F491095

General Info

Members Datasets Scaffolds Average Seq Length
1167 432 1118 275

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100048281|Ga0075431_1000482814
Length 264
Sequence MQKFLKDLFTKQSYDEKNFFLIAGPCVVESEELAMEVADKVYGICKNLGIPYVFKSSYRKANRTSATSFTGIGDEKALAIVKKTGEKYGVPTTSDIHAHDEAEVAAKYVDILQIPAFLCRQTTGKIVNVKKGQFLSGESMKFAVEKIKAAENNKVILTERGTTFGYHDLVVDYRNIPAMQKFDVPVVMDCTHSLQQPNQTSGVTGGNPQMIGTISKAAIASGADGLFIETHPNPAVAKSDGANMLKLDLLEDLLNKLVKLRKAM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
16 2818991444 Filimonas endophytica 3197 Isolate Unclassified
17 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
18 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
19 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
20 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
21 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
22 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
23 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
24 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
25 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
26 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
27 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
28 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
29 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
30 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
31 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
32 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
33 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
34 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
35 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
36 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
37 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
38 2914759650 Rhizosphaericola mali Isolate Rhizosphere
39 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
40 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
41 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
42 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
43 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
44 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
45 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
46 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
47 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
48 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
49 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
83 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
102 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
166 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
251 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
252 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
253 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
254 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
255 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
258 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
260 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
261 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
262 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
263 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
266 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
269 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
270 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
271 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
272 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
273 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
274 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
278 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
287 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
294 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
295 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
298 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
299 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
300 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
301 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
302 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
303 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
304 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
305 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
308 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
309 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
313 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
314 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
323 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
324 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
335 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
336 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
337 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
338 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
383 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
384 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
385 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
386 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
387 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
388 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
389 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
390 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
391 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
396 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
405 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
406 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
407 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
408 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
411 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
414 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
417 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
418 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
423 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
424 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
425 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
426 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
432 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 0.09
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.43
Nodule 0
Rhizoplane 0.86
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2039605 2162886007 Bacteria 2927
2 SwRhRL2b_contig_2043181 2162886007 Bacteria 31792
3 SwRhRL2b_contig_2513460 2162886007 Bacteria 7126
4 MRS1b_contig_5332534 2162886011 Unclassified 1037
5 JGI25154J39366_1000007 3300002738 Bacteria 335932
6 JGI25152J39213_1000647 3300002773 Bacteria 18444
7 JGI25150J39212_1000009 3300002774 Bacteria 249509
8 JGI25151J46595_10000017 3300003187 Bacteria 249509
9 JGI25406J46586_10000525 3300003203 Bacteria 17890
10 JGI25153J46596_10000023 3300003215 Bacteria 249509
11 JGI25153J46596_10014038 3300003215 Bacteria 3353
12 rootH1_10002677 3300003316 Bacteria 1348
13 rootH1_10068633 3300003316 Unclassified 2751
14 rootH1_10100877 3300003316 Bacteria 2668
15 rootH1_10135481 3300003316 Bacteria 1892
16 rootH2_10040458 3300003320 Bacteria 6763
17 rootH2_10047580 3300003320 Bacteria 23351
18 rootH2_10069535 3300003320 Bacteria 11638
19 rootH2_10086703 3300003320 Bacteria 2647
20 rootH2_10096794 3300003320 Bacteria 5474
21 rootH2_10125569 3300003320 Bacteria 2987
22 rootL2_10010003 3300003322 Bacteria 3121
23 rootL2_10013694 3300003322 Bacteria 3185
24 rootL2_10037159 3300003322 Bacteria 5236
25 rootL2_10106122 3300003322 Bacteria 1367
26 rootL2_10176488 3300003322 Bacteria 3277
27 rootL2_10283503 3300003322 Bacteria 1558
28 rootH1_10002262 3300003323 Bacteria 13157
29 rootH1_10031210 3300003323 Bacteria 6277
30 rootH1_10067892 3300003323 Bacteria 3886
31 rootH1_10081850 3300003323 Bacteria 5525
32 rootH1_10208372 3300003323 Bacteria 1646
33 JGI25160J50197_1001273 3300003354 Bacteria 12786
34 JGI25160J50197_1001820 3300003354 Bacteria 10281
35 JGI25160J50197_1009684 3300003354 Bacteria 3550
36 Ga0055542_1005732 3300003762 Bacteria 2752
37 Ga0055528_1000164 3300003790 Bacteria 55729
38 Ga0055530_10002036 3300003791 Bacteria 13649
39 Ga0055530_10002755 3300003791 Bacteria 10873
40 Ga0055531_10000020 3300003794 Bacteria 170186
41 Ga0065165_1000010 3300005262 Bacteria 323737
42 Ga0065165_1030900 3300005262 Bacteria 1699
43 Ga0065714_10002310 3300005288 Bacteria 37379
44 Ga0065714_10003657 3300005288 Bacteria 30790
45 Ga0065714_10004769 3300005288 Bacteria 5412
46 Ga0065714_10004961 3300005288 Bacteria 4727
47 Ga0065714_10023632 3300005288 Bacteria 1672
48 Ga0065714_10064664 3300005288 Bacteria 25064
49 Ga0065714_10064897 3300005288 Bacteria 15960
50 Ga0065714_10118971 3300005288 Bacteria 1365
51 Ga0065714_10123017 3300005288 Bacteria 1326
