240_100920552 | 270 |
| 500 | 3300009093 | Ga0105240_10140580 | Ga0105240_101405803 | 270 |
| 501 | 3300009093 | Ga0105240_10187278 | Ga0105240_101872781 | 270 |
| 502 | 3300009093 | Ga0105240_10260537 | Ga0105240_102605372 | 270 |
| 503 | 3300009093 | Ga0105240_10385880 | Ga0105240_103858802 | 270 |
| 504 | 3300009093 | Ga0105240_10474576 | Ga0105240_104745762 | 270 |
| 505 | 3300009094 | Ga0111539_10029443 | Ga0111539_100294432 | 270 |
| 506 | 3300009094 | Ga0111539_10223014 | Ga0111539_102230142 | 270 |
| 507 | 3300009098 | Ga0105245_10707957 | Ga0105245_107079571 | 270 |
| 508 | 3300009101 | Ga0105247_10087178 | Ga0105247_100871783 | 270 |
| 509 | 3300009101 | Ga0105247_10179217 | Ga0105247_101792172 | 270 |
| 510 | 3300009147 | Ga0114129_10201912 | Ga0114129_102019123 | 270 |
| 511 | 3300009174 | Ga0105241_10000160 | Ga0105241_1000016016 | 270 |
| 512 | 3300009174 | Ga0105241_10005397 | Ga0105241_100053974 | 270 |
| 513 | 3300009174 | Ga0105241_10006798 | Ga0105241_100067987 | 270 |
| 514 | 3300009176 | Ga0105242_10010378 | Ga0105242_100103788 | 270 |
| 515 | 3300009176 | Ga0105242_10040136 | Ga0105242_100401364 | 270 |
| 516 | 3300009176 | Ga0105242_10043339 | Ga0105242_100433392 | 270 |
| 517 | 3300009176 | Ga0105242_10045988 | Ga0105242_100459883 | 270 |
| 518 | 3300009176 | Ga0105242_10086591 | Ga0105242_100865913 | 270 |
| 519 | 3300009176 | Ga0105242_10140101 | Ga0105242_101401013 | 270 |
| 520 | 3300009176 | Ga0105242_10155242 | Ga0105242_101552422 | 270 |
| 521 | 3300009177 | Ga0105248_10031239 | Ga0105248_100312393 | 270 |
| 522 | 3300009545 | Ga0105237_10000651 | Ga0105237_1000065139 | 270 |
| 523 | 3300009545 | Ga0105237_10001003 | Ga0105237_1000100334 | 270 |
| 524 | 3300009545 | Ga0105237_10010984 | Ga0105237_100109846 | 270 |
| 525 | 3300009545 | Ga0105237_10012955 | Ga0105237_100129556 | 270 |
| 526 | 3300009545 | Ga0105237_10031701 | Ga0105237_100317015 | 270 |
| 527 | 3300009545 | Ga0105237_10061473 | Ga0105237_100614732 | 270 |
| 528 | 3300009545 | Ga0105237_10096161 | Ga0105237_100961613 | 270 |
| 529 | 3300009545 | Ga0105237_10229777 | Ga0105237_102297772 | 270 |
| 530 | 3300009545 | Ga0105237_10327524 | Ga0105237_103275242 | 270 |
| 531 | 3300009551 | Ga0105238_10006277 | Ga0105238_100062777 | 270 |
| 532 | 3300009551 | Ga0105238_10035934 | Ga0105238_100359344 | 270 |
| 533 | 3300009551 | Ga0105238_10041567 | Ga0105238_100415673 | 270 |
| 534 | 3300009553 | Ga0105249_10003523 | Ga0105249_100035234 | 270 |
| 535 | 3300009553 | Ga0105249_10034299 | Ga0105249_100342994 | 270 |
| 536 | 3300009553 | Ga0105249_10056871 | Ga0105249_100568713 | 270 |
| 537 | 3300009553 | Ga0105249_10095840 | Ga0105249_100958403 | 270 |
| 538 | 3300009553 | Ga0105249_10170736 | Ga0105249_101707362 | 270 |
| 539 | 3300009553 | Ga0105249_10208189 | Ga0105249_102081892 | 270 |
| 540 | 3300009553 | Ga0105249_10283174 | Ga0105249_102831742 | 270 |
| 541 | 3300009553 | Ga0105249_10294582 | Ga0105249_102945822 | 270 |
| 542 | 3300010375 | Ga0105239_10000457 | Ga0105239_1000045710 | 270 |
| 543 | 3300010375 | Ga0105239_10001481 | Ga0105239_1000148113 | 270 |
| 544 | 3300010375 | Ga0105239_10014988 | Ga0105239_100149885 | 270 |
| 545 | 3300010375 | Ga0105239_10018841 | Ga0105239_100188413 | 270 |
| 546 | 3300010375 | Ga0105239_10046890 | Ga0105239_100468902 | 270 |
| 547 | 3300010375 | Ga0105239_10049269 | Ga0105239_100492692 | 270 |
| 548 | 3300010375 | Ga0105239_10098424 | Ga0105239_100984245 | 270 |
| 549 | 3300010375 | Ga0105239_10207254 | Ga0105239_102072543 | 270 |
| 550 | 3300011119 | Ga0105246_10013049 | Ga0105246_100130493 | 270 |
| 551 | 3300011119 | Ga0105246_10034419 | Ga0105246_100344194 | 270 |
| 552 | 3300011119 | Ga0105246_10145743 | Ga0105246_101457431 | 270 |
| 553 | 3300013100 | Ga0157373_10010365 | Ga0157373_100103654 | 270 |
| 554 | 3300013100 | Ga0157373_10011057 | Ga0157373_100110573 | 270 |
| 555 | 3300013100 | Ga0157373_10011567 | Ga0157373_100115676 | 270 |
| 556 | 3300013100 | Ga0157373_10044643 | Ga0157373_100446431 | 270 |
| 557 | 3300013100 | Ga0157373_10127960 | Ga0157373_101279601 | 270 |
| 558 | 3300013102 | Ga0157371_10000009 | Ga0157371_10000009327 | 270 |
| 559 | 3300013102 | Ga0157371_10004069 | Ga0157371_100040697 | 270 |
| 560 | 3300013102 | Ga0157371_10022986 | Ga0157371_100229864 | 270 |
| 561 | 3300013102 | Ga0157371_10053517 | Ga0157371_100535172 | 270 |
| 562 | 3300013102 | Ga0157371_10112606 | Ga0157371_101126061 | 270 |
| 563 | 3300013102 | Ga0157371_10150197 | Ga0157371_101501972 | 270 |
| 564 | 3300013102 | Ga0157371_10174230 | Ga0157371_101742301 | 270 |
| 565 | 3300013104 | Ga0157370_10001064 | Ga0157370_1000106416 | 270 |
| 566 | 3300013104 | Ga0157370_10002306 | Ga0157370_1000230617 | 270 |
| 567 | 3300013104 | Ga0157370_10004498 | Ga0157370_100044982 | 270 |
| 568 | 3300013104 | Ga0157370_10011684 | Ga0157370_100116844 | 270 |
| 569 | 3300013104 | Ga0157370_10012352 | Ga0157370_100123524 | 270 |
| 570 | 3300013104 | Ga0157370_10020896 | Ga0157370_100208964 | 270 |
| 571 | 3300013104 | Ga0157370_10059442 | Ga0157370_100594421 | 270 |
| 572 | 3300013104 | Ga0157370_10179665 | Ga0157370_101796652 | 270 |
| 573 | 3300013104 | Ga0157370_10526036 | Ga0157370_105260362 | 270 |
| 574 | 3300013104 | Ga0157370_10551105 | Ga0157370_105511051 | 270 |
| 575 | 3300013105 | Ga0157369_10000006 | Ga0157369_10000006353 | 270 |
| 576 | 3300013105 | Ga0157369_10008134 | Ga0157369_100081346 | 270 |
| 577 | 3300013105 | Ga0157369_10015578 | Ga0157369_100155784 | 270 |
| 578 | 3300013105 | Ga0157369_10080689 | Ga0157369_100806893 | 270 |
| 579 | 3300013105 | Ga0157369_10180230 | Ga0157369_101802302 | 270 |
| 580 | 3300013105 | Ga0157369_10373796 | Ga0157369_103737962 | 270 |
| 581 | 3300013296 | Ga0157374_10000007 | Ga0157374_10000007164 | 270 |
| 582 | 3300013296 | Ga0157374_10000629 | Ga0157374_100006296 | 270 |
| 583 | 3300013296 | Ga0157374_10029588 | Ga0157374_100295883 | 270 |
| 584 | 3300013296 | Ga0157374_10059605 | Ga0157374_100596053 | 270 |
| 585 | 3300013296 | Ga0157374_10065532 | Ga0157374_100655324 | 270 |
| 586 | 3300013296 | Ga0157374_10075514 | Ga0157374_100755144 | 270 |
| 587 | 3300013296 | Ga0157374_10180871 | Ga0157374_101808712 | 270 |
| 588 | 3300013296 | Ga0157374_10214026 | Ga0157374_102140262 | 270 |
| 589 | 3300013296 | Ga0157374_10242203 | Ga0157374_102422032 | 270 |
| 590 | 3300013296 | Ga0157374_10954962 | Ga0157374_109549621 | 270 |
| 591 | 3300013297 | Ga0157378_10006049 | Ga0157378_1000604913 | 270 |
| 592 | 3300013297 | Ga0157378_10006118 | Ga0157378_100061183 | 270 |
| 593 | 3300013297 | Ga0157378_10006926 | Ga0157378_100069268 | 270 |
| 594 | 3300013297 | Ga0157378_10007878 | Ga0157378_100078783 | 270 |
| 595 | 3300013297 | Ga0157378_10025320 | Ga0157378_100253203 | 270 |
| 596 | 3300013297 | Ga0157378_10057639 | Ga0157378_100576393 | 270 |
| 597 | 3300013297 | Ga0157378_10072304 | Ga0157378_100723044 | 270 |
| 598 | 3300013297 | Ga0157378_10139500 | Ga0157378_101395002 | 270 |
| 599 | 3300013306 | Ga0163162_10000140 | Ga0163162_1000014048 | 270 |
| 600 | 3300013306 | Ga0163162_10000177 | Ga0163162_1000017743 | 270 |
| 601 | 3300013306 | Ga0163162_10000213 | Ga0163162_1000021338 | 270 |
| 602 | 3300013306 | Ga0163162_10004487 | Ga0163162_100044879 | 270 |
| 603 | 3300013306 | Ga0163162_10008778 | Ga0163162_100087785 | 270 |
| 604 | 3300013306 | Ga0163162_10011211 | Ga0163162_100112114 | 270 |
| 605 | 3300013306 | Ga0163162_10022548 | Ga0163162_100225484 | 270 |
| 606 | 3300013306 | Ga0163162_10041859 | Ga0163162_100418595 | 270 |
| 607 | 3300013306 | Ga0163162_10050767 | Ga0163162_100507673 | 270 |
| 608 | 3300013306 | Ga0163162_10058353 | Ga0163162_100583531 | 270 |
| 609 | 3300013306 | Ga0163162_10150916 | Ga0163162_101509162 | 270 |
| 610 | 3300013306 | Ga0163162_10207695 | Ga0163162_102076951 | 270 |
| 611 | 3300013307 | Ga0157372_10002277 | Ga0157372_1000227716 | 270 |
| 612 | 3300013307 | Ga0157372_10007751 | Ga0157372_100077514 | 270 |
| 613 | 3300013307 | Ga0157372_10008222 | Ga0157372_100082224 | 270 |
| 614 | 3300013307 | Ga0157372_10016773 | Ga0157372_100167735 | 270 |
| 615 | 3300013307 | Ga0157372_10028931 | Ga0157372_100289314 | 270 |
| 616 | 3300013307 | Ga0157372_10088920 | Ga0157372_100889203 | 270 |
| 617 | 3300013307 | Ga0157372_10096272 | Ga0157372_100962722 | 270 |
| 618 | 3300013307 | Ga0157372_10133614 | Ga0157372_101336143 | 270 |
| 619 | 3300013307 | Ga0157372_10193945 | Ga0157372_101939452 | 270 |
| 620 | 3300013308 | Ga0157375_10001313 | Ga0157375_1000131315 | 270 |
| 621 | 3300013308 | Ga0157375_10050973 | Ga0157375_100509734 | 270 |
| 622 | 3300013308 | Ga0157375_10054532 | Ga0157375_100545324 | 270 |
| 623 | 3300013308 | Ga0157375_10074533 | Ga0157375_100745333 | 270 |
| 624 | 3300013308 | Ga0157375_10160367 | Ga0157375_101603671 | 270 |
| 625 | 3300013308 | Ga0157375_10321264 | Ga0157375_103212642 | 270 |
| 626 | 3300013308 | Ga0157375_10353298 | Ga0157375_103532982 | 270 |
| 627 | 3300014325 | Ga0163163_10000332 | Ga0163163_100003325 | 270 |
| 628 | 3300014325 | Ga0163163_10000457 | Ga0163163_100004573 | 270 |
| 629 | 3300014325 | Ga0163163_10044180 | Ga0163163_100441802 | 270 |
| 630 | 3300014325 | Ga0163163_10128627 | Ga0163163_101286272 | 270 |
| 631 | 3300014325 | Ga0163163_10232691 | Ga0163163_102326911 | 270 |
| 632 | 3300014325 | Ga0163163_10353516 | Ga0163163_103535162 | 270 |
| 633 | 3300014325 | Ga0163163_10767535 | Ga0163163_107675351 | 270 |
| 634 | 3300014326 | Ga0157380_10000022 | Ga0157380_1000002268 | 270 |
| 635 | 3300014326 | Ga0157380_10046770 | Ga0157380_100467704 | 270 |
| 636 | 3300014326 | Ga0157380_10079325 | Ga0157380_100793253 | 270 |
| 637 | 3300014326 | Ga0157380_10088288 | Ga0157380_100882882 | 270 |
| 638 | 3300014497 | Ga0182008_10009414 | Ga0182008_100094144 | 270 |
| 639 | 3300014745 | Ga0157377_10060152 | Ga0157377_100601522 | 270 |
| 640 | 3300014968 | Ga0157379_10000340 | Ga0157379_1000034027 | 270 |
| 641 | 3300014968 | Ga0157379_10042488 | Ga0157379_100424882 | 270 |
| 642 | 3300014968 | Ga0157379_10080869 | Ga0157379_100808691 | 270 |
| 643 | 3300014968 | Ga0157379_10168863 | Ga0157379_101688632 | 270 |
| 644 | 3300014968 | Ga0157379_10268519 | Ga0157379_102685192 | 270 |
| 645 | 3300014969 | Ga0157376_10000771 | Ga0157376_1000077110 | 270 |
| 646 | 3300014969 | Ga0157376_10003394 | Ga0157376_100033944 | 270 |
| 647 | 3300014969 | Ga0157376_10058992 | Ga0157376_100589921 | 270 |
| 648 | 3300014969 | Ga0157376_10131972 | Ga0157376_101319721 | 270 |
| 649 | 3300014969 | Ga0157376_10248818 | Ga0157376_102488183 | 270 |
| 650 | 3300014969 | Ga0157376_10389068 | Ga0157376_103890682 | 270 |
| 651 | 3300015261 | Ga0182006_1000322 | Ga0182006_10003226 | 270 |
| 652 | 3300015261 | Ga0182006_1008844 | Ga0182006_10088443 | 270 |
| 653 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001302 | 270 |
| 654 | 3300015682 | Ga0183373_1006 | Ga0183373_1006198 | 270 |
| 655 | 3300017792 | Ga0163161_10001740 | Ga0163161_100017402 | 270 |
| 656 | 3300017792 | Ga0163161_10002015 | Ga0163161_100020152 | 270 |
| 657 | 3300017792 | Ga0163161_10005625 | Ga0163161_100056254 | 270 |
| 658 | 3300017792 | Ga0163161_10014448 | Ga0163161_100144482 | 270 |
| 659 | 3300017792 | Ga0163161_10022817 | Ga0163161_100228173 | 270 |
| 660 | 3300017792 | Ga0163161_10274892 | Ga0163161_102748922 | 270 |
| 661 | 3300017792 | Ga0163161_10295845 | Ga0163161_102958452 | 270 |
| 662 | 3300020078 | Ga0206352_10602261 | Ga0206352_106022611 | 270 |
| 663 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007330 | 270 |
| 664 | 3300025246 | Ga0209646_1000770 | Ga0209646_10007707 | 270 |
| 665 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006330 | 270 |
| 666 | 3300025271 | Ga0207666_1004201 | Ga0207666_10042012 | 270 |
| 667 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025160 | 270 |
| 668 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016330 | 270 |
| 669 | 3300025302 | Ga0207426_1000230 | Ga0207426_1000230102 | 270 |
| 670 | 3300025315 | Ga0207697_10061167 | Ga0207697_100611672 | 270 |
| 671 | 3300025315 | Ga0207697_10068184 | Ga0207697_100681842 | 270 |
| 672 | 3300025321 | Ga0207656_10005150 | Ga0207656_100051505 | 270 |
| 673 | 3300025893 | Ga0207682_10009398 | Ga0207682_100093983 | 270 |
| 674 | 3300025893 | Ga0207682_10108183 | Ga0207682_101081831 | 270 |
| 675 | 3300025899 | Ga0207642_10041343 | Ga0207642_100413432 | 270 |
| 676 | 3300025899 | Ga0207642_10119113 | Ga0207642_101191132 | 270 |
| 677 | 3300025900 | Ga0207710_10000804 | Ga0207710_1000080412 | 270 |
| 678 | 3300025900 | Ga0207710_10016472 | Ga0207710_100164723 | 270 |