52 Ga0065704_10000193 3300005289 Bacteria 203271
53 Ga0065704_10070350 3300005289 Bacteria 30787
54 Ga0065712_10173878 3300005290 Unclassified 1228
55 Ga0070658_10001041 3300005327 Bacteria 23743
56 Ga0070658_10040671 3300005327 Bacteria 3751
57 Ga0070658_10046802 3300005327 Bacteria 3500
58 Ga0070658_10227153 3300005327 Bacteria 1580
59 Ga0070676_10001302 3300005328 Bacteria 12549
60 Ga0070676_10001325 3300005328 Bacteria 12443
61 Ga0070676_10039691 3300005328 Bacteria 2723
62 Ga0070683_100000163 3300005329 Bacteria 43905
63 Ga0070683_100002968 3300005329 Bacteria 13603
64 Ga0070683_100006525 3300005329 Bacteria 9797
65 Ga0070683_100062783 3300005329 Bacteria 3454
66 Ga0070683_100236447 3300005329 Bacteria 1737
67 Ga0070690_100007549 3300005330 Bacteria 6224
68 Ga0070690_100055790 3300005330 Bacteria 2531
69 Ga0070690_100126964 3300005330 Unclassified 1718
70 Ga0070670_100062169 3300005331 Bacteria 3206
71 Ga0070670_100069074 3300005331 Bacteria 3033
72 Ga0070670_100130431 3300005331 Bacteria 2170
73 Ga0070677_10035784 3300005333 Bacteria 1927
74 Ga0068869_100018339 3300005334 Bacteria 4762
75 Ga0068869_100023955 3300005334 Bacteria 4223
76 Ga0068869_100033372 3300005334 Bacteria 3633
77 Ga0068869_100056074 3300005334 Bacteria 2873
78 Ga0068869_100077989 3300005334 Bacteria 2466
79 Ga0068869_100102195 3300005334 Unclassified 2169
80 Ga0070666_10000470 3300005335 Bacteria 24388
81 Ga0070666_10002147 3300005335 Bacteria 11985
82 Ga0070666_10007390 3300005335 Bacteria 6770
83 Ga0070666_10093615 3300005335 Bacteria 2066
84 Ga0070680_100019950 3300005336 Bacteria 5313
85 Ga0070680_100108378 3300005336 Bacteria 2310
86 Ga0070680_100256235 3300005336 Bacteria 1480
87 Ga0070682_100000125 3300005337 Bacteria 67243
88 Ga0070682_100000763 3300005337 Bacteria 19108
89 Ga0068868_100009542 3300005338 Bacteria 6993
90 Ga0068868_100010057 3300005338 Bacteria 6836
91 Ga0068868_100020797 3300005338 Bacteria 4938
92 Ga0068868_100023201 3300005338 Bacteria 4694
93 Ga0068868_100029528 3300005338 Bacteria 4199
94 Ga0068868_100222541 3300005338 Bacteria 1580
95 Ga0068868_100486689 3300005338 Bacteria 1079
96 Ga0068868_100525858 3300005338 Bacteria 1039
97 Ga0070660_100007237 3300005339 Bacteria 7723
98 Ga0070660_100015655 3300005339 Bacteria 5481
99 Ga0070660_100087378 3300005339 Unclassified 2454
100 Ga0070689_100371436 3300005340 Bacteria 1203
101 Ga0070689_100578495 3300005340 Bacteria 970
102 Ga0070691_10003781 3300005341 Bacteria 6839
103 Ga0070691_10080700 3300005341 Bacteria 1592
104 Ga0070687_100060562 3300005343 Bacteria 1997
105 Ga0070661_100008117 3300005344 Bacteria 7243
106 Ga0070661_100013480 3300005344 Bacteria 5738
107 Ga0070661_100015221 3300005344 Bacteria 5428
108 Ga0070661_100278994 3300005344 Unclassified 1296
109 Ga0070668_100000043 3300005347 Bacteria 78564
110 Ga0070668_100055178 3300005347 Bacteria 3066
111 Ga0070669_100021225 3300005353 Bacteria 4641
112 Ga0070669_100027147 3300005353 Bacteria 4121
113 Ga0070675_100012773 3300005354 Bacteria 6587
114 Ga0070675_100022391 3300005354 Bacteria 5050
115 Ga0070675_100419922 3300005354 Bacteria 1196
116 Ga0070671_100006875 3300005355 Bacteria 9110
117 Ga0070671_100075054 3300005355 Unclassified 2824
118 Ga0070671_100098121 3300005355 Bacteria 2457
119 Ga0070671_100116745 3300005355 Bacteria 2244
120 Ga0070671_100347355 3300005355 Bacteria 1266
121 Ga0070674_100007210 3300005356 Bacteria 6544
122 Ga0070674_100048543 3300005356 Bacteria 2914
123 Ga0070674_100093218 3300005356 Unclassified 2179
124 Ga0070674_100108558 3300005356 Bacteria 2034
125 Ga0070674_100545728 3300005356 Unclassified 972
126 Ga0070673_100000327 3300005364 Bacteria 25035
127 Ga0070673_100025591 3300005364 Bacteria 4347
128 Ga0070673_100026841 3300005364 Bacteria 4259
129 Ga0070673_100029665 3300005364 Bacteria 4081
130 Ga0070673_100076951 3300005364 Bacteria 2695
131 Ga0070673_100101829 3300005364 Bacteria 2367
132 Ga0070673_100105793 3300005364 Unclassified 2325
133 Ga0070673_100113300 3300005364 Bacteria 2252
134 Ga0070688_100008996 3300005365 Bacteria 5443
135 Ga0070688_100010503 3300005365 Bacteria 5109
136 Ga0070688_100066198 3300005365 Bacteria 2299
137 Ga0070688_100169717 3300005365 Bacteria 1504
138 Ga0070659_100003048 3300005366 Bacteria 11911
139 Ga0070659_100340092 3300005366 Bacteria 1257
140 Ga0070659_100512500 3300005366 Bacteria 1023
141 Ga0070667_100002415 3300005367 Bacteria 16338
142 Ga0070667_100003720 3300005367 Bacteria 12949
143 Ga0070667_100013202 3300005367 Bacteria 6827
144 Ga0070667_100014132 3300005367 Bacteria 6596
145 Ga0070667_100172908 3300005367 Bacteria 1908
146 Ga0070667_100181840 3300005367 Bacteria 1859
147 Ga0070667_100192966 3300005367 Bacteria 1805
148 Ga0070700_100073234 3300005441 Unclassified 2192
149 Ga0070663_100127377 3300005455 Bacteria 1930
150 Ga0070663_100164210 3300005455 Bacteria 1711
151 Ga0070663_100212572 3300005455 Bacteria 1515
152 Ga0070678_100119132 3300005456 Bacteria 2079
153 Ga0070678_100151186 3300005456 Unclassified 1870
154 Ga0070662_100000634 3300005457 Bacteria 21289
155 Ga0070662_100006198 3300005457 Bacteria 7700
156 Ga0070662_100011578 3300005457 Bacteria 5821
157 Ga0070662_100024164 3300005457 Bacteria 4183
158 Ga0070662_100351813 3300005457 Unclassified 1207
159 Ga0070681_10171808 3300005458 Bacteria 2089
160 Ga0068867_100007977 3300005459 Bacteria 7480
161 Ga0068867_100033229 3300005459 Bacteria 3734
162 Ga0068867_100042668 3300005459 Bacteria 3319
163 Ga0068867_100110092 3300005459 Bacteria 2115
164 Ga0070685_10020801 3300005466 Bacteria 3556
165 Ga0070685_10020953 3300005466 Bacteria 3546
166 Ga0070685_10023651 3300005466 Bacteria 3367
167 Ga0070685_10294017 3300005466 Bacteria 1092
168 Ga0070707_100237998 3300005468 Bacteria 1772
169 Ga0070698_100000297 3300005471 Bacteria 50707
170 Ga0070698_100044656 3300005471 Bacteria 4536
171 Ga0070698_100306542 3300005471 Unclassified 1519
172 Ga0070679_100009706 3300005530 Bacteria 9105
173 Ga0070679_100017964 3300005530 Bacteria 6854
174 Ga0070679_100114743 3300005530 Bacteria 2679
175 Ga0070684_100002223 3300005535 Bacteria 14311
176 Ga0070684_100003255 3300005535 Bacteria 12160
177 Ga0070684_100036799 3300005535 Bacteria 4195
178 Ga0070684_100123368 3300005535 Bacteria 2331
179 Ga0068853_100000393 3300005539 Bacteria 29967
180 Ga0068853_100012039 3300005539 Bacteria 7037
181 Ga0068853_100012865 3300005539 Bacteria 6819
182 Ga0068853_100035117 3300005539 Bacteria 4258
183 Ga0068853_100038576 3300005539 Bacteria 4069
184 Ga0068853_100047147 3300005539 Bacteria 3698
185 Ga0068853_100086173 3300005539 Bacteria 2754
186 Ga0068853_100134818 3300005539 Bacteria 2213
187 Ga0068853_100187668 3300005539 Bacteria 1877
188 Ga0068853_100198341 3300005539 Bacteria 1826
189 Ga0068853_100249885 3300005539 Bacteria 1627
190 Ga0068853_100539848 3300005539 Unclassified 1104
191 Ga0070672_100000109 3300005543 Bacteria 41435
192 Ga0070672_100025040 3300005543 Bacteria 4420
193 Ga0070672_100404349 3300005543 Bacteria 1171
194 Ga0070686_100116157 3300005544 Bacteria 1831
195 Ga0070696_100127934 3300005546 Unclassified 1845
196 Ga0070693_100029934 3300005547 Bacteria 2973
197 Ga0070665_100000013 3300005548 Bacteria 484927
198 Ga0070665_100000442 3300005548 Bacteria 60619
199 Ga0070665_100033784 3300005548 Bacteria 5145
200 Ga0068855_100000424 3300005563 Bacteria 52152
201 Ga0068855_100007894 3300005563 Bacteria 12855
202 Ga0068855_100042418 3300005563 Bacteria 5391
203 Ga0068855_100043267 3300005563 Bacteria 5335
204 Ga0068855_100125412 3300005563 Bacteria 2936
205 Ga0068855_100129313 3300005563 Bacteria 2885
206 Ga0068855_100260832 3300005563 Bacteria 1930
207 Ga0070664_100003401 3300005564 Bacteria 12846
208 Ga0070664_100014457 3300005564 Bacteria 6435
209 Ga0070664_100154403 3300005564 Bacteria 2028
210 Ga0070664_100181958 3300005564 Bacteria 1868
211 Ga0070664_100246686 3300005564 Bacteria 1604
212 Ga0068857_100026465 3300005577 Bacteria 5113
213 Ga0068857_100041415 3300005577 Bacteria 4085
214 Ga0068857_100164522 3300005577 Unclassified 2014
215 Ga0068857_100295396 3300005577 Bacteria 1493
216 Ga0068854_100058430 3300005578 Bacteria 2784
217 Ga0068854_100068897 3300005578 Bacteria 2581
218 Ga0068854_100092898 3300005578 Bacteria 2248
219 Ga0068854_100298702 3300005578 Bacteria 1302
220 Ga0068854_100447205 3300005578 Bacteria 1078
221 Ga0068854_100681855 3300005578 Bacteria 885
222 Ga0068856_100036956 3300005614 Bacteria 4790
223 Ga0068856_100184238 3300005614 Unclassified 2101
224 Ga0070702_100332360 3300005615 Bacteria 1063
225 Ga0068852_100002256 3300005616 Bacteria 13229
226 Ga0068852_100007763 3300005616 Bacteria 7853
227 Ga0068852_100008104 3300005616 Bacteria 7711
228 Ga0068852_100028525 3300005616 Bacteria 4570
229 Ga0068852_100061314 3300005616 Bacteria 3269
230 Ga0068852_100124699 3300005616 Bacteria 2363
231 Ga0068852_100169367 3300005616 Bacteria 2046
232 Ga0068852_100173333 3300005616 Bacteria 2024
233 Ga0068852_100184267 3300005616 Bacteria 1965
234 Ga0068859_100000012 3300005617 Bacteria 300376
235 Ga0068859_100009837 3300005617 Bacteria 9653
236 Ga0068859_100291434 3300005617 Bacteria 1725
237 Ga0068859_100330486 3300005617 Bacteria 1618
238 Ga0068859_100411599 3300005617 Bacteria 1448
239 Ga0068864_100002855 3300005618 Bacteria 14274
240 Ga0068864_100002925 3300005618 Bacteria 14126
241 Ga0068864_100038495 3300005618 Bacteria 4085
242 Ga0068864_100334473 3300005618 Bacteria 1426
243 Ga0068864_100414635 3300005618 Bacteria 1282
244 Ga0068864_100434066 3300005618 Bacteria 1254
245 Ga0068866_10031108 3300005718 Unclassified 2568
246 Ga0068866_10039537 3300005718 Bacteria 2329
247 Ga0068861_100096503 3300005719 Bacteria 2343
248 Ga0068851_10000757 3300005834 Bacteria 13887
249 Ga0068851_10023638 3300005834 Unclassified 3006
250 Ga0068851_10033342 3300005834 Bacteria 2566
251 Ga0068851_10061988 3300005834 Unclassified 1918
252 Ga0068851_10099080 3300005834 Bacteria 1544
253 Ga0068851_10123477 3300005834 Bacteria 1394
254 Ga0068870_10086437 3300005840 Bacteria 1744
255 Ga0068863_100000837 3300005841 Bacteria 30852
256 Ga0068863_100004877 3300005841 Bacteria 13216
257 Ga0068863_100031428 3300005841 Bacteria 5065
258 Ga0068863_100167215 3300005841 Bacteria 2109
259 Ga0068863_100241607 3300005841 Bacteria 1743
260 Ga0068863_100912930 3300005841 Bacteria 879
261 Ga0068858_100000199 3300005842 Bacteria 64607
262 Ga0068858_100003623 3300005842 Bacteria 15279
263 Ga0068858_100044704 3300005842 Bacteria 4105
264 Ga0068858_100062898 3300005842 Bacteria 3433
265 Ga0068858_100138918 3300005842 Unclassified 2281
266 Ga0068860_100000060 3300005843 Bacteria 195631
267 Ga0068860_100001065 3300005843 Bacteria 30280
268 Ga0068860_100002282 3300005843 Bacteria 20152
269 Ga0068860_100006172 3300005843 Bacteria 12053
270 Ga0068860_100015467 3300005843 Bacteria 7450
271 Ga0068860_100024334 3300005843 Bacteria 5852
272 Ga0068860_100078244 3300005843 Bacteria 3145
273 Ga0081539_10000037 3300005985 Bacteria 296160
274 Ga0081539_10021605 3300005985 Bacteria 4289
275 Ga0075366_10057949 3300006195 Bacteria 2301
276 Ga0075366_10128799 3300006195 Bacteria 1527
277 Ga0075366_10145746 3300006195 Bacteria 1433
278 Ga0075366_10185617 3300006195 Bacteria 1263
279 Ga0075366_10262687 3300006195 Bacteria 1054
280 Ga0097621_100001588 3300006237 Bacteria 15542
281 Ga0097621_100027698 3300006237 Bacteria 4459
282 Ga0097621_100080231 3300006237 Bacteria 2714
283 Ga0097621_100116128 3300006237 Bacteria 2266
284 Ga0097621_100139561 3300006237 Bacteria 2070
285 Ga0097621_100193836 3300006237 Unclassified 1761
286 Ga0097621_100296828 3300006237 Bacteria 1426
287 Ga0068871_100000415 3300006358 Bacteria 29454
288 Ga0068871_100012310 3300006358 Bacteria 6303
289 Ga0068871_100025288 3300006358 Bacteria 4617
290 Ga0068871_100035662 3300006358 Bacteria 3954
291 Ga0068871_100076489 3300006358 Bacteria 2765
292 Ga0068871_100097438 3300006358 Bacteria 2458
293 Ga0068871_100302487 3300006358 Bacteria 1404
294 Ga0075428_100359180 3300006844 Unclassified 1563
295 Ga0075431_100048281 3300006847 Bacteria 4391
296 Ga0068865_100029956 3300006881 Bacteria 3616
297 Ga0068865_100169183 3300006881 Bacteria 1674
298 Ga0068865_100214390 3300006881 Unclassified 1502
299 Ga0068865_100625544 3300006881 Bacteria 912
300 Ga0097620_100000012 3300006931 Bacteria 300376
301 Ga0097620_100009837 3300006931 Bacteria 9653
302 Ga0097620_100291442 3300006931 Bacteria 1725
303 Ga0097620_100330498 3300006931 Bacteria 1618
304 Ga0097620_100411639 3300006931 Bacteria 1448
305 Ga0105240_10000020 3300009093 Bacteria 399699
306 Ga0105240_10000486 3300009093 Bacteria 73492
307 Ga0105240_10001336 3300009093 Bacteria 42397
308 Ga0105240_10001733 3300009093 Bacteria 36808
309 Ga0105240_10002769 3300009093 Bacteria 27701
310 Ga0105240_10053213 3300009093 Bacteria 5083
311 Ga0105240_10092055 3300009093 Bacteria 3703
312 Ga0105240_10140580 3300009093 Bacteria 2887
313 Ga0105240_10187278 3300009093 Bacteria 2437
314 Ga0105240_10260537 3300009093 Bacteria 2000
315 Ga0105240_10385880 3300009093 Unclassified 1581
316 Ga0105240_10474576 3300009093 Bacteria 1395
317 Ga0111539_10029443 3300009094 Bacteria 6687
318 Ga0111539_10223014 3300009094 Bacteria 2195
319 Ga0105245_10707957 3300009098 Bacteria 1041
320 Ga0105247_10087178 3300009101 Bacteria 1976
321 Ga0105247_10179217 3300009101 Bacteria 1413
322 Ga0114129_10201912 3300009147 Bacteria 2692
323 Ga0105241_10000160 3300009174 Bacteria 48902
324 Ga0105241_10005397 3300009174 Bacteria 9451
325 Ga0105241_10006798 3300009174 Bacteria 8412
326 Ga0105242_10010378 3300009176 Bacteria 7143
327 Ga0105242_10040136 3300009176 Bacteria 3771
328 Ga0105242_10043339 3300009176 Bacteria 3640
329 Ga0105242_10045988 3300009176 Bacteria 3540
330 Ga0105242_10086591 3300009176 Bacteria 2629
331 Ga0105242_10140101 3300009176 Bacteria 2098
332 Ga0105242_10155242 3300009176 Bacteria 1999
333 Ga0105242_10744581 3300009176 Unclassified 964
334 Ga0105248_10004754 3300009177 Bacteria 15030
335 Ga0105248_10031239 3300009177 Bacteria 5952
336 Ga0105237_10000651 3300009545 Bacteria 48483
337 Ga0105237_10001003 3300009545 Bacteria 37998
338 Ga0105237_10006737 3300009545 Bacteria 12689
339 Ga0105237_10010984 3300009545 Bacteria 9610
340 Ga0105237_10012955 3300009545 Bacteria 8758
341 Ga0105237_10031701 3300009545 Bacteria 5354
342 Ga0105237_10061473 3300009545 Bacteria 3755
343 Ga0105237_10096161 3300009545 Bacteria 2952
344 Ga0105237_10229777 3300009545 Bacteria 1856
345 Ga0105237_10327524 3300009545 Bacteria 1536
346 Ga0105238_10006277 3300009551 Bacteria 11811
347 Ga0105238_10035934 3300009551 Bacteria 5037
348 Ga0105238_10041567 3300009551 Bacteria 4655
349 Ga0105249_10003523 3300009553 Bacteria 13534
350 Ga0105249_10018325 3300009553 Bacteria 6225
351 Ga0105249_10034299 3300009553 Bacteria 4599
352 Ga0105249_10056871 3300009553 Bacteria 3582
353 Ga0105249_10095840 3300009553 Bacteria 2783
354 Ga0105249_10170736 3300009553 Bacteria 2108
355 Ga0105249_10208189 3300009553 Bacteria 1918
356 Ga0105249_10283174 3300009553 Bacteria 1656
357 Ga0105249_10294582 3300009553 Bacteria 1625
358 Ga0105239_10000457 3300010375 Bacteria 59635
359 Ga0105239_10001481 3300010375 Bacteria 31222
360 Ga0105239_10014988 3300010375 Bacteria 8594
361 Ga0105239_10018841 3300010375 Bacteria 7626
362 Ga0105239_10046890 3300010375 Bacteria 4735
363 Ga0105239_10049269 3300010375 Bacteria 4619
364 Ga0105239_10098424 3300010375 Bacteria 3233
365 Ga0105239_10123388 3300010375 Bacteria 2878
366 Ga0105239_10169435 3300010375 Bacteria 2442
367 Ga0105239_10207254 3300010375 Bacteria 2197
368 Ga0105246_10013049 3300011119 Bacteria 5199
369 Ga0105246_10034419 3300011119 Bacteria 3376
370 Ga0105246_10145743 3300011119 Unclassified 1786
371 Ga0157373_10000136 3300013100 Bacteria 57912
372 Ga0157373_10010365 3300013100 Bacteria 6861
373 Ga0157373_10011057 3300013100 Bacteria 6647
374 Ga0157373_10011567 3300013100 Bacteria 6484
375 Ga0157373_10044643 3300013100 Bacteria 3164
376 Ga0157373_10127960 3300013100 Bacteria 1786
377 Ga0157371_10000009 3300013102 Bacteria 392895
378 Ga0157371_10004069 3300013102 Bacteria 12926
379 Ga0157371_10004753 3300013102 Bacteria 11717
380 Ga0157371_10007420 3300013102 Bacteria 8881
381 Ga0157371_10011958 3300013102 Bacteria 6656
382 Ga0157371_10022986 3300013102 Bacteria 4559
383 Ga0157371_10053517 3300013102 Bacteria 2866
384 Ga0157371_10112606 3300013102 Bacteria 1931
385 Ga0157371_10150197 3300013102 Bacteria 1661
386 Ga0157371_10174230 3300013102 Unclassified 1538
387 Ga0157370_10001064 3300013104 Bacteria 34340
388 Ga0157370_10002306 3300013104 Bacteria 23088
389 Ga0157370_10004498 3300013104 Bacteria 15980
390 Ga0157370_10011097 3300013104 Bacteria 9444
391 Ga0157370_10011684 3300013104 Bacteria 9166
392 Ga0157370_10012352 3300013104 Bacteria 8862
393 Ga0157370_10020896 3300013104 Bacteria 6531
394 Ga0157370_10029726 3300013104 Bacteria 5359
395 Ga0157370_10043363 3300013104 Unclassified 4330
396 Ga0157370_10059442 3300013104 Bacteria 3632
397 Ga0157370_10084627 3300013104 Bacteria 2981
398 Ga0157370_10144239 3300013104 Bacteria 2218
399 Ga0157370_10179665 3300013104 Bacteria 1966
400 Ga0157370_10190126 3300013104 Bacteria 1906
401 Ga0157370_10526036 3300013104 Bacteria 1085
402 Ga0157370_10551105 3300013104 Unclassified 1057
403 Ga0157369_10000006 3300013105 Bacteria 412230
404 Ga0157369_10008134 3300013105 Bacteria 12027
405 Ga0157369_10015578 3300013105 Bacteria 8567
406 Ga0157369_10029590 3300013105 Bacteria 6051
407 Ga0157369_10080689 3300013105 Bacteria 3483
408 Ga0157369_10180230 3300013105 Bacteria 2223
409 Ga0157369_10373796 3300013105 Bacteria 1479