| 679 | 3300025900 | Ga0207710_10093631 | Ga0207710_100936311 | 270 |
| 680 | 3300025901 | Ga0207688_10007738 | Ga0207688_100077382 | 270 |
| 681 | 3300025901 | Ga0207688_10011124 | Ga0207688_100111243 | 270 |
| 682 | 3300025903 | Ga0207680_10000031 | Ga0207680_1000003141 | 270 |
| 683 | 3300025903 | Ga0207680_10001651 | Ga0207680_100016518 | 270 |
| 684 | 3300025903 | Ga0207680_10041946 | Ga0207680_100419462 | 270 |
| 685 | 3300025903 | Ga0207680_10162839 | Ga0207680_101628392 | 270 |
| 686 | 3300025904 | Ga0207647_10000288 | Ga0207647_1000028829 | 270 |
| 687 | 3300025904 | Ga0207647_10065300 | Ga0207647_100653003 | 270 |
| 688 | 3300025907 | Ga0207645_10000713 | Ga0207645_1000071318 | 270 |
| 689 | 3300025907 | Ga0207645_10001819 | Ga0207645_1000181913 | 270 |
| 690 | 3300025907 | Ga0207645_10042582 | Ga0207645_100425823 | 270 |
| 691 | 3300025908 | Ga0207643_10010031 | Ga0207643_100100316 | 270 |
| 692 | 3300025909 | Ga0207705_10119645 | Ga0207705_101196452 | 270 |
| 693 | 3300025911 | Ga0207654_10001314 | Ga0207654_100013145 | 270 |
| 694 | 3300025911 | Ga0207654_10003003 | Ga0207654_100030036 | 270 |
| 695 | 3300025912 | Ga0207707_10000323 | Ga0207707_1000032335 | 270 |
| 696 | 3300025913 | Ga0207695_10000130 | Ga0207695_1000013054 | 270 |
| 697 | 3300025913 | Ga0207695_10000170 | Ga0207695_10000170113 | 270 |
| 698 | 3300025913 | Ga0207695_10003034 | Ga0207695_1000303413 | 270 |
| 699 | 3300025913 | Ga0207695_10004097 | Ga0207695_100040977 | 270 |
| 700 | 3300025913 | Ga0207695_10011079 | Ga0207695_100110799 | 270 |
| 701 | 3300025913 | Ga0207695_10037565 | Ga0207695_100375654 | 270 |
| 702 | 3300025913 | Ga0207695_10047325 | Ga0207695_100473254 | 270 |
| 703 | 3300025913 | Ga0207695_10130257 | Ga0207695_101302572 | 270 |
| 704 | 3300025913 | Ga0207695_10173850 | Ga0207695_101738503 | 270 |
| 705 | 3300025913 | Ga0207695_10179390 | Ga0207695_101793902 | 270 |
| 706 | 3300025914 | Ga0207671_10004377 | Ga0207671_1000437710 | 270 |
| 707 | 3300025914 | Ga0207671_10005384 | Ga0207671_100053845 | 270 |
| 708 | 3300025914 | Ga0207671_10012131 | Ga0207671_100121318 | 270 |
| 709 | 3300025914 | Ga0207671_10020567 | Ga0207671_100205674 | 270 |
| 710 | 3300025914 | Ga0207671_10124741 | Ga0207671_101247412 | 270 |
| 711 | 3300025914 | Ga0207671_10275579 | Ga0207671_102755792 | 270 |
| 712 | 3300025917 | Ga0207660_10017192 | Ga0207660_100171923 | 270 |
| 713 | 3300025917 | Ga0207660_10174603 | Ga0207660_101746032 | 270 |
| 714 | 3300025918 | Ga0207662_10011934 | Ga0207662_100119342 | 270 |
| 715 | 3300025919 | Ga0207657_10003020 | Ga0207657_1000302014 | 270 |
| 716 | 3300025919 | Ga0207657_10013457 | Ga0207657_100134573 | 270 |
| 717 | 3300025919 | Ga0207657_10058434 | Ga0207657_100584342 | 270 |
| 718 | 3300025919 | Ga0207657_10107784 | Ga0207657_101077843 | 270 |
| 719 | 3300025920 | Ga0207649_10013964 | Ga0207649_100139641 | 270 |
| 720 | 3300025920 | Ga0207649_10111205 | Ga0207649_101112051 | 270 |
| 721 | 3300025921 | Ga0207652_10015975 | Ga0207652_100159752 | 270 |
| 722 | 3300025921 | Ga0207652_10031715 | Ga0207652_100317155 | 270 |
| 723 | 3300025923 | Ga0207681_10109044 | Ga0207681_101090443 | 270 |
| 724 | 3300025923 | Ga0207681_10179303 | Ga0207681_101793032 | 270 |
| 725 | 3300025924 | Ga0207694_10020325 | Ga0207694_100203251 | 270 |
| 726 | 3300025924 | Ga0207694_10031981 | Ga0207694_100319812 | 270 |
| 727 | 3300025925 | Ga0207650_10105187 | Ga0207650_101051872 | 270 |
| 728 | 3300025925 | Ga0207650_10200158 | Ga0207650_102001582 | 270 |
| 729 | 3300025925 | Ga0207650_10272361 | Ga0207650_102723612 | 270 |
| 730 | 3300025926 | Ga0207659_10014768 | Ga0207659_100147682 | 270 |
| 731 | 3300025926 | Ga0207659_10057168 | Ga0207659_100571681 | 270 |
| 732 | 3300025926 | Ga0207659_10115671 | Ga0207659_101156712 | 270 |
| 733 | 3300025926 | Ga0207659_10130354 | Ga0207659_101303541 | 270 |
| 734 | 3300025926 | Ga0207659_10483281 | Ga0207659_104832811 | 270 |
| 735 | 3300025931 | Ga0207644_10024353 | Ga0207644_100243533 | 270 |
| 736 | 3300025931 | Ga0207644_10219411 | Ga0207644_102194112 | 270 |
| 737 | 3300025932 | Ga0207690_10044183 | Ga0207690_100441833 | 270 |
| 738 | 3300025933 | Ga0207706_10001885 | Ga0207706_1000188513 | 270 |
| 739 | 3300025933 | Ga0207706_10002590 | Ga0207706_100025907 | 270 |
| 740 | 3300025933 | Ga0207706_10024967 | Ga0207706_100249675 | 270 |
| 741 | 3300025933 | Ga0207706_10096610 | Ga0207706_100966103 | 270 |
| 742 | 3300025933 | Ga0207706_10574188 | Ga0207706_105741881 | 270 |
| 743 | 3300025934 | Ga0207686_10003787 | Ga0207686_100037872 | 270 |
| 744 | 3300025934 | Ga0207686_10043510 | Ga0207686_100435103 | 270 |
| 745 | 3300025934 | Ga0207686_10113308 | Ga0207686_101133082 | 270 |
| 746 | 3300025934 | Ga0207686_10139321 | Ga0207686_101393212 | 270 |
| 747 | 3300025936 | Ga0207670_10023950 | Ga0207670_100239502 | 270 |
| 748 | 3300025936 | Ga0207670_10056611 | Ga0207670_100566112 | 270 |
| 749 | 3300025937 | Ga0207669_10194024 | Ga0207669_101940242 | 270 |
| 750 | 3300025937 | Ga0207669_10195968 | Ga0207669_101959681 | 270 |
| 751 | 3300025938 | Ga0207704_10004827 | Ga0207704_100048272 | 270 |
| 752 | 3300025938 | Ga0207704_10106478 | Ga0207704_101064781 | 270 |
| 753 | 3300025938 | Ga0207704_10138656 | Ga0207704_101386562 | 270 |
| 754 | 3300025940 | Ga0207691_10000228 | Ga0207691_100002282 | 270 |
| 755 | 3300025940 | Ga0207691_10005384 | Ga0207691_100053848 | 270 |
| 756 | 3300025940 | Ga0207691_10121506 | Ga0207691_101215061 | 270 |
| 757 | 3300025940 | Ga0207691_10138922 | Ga0207691_101389222 | 270 |
| 758 | 3300025942 | Ga0207689_10001966 | Ga0207689_100019663 | 270 |
| 759 | 3300025942 | Ga0207689_10003756 | Ga0207689_100037568 | 270 |
| 760 | 3300025942 | Ga0207689_10008218 | Ga0207689_100082187 | 270 |
| 761 | 3300025942 | Ga0207689_10010467 | Ga0207689_100104672 | 270 |
| 762 | 3300025942 | Ga0207689_10018417 | Ga0207689_100184176 | 270 |
| 763 | 3300025942 | Ga0207689_10026108 | Ga0207689_100261084 | 270 |
| 764 | 3300025942 | Ga0207689_10032751 | Ga0207689_100327513 | 270 |
| 765 | 3300025942 | Ga0207689_10155145 | Ga0207689_101551451 | 270 |
| 766 | 3300025942 | Ga0207689_10570749 | Ga0207689_105707491 | 270 |
| 767 | 3300025944 | Ga0207661_10046137 | Ga0207661_100461373 | 270 |