410 Ga0157374_10000007 3300013296 Bacteria 595643
411 Ga0157374_10000629 3300013296 Bacteria 31059
412 Ga0157374_10029588 3300013296 Bacteria 4962
413 Ga0157374_10059605 3300013296 Bacteria 3570
414 Ga0157374_10065532 3300013296 Bacteria 3411
415 Ga0157374_10075514 3300013296 Bacteria 3184
416 Ga0157374_10180871 3300013296 Bacteria 2060
417 Ga0157374_10214026 3300013296 Bacteria 1890
418 Ga0157374_10242203 3300013296 Bacteria 1773
419 Ga0157374_10470460 3300013296 Bacteria 1259
420 Ga0157374_10954962 3300013296 Bacteria 876
421 Ga0157378_10006049 3300013297 Bacteria 10601
422 Ga0157378_10006118 3300013297 Bacteria 10537
423 Ga0157378_10006926 3300013297 Bacteria 9899
424 Ga0157378_10007878 3300013297 Bacteria 9298
425 Ga0157378_10012427 3300013297 Bacteria 7456
426 Ga0157378_10025320 3300013297 Bacteria 5226
427 Ga0157378_10057639 3300013297 Bacteria 3462
428 Ga0157378_10072304 3300013297 Bacteria 3099
429 Ga0157378_10139500 3300013297 Bacteria 2250
430 Ga0163162_10000140 3300013306 Bacteria 65811
431 Ga0163162_10000177 3300013306 Bacteria 58576
432 Ga0163162_10000213 3300013306 Bacteria 53744
433 Ga0163162_10000371 3300013306 Bacteria 40778
434 Ga0163162_10002125 3300013306 Bacteria 18615
435 Ga0163162_10004487 3300013306 Bacteria 13448
436 Ga0163162_10008778 3300013306 Bacteria 9826
437 Ga0163162_10011211 3300013306 Bacteria 8738
438 Ga0163162_10022548 3300013306 Bacteria 6206
439 Ga0163162_10041859 3300013306 Bacteria 4583
440 Ga0163162_10044729 3300013306 Bacteria 4435
441 Ga0163162_10050767 3300013306 Bacteria 4160
442 Ga0163162_10058353 3300013306 Bacteria 3888
443 Ga0163162_10150916 3300013306 Unclassified 2441
444 Ga0163162_10207695 3300013306 Bacteria 2088
445 Ga0163162_10255070 3300013306 Bacteria 1886
446 Ga0163162_10836372 3300013306 Bacteria 1036
447 Ga0157372_10002277 3300013307 Bacteria 20793
448 Ga0157372_10007751 3300013307 Bacteria 11407
449 Ga0157372_10008222 3300013307 Bacteria 11088
450 Ga0157372_10016773 3300013307 Bacteria 7863
451 Ga0157372_10028931 3300013307 Bacteria 6046
452 Ga0157372_10088920 3300013307 Bacteria 3508
453 Ga0157372_10096272 3300013307 Bacteria 3373
454 Ga0157372_10104649 3300013307 Bacteria 3236
455 Ga0157372_10133614 3300013307 Unclassified 2856
456 Ga0157372_10193945 3300013307 Bacteria 2353
457 Ga0157372_10290381 3300013307 Unclassified 1902
458 Ga0157375_10000553 3300013308 Bacteria 33598
459 Ga0157375_10001313 3300013308 Bacteria 21428
460 Ga0157375_10050973 3300013308 Bacteria 4062
461 Ga0157375_10054532 3300013308 Bacteria 3937
462 Ga0157375_10074533 3300013308 Bacteria 3415
463 Ga0157375_10160367 3300013308 Unclassified 2390
464 Ga0157375_10321264 3300013308 Bacteria 1713
465 Ga0157375_10353298 3300013308 Bacteria 1636
466 Ga0157375_10531593 3300013308 Bacteria 1338
467 Ga0163163_10000332 3300014325 Bacteria 45415
468 Ga0163163_10000457 3300014325 Bacteria 37238
469 Ga0163163_10000677 3300014325 Bacteria 29135
470 Ga0163163_10044180 3300014325 Bacteria 4370
471 Ga0163163_10128627 3300014325 Bacteria 2572
472 Ga0163163_10232691 3300014325 Bacteria 1892
473 Ga0163163_10353516 3300014325 Bacteria 1526
474 Ga0163163_10767535 3300014325 Bacteria 1027
475 Ga0157380_10000022 3300014326 Bacteria 114070
476 Ga0157380_10046770 3300014326 Unclassified 3400
477 Ga0157380_10079325 3300014326 Bacteria 2681
478 Ga0157380_10088288 3300014326 Bacteria 2551
479 Ga0182008_10000018 3300014497 Bacteria 230609
480 Ga0182008_10000378 3300014497 Bacteria 34433
481 Ga0182008_10009414 3300014497 Bacteria 5271
482 Ga0182008_10033160 3300014497 Bacteria 2592
483 Ga0157377_10060152 3300014745 Bacteria 2168
484 Ga0157379_10000340 3300014968 Bacteria 37587
485 Ga0157379_10042488 3300014968 Bacteria 4059
486 Ga0157379_10045025 3300014968 Bacteria 3939
487 Ga0157379_10080869 3300014968 Bacteria 2911
488 Ga0157379_10168863 3300014968 Bacteria 1975
489 Ga0157379_10268519 3300014968 Bacteria 1551
490 Ga0157376_10000491 3300014969 Bacteria 25555
491 Ga0157376_10000771 3300014969 Bacteria 20899
492 Ga0157376_10003394 3300014969 Bacteria 10966
493 Ga0157376_10058992 3300014969 Bacteria 3217
494 Ga0157376_10098268 3300014969 Bacteria 2552
495 Ga0157376_10131972 3300014969 Bacteria 2230
496 Ga0157376_10248818 3300014969 Bacteria 1659
497 Ga0157376_10389068 3300014969 Bacteria 1345
498 Ga0182006_1000322 3300015261 Bacteria 41718
499 Ga0182006_1000382 3300015261 Bacteria 36661
500 Ga0182006_1007681 3300015261 Bacteria 4925
501 Ga0182006_1008844 3300015261 Bacteria 4548
502 Ga0182006_1044752 3300015261 Bacteria 1725
503 Ga0182007_10000001 3300015262 Bacteria 1127301
504 Ga0182005_1000131 3300015265 Bacteria 53401
505 Ga0183373_1006 3300015682 Bacteria 328276
506 Ga0163161_10000153 3300017792 Bacteria 63614
507 Ga0163161_10001740 3300017792 Bacteria 15937
508 Ga0163161_10002015 3300017792 Bacteria 14700
509 Ga0163161_10005625 3300017792 Bacteria 8693
510 Ga0163161_10006269 3300017792 Bacteria 8233
511 Ga0163161_10014448 3300017792 Bacteria 5497
512 Ga0163161_10022817 3300017792 Bacteria 4409
513 Ga0163161_10030675 3300017792 Bacteria 3828
514 Ga0163161_10274892 3300017792 Bacteria 1319
515 Ga0163161_10295845 3300017792 Bacteria 1274
516 Ga0206352_10602261 3300020078 Bacteria 1002
517 Ga0213876_10001070 3300021384 Bacteria 17605
518 Ga0209436_102245 3300025208 Bacteria 5974
519 Ga0209436_103275 3300025208 Bacteria 4367
520 Ga0209258_100219 3300025242 Bacteria 108974
521 Ga0207425_1000007 3300025245 Bacteria 777411
522 Ga0209646_1000002 3300025246 Bacteria 1425781
523 Ga0209646_1000770 3300025246 Bacteria 11079
524 Ga0209148_1000283 3300025254 Bacteria 77780
525 Ga0209129_1000006 3300025258 Bacteria 777761
526 Ga0207666_1004201 3300025271 Bacteria 1799
527 Ga0209673_1000082 3300025273 Bacteria 219716
528 Ga0209130_1003990 3300025284 Bacteria 5888
529 Ga0209025_1000025 3300025294 Bacteria 524454
530 Ga0209564_1008534 3300025295 Bacteria 5039
531 Ga0209758_1000016 3300025297 Bacteria 778557
532 Ga0209758_1011315 3300025297 Bacteria 5187
533 Ga0209758_1012324 3300025297 Bacteria 4798
534 Ga0209050_1000555 3300025298 Bacteria 61428
535 Ga0207426_1000230 3300025302 Bacteria 128357
536 Ga0207426_1000493 3300025302 Bacteria 59050
537 Ga0207426_1000514 3300025302 Bacteria 56462
538 Ga0207426_1000883 3300025302 Bacteria 30996
539 Ga0209051_1037251 3300025303 Bacteria 1786
540 Ga0209257_1000001 3300025304 Bacteria 2274655
541 Ga0207697_10061167 3300025315 Bacteria 1566
542 Ga0207697_10068184 3300025315 Unclassified 1488
543 Ga0207656_10005150 3300025321 Bacteria 4596
544 Ga0207682_10009398 3300025893 Bacteria 3860
545 Ga0207682_10108183 3300025893 Bacteria 1222
546 Ga0207642_10041343 3300025899 Unclassified 2018
547 Ga0207642_10119113 3300025899 Bacteria 1358
548 Ga0207710_10000804 3300025900 Bacteria 16999
549 Ga0207710_10016472 3300025900 Unclassified 3128
550 Ga0207710_10093631 3300025900 Bacteria 1409
551 Ga0207688_10007738 3300025901 Bacteria 5853
552 Ga0207688_10011124 3300025901 Bacteria 4896
553 Ga0207680_10000031 3300025903 Bacteria 77871
554 Ga0207680_10001651 3300025903 Bacteria 10542
555 Ga0207680_10041946 3300025903 Bacteria 2673
556 Ga0207680_10047382 3300025903 Bacteria 2547
557 Ga0207680_10162839 3300025903 Unclassified 1497
558 Ga0207680_10210022 3300025903 Unclassified 1330
559 Ga0207647_10000288 3300025904 Bacteria 41316
560 Ga0207647_10015219 3300025904 Bacteria 5282
561 Ga0207647_10065300 3300025904 Bacteria 2210
562 Ga0207645_10000713 3300025907 Bacteria 27669
563 Ga0207645_10001819 3300025907 Bacteria 17206
564 Ga0207645_10042582 3300025907 Unclassified 2906
565 Ga0207643_10010031 3300025908 Bacteria 5092
566 Ga0207705_10119645 3300025909 Bacteria 1953
567 Ga0207705_10195836 3300025909 Bacteria 1530
568 Ga0207654_10001314 3300025911 Bacteria 13252
569 Ga0207654_10003003 3300025911 Bacteria 8561
570 Ga0207707_10000323 3300025912 Bacteria 50505
571 Ga0207695_10000130 3300025913 Bacteria 224214
572 Ga0207695_10000170 3300025913 Bacteria 192469
573 Ga0207695_10003034 3300025913 Bacteria 24093
574 Ga0207695_10004097 3300025913 Bacteria 20033
575 Ga0207695_10011079 3300025913 Bacteria 10950
576 Ga0207695_10012565 3300025913 Bacteria 10148
577 Ga0207695_10037565 3300025913 Bacteria 5225
578 Ga0207695_10047325 3300025913 Bacteria 4553
579 Ga0207695_10130257 3300025913 Bacteria 2473
580 Ga0207695_10173850 3300025913 Bacteria 2077
581 Ga0207695_10179390 3300025913 Bacteria 2039
582 Ga0207671_10000030 3300025914 Bacteria 248197
583 Ga0207671_10004377 3300025914 Bacteria 13538
584 Ga0207671_10005384 3300025914 Bacteria 11818
585 Ga0207671_10011928 3300025914 Bacteria 7027
586 Ga0207671_10012131 3300025914 Bacteria 6955
587 Ga0207671_10020567 3300025914 Bacteria 5022
588 Ga0207671_10124741 3300025914 Bacteria 1971
589 Ga0207671_10275579 3300025914 Bacteria 1326