| 768 | 3300025944 | Ga0207661_10151429 | Ga0207661_101514291 | 270 |
| 769 | 3300025944 | Ga0207661_10176161 | Ga0207661_101761612 | 270 |
| 770 | 3300025945 | Ga0207679_10001677 | Ga0207679_100016776 | 270 |
| 771 | 3300025945 | Ga0207679_10011282 | Ga0207679_100112824 | 270 |
| 772 | 3300025945 | Ga0207679_10385025 | Ga0207679_103850252 | 270 |
| 773 | 3300025945 | Ga0207679_10543041 | Ga0207679_105430412 | 270 |
| 774 | 3300025949 | Ga0207667_10004780 | Ga0207667_100047806 | 270 |
| 775 | 3300025949 | Ga0207667_10005051 | Ga0207667_1000505112 | 270 |
| 776 | 3300025949 | Ga0207667_10024155 | Ga0207667_100241552 | 270 |
| 777 | 3300025949 | Ga0207667_10035134 | Ga0207667_100351345 | 270 |
| 778 | 3300025949 | Ga0207667_10035973 | Ga0207667_100359733 | 270 |
| 779 | 3300025949 | Ga0207667_10762084 | Ga0207667_107620841 | 270 |
| 780 | 3300025960 | Ga0207651_10000190 | Ga0207651_1000019018 | 270 |
| 781 | 3300025960 | Ga0207651_10154886 | Ga0207651_101548861 | 270 |
| 782 | 3300025960 | Ga0207651_10203249 | Ga0207651_102032492 | 270 |
| 783 | 3300025960 | Ga0207651_10250917 | Ga0207651_102509172 | 270 |
| 784 | 3300025961 | Ga0207712_10014998 | Ga0207712_100149985 | 270 |
| 785 | 3300025961 | Ga0207712_10032303 | Ga0207712_100323032 | 270 |
| 786 | 3300025961 | Ga0207712_10062100 | Ga0207712_100621002 | 270 |
| 787 | 3300025961 | Ga0207712_10132946 | Ga0207712_101329462 | 270 |
| 788 | 3300025961 | Ga0207712_10225630 | Ga0207712_102256301 | 270 |
| 789 | 3300025961 | Ga0207712_10266743 | Ga0207712_102667432 | 270 |
| 790 | 3300025961 | Ga0207712_10365795 | Ga0207712_103657952 | 270 |
| 791 | 3300025961 | Ga0207712_10412282 | Ga0207712_104122822 | 270 |
| 792 | 3300025972 | Ga0207668_10012446 | Ga0207668_100124463 | 270 |
| 793 | 3300025972 | Ga0207668_10421421 | Ga0207668_104214212 | 270 |
| 794 | 3300025981 | Ga0207640_10021295 | Ga0207640_100212954 | 270 |
| 795 | 3300025981 | Ga0207640_10126770 | Ga0207640_101267702 | 270 |
| 796 | 3300025981 | Ga0207640_10580324 | Ga0207640_105803241 | 270 |
| 797 | 3300025986 | Ga0207658_10000176 | Ga0207658_100001766 | 270 |
| 798 | 3300025986 | Ga0207658_10031222 | Ga0207658_100312224 | 270 |
| 799 | 3300025986 | Ga0207658_10033227 | Ga0207658_100332273 | 270 |
| 800 | 3300025986 | Ga0207658_10155566 | Ga0207658_101555662 | 270 |
| 801 | 3300025986 | Ga0207658_10296265 | Ga0207658_102962651 | 270 |
| 802 | 3300026023 | Ga0207677_10005124 | Ga0207677_100051246 | 270 |
| 803 | 3300026023 | Ga0207677_10107854 | Ga0207677_101078542 | 270 |
| 804 | 3300026023 | Ga0207677_10282990 | Ga0207677_102829902 | 270 |
| 805 | 3300026023 | Ga0207677_10292051 | Ga0207677_102920512 | 270 |
| 806 | 3300026023 | Ga0207677_10324851 | Ga0207677_103248511 | 270 |
| 807 | 3300026035 | Ga0207703_10000433 | Ga0207703_100004339 | 270 |
| 808 | 3300026035 | Ga0207703_10036338 | Ga0207703_100363382 | 270 |
| 809 | 3300026035 | Ga0207703_10187141 | Ga0207703_101871412 | 270 |
| 810 | 3300026041 | Ga0207639_10028406 | Ga0207639_100284064 | 270 |
| 811 | 3300026041 | Ga0207639_10029884 | Ga0207639_100298842 | 270 |
| 812 | 3300026041 | Ga0207639_10035919 | Ga0207639_100359192 | 270 |
| 813 | 3300026041 | Ga0207639_10104095 | Ga0207639_101040952 | 270 |
| 814 | 3300026041 | Ga0207639_10111906 | Ga0207639_101119063 | 270 |
| 815 | 3300026041 | Ga0207639_10118486 | Ga0207639_101184862 | 270 |
| 816 | 3300026041 | Ga0207639_10143323 | Ga0207639_101433232 | 270 |
| 817 | 3300026041 | Ga0207639_10224074 | Ga0207639_102240742 | 270 |
| 818 | 3300026041 | Ga0207639_10316101 | Ga0207639_103161011 | 270 |
| 819 | 3300026067 | Ga0207678_10088678 | Ga0207678_100886783 | 270 |
| 820 | 3300026078 | Ga0207702_10041909 | Ga0207702_100419093 | 270 |
| 821 | 3300026078 | Ga0207702_10062526 | Ga0207702_100625263 | 270 |
| 822 | 3300026078 | Ga0207702_10139589 | Ga0207702_101395891 | 270 |
| 823 | 3300026088 | Ga0207641_10000048 | Ga0207641_10000048133 | 270 |
| 824 | 3300026088 | Ga0207641_10000601 | Ga0207641_100006017 | 270 |
| 825 | 3300026088 | Ga0207641_10002006 | Ga0207641_1000200611 | 270 |
| 826 | 3300026088 | Ga0207641_10037593 | Ga0207641_100375935 | 270 |
| 827 | 3300026088 | Ga0207641_10142918 | Ga0207641_101429183 | 270 |
| 828 | 3300026088 | Ga0207641_10220204 | Ga0207641_102202042 | 270 |
| 829 | 3300026088 | Ga0207641_10289879 | Ga0207641_102898792 | 270 |
| 830 | 3300026088 | Ga0207641_10805310 | Ga0207641_108053101 | 270 |
| 831 | 3300026089 | Ga0207648_10006817 | Ga0207648_100068175 | 270 |
| 832 | 3300026089 | Ga0207648_10020665 | Ga0207648_100206656 | 270 |
| 833 | 3300026089 | Ga0207648_10067423 | Ga0207648_100674234 | 270 |
| 834 | 3300026089 | Ga0207648_10273293 | Ga0207648_102732932 | 270 |
| 835 | 3300026095 | Ga0207676_10001236 | Ga0207676_100012366 | 270 |
| 836 | 3300026095 | Ga0207676_10044893 | Ga0207676_100448933 | 270 |
| 837 | 3300026095 | Ga0207676_10093368 | Ga0207676_100933683 | 270 |
| 838 | 3300026095 | Ga0207676_10196680 | Ga0207676_101966802 | 270 |
| 839 | 3300026095 | Ga0207676_10225999 | Ga0207676_102259992 | 270 |
| 840 | 3300026095 | Ga0207676_10680237 | Ga0207676_106802371 | 270 |
| 841 | 3300026116 | Ga0207674_10007789 | Ga0207674_1000778910 | 270 |
| 842 | 3300026116 | Ga0207674_10015679 | Ga0207674_100156794 | 270 |
| 843 | 3300026116 | Ga0207674_10106874 | Ga0207674_101068742 | 270 |
| 844 | 3300026116 | Ga0207674_10111062 | Ga0207674_101110622 | 270 |
| 845 | 3300026118 | Ga0207675_100007107 | Ga0207675_1000071079 | 270 |
| 846 | 3300026118 | Ga0207675_100038046 | Ga0207675_1000380464 | 270 |
| 847 | 3300026118 | Ga0207675_100130205 | Ga0207675_1001302053 | 270 |
| 848 | 3300026121 | Ga0207683_10008436 | Ga0207683_100084365 | 270 |
| 849 | 3300026121 | Ga0207683_10013033 | Ga0207683_100130335 | 270 |
| 850 | 3300026121 | Ga0207683_10152583 | Ga0207683_101525832 | 270 |
| 851 | 3300026142 | Ga0207698_10021707 | Ga0207698_100217073 | 270 |
| 852 | 3300026142 | Ga0207698_10026986 | Ga0207698_100269862 | 270 |
| 853 | 3300026142 | Ga0207698_10049049 | Ga0207698_100490492 | 270 |
| 854 | 3300026142 | Ga0207698_10132979 | Ga0207698_101329792 | 270 |
| 855 | 3300026142 | Ga0207698_10257712 | Ga0207698_102577122 | 270 |
| 856 | 3300026142 | Ga0207698_10323409 | Ga0207698_103234092 | 270 |
| 857 | 3300026142 | Ga0207698_10372766 | Ga0207698_103727662 | 270 |
| 858 | 3300026142 | Ga0207698_10454248 | Ga0207698_104542481 | 270 |
| 859 | 3300026142 | Ga0207698_10456237 | Ga0207698_104562371 | 270 |
| 860 | 3300027462 | Ga0210000_1022266 | Ga0210000_10222661 | 270 |
| 861 | 3300027471 | Ga0209995_1005032 | Ga0209995_10050322 | 270 |
| 862 | 3300028379 | Ga0268266_10000024 | Ga0268266_10000024180 | 270 |
| 863 | 3300028379 | Ga0268266_10007977 | Ga0268266_100079774 | 270 |
| 864 | 3300028380 | Ga0268265_10087313 | Ga0268265_100873131 | 270 |
| 865 | 3300028380 | Ga0268265_10226556 | Ga0268265_102265562 | 270 |
| 866 | 3300028381 | Ga0268264_10000109 | Ga0268264_10000109145 | 270 |
| 867 | 3300028381 | Ga0268264_10001271 | Ga0268264_100012716 | 270 |
| 868 | 3300028381 | Ga0268264_10001954 | Ga0268264_1000195411 | 270 |
| 869 | 3300028381 | Ga0268264_10004274 | Ga0268264_100042743 | 270 |
| 870 | 3300028653 | Ga0265323_10000975 | Ga0265323_1000097514 | 270 |
| 871 | 3300028786 | Ga0307517_10006013 | Ga0307517_100060136 | 270 |
| 872 | 3300028786 | Ga0307517_10088779 | Ga0307517_100887792 | 270 |
| 873 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002322 | 270 |
| 874 | 3300028794 | Ga0307515_10000072 | Ga0307515_1000007242 | 270 |
| 875 | 3300028794 | Ga0307515_10249372 | Ga0307515_102493722 | 270 |
| 876 | 3300030521 | Ga0307511_10004747 | Ga0307511_100047475 | 270 |
| 877 | 3300031251 | Ga0265327_10000093 | Ga0265327_1000009347 | 270 |
| 878 | 3300031251 | Ga0265327_10000148 | Ga0265327_10000148116 | 270 |
| 879 | 3300031251 | Ga0265327_10105839 | Ga0265327_101058392 | 270 |
| 880 | 3300031344 | Ga0265316_10000618 | Ga0265316_1000061814 | 270 |
| 881 | 3300031344 | Ga0265316_10001145 | Ga0265316_1000114511 | 270 |
| 882 | 3300031507 | Ga0307509_10025075 | Ga0307509_100250753 | 270 |
| 883 | 3300031548 | Ga0307408_100000305 | Ga0307408_10000030530 | 270 |
| 884 | 3300031616 | Ga0307508_10001286 | Ga0307508_1000128616 | 270 |
| 885 | 3300031727 | Ga0316576_10099200 | Ga0316576_100992002 | 270 |
| 886 | 3300031727 | Ga0316576_10146162 | Ga0316576_101461623 | 270 |
| 887 | 3300031731 | Ga0307405_10000010 | Ga0307405_1000001046 | 270 |
| 888 | 3300031733 | Ga0316577_10099416 | Ga0316577_100994162 | 270 |
| 889 | 3300031852 | Ga0307410_10140025 | Ga0307410_101400252 | 270 |
| 890 | 3300031903 | Ga0307407_10000042 | Ga0307407_1000004242 | 270 |
| 891 | 3300031911 | Ga0307412_10003261 | Ga0307412_100032612 | 270 |
| 892 | 3300032002 | Ga0307416_100000019 | Ga0307416_10000001913 | 270 |
| 893 | 3300032004 | Ga0307414_10002825 | Ga0307414_100028253 | 270 |
| 894 | 3300035171 | Ga0373946_0212995 | Ga0373946_0212995_95_916 | 270 |
| 895 | 3300035172 | Ga0373955_0039844 | Ga0373955_0039844_987_1814 | 270 |
| 896 | 3300035398 | Ga0316574_0132073 | Ga0316574_0132073_533_1354 | 270 |
| 897 | 3300035410 | Ga0373924_0007228 | Ga0373924_0007228_1915_2742 | 270 |
| 898 | 3300035724 | Ga0373933_0062270 | Ga0373933_0062270_987_1814 | 270 |
| 899 | 3300035725 | Ga0373947_0021674 | Ga0373947_0021674_2453_3274 | 270 |
| 900 | 3300035725 | Ga0373947_0058903 | Ga0373947_0058903_411_1232 | 270 |
| 901 | 3300036401 | Ga0373937_0005153 | Ga0373937_0005153_1247_2074 | 270 |
| 902 | 3300036401 | Ga0373937_0168582 | Ga0373937_0168582_894_1715 | 270 |
| 903 | 3300037312 | Ga0395899_0003607 | Ga0395899_0003607_7644_8465 | 270 |
| 904 | 3300037312 | Ga0395899_0180455 | Ga0395899_0180455_188_1009 | 270 |
| 905 | 3300037418 | Ga0395900_0016503 | Ga0395900_0016503_1388_2209 | 270 |
| 906 | 3300037418 | Ga0395900_0109393 | Ga0395900_0109393_284_1162 | 270 |
| 907 | 3300037418 | Ga0395900_0321332 | Ga0395900_0321332_37_864 | 270 |
| 908 | 3300037418 | Ga0395900_0337680 | Ga0395900_0337680_421_1245 | 270 |
| 909 | 3300037418 | Ga0395900_0814931 | Ga0395900_0814931_18_842 | 270 |
| 910 | 3300037466 | Ga0395898_0001425 | Ga0395898_0001425_32895_33716 | 270 |
| 911 | 3300037466 | Ga0395898_0071097 | Ga0395898_0071097_585_1463 | 270 |
| 912 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_329427_330242 | 270 |
| 913 | 3300037471 | Ga0395905_0073040 | Ga0395905_0073040_2036_2863 | 270 |
| 914 | 3300037471 | Ga0395905_0092206 | Ga0395905_0092206_807_1631 | 270 |
| 915 | 3300038443 | Ga0395901_0006414 | Ga0395901_0006414_5448_6269 | 270 |
| 916 | 3300038443 | Ga0395901_0329352 | Ga0395901_0329352_301_1179 | 270 |
| 917 | 3300039093 | Ga0400489_27519 | Ga0400489_27519_2016_2840 | 270 |
| 918 | 3300039437 | Ga0436365_0480954 | Ga0436365_0480954_4590_5423 | 270 |
| 919 | 3300041404 | Ga0439436_0013332 | Ga0439436_0013332_683_1504 | 270 |
| 920 | 3300041413 | Ga0439465_0063206 | Ga0439465_0063206_278_1099 | 270 |
| 921 | 3300041509 | Ga0451843_1146337 | Ga0451843_1146337_73_894 | 270 |
| 922 | 3300041997 | Ga0439431_0035757 | Ga0439431_0035757_222_1061 | 270 |
| 923 | 3300042007 | Ga0439449_0118971 | Ga0439449_0118971_128_949 | 270 |
| 924 | 3300042014 | Ga0439457_001586 | Ga0439457_001586_2060_2881 | 270 |
| 925 | 3300042015 | Ga0439462_0023582 | Ga0439462_0023582_510_1331 | 270 |
| 926 | 3300042876 | Ga0451577_0038696 | Ga0451577_0038696_2206_3036 | 270 |
| 927 | 3300042876 | Ga0451577_0053904 | Ga0451577_0053904_270_1082 | 270 |
| 928 | 3300042876 | Ga0451577_0252122 | Ga0451577_0252122_454_1275 | 270 |
| 929 | 3300042876 | Ga0451577_0400323 | Ga0451577_0400323_48_878 | 270 |
| 930 | 3300042876 | Ga0451577_0604840 | Ga0451577_0604840_162_983 | 270 |
| 931 | 3300044656 | Ga0466969_0000665 | Ga0466969_0000665_13632_14456 | 270 |
| 932 | 3300044658 | Ga0466972_0000013 | Ga0466972_0000013_61983_62804 | 270 |
| 933 | 3300044658 | Ga0466972_0000064 | Ga0466972_0000064_89713_90537 | 270 |
| 934 | 3300044658 | Ga0466972_0000347 | Ga0466972_0000347_17174_17998 | 270 |
| 935 | 3300044658 | Ga0466972_0032268 | Ga0466972_0032268_891_1805 | 270 |
| 936 | 3300044684 | Ga0466966_0000806 | Ga0466966_0000806_6659_7483 | 270 |
| 937 | 3300044712 | Ga0453684_0000724 | Ga0453684_0000724_93120_93950 | 270 |
| 938 | 3300044712 | Ga0453684_0004378 | Ga0453684_0004378_2724_3554 | 270 |
| 939 | 3300044712 | Ga0453684_0004818 | Ga0453684_0004818_12349_13170 | 270 |
| 940 | 3300044712 | Ga0453684_0019698 | Ga0453684_0019698_7668_8489 | 270 |
| 941 | 3300044712 | Ga0453684_0024450 | Ga0453684_0024450_1891_2721 | 270 |
| 942 | 3300044712 | Ga0453684_0041364 | Ga0453684_0041364_3395_4228 | 270 |