590 Ga0207660_10017192 3300025917 Bacteria 4799
591 Ga0207660_10174603 3300025917 Bacteria 1665
592 Ga0207662_10011934 3300025918 Bacteria 4832
593 Ga0207657_10003020 3300025919 Bacteria 18018
594 Ga0207657_10007892 3300025919 Bacteria 10857
595 Ga0207657_10013457 3300025919 Bacteria 8026
596 Ga0207657_10058434 3300025919 Bacteria 3319
597 Ga0207657_10107784 3300025919 Bacteria 2304
598 Ga0207657_10203664 3300025919 Bacteria 1591
599 Ga0207649_10013964 3300025920 Bacteria 4493
600 Ga0207649_10111205 3300025920 Unclassified 1830
601 Ga0207652_10000942 3300025921 Bacteria 27351
602 Ga0207652_10015975 3300025921 Bacteria 6120
603 Ga0207652_10031715 3300025921 Bacteria 4439
604 Ga0207681_10109044 3300025923 Bacteria 2011
605 Ga0207681_10179303 3300025923 Unclassified 1612
606 Ga0207694_10020325 3300025924 Bacteria 5022
607 Ga0207694_10031981 3300025924 Bacteria 4024
608 Ga0207650_10105187 3300025925 Bacteria 2178
609 Ga0207650_10200158 3300025925 Bacteria 1599
610 Ga0207650_10272361 3300025925 Bacteria 1376
611 Ga0207659_10014768 3300025926 Bacteria 5047
612 Ga0207659_10057168 3300025926 Bacteria 2796
613 Ga0207659_10115671 3300025926 Bacteria 2046
614 Ga0207659_10130354 3300025926 Bacteria 1940
615 Ga0207659_10483281 3300025926 Bacteria 1047
616 Ga0207644_10003616 3300025931 Bacteria 10019
617 Ga0207644_10024353 3300025931 Bacteria 4154
618 Ga0207644_10219411 3300025931 Bacteria 1507
619 Ga0207644_10296907 3300025931 Unclassified 1301
620 Ga0207690_10044183 3300025932 Bacteria 2935
621 Ga0207706_10001885 3300025933 Bacteria 20569
622 Ga0207706_10002590 3300025933 Bacteria 17616
623 Ga0207706_10024967 3300025933 Bacteria 5358
624 Ga0207706_10096610 3300025933 Bacteria 2598
625 Ga0207706_10574188 3300025933 Bacteria 970
626 Ga0207686_10003787 3300025934 Bacteria 8121
627 Ga0207686_10043510 3300025934 Unclassified 2752
628 Ga0207686_10113308 3300025934 Bacteria 1833
629 Ga0207686_10139321 3300025934 Bacteria 1675
630 Ga0207709_10000006 3300025935 Bacteria 800946
631 Ga0207670_10023950 3300025936 Bacteria 3808
632 Ga0207670_10056611 3300025936 Bacteria 2655
633 Ga0207669_10194024 3300025937 Unclassified 1468
634 Ga0207669_10195968 3300025937 Bacteria 1462
635 Ga0207704_10004827 3300025938 Bacteria 6186
636 Ga0207704_10106478 3300025938 Bacteria 1884
637 Ga0207704_10138656 3300025938 Bacteria 1697
638 Ga0207691_10000228 3300025940 Bacteria 54500
639 Ga0207691_10005384 3300025940 Bacteria 12354
640 Ga0207691_10121506 3300025940 Bacteria 2314
641 Ga0207691_10138922 3300025940 Bacteria 2142
642 Ga0207691_10344927 3300025940 Bacteria 1274
643 Ga0207689_10001966 3300025942 Bacteria 19411
644 Ga0207689_10003756 3300025942 Bacteria 13835
645 Ga0207689_10008218 3300025942 Bacteria 9094
646 Ga0207689_10010467 3300025942 Bacteria 7988
647 Ga0207689_10018291 3300025942 Bacteria 5914
648 Ga0207689_10018417 3300025942 Bacteria 5892
649 Ga0207689_10026108 3300025942 Bacteria 4891
650 Ga0207689_10032751 3300025942 Bacteria 4321
651 Ga0207689_10155145 3300025942 Unclassified 1887
652 Ga0207689_10570749 3300025942 Bacteria 951
653 Ga0207661_10046137 3300025944 Bacteria 3454
654 Ga0207661_10151429 3300025944 Bacteria 2005
655 Ga0207661_10176161 3300025944 Bacteria 1865
656 Ga0207679_10001677 3300025945 Bacteria 13793
657 Ga0207679_10011282 3300025945 Bacteria 5779
658 Ga0207679_10385025 3300025945 Bacteria 1230
659 Ga0207679_10543041 3300025945 Bacteria 1042
660 Ga0207667_10004780 3300025949 Bacteria 16560
661 Ga0207667_10005051 3300025949 Bacteria 16114
662 Ga0207667_10024155 3300025949 Bacteria 6679
663 Ga0207667_10035134 3300025949 Bacteria 5378
664 Ga0207667_10035973 3300025949 Bacteria 5310
665 Ga0207667_10762084 3300025949 Bacteria 966
666 Ga0207651_10000190 3300025960 Bacteria 26708
667 Ga0207651_10154886 3300025960 Bacteria 1789
668 Ga0207651_10203249 3300025960 Unclassified 1589
669 Ga0207651_10250917 3300025960 Bacteria 1448
670 Ga0207651_10258081 3300025960 Bacteria 1429
671 Ga0207712_10014998 3300025961 Bacteria 4993
672 Ga0207712_10032303 3300025961 Bacteria 3533
673 Ga0207712_10045084 3300025961 Bacteria 3052
674 Ga0207712_10062100 3300025961 Unclassified 2654
675 Ga0207712_10132946 3300025961 Bacteria 1898
676 Ga0207712_10225630 3300025961 Bacteria 1500
677 Ga0207712_10266743 3300025961 Bacteria 1391
678 Ga0207712_10365795 3300025961 Unclassified 1203
679 Ga0207712_10412282 3300025961 Bacteria 1138
680 Ga0207668_10012446 3300025972 Bacteria 5208
681 Ga0207668_10421421 3300025972 Bacteria 1133
682 Ga0207640_10021295 3300025981 Bacteria 3863
683 Ga0207640_10057686 3300025981 Unclassified 2555
684 Ga0207640_10064402 3300025981 Bacteria 2440
685 Ga0207640_10126770 3300025981 Bacteria 1839
686 Ga0207640_10580324 3300025981 Unclassified 946
687 Ga0207658_10000176 3300025986 Bacteria 68501
688 Ga0207658_10031222 3300025986 Bacteria 3781
689 Ga0207658_10033227 3300025986 Bacteria 3679
690 Ga0207658_10155566 3300025986 Bacteria 1868
691 Ga0207658_10296265 3300025986 Bacteria 1392
692 Ga0207677_10005124 3300026023 Bacteria 7090
693 Ga0207677_10107854 3300026023 Bacteria 2066
694 Ga0207677_10282990 3300026023 Bacteria 1362
695 Ga0207677_10292051 3300026023 Bacteria 1343
696 Ga0207677_10324851 3300026023 Unclassified 1280
697 Ga0207703_10000433 3300026035 Bacteria 44015
698 Ga0207703_10036338 3300026035 Bacteria 3921
699 Ga0207703_10187141 3300026035 Bacteria 1831
700 Ga0207639_10028406 3300026041 Bacteria 4083
701 Ga0207639_10029884 3300026041 Bacteria 3994
702 Ga0207639_10035919 3300026041 Bacteria 3669
703 Ga0207639_10104095 3300026041 Bacteria 2301
704 Ga0207639_10111906 3300026041 Bacteria 2227
705 Ga0207639_10118486 3300026041 Bacteria 2171
706 Ga0207639_10143323 3300026041 Bacteria 1993
707 Ga0207639_10224074 3300026041 Bacteria 1626
708 Ga0207639_10316101 3300026041 Bacteria 1385
709 Ga0207678_10088678 3300026067 Bacteria 2644
710 Ga0207702_10041909 3300026078 Bacteria 3839
711 Ga0207702_10062526 3300026078 Bacteria 3180
712 Ga0207702_10139589 3300026078 Bacteria 2191
713 Ga0207641_10000048 3300026088 Bacteria 178206
714 Ga0207641_10000601 3300026088 Bacteria 39530
715 Ga0207641_10002006 3300026088 Bacteria 19406
716 Ga0207641_10037149 3300026088 Bacteria 4067
717 Ga0207641_10037593 3300026088 Bacteria 4044
718 Ga0207641_10142918 3300026088 Bacteria 2161
719 Ga0207641_10220204 3300026088 Bacteria 1760
720 Ga0207641_10289879 3300026088 Bacteria 1542
721 Ga0207641_10805310 3300026088 Bacteria 929
722 Ga0207648_10006817 3300026089 Bacteria 11319
723 Ga0207648_10020665 3300026089 Bacteria 5927
724 Ga0207648_10028862 3300026089 Bacteria 4917
725 Ga0207648_10067423 3300026089 Bacteria 3119
726 Ga0207648_10273293 3300026089 Bacteria 1510
727 Ga0207676_10001236 3300026095 Bacteria 19009
728 Ga0207676_10044893 3300026095 Unclassified 3411
729 Ga0207676_10093368 3300026095 Bacteria 2477
730 Ga0207676_10196680 3300026095 Bacteria 1778
731 Ga0207676_10197912 3300026095 Bacteria 1773
732 Ga0207676_10225999 3300026095 Bacteria 1670
733 Ga0207676_10464196 3300026095 Bacteria 1196
734 Ga0207676_10680237 3300026095 Bacteria 995
735 Ga0207674_10007789 3300026116 Bacteria 12460
736 Ga0207674_10015679 3300026116 Bacteria 8319
737 Ga0207674_10106874 3300026116 Bacteria 2775
738 Ga0207674_10111062 3300026116 Bacteria 2716
739 Ga0207675_100007107 3300026118 Bacteria 10580
740 Ga0207675_100038046 3300026118 Bacteria 4490
741 Ga0207675_100130205 3300026118 Bacteria 2385
742 Ga0207683_10008436 3300026121 Bacteria 8820
743 Ga0207683_10013033 3300026121 Bacteria 7095
744 Ga0207683_10152583 3300026121 Bacteria 2085
745 Ga0207698_10021707 3300026142 Bacteria 4447
746 Ga0207698_10026986 3300026142 Bacteria 4071
747 Ga0207698_10049049 3300026142 Bacteria 3210
748 Ga0207698_10132979 3300026142 Bacteria 2129
749 Ga0207698_10257712 3300026142 Bacteria 1600
750 Ga0207698_10323409 3300026142 Bacteria 1445
751 Ga0207698_10372766 3300026142 Bacteria 1355
752 Ga0207698_10454248 3300026142 Unclassified 1237
753 Ga0207698_10456237 3300026142 Bacteria 1235
754 Ga0210000_1022266 3300027462 Bacteria 972
755 Ga0209995_1005032 3300027471 Unclassified 2122
756 Ga0268266_10000024 3300028379 Bacteria 490820
757 Ga0268266_10007977 3300028379 Bacteria 9463
758 Ga0268266_10013344 3300028379 Bacteria 7078
759 Ga0268265_10087313 3300028380 Bacteria 2481
760 Ga0268265_10226556 3300028380 Bacteria 1640
761 Ga0268264_10000109 3300028381 Bacteria 208477
762 Ga0268264_10001271 3300028381 Bacteria 23942
763 Ga0268264_10001954 3300028381 Bacteria 18515
764 Ga0268264_10004274 3300028381 Bacteria 12193
765 Ga0268264_10060376 3300028381 Bacteria 3178
766 Ga0265318_10005180 3300028577 Bacteria 6156
767 Ga0265323_10000975 3300028653 Bacteria 14931
768 Ga0307517_10006013 3300028786 Bacteria 18085
769 Ga0307517_10088779 3300028786 Bacteria 2552
770 Ga0307515_10000002 3300028794 Bacteria 1231751