| 943 | 3300044712 | Ga0453684_0047360 | Ga0453684_0047360_1967_2788 | 270 |
| 944 | 3300044712 | Ga0453684_0071263 | Ga0453684_0071263_902_1726 | 270 |
| 945 | 3300044712 | Ga0453684_0096856 | Ga0453684_0096856_85_906 | 270 |
| 946 | 3300044712 | Ga0453684_0143346 | Ga0453684_0143346_1732_2562 | 270 |
| 947 | 3300044712 | Ga0453684_0179836 | Ga0453684_0179836_1349_2173 | 270 |
| 948 | 3300044712 | Ga0453684_0189010 | Ga0453684_0189010_949_1767 | 270 |
| 949 | 3300044712 | Ga0453684_0275112 | Ga0453684_0275112_724_1539 | 270 |
| 950 | 3300044712 | Ga0453684_0315998 | Ga0453684_0315998_494_1312 | 270 |
| 951 | 3300044712 | Ga0453684_0469802 | Ga0453684_0469802_530_1354 | 270 |
| 952 | 3300044712 | Ga0453684_0707475 | Ga0453684_0707475_40_867 | 270 |
| 953 | 3300044712 | Ga0453684_0858102 | Ga0453684_0858102_92_922 | 270 |
| 954 | 3300044735 | Ga0466968_0010784 | Ga0466968_0010784_687_1511 | 270 |
| 955 | 3300044765 | Ga0466970_0000094 | Ga0466970_0000094_7190_8014 | 270 |
| 956 | 3300044765 | Ga0466970_0028240 | Ga0466970_0028240_1279_2103 | 270 |
| 957 | 3300044842 | Ga0466957_0000070 | Ga0466957_0000070_11288_12100 | 270 |
| 958 | 3300044842 | Ga0466957_0009587 | Ga0466957_0009587_1280_2101 | 270 |
| 959 | 3300045049 | Ga0466959_0000023 | Ga0466959_0000023_105219_106043 | 270 |
| 960 | 3300045051 | Ga0451576_0005479 | Ga0451576_0005479_4632_5450 | 270 |
| 961 | 3300045051 | Ga0451576_0042016 | Ga0451576_0042016_1501_2316 | 270 |
| 962 | 3300045051 | Ga0451576_0797954 | Ga0451576_0797954_137_967 | 270 |
| 963 | 3300045976 | Ga0466967_0059978 | Ga0466967_0059978_1944_2768 | 270 |
| 964 | 3300046453 | Ga0495627_089317 | Ga0495627_089317_54_866 | 270 |
| 965 | 3300046460 | Ga0495638_0116054 | Ga0495638_0116054_279_1103 | 270 |
| 966 | 3300046463 | Ga0495653_0112063 | Ga0495653_0112063_987_1814 | 270 |
| 967 | 3300046471 | Ga0495650_0067874 | Ga0495650_0067874_170_1003 | 270 |
| 968 | 3300046472 | Ga0495580_0143758 | Ga0495580_0143758_189_1010 | 270 |
| 969 | 3300046472 | Ga0495580_0253227 | Ga0495580_0253227_204_1025 | 270 |
| 970 | 3300046473 | Ga0495582_0087882 | Ga0495582_0087882_54_875 | 270 |
| 971 | 3300046476 | Ga0495662_0142510 | Ga0495662_0142510_182_997 | 270 |
| 972 | 3300046507 | Ga0495606_0005411 | Ga0495606_0005411_2924_3748 | 270 |
| 973 | 3300046512 | Ga0495610_0001760 | Ga0495610_0001760_2319_3131 | 270 |
| 974 | 3300046512 | Ga0495610_0003107 | Ga0495610_0003107_2370_3182 | 270 |
| 975 | 3300046514 | Ga0495618_0012660 | Ga0495618_0012660_3966_4793 | 270 |
| 976 | 3300046517 | Ga0495630_0021010 | Ga0495630_0021010_1986_2813 | 270 |
| 977 | 3300046524 | Ga0495648_0006590 | Ga0495648_0006590_465_1289 | 270 |
| 978 | 3300046535 | Ga0495586_0048106 | Ga0495586_0048106_1344_2171 | 270 |
| 979 | 3300046535 | Ga0495586_0123057 | Ga0495586_0123057_84_905 | 270 |
| 980 | 3300046536 | Ga0495587_0118595 | Ga0495587_0118595_394_1221 | 270 |
| 981 | 3300046559 | Ga0495667_0068369 | Ga0495667_0068369_1099_1926 | 270 |
| 982 | 3300046616 | Ga0495668_0000191 | Ga0495668_0000191_8867_9688 | 270 |
| 983 | 3300046616 | Ga0495668_0002342 | Ga0495668_0002342_8496_9317 | 270 |
| 984 | 3300046642 | Ga0495634_0052705 | Ga0495634_0052705_898_1719 | 270 |
| 985 | 3300046642 | Ga0495634_0304744 | Ga0495634_0304744_19_834 | 270 |
| 986 | 3300046648 | Ga0495611_0000252 | Ga0495611_0000252_9341_10165 | 270 |
| 987 | 3300046648 | Ga0495611_0025805 | Ga0495611_0025805_1293_2117 | 270 |
| 988 | 3300046683 | Ga0495658_0036056 | Ga0495658_0036056_1393_2214 | 270 |
| 989 | 3300046691 | Ga0495670_0078629 | Ga0495670_0078629_667_1488 | 270 |
| 990 | 3300046809 | Ga0495600_0094655 | Ga0495600_0094655_30_851 | 270 |
| 991 | 3300047318 | Ga0495636_0000049 | Ga0495636_0000049_3376_4203 | 270 |
| 992 | 3300047319 | Ga0495674_0012090 | Ga0495674_0012090_3995_4816 | 270 |
| 993 | 3300047320 | Ga0495672_0031702 | Ga0495672_0031702_1767_2591 | 270 |
| 994 | 3300047320 | Ga0495672_0047219 | Ga0495672_0047219_1165_1989 | 270 |
| 995 | 3300047320 | Ga0495672_0120137 | Ga0495672_0120137_149_979 | 270 |
| 996 | 3300047321 | Ga0495676_0081222 | Ga0495676_0081222_29_850 | 270 |
| 997 | 3300047321 | Ga0495676_0315195 | Ga0495676_0315195_48_875 | 270 |
| 998 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_171447_172271 | 270 |
| 999 | 3300047472 | Ga0495686_0000034 | Ga0495686_0000034_196847_197671 | 270 |
| 1000 | 3300047472 | Ga0495686_0031850 | Ga0495686_0031850_330_1151 | 270 |
| 1001 | 3300047472 | Ga0495686_0126490 | Ga0495686_0126490_560_1384 | 270 |
| 1002 | 3300047472 | Ga0495686_0148618 | Ga0495686_0148618_459_1283 | 270 |
| 1003 | 3300048908 | Ga0496105_0353723 | Ga0496105_0353723_80_979 | 270 |
| 1004 | 3300048909 | Ga0496106_0343792 | Ga0496106_0343792_153_974 | 270 |
| 1005 | 3300048911 | Ga0496108_0286981 | Ga0496108_0286981_175_996 | 270 |
| 1006 | 3300048912 | Ga0496109_0159922 | Ga0496109_0159922_195_1016 | 270 |
| 1007 | 3300048912 | Ga0496109_0494019 | Ga0496109_0494019_225_1046 | 270 |
| 1008 | 3300048913 | Ga0496110_0543207 | Ga0496110_0543207_201_1022 | 270 |
| 1009 | 3300048918 | Ga0496115_0025603 | Ga0496115_0025603_2562_3425 | 270 |
| 1010 | 3300048918 | Ga0496115_0369102 | Ga0496115_0369102_109_936 | 270 |
| 1011 | 3300048927 | Ga0496124_0028833 | Ga0496124_0028833_850_1674 | 270 |
| 1012 | 3300049568 | Ga0501031_0008920 | Ga0501031_0008920_1610_2431 | 270 |
| 1013 | 3300049569 | Ga0501032_0006744 | Ga0501032_0006744_7493_8314 | 270 |
| 1014 | 3300049569 | Ga0501032_0056211 | Ga0501032_0056211_1072_1893 | 270 |
| 1015 | 3300049570 | Ga0501033_0035991 | Ga0501033_0035991_742_1563 | 270 |
| 1016 | 3300049570 | Ga0501033_0062187 | Ga0501033_0062187_77_898 | 270 |
| 1017 | 3300049571 | Ga0501034_0000399 | Ga0501034_0000399_37084_37905 | 270 |
| 1018 | 3300049571 | Ga0501034_0007132 | Ga0501034_0007132_8172_8993 | 270 |
| 1019 | 3300049571 | Ga0501034_0027512 | Ga0501034_0027512_657_1481 | 270 |
| 1020 | 3300049571 | Ga0501034_0034359 | Ga0501034_0034359_3756_4577 | 270 |
| 1021 | 3300049571 | Ga0501034_0114355 | Ga0501034_0114355_1210_2037 | 270 |
| 1022 | 3300049571 | Ga0501034_0155149 | Ga0501034_0155149_290_1123 | 270 |
| 1023 | 3300049571 | Ga0501034_0315125 | Ga0501034_0315125_359_1183 | 270 |
| 1024 | 3300049571 | Ga0501034_0316000 | Ga0501034_0316000_136_963 | 270 |