771 Ga0307515_10000072 3300028794 Bacteria 237798
772 Ga0307515_10249372 3300028794 Bacteria 1531
773 Ga0265338_10000319 3300028800 Bacteria 87159
774 Ga0265338_10128534 3300028800 Bacteria 2006
775 Ga0307511_10004747 3300030521 Bacteria 13895
776 Ga0316177_1057164 3300030731 Bacteria 9539
777 Ga0316176_1020373 3300030732 Bacteria 27096
778 Ga0316183_1111132 3300030742 Bacteria 56687
779 Ga0316181_1134699 3300030744 Bacteria 10028
780 Ga0316182_1300351 3300030745 Bacteria 1293
781 Ga0265332_10002898 3300031238 Bacteria 8474
782 Ga0265325_10086235 3300031241 Bacteria 1554
783 Ga0265340_10126731 3300031247 Bacteria 1173
784 Ga0265339_10051425 3300031249 Bacteria 2248
785 Ga0265331_10007182 3300031250 Bacteria 6475
786 Ga0265327_10000093 3300031251 Bacteria 195220
787 Ga0265327_10000148 3300031251 Bacteria 151952
788 Ga0265327_10105839 3300031251 Bacteria 1351
789 Ga0265316_10000618 3300031344 Bacteria 39590
790 Ga0265316_10001145 3300031344 Bacteria 28776
791 Ga0265316_10005421 3300031344 Bacteria 12395
792 Ga0307509_10025075 3300031507 Bacteria 6666
793 Ga0307408_100000305 3300031548 Bacteria 47032
794 Ga0307508_10001286 3300031616 Bacteria 28488
795 Ga0316579_10068300 3300031691 Bacteria 1681
796 Ga0265314_10058229 3300031711 Bacteria 2648
797 Ga0265342_10016089 3300031712 Bacteria 4898
798 Ga0316576_10099200 3300031727 Bacteria 2175
799 Ga0316576_10146162 3300031727 Bacteria 1781
800 Ga0316578_10110364 3300031728 Bacteria 1652
801 Ga0307405_10000010 3300031731 Bacteria 250978
802 Ga0316577_10099416 3300031733 Unclassified 1630
803 Ga0307410_10140025 3300031852 Unclassified 1789
804 Ga0307407_10000042 3300031903 Bacteria 65025
805 Ga0307412_10000077 3300031911 Bacteria 96375
806 Ga0307412_10003261 3300031911 Bacteria 9011
807 Ga0307416_100000019 3300032002 Bacteria 199706
808 Ga0307414_10002825 3300032004 Bacteria 9156
809 Ga0307414_10011145 3300032004 Bacteria 5259
810 Ga0307414_10054109 3300032004 Bacteria 2803
811 Ga0307414_10055748 3300032004 Bacteria 2769
812 Ga0307414_10491851 3300032004 Bacteria 1084
813 Ga0307414_10634722 3300032004 Bacteria 961
814 Ga0316585_10019775 3300032137 Bacteria 2056
815 Ga0373946_0212995 3300035171 Bacteria 930
816 Ga0373955_0039844 3300035172 Bacteria 2510
817 Ga0316574_0132073 3300035398 Bacteria 1607
818 Ga0373924_0007228 3300035410 Bacteria 4003
819 Ga0373933_0062270 3300035724 Bacteria 2253
820 Ga0373947_0021674 3300035725 Bacteria 3721
821 Ga0373947_0058903 3300035725 Bacteria 2328
822 Ga0373937_0005153 3300036401 Bacteria 11144
823 Ga0373937_0168582 3300036401 Bacteria 2054
824 Ga0316582_0053693 3300036647 Bacteria 2564
825 Ga0316584_0001570 3300036712 Bacteria 13862
826 Ga0316584_0005044 3300036712 Bacteria 8799
827 Ga0395899_0003607 3300037312 Bacteria 12242
828 Ga0395899_0180455 3300037312 Bacteria 1482
829 Ga0395900_0016503 3300037418 Bacteria 7532
830 Ga0395900_0046549 3300037418 Bacteria 4467
831 Ga0395900_0109393 3300037418 Bacteria 2839
832 Ga0395900_0321332 3300037418 Bacteria 1528
833 Ga0395900_0337680 3300037418 Bacteria 1483
834 Ga0395900_0814931 3300037418 Bacteria 861
835 Ga0395898_0001425 3300037466 Bacteria 34011
836 Ga0395898_0071097 3300037466 Unclassified 3363
837 Ga0395905_0000003 3300037471 Bacteria 1347396
838 Ga0395905_0073040 3300037471 Bacteria 3215
839 Ga0395905_0092206 3300037471 Bacteria 2841
840 Ga0395901_0006414 3300038443 Bacteria 11920
841 Ga0395901_0329352 3300038443 Bacteria 1579
842 Ga0400488_57128 3300038741 Bacteria 1089
843 Ga0400483_094790 3300039062 Bacteria 31668
844 Ga0400489_27519 3300039093 Bacteria 3718
845 Ga0436365_0480954 3300039437 Bacteria 25378
846 Ga0436365_0785409 3300039437 Bacteria 17126
847 Ga0439436_0013332 3300041404 Bacteria 2486
848 Ga0439465_0063206 3300041413 Bacteria 1229
849 Ga0451795_0125519 3300041456 Bacteria 1716
850 Ga0451843_1146337 3300041509 Bacteria 1367
851 Ga0451855_0550985 3300041511 Bacteria 2393
852 Ga0439431_0004736 3300041997 Bacteria 2994
853 Ga0439431_0035757 3300041997 Bacteria 1249
854 Ga0439449_0118971 3300042007 Bacteria 980
855 Ga0439457_001586 3300042014 Bacteria 6789
856 Ga0439462_0023582 3300042015 Bacteria 1613
857 Ga0451577_0000754 3300042876 Bacteria 49345
858 Ga0451577_0010712 3300042876 Bacteria 8730
859 Ga0451577_0038696 3300042876 Bacteria 4289
860 Ga0451577_0043507 3300042876 Bacteria 4023
861 Ga0451577_0053904 3300042876 Bacteria 3590
862 Ga0451577_0090796 3300042876 Unclassified 2726
863 Ga0451577_0153065 3300042876 Bacteria 2075
864 Ga0451577_0252122 3300042876 Bacteria 1598
865 Ga0451577_0400323 3300042876 Bacteria 1246
866 Ga0451577_0604840 3300042876 Bacteria 995
867 Ga0451577_0640499 3300042876 Bacteria 964
868 Ga0466969_0000665 3300044656 Bacteria 18684
869 Ga0466972_0000013 3300044658 Bacteria 229345
870 Ga0466972_0000064 3300044658 Bacteria 104558
871 Ga0466972_0000347 3300044658 Bacteria 25337
872 Ga0466972_0032268 3300044658 Bacteria 2572
873 Ga0466972_0058744 3300044658 Bacteria 1846
874 Ga0453683_0000227 3300044673 Bacteria 75124
875 Ga0453683_0001274 3300044673 Bacteria 22351
876 Ga0453683_0116716 3300044673 Bacteria 1679
877 Ga0466965_0028230 3300044683 Bacteria 2726
878 Ga0466966_0000806 3300044684 Bacteria 19961
879 Ga0453684_0000724 3300044712 Bacteria 116382
880 Ga0453684_0001194 3300044712 Bacteria 80254
881 Ga0453684_0001431 3300044712 Bacteria 68233
882 Ga0453684_0002120 3300044712 Bacteria 49982
883 Ga0453684_0004008 3300044712 Bacteria 32105
884 Ga0453684_0004378 3300044712 Bacteria 29932
885 Ga0453684_0004818 3300044712 Bacteria 27744
886 Ga0453684_0007236 3300044712 Bacteria 20571
887 Ga0453684_0019698 3300044712 Bacteria 10244
888 Ga0453684_0024450 3300044712 Bacteria 8828
889 Ga0453684_0040458 3300044712 Bacteria 6329
890 Ga0453684_0041364 3300044712 Bacteria 6235
891 Ga0453684_0047360 3300044712 Bacteria 5703
892 Ga0453684_0050218 3300044712 Bacteria 5490
893 Ga0453684_0064241 3300044712 Bacteria 4689
894 Ga0453684_0071263 3300044712 Bacteria 4395
895 Ga0453684_0096856 3300044712 Bacteria 3623
896 Ga0453684_0143346 3300044712 Unclassified 2849
897 Ga0453684_0144695 3300044712 Bacteria 2833
898 Ga0453684_0179836 3300044712 Bacteria 2484
899 Ga0453684_0189010 3300044712 Unclassified 2410
900 Ga0453684_0262231 3300044712 Bacteria 1979
901 Ga0453684_0275112 3300044712 Bacteria 1922
902 Ga0453684_0315998 3300044712 Bacteria 1770
903 Ga0453684_0469802 3300044712 Bacteria 1397
904 Ga0453684_0707475 3300044712 Unclassified 1094
905 Ga0453684_0858102 3300044712 Bacteria 975
906 Ga0466968_0010784 3300044735 Bacteria 3550
907 Ga0466970_0000094 3300044765 Bacteria 37832
908 Ga0466970_0028240 3300044765 Bacteria 2947
909 Ga0466957_0000070 3300044842 Bacteria 39824
910 Ga0466957_0009587 3300044842 Bacteria 5530
911 Ga0466959_0000023 3300045049 Bacteria 124545
912 Ga0466959_0071946 3300045049 Bacteria 2503
913 Ga0451576_0001102 3300045051 Bacteria 49331
914 Ga0451576_0002021 3300045051 Bacteria 32067
915 Ga0451576_0005479 3300045051 Bacteria 15888
916 Ga0451576_0042016 3300045051 Bacteria 4827
917 Ga0451576_0074409 3300045051 Bacteria 3535
918 Ga0451576_0108417 3300045051 Bacteria 2889
919 Ga0451576_0190156 3300045051 Unclassified 2144
920 Ga0451576_0198816 3300045051 Unclassified 2094
921 Ga0451576_0207112 3300045051 Bacteria 2048
922 Ga0451576_0797954 3300045051 Bacteria 991
923 Ga0466967_0059978 3300045976 Bacteria 3370
924 Ga0495627_001544 3300046453 Bacteria 13158
925 Ga0495627_089317 3300046453 Bacteria 887
926 Ga0495638_0116054 3300046460 Bacteria 1586
927 Ga0495653_0112063 3300046463 Bacteria 1959
928 Ga0495650_0067874 3300046471 Unclassified 1408
929 Ga0495580_0143758 3300046472 Bacteria 1653
930 Ga0495580_0253227 3300046472 Bacteria 1205
931 Ga0495582_0087882 3300046473 Bacteria 1731
932 Ga0495662_0142510 3300046476 Bacteria 1180
933 Ga0495606_0005411 3300046507 Bacteria 12235
934 Ga0495610_0001760 3300046512 Bacteria 18954
935 Ga0495610_0003107 3300046512 Bacteria 13229
936 Ga0495618_0012660 3300046514 Bacteria 5125
937 Ga0495630_0021010 3300046517 Bacteria 4819
938 Ga0495632_0092237 3300046519 Bacteria 1435
939 Ga0495648_0006590 3300046524 Bacteria 9440
940 Ga0495586_0048106 3300046535 Unclassified 2304
941 Ga0495586_0123057 3300046535 Bacteria 1450
942 Ga0495587_0118595 3300046536 Unclassified 1516
943 Ga0495633_0000154 3300046558 Bacteria 90209
944 Ga0495667_0068369 3300046559 Unclassified 2320
945 Ga0495668_0000191 3300046616 Bacteria 90923
946 Ga0495668_0000361 3300046616 Bacteria 60120
947 Ga0495668_0002342 3300046616 Bacteria 15781
948 Ga0495634_0052705 3300046642 Bacteria 2727
949 Ga0495634_0304744 3300046642 Bacteria 962
950 Ga0495611_0000252 3300046648 Bacteria 36998
951 Ga0495611_0025805 3300046648 Bacteria 2563
952 Ga0495658_0036056 3300046683 Bacteria 2726
953 Ga0495670_0078629 3300046691 Bacteria 1678
954 Ga0495600_0094655 3300046809 Bacteria 1948
955 Ga0495636_0000049 3300047318 Bacteria 51760
956 Ga0495674_0012090 3300047319 Bacteria 8134
957 Ga0495672_0031702 3300047320 Bacteria 3298
958 Ga0495672_0047219 3300047320 Bacteria 2562
959 Ga0495672_0120137 3300047320 Bacteria 1398
960 Ga0495676_0081222 3300047321 Bacteria 2458
961 Ga0495676_0315195 3300047321 Bacteria 1052
962 Ga0495687_000014 3300047443 Bacteria 366896
963 Ga0495686_0000034 3300047472 Bacteria 325038
964 Ga0495686_0001210 3300047472 Bacteria 29692
965 Ga0495686_0031850 3300047472 Bacteria 3416
966 Ga0495686_0126490 3300047472 Bacteria 1519
967 Ga0495686_0148618 3300047472 Bacteria 1377
968 Ga0496101_0028716 3300048904 Bacteria 3886
969 Ga0496105_0353723 3300048908 Unclassified 1173
970 Ga0496106_0343792 3300048909 Bacteria 1198
971 Ga0496108_0286981 3300048911 Bacteria 1433
972 Ga0496109_0159922 3300048912 Bacteria 2110
973 Ga0496109_0494019 3300048912 Bacteria 1155
974 Ga0496110_0543207 3300048913 Bacteria 1056
975 Ga0496115_0025603 3300048918 Bacteria 4595
976 Ga0496115_0369102 3300048918 Unclassified 1168
977 Ga0496116_0001546 3300048919 Bacteria 25478
978 Ga0496117_0007089 3300048920 Bacteria 11078
979 Ga0496118_0195100 3300048921 Bacteria 1206
980 Ga0496121_0000020 3300048924 Bacteria 498732
981 Ga0496122_0000746 3300048925 Bacteria 63466
982 Ga0496122_0008031 3300048925 Bacteria 11521
983 Ga0496123_0030182 3300048926 Bacteria 3972
984 Ga0496123_0096201 3300048926 Bacteria 1739
985 Ga0496124_0028833 3300048927 Bacteria 4958
986 Ga0496124_0113530 3300048927 Bacteria 2177
987 Ga0496125_0211980 3300048928 Bacteria 1257
988 Ga0496126_0003667 3300048929 Bacteria 19179
989 Ga0501031_0008920 3300049568 Bacteria 6520
990 Ga0501032_0006744 3300049569 Bacteria 8429
991 Ga0501032_0056211 3300049569 Bacteria 2646
992 Ga0501033_0035991 3300049570 Bacteria 3711
993 Ga0501033_0062187 3300049570 Bacteria 2750
994 Ga0501033_0176559 3300049570 Bacteria 1532
995 Ga0501034_0000399 3300049571 Bacteria 73348
996 Ga0501034_0007132 3300049571 Bacteria 11922
997 Ga0501034_0027512 3300049571 Bacteria 5785
998 Ga0501034_0034359 3300049571 Bacteria 5139
999 Ga0501034_0078744 3300049571 Bacteria 3299
1000 Ga0501034_0095890 3300049571 Bacteria 2962
1001 Ga0501034_0114355 3300049571 Bacteria 2687
1002 Ga0501034_0155149 3300049571 Bacteria 2264
1003 Ga0501034_0315125 3300049571 Bacteria 1498
1004 Ga0501034_0316000 3300049571 Bacteria 1495
1005 Ga0501036_0021107 3300049572 Bacteria 5471
1006 Ga0501036_0031265 3300049572 Bacteria 4498
1007 Ga0501036_0031936 3300049572 Bacteria 4448
1008 Ga0501037_0004614 3300049573 Bacteria 10014
1009 Ga0501037_0037569 3300049573 Bacteria 3570
1010 Ga0501038_0008621 3300049574 Bacteria 9360
1011 Ga0501038_0009237 3300049574 Bacteria 9047
1012 Ga0501038_0014450 3300049574 Bacteria 7196
1013 Ga0501039_0082895 3300049575 Bacteria 2497
1014 Ga0501039_0083623 3300049575 Bacteria 2485
1015 Ga0501043_0006099 3300049579 Bacteria 9683
1016 Ga0501043_0011618 3300049579 Bacteria 6893
1017 Ga0501043_0033806 3300049579 Bacteria 4023
1018 Ga0501043_0072677 3300049579 Bacteria 2702
1019 Ga0501043_0076043 3300049579 Bacteria 2638
1020 Ga0501043_0362232 3300049579 Bacteria 1100
1021 Ga0501046_0007340 3300049580 Bacteria 9697
1022 Ga0501047_0021899 3300049581 Bacteria 6136
1023 Ga0501047_0040807 3300049581 Bacteria 4487
1024 Ga0501047_0049782 3300049581 Bacteria 4045
1025 Ga0501047_0054822 3300049581 Bacteria 3856
1026 Ga0501047_0204429 3300049581 Bacteria 1835
1027 Ga0501048_0116127 3300049582 Bacteria 1891
1028 Ga0501067_0009624 3300049583 Bacteria 5352
1029 Ga0501067_0039532 3300049583 Bacteria 2619
1030 Ga0501068_0162628 3300049584 Bacteria 1407
1031 Ga0501070_0083168 3300049586 Bacteria 2650
1032 Ga0501071_0202825 3300049587 Bacteria 1490
1033 Ga0501073_0001901 3300049589 Bacteria 15565
1034 Ga0501073_0081407 3300049589 Bacteria 2252
1035 Ga0501074_0001080 3300049590 Bacteria 17807
1036 Ga0501202_000051 3300049652 Bacteria 12160
1037 Ga0501202_005033 3300049652 Bacteria 2331
1038 Ga0501216_020232 3300049660 Bacteria 1161
1039 Ga0501217_022286 3300049661 Bacteria 1501
1040 Ga0501223_003413 3300049663 Bacteria 3464
1041 Ga0501223_004449 3300049663 Bacteria 3000
1042 Ga0501240_016844 3300049673 Bacteria 1056
1043 Ga0501257_001076 3300049686 Bacteria 5535
1044 Ga0501259_000915 3300049688 Bacteria 4868
1045 Ga0501219_000752 3300049703 Bacteria 4382
1046 Ga0501225_0011343 3300049705 Bacteria 2508
1047 Ga0501245_002468 3300049708 Bacteria 2471
1048 Ga0501079_0200118 3300049741 Bacteria 1560
1049 Ga0501080_0033602 3300049742 Bacteria 4787
1050 Ga0501080_0133390 3300049742 Bacteria 2299
1051 Ga0501083_0008410 3300049744 Bacteria 7296
1052 Ga0501083_0014634 3300049744 Bacteria 5484
1053 Ga0501241_000580 3300049758 Bacteria 7859
1054 Ga0501266_004672 3300049763 Bacteria 1701
1055 Ga0501035_0015725 3300049822 Bacteria 6984
1056 Ga0501035_0017194 3300049822 Bacteria 6666
1057 Ga0501035_0023744 3300049822 Bacteria 5626
1058 Ga0501035_0135363 3300049822 Bacteria 2146
1059 Ga0501035_0360903 3300049822 Bacteria 1214
1060 Ga0501035_0540226 3300049822 Bacteria 956
1061 Ga0501044_0003839 3300049823 Bacteria 16859
1062 Ga0501044_0008687 3300049823 Bacteria 11117
1063 Ga0501044_0009313 3300049823 Bacteria 10716
1064 Ga0501044_0018183 3300049823 Bacteria 7540
1065 Ga0501044_0067496 3300049823 Bacteria 3644
1066 Ga0501044_0077352 3300049823 Bacteria 3375
1067 Ga0501044_0165444 3300049823 Unclassified 2186
1068 Ga0501044_0389642 3300049823 Bacteria 1307
1069 Ga0501044_0403448 3300049823 Bacteria 1279
1070 Ga0501284_00019 3300050005 Bacteria 92576
1071 nmdc:mga0k408_7375_c1 3300050493 Bacteria 5871
1072 nmdc:mga05p37_288459_c1 3300050507 Bacteria 1954
1073 nmdc:mga05p37_3288_c1 3300050507 Bacteria 18845
1074 nmdc:mga05p37_70934_c1 3300050507 Bacteria 4285
1075 nmdc:mga09592_108348_c1 3300050508 Unclassified 2383
1076 nmdc:mga08y16_160301_c1 3300050511 Bacteria 2337
1077 nmdc:mga08y16_22514_c1 3300050511 Bacteria 6652
1078 nmdc:mga08y16_511295_c1 3300050511 Bacteria 1219
1079 nmdc:mga08y16_783501_c1 3300050511 Bacteria 947
1080 Ga0495601_0179435 3300053077 Bacteria 1385
1081 Ga0500578_0000150 3300053086 Bacteria 83541
1082 Ga0500644_0000108 3300053088 Bacteria 52348
1083 Ga0500646_0000820 3300053090 Bacteria 8616
1084 Ga0500583_0000108 3300053092 Bacteria 41760
1085 Ga0500583_0002339 3300053092 Bacteria 5674
1086 Ga0500583_0004734 3300053092 Bacteria 4476
1087 Ga0500651_0000127 3300053093 Bacteria 47010
1088 Ga0500594_0008751 3300053118 Bacteria 2315
1089 Ga0500594_0041262 3300053118 Bacteria 1263
1090 Ga0500607_081521 3300053121 Bacteria 1649
1091 Ga0500642_0003779 3300053130 Bacteria 4635
1092 Ga0500642_0034331 3300053130 Bacteria 2145
1093 Ga0500652_011727 3300053131 Bacteria 3048
1094 Ga0500658_0005805 3300053134 Bacteria 4598
1095 Ga0500568_0000789 3300053139 Bacteria 22357
1096 Ga0500577_0008558 3300053142 Bacteria 2925
1097 Ga0500590_042656 3300053148 Bacteria 2329
1098 Ga0500603_068004 3300053150 Unclassified 1010
1099 Ga0500604_0000484 3300053151 Bacteria 10975
1100 Ga0500616_0001887 3300053153 Bacteria 18863
1101 Ga0500616_0013004 3300053153 Bacteria 4847
1102 Ga0500616_0075315 3300053153 Bacteria 1709
1103 Ga0500616_0104336 3300053153 Bacteria 1380
1104 Ga0500622_0000077 3300053156 Bacteria 108558
1105 Ga0500622_0000304 3300053156 Bacteria 50299
1106 Ga0500622_0007889 3300053156 Bacteria 5994
1107 Ga0500622_0008720 3300053156 Bacteria 5655
1108 Ga0500622_0023113 3300053156 Bacteria 3294
1109 Ga0500633_0006718 3300053160 Bacteria 2842
1110 Ga0500634_0015518 3300053161 Bacteria 4047
1111 Ga0500636_0002666 3300053177 Bacteria 9922
1112 Ga0500637_0157527 3300053178 Bacteria 1310
1113 Ga0500645_004553 3300053730 Bacteria 5286
1114 Ga0501084_0069145 3300054114 Bacteria 2956
1115 Ga0501084_0307219 3300054114 Bacteria 1339
1116 Ga0500661_005721 3300055283 Bacteria 2317
1117 Ga0501082_0366013 3300060353 Bacteria 1258
1118 Ga0466962_0136586 3300061719 Bacteria 1187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005618 Ga0068864_100038495 Ga0068864_1000384952 249
2 3300026095 Ga0207676_10197912 Ga0207676_101979122 249
3 3300003320 rootH2_10125569 rootH2_101255695 256
4 3300049581 Ga0501047_0049782 Ga0501047_0049782_529_1368 257
5 3300006844 Ga0075428_100359180 Ga0075428_1003591801 261
6 3300006847 Ga0075431_100048281 Ga0075431_1000482814 261
7 3300009093 Ga0105240_10000020 Ga0105240_10000020247 261
8 3300050507 nmdc:mga05p37_70934_c1 nmdc:mga05p37_70934_c1_2020_2940 261
9 3300028577 Ga0265318_10005180 Ga0265318_100051805 262
10 3300028800 Ga0265338_10128534 Ga0265338_101285342 262
11 3300031238 Ga0265332_10002898 Ga0265332_100028989 262
12 3300031241 Ga0265325_10086235 Ga0265325_100862352 262
13 3300031247 Ga0265340_10126731 Ga0265340_101267312 262
14 3300031249 Ga0265339_10051425 Ga0265339_100514252 262
15 3300031250 Ga0265331_10007182 Ga0265331_100071826 262
16 3300031344 Ga0265316_10005421 Ga0265316_1000542111 262
17 3300031711 Ga0265314_10058229 Ga0265314_100582292 262
18 3300031712 Ga0265342_10016089 Ga0265342_100160894 262
19 3300031728 Ga0316578_10110364 Ga0316578_101103642 262
20 3300031691 Ga0316579_10068300 Ga0316579_100683001 263
21 3300032137 Ga0316585_10019775 Ga0316585_100197752 263
22 3300036647 Ga0316582_0053693 Ga0316582_0053693_368_1171 263
23 3300036712 Ga0316584_0001570 Ga0316584_0001570_10088_10891 263
24 iso_pu_bacteria 2895498888 2895502712 264
25 3300038741 Ga0400488_57128 Ga0400488_57128_23_838 265
26 3300039062 Ga0400483_094790 Ga0400483_094790_6831_7646 265
27 iso_pu_bacteria 2839989709 2839991192 265
28 iso_pu_bacteria 2840677318 2840677545 265
29 iso_pu_bacteria 2896085136 2896085363 265
30 iso_pu_bacteria 2910245624 2910247133 265
31 3300041456 Ga0451795_0125519 Ga0451795_0125519_577_1377 266
32 3300042876 Ga0451577_0000754 Ga0451577_0000754_9013_9819 266
33 3300042876 Ga0451577_0010712 Ga0451577_0010712_1211_2017 266
34 3300042876 Ga0451577_0090796 Ga0451577_0090796_575_1381 266
35 3300042876 Ga0451577_0153065 Ga0451577_0153065_980_1786 266
36 3300042876 Ga0451577_0640499 Ga0451577_0640499_45_854 266
37 3300044673 Ga0453683_0000227 Ga0453683_0000227_9860_10666 266
38 3300044673 Ga0453683_0001274 Ga0453683_0001274_8100_8906 266
39 3300044673 Ga0453683_0116716 Ga0453683_0116716_343_1149 266
40 3300044712 Ga0453684_0001194 Ga0453684_0001194_6590_7396 266
41 3300044712 Ga0453684_0001431 Ga0453684_0001431_51073_51879 266
42 3300044712 Ga0453684_0002120 Ga0453684_0002120_9013_9819 266
43 3300044712 Ga0453684_0004008 Ga0453684_0004008_11571_12377 266
44 3300044712 Ga0453684_0040458 Ga0453684_0040458_559_1365 266
45 3300044712 Ga0453684_0064241 Ga0453684_0064241_1023_1829 266
46 3300044712 Ga0453684_0144695 Ga0453684_0144695_1183_1989 266
47 3300045051 Ga0451576_0001102 Ga0451576_0001102_9007_9813 266
48 3300045051 Ga0451576_0002021 Ga0451576_0002021_11574_12380 266
49 3300045051 Ga0451576_0074409 Ga0451576_0074409_1301_2107 266
50 3300045051 Ga0451576_0108417 Ga0451576_0108417_466_1275 266
51 iso_pu_bacteria 2585427687 2586207414 266
52 iso_pu_bacteria 2738541302 2738854005 266
53 iso_pu_bacteria 2739367651 2739588605 266
54 iso_pu_bacteria 2739367656 2739615900 266
55 iso_pu_bacteria 2739367663 2739644991 266
56 iso_pu_bacteria 2818991437 2819548144 266
57 iso_pu_bacteria 2842722452 2842723742 266
58 iso_pu_bacteria 2842909656 2842910248 266
59 iso_pu_bacteria 2849281842 2849284297 266
60 iso_pu_bacteria 2896109856 2896113539 266
61 iso_pu_bacteria 2904445276 2904445700 266
62 iso_pu_bacteria 2945997725 2946000602 266
63 iso_pu_bacteria 2954016120 2954017484 266
64 3300028800 Ga0265338_10000319 Ga0265338_1000031970 267
65 3300044712 Ga0453684_0007236 Ga0453684_0007236_11154_11975 267
66 3300044712 Ga0453684_0262231 Ga0453684_0262231_202_1020 267
67 3300045051 Ga0451576_0198816 Ga0451576_0198816_387_1205 267
68 3300045051 Ga0451576_0207112 Ga0451576_0207112_526_1344 267
69 iso_pu_bacteria 2721755487 2722728749 267
70 iso_pu_bacteria 2738541283 2738755049 267
71 iso_pu_bacteria 2738541284 2738760984 267
72 iso_pu_bacteria 2738543023 2739301203 267
73 iso_pu_bacteria 2775506987 2776613170 267
74 iso_pu_bacteria 2842903701 2842906612 267
75 iso_pu_bacteria 2852627209 2852631320 267
76 iso_pu_bacteria 2884791551 2884798168 267
77 iso_pu_bacteria 2890737413 2890738542 267
78 iso_pu_bacteria 2896317667 2896318366 267
79 iso_pu_bacteria 2896344016 2896345961 267
80 iso_pu_bacteria 2898713307 2898714981 267
81 iso_pu_bacteria 2904780799 2904784262 267
82 iso_pu_bacteria 2919177583 2919179114 267
83 iso_pu_bacteria 2919186247 2919187241 267
84 iso_pu_bacteria 2929177148 2929182751 267
85 iso_pu_bacteria 2929921140 2929923463 267
86 iso_pu_bacteria 2939664404 2939665490 267
87 iso_pu_bacteria 2945977869 2945978704 267
88 iso_pu_bacteria 2946013367 2946015428 267
89 iso_pu_bacteria 8003151029 8003152865 267
90 iso_pu_bacteria 8055588893 8055589358 267
91 3300003322 rootL2_10106122 rootL2_101061222 268
92 3300010375 Ga0105239_10123388 Ga0105239_101233882 268
93 3300041511 Ga0451855_0550985 Ga0451855_0550985_1310_2125 268
94 3300046616 Ga0495668_0000361 Ga0495668_0000361_18361_19173 268
95 3300047472 Ga0495686_0001210 Ga0495686_0001210_9168_9980 268
96 3300049570 Ga0501033_0176559 Ga0501033_0176559_189_1007 268
97 3300049571 Ga0501034_0078744 Ga0501034_0078744_1616_2434 268
98 3300049822 Ga0501035_0135363 Ga0501035_0135363_1254_2069 268
99 3300049823 Ga0501044_0008687 Ga0501044_0008687_1331_2149 268
100 3300049823 Ga0501044_0077352 Ga0501044_0077352_969_1784 268
101 3300049823 Ga0501044_0165444 Ga0501044_0165444_474_1301 268
102 3300053130 Ga0500642_0003779 Ga0500642_0003779_2618_3430 268
103 3300053153 Ga0500616_0001887 Ga0500616_0001887_8348_9163 268
104 2162886007 SwRhRL2b_contig_2043181 SwRhRL2b_0193.00004740 269
105 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007132 269
106 3300003215 JGI25153J46596_10014038 JGI25153J46596_100140382 269
107 3300003316 rootH1_10100877 rootH1_101008772 269
108 3300003320 rootH2_10086703 rootH2_100867032 269
109 3300003322 rootL2_10010003 rootL2_100100032 269
110 3300003322 rootL2_10013694 rootL2_100136941 269
111 3300003323 rootH1_10031210 rootH1_100312103 269
112 3300003323 rootH1_10067892 rootH1_100678921 269
113 3300003323 rootH1_10081850 rootH1_100818502 269
114 3300003354 JGI25160J50197_1001820 JGI25160J50197_10018205 269
115 3300003354 JGI25160J50197_1009684 JGI25160J50197_10096842 269
116 3300003762 Ga0055542_1005732 Ga0055542_10057324 269
117 3300003790 Ga0055528_1000164 Ga0055528_100016426 269
118 3300003791 Ga0055530_10002036 Ga0055530_100020368 269
119 3300003794 Ga0055531_10000020 Ga0055531_10000020140 269
120 3300005262 Ga0065165_1000010 Ga0065165_1000010133 269
121 3300005262 Ga0065165_1030900 Ga0065165_10309003 269
122 3300005289 Ga0065704_10070350 Ga0065704_100703508 269
123 3300005327 Ga0070658_10040671 Ga0070658_100406711 269
124 3300005327 Ga0070658_10227153 Ga0070658_102271531 269
125 3300005335 Ga0070666_10093615 Ga0070666_100936152 269
126 3300005337 Ga0070682_100000125 Ga0070682_10000012519 269
127 3300005339 Ga0070660_100087378 Ga0070660_1000873782 269
128 3300005355 Ga0070671_100006875 Ga0070671_1000068754 269
129 3300005459 Ga0068867_100042668 Ga0068867_1000426684 269
130 3300005530 Ga0070679_100114743 Ga0070679_1001147432 269
131 3300005548 Ga0070665_100000442 Ga0070665_1000004422 269
132 3300005564 Ga0070664_100154403 Ga0070664_1001544031 269
133 3300005578 Ga0068854_100058430 Ga0068854_1000584301 269
134 3300005578 Ga0068854_100092898 Ga0068854_1000928981 269
135 3300005578 Ga0068854_100447205 Ga0068854_1004472051 269
136 3300005843 Ga0068860_100078244 Ga0068860_1000782442 269
137 3300006195 Ga0075366_10057949 Ga0075366_100579492 269
138 3300006237 Ga0097621_100001588 Ga0097621_1000015881 269
139 3300006358 Ga0068871_100000415 Ga0068871_1000004153 269
140 3300009093 Ga0105240_10053213 Ga0105240_100532132 269
141 3300009176 Ga0105242_10744581 Ga0105242_107445811 269
142 3300009177 Ga0105248_10004754 Ga0105248_100047542 269
143 3300009553 Ga0105249_10018325 Ga0105249_100183255 269
144 3300010375 Ga0105239_10169435 Ga0105239_101694352 269
145 3300013104 Ga0157370_10043363 Ga0157370_100433632 269
146 3300013105 Ga0157369_10029590 Ga0157369_100295904 269
147 3300013296 Ga0157374_10470460 Ga0157374_104704602 269
148 3300013297 Ga0157378_10012427 Ga0157378_100124276 269
149 3300013306 Ga0163162_10000371 Ga0163162_1000037134 269
150 3300013306 Ga0163162_10002125 Ga0163162_1000212510 269
151 3300013306 Ga0163162_10044729 Ga0163162_100447292 269
152 3300013306 Ga0163162_10255070 Ga0163162_102550703 269
153 3300013306 Ga0163162_10836372 Ga0163162_108363722 269
154 3300013307 Ga0157372_10104649 Ga0157372_101046493 269
155 3300013307 Ga0157372_10290381 Ga0157372_102903812 269
156 3300013308 Ga0157375_10000553 Ga0157375_100005535 269
157 3300014325 Ga0163163_10000677 Ga0163163_1000067713 269
158 3300014968 Ga0157379_10045025 Ga0157379_100450251 269
159 3300014969 Ga0157376_10000491 Ga0157376_100004911 269
160 3300014969 Ga0157376_10098268 Ga0157376_100982682 269
161 3300015265 Ga0182005_1000131 Ga0182005_100013120 269
162 3300017792 Ga0163161_10030675 Ga0163161_100306754 269
163 3300021384 Ga0213876_10001070 Ga0213876_1000107014 269
164 3300025208 Ga0209436_102245 Ga0209436_1022454 269
165 3300025208 Ga0209436_103275 Ga0209436_1032754 269
166 3300025242 Ga0209258_100219 Ga0209258_10021946 269
167 3300025246 Ga0209646_1000002 Ga0209646_1000002737 269
168 3300025254 Ga0209148_1000283 Ga0209148_100028316 269
169 3300025273 Ga0209673_1000082 Ga0209673_1000082107 269
170 3300025284 Ga0209130_1003