| 1025 | 3300049572 | Ga0501036_0021107 | Ga0501036_0021107_2009_2830 | 270 |
| 1026 | 3300049572 | Ga0501036_0031265 | Ga0501036_0031265_3513_4337 | 270 |
| 1027 | 3300049572 | Ga0501036_0031936 | Ga0501036_0031936_1222_2043 | 270 |
| 1028 | 3300049573 | Ga0501037_0004614 | Ga0501037_0004614_6662_7483 | 270 |
| 1029 | 3300049573 | Ga0501037_0037569 | Ga0501037_0037569_1078_1899 | 270 |
| 1030 | 3300049574 | Ga0501038_0008621 | Ga0501038_0008621_6154_6975 | 270 |
| 1031 | 3300049574 | Ga0501038_0009237 | Ga0501038_0009237_2923_3744 | 270 |
| 1032 | 3300049574 | Ga0501038_0014450 | Ga0501038_0014450_2477_3301 | 270 |
| 1033 | 3300049575 | Ga0501039_0082895 | Ga0501039_0082895_831_1655 | 270 |
| 1034 | 3300049575 | Ga0501039_0083623 | Ga0501039_0083623_860_1681 | 270 |
| 1035 | 3300049579 | Ga0501043_0006099 | Ga0501043_0006099_4519_5340 | 270 |
| 1036 | 3300049579 | Ga0501043_0011618 | Ga0501043_0011618_3654_4478 | 270 |
| 1037 | 3300049579 | Ga0501043_0033806 | Ga0501043_0033806_1409_2230 | 270 |
| 1038 | 3300049579 | Ga0501043_0076043 | Ga0501043_0076043_388_1209 | 270 |
| 1039 | 3300049579 | Ga0501043_0362232 | Ga0501043_0362232_245_1072 | 270 |
| 1040 | 3300049580 | Ga0501046_0007340 | Ga0501046_0007340_5646_6470 | 270 |
| 1041 | 3300049581 | Ga0501047_0021899 | Ga0501047_0021899_4283_5107 | 270 |
| 1042 | 3300049581 | Ga0501047_0040807 | Ga0501047_0040807_1079_1900 | 270 |
| 1043 | 3300049581 | Ga0501047_0054822 | Ga0501047_0054822_2216_3037 | 270 |
| 1044 | 3300049582 | Ga0501048_0116127 | Ga0501048_0116127_970_1791 | 270 |
| 1045 | 3300049583 | Ga0501067_0009624 | Ga0501067_0009624_2691_3515 | 270 |
| 1046 | 3300049583 | Ga0501067_0039532 | Ga0501067_0039532_721_1548 | 270 |
| 1047 | 3300049584 | Ga0501068_0162628 | Ga0501068_0162628_346_1167 | 270 |
| 1048 | 3300049586 | Ga0501070_0083168 | Ga0501070_0083168_91_915 | 270 |
| 1049 | 3300049587 | Ga0501071_0202825 | Ga0501071_0202825_571_1398 | 270 |
| 1050 | 3300049589 | Ga0501073_0001901 | Ga0501073_0001901_5548_6372 | 270 |
| 1051 | 3300049589 | Ga0501073_0081407 | Ga0501073_0081407_1242_2069 | 270 |
| 1052 | 3300049590 | Ga0501074_0001080 | Ga0501074_0001080_12749_13573 | 270 |
| 1053 | 3300049652 | Ga0501202_000051 | Ga0501202_000051_7327_8154 | 270 |
| 1054 | 3300049652 | Ga0501202_005033 | Ga0501202_005033_249_1070 | 270 |
| 1055 | 3300049660 | Ga0501216_020232 | Ga0501216_020232_189_1016 | 270 |
| 1056 | 3300049661 | Ga0501217_022286 | Ga0501217_022286_654_1481 | 270 |
| 1057 | 3300049663 | Ga0501223_003413 | Ga0501223_003413_439_1251 | 270 |
| 1058 | 3300049663 | Ga0501223_004449 | Ga0501223_004449_1132_1959 | 270 |
| 1059 | 3300049686 | Ga0501257_001076 | Ga0501257_001076_2510_3331 | 270 |
| 1060 | 3300049688 | Ga0501259_000915 | Ga0501259_000915_558_1379 | 270 |
| 1061 | 3300049703 | Ga0501219_000752 | Ga0501219_000752_2011_2832 | 270 |
| 1062 | 3300049705 | Ga0501225_0011343 | Ga0501225_0011343_1624_2445 | 270 |
| 1063 | 3300049708 | Ga0501245_002468 | Ga0501245_002468_1072_1893 | 270 |
| 1064 | 3300049741 | Ga0501079_0200118 | Ga0501079_0200118_166_990 | 270 |
| 1065 | 3300049742 | Ga0501080_0033602 | Ga0501080_0033602_354_1178 | 270 |
| 1066 | 3300049742 | Ga0501080_0133390 | Ga0501080_0133390_1039_1866 | 270 |
| 1067 | 3300049744 | Ga0501083_0008410 | Ga0501083_0008410_5543_6367 | 270 |
| 1068 | 3300049744 | Ga0501083_0014634 | Ga0501083_0014634_2093_2920 | 270 |
| 1069 | 3300049763 | Ga0501266_004672 | Ga0501266_004672_113_934 | 270 |
| 1070 | 3300049822 | Ga0501035_0015725 | Ga0501035_0015725_5800_6621 | 270 |
| 1071 | 3300049822 | Ga0501035_0017194 | Ga0501035_0017194_3562_4383 | 270 |
| 1072 | 3300049822 | Ga0501035_0023744 | Ga0501035_0023744_1194_2018 | 270 |
| 1073 | 3300049822 | Ga0501035_0360903 | Ga0501035_0360903_169_990 | 270 |
| 1074 | 3300049822 | Ga0501035_0540226 | Ga0501035_0540226_20_853 | 270 |
| 1075 | 3300049823 | Ga0501044_0003839 | Ga0501044_0003839_9572_10393 | 270 |
| 1076 | 3300049823 | Ga0501044_0009313 | Ga0501044_0009313_450_1274 | 270 |
| 1077 | 3300049823 | Ga0501044_0018183 | Ga0501044_0018183_3496_4317 | 270 |
| 1078 | 3300049823 | Ga0501044_0067496 | Ga0501044_0067496_572_1393 | 270 |
| 1079 | 3300049823 | Ga0501044_0389642 | Ga0501044_0389642_179_1006 | 270 |
| 1080 | 3300049823 | Ga0501044_0403448 | Ga0501044_0403448_37_858 | 270 |
| 1081 | 3300050005 | Ga0501284_00019 | Ga0501284_00019_20732_21553 | 270 |
| 1082 | 3300050493 | nmdc:mga0k408_7375_c1 | nmdc:mga0k408_7375_c1_2929_3750 | 270 |
| 1083 | 3300050507 | nmdc:mga05p37_288459_c1 | nmdc:mga05p37_288459_c1_653_1474 | 270 |
| 1084 | 3300050507 | nmdc:mga05p37_3288_c1 | nmdc:mga05p37_3288_c1_17894_18715 | 270 |
| 1085 | 3300050508 | nmdc:mga09592_108348_c1 | nmdc:mga09592_108348_c1_542_1363 | 270 |
| 1086 | 3300050511 | nmdc:mga08y16_160301_c1 | nmdc:mga08y16_160301_c1_1401_2222 | 270 |
| 1087 | 3300050511 | nmdc:mga08y16_22514_c1 | nmdc:mga08y16_22514_c1_875_1696 | 270 |
| 1088 | 3300050511 | nmdc:mga08y16_511295_c1 | nmdc:mga08y16_511295_c1_374_1195 | 270 |
| 1089 | 3300050511 | nmdc:mga08y16_783501_c1 | nmdc:mga08y16_783501_c1_93_914 | 270 |
| 1090 | 3300053077 | Ga0495601_0179435 | Ga0495601_0179435_472_1293 | 270 |
| 1091 | 3300053086 | Ga0500578_0000150 | Ga0500578_0000150_6258_7079 | 270 |
| 1092 | 3300053090 | Ga0500646_0000820 | Ga0500646_0000820_4884_5765 | 270 |
| 1093 | 3300053092 | Ga0500583_0000108 | Ga0500583_0000108_35806_36627 | 270 |
| 1094 | 3300053092 | Ga0500583_0004734 | Ga0500583_0004734_3029_3850 | 270 |
| 1095 | 3300053118 | Ga0500594_0008751 | Ga0500594_0008751_1466_2287 | 270 |
| 1096 | 3300053118 | Ga0500594_0041262 | Ga0500594_0041262_89_910 | 270 |
| 1097 | 3300053130 | Ga0500642_0034331 | Ga0500642_0034331_1011_1835 | 270 |
| 1098 | 3300053139 | Ga0500568_0000789 | Ga0500568_0000789_16369_17190 | 270 |
| 1099 | 3300053150 | Ga0500603_068004 | Ga0500603_068004_11_832 | 270 |
| 1100 | 3300053151 | Ga0500604_0000484 | Ga0500604_0000484_2205_3026 | 270 |
| 1101 | 3300053153 | Ga0500616_0075315 | Ga0500616_0075315_600_1421 | 270 |
| 1102 | 3300053153 | Ga0500616_0104336 | Ga0500616_0104336_382_1206 | 270 |
| 1103 | 3300053156 | Ga0500622_0000304 | Ga0500622_0000304_23946_24770 | 270 |
| 1104 | 3300053156 | Ga0500622_0007889 | Ga0500622_0007889_90_911 | 270 |
| 1105 | 3300053156 | Ga0500622_0008720 | Ga0500622_0008720_2107_2931 | 270 |
| 1106 | 3300053156 | Ga0500622_0023113 | Ga0500622_0023113_898_1719 | 270 |
| 1107 | 3300053178 | Ga0500637_0157527 | Ga0500637_0157527_403_1227 | 270 |
| 1108 | 3300053730 | Ga0500645_004553 | Ga0500645_004553_772_1713 | 270 |
| 1109 | 3300054114 | Ga0501084_0069145 | Ga0501084_0069145_1794_2618 | 270 |
| 1110 | 3300054114 | Ga0501084_0307219 | Ga0501084_0307219_372_1199 | 270 |
| 1111 | 3300055283 | Ga0500661_005721 | Ga0500661_005721_1275_2099 | 270 |
| 1112 | 3300060353 | Ga0501082_0366013 | Ga0501082_0366013_343_1164 | 270 |
| 1113 | 3300061719 | Ga0466962_0136586 | Ga0466962_0136586_154_978 | 270 |
| 1114 | iso_pu_bacteria | 2818991444 | 2819588687 | 270 |
| 1115 | iso_pu_bacteria | 2914759650 | 2914760382 | 270 |
| 1116 | iso_pu_bacteria | 2929154850 | 2929157628 | 270 |
| 1117 | 2162886007 | SwRhRL2b_contig_2039605 | SwRhRL2b_0824.00004670 | 271 |
| 1118 | 2162886007 | SwRhRL2b_contig_2513460 | SwRhRL2b_0966.00006370 | 271 |
| 1119 | 3300005288 | Ga0065714_10003657 | Ga0065714_1000365723 | 271 |
| 1120 | 3300005288 | Ga0065714_10004961 | Ga0065714_100049614 | 271 |
| 1121 | 3300005288 | Ga0065714_10064664 | Ga0065714_100646642 | 271 |
| 1122 | 3300005288 | Ga0065714_10064897 | Ga0065714_1006489716 | 271 |
| 1123 | 3300005288 | Ga0065714_10118971 | Ga0065714_101189712 | 271 |
| 1124 | 3300005289 | Ga0065704_10000193 | Ga0065704_1000019350 | 271 |
| 1125 | 3300009545 | Ga0105237_10006737 | Ga0105237_100067376 | 271 |
| 1126 | 3300013100 | Ga0157373_10000136 | Ga0157373_100001362 | 271 |
| 1127 | 3300013102 | Ga0157371_10004753 | Ga0157371_1000475311 | 271 |
| 1128 | 3300013102 | Ga0157371_10007420 | Ga0157371_100074202 | 271 |
| 1129 | 3300013102 | Ga0157371_10011958 | Ga0157371_100119582 | 271 |
| 1130 | 3300013104 | Ga0157370_10011097 | Ga0157370_100110977 | 271 |
| 1131 | 3300013104 | Ga0157370_10029726 | Ga0157370_100297262 | 271 |
| 1132 | 3300013104 | Ga0157370_10084627 | Ga0157370_100846272 | 271 |
| 1133 | 3300013104 | Ga0157370_10144239 | Ga0157370_101442392 | 271 |
| 1134 | 3300013104 | Ga0157370_10190126 | Ga0157370_101901262 | 271 |
| 1135 | 3300013308 | Ga0157375_10531593 | Ga0157375_105315931 | 271 |
| 1136 | 3300014497 | Ga0182008_10000018 | Ga0182008_10000018151 | 271 |
| 1137 | 3300014497 | Ga0182008_10000378 | Ga0182008_1000037831 | 271 |
| 1138 | 3300014497 | Ga0182008_10033160 | Ga0182008_100331602 | 271 |
| 1139 | 3300015261 | Ga0182006_1000382 | Ga0182006_100038218 | 271 |
| 1140 | 3300015261 | Ga0182006_1007681 | Ga0182006_10076815 | 271 |
| 1141 | 3300015261 | Ga0182006_1044752 | Ga0182006_10447522 | 271 |
| 1142 | 3300017792 | Ga0163161_10000153 | Ga0163161_1000015357 | 271 |
| 1143 | 3300017792 | Ga0163161_10006269 | Ga0163161_100062696 | 271 |
| 1144 | 3300025914 | Ga0207671_10011928 | Ga0207671_100119283 | 271 |
| 1145 | 3300025935 | Ga0207709_10000006 | Ga0207709_10000006383 | 271 |
| 1146 | 3300030731 | Ga0316177_1057164 | Ga0316177_10571643 | 271 |
| 1147 | 3300030732 | Ga0316176_1020373 | Ga0316176_10203738 | 271 |
| 1148 | 3300030742 | Ga0316183_1111132 | Ga0316183_111113236 | 271 |
| 1149 | 3300030744 | Ga0316181_1134699 | Ga0316181_11346997 | 271 |
| 1150 | 3300030745 | Ga0316182_1300351 | Ga0316182_13003512 | 271 |
| 1151 | 3300031911 | Ga0307412_10000077 | Ga0307412_1000007739 | 271 |
| 1152 | 3300032004 | Ga0307414_10011145 | Ga0307414_100111454 | 271 |
| 1153 | 3300032004 | Ga0307414_10054109 | Ga0307414_100541092 | 271 |
| 1154 | 3300032004 | Ga0307414_10055748 | Ga0307414_100557482 | 271 |
| 1155 | 3300032004 | Ga0307414_10491851 | Ga0307414_104918511 | 271 |
| 1156 | 3300032004 | Ga0307414_10634722 | Ga0307414_106347222 | 271 |
| 1157 | 3300036712 | Ga0316584_0005044 | Ga0316584_0005044_7676_8521 | 271 |
| 1158 | 3300048919 | Ga0496116_0001546 | Ga0496116_0001546_15247_16062 | 271 |
| 1159 | 3300048920 | Ga0496117_0007089 | Ga0496117_0007089_6779_7594 | 271 |
| 1160 | 3300048921 | Ga0496118_0195100 | Ga0496118_0195100_329_1144 | 271 |
| 1161 | 3300048925 | Ga0496122_0000746 | Ga0496122_0000746_12785_13600 | 271 |
| 1162 | 3300048925 | Ga0496122_0008031 | Ga0496122_0008031_5739_6554 | 271 |
| 1163 | 3300048926 | Ga0496123_0030182 | Ga0496123_0030182_2859_3674 | 271 |
| 1164 | 3300048926 | Ga0496123_0096201 | Ga0496123_0096201_204_1019 | 271 |
| 1165 | 3300048927 | Ga0496124_0113530 | Ga0496124_0113530_604_1419 | 271 |
| 1166 | 3300048928 | Ga0496125_0211980 | Ga0496125_0211980_343_1158 | 271 |
| 1167 | 3300053093 | Ga0500651_0000127 | Ga0500651_0000127_35662_36477 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fs2-assembly1.cif.gz_B | crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution | 0.9772 | 16 | 270 |
| 3fs2-assembly1.cif.gz_A | crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution | 0.9761 | 14 | 270 |
| 2nxh-assembly2.cif.gz_H | structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase. | 0.9684 | 16 | 270 |
| 1lrn-assembly1.cif.gz_B-2 | aquifex aeolicus kdo8p synthase h185g mutant in complex with cadmium | 0.9681 | 16 | 270 |
| 1lrq-assembly1.cif.gz_B | aquifex aeolicus kdo8p synthase h185g mutant in complex with pep, a5p and cadmium | 0.9681 | 16 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9624 | 15 | 270 | 3.20.20.70 |
| 1o60D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9428 | 9 | 270 | 3.20.20.70 |
| 1fwtA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9339 | 15 | 270 | 3.20.20.70 |
| 4z1aA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9241 | 16 | 269 | 3.20.20.70 |
| 3t4cC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.913 | 15 | 269 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800F255-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9967 | 93 | 198 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A6P1B415-F1-model_v4 | deleted | 0.9923 | 119 | 203 |
|
| AF-A0A519WMH6-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9914 | 8 | 142 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A1I3IEC6-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9913 | 3 | 269 |
GO:0005737
GO:0008676 GO:0009103 |
| AF-A0A2S1Q9C8-F1-model_v4 | 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) | 0.9911 | 8 | 270 |
GO:0005737
GO:0008676 GO:0009103 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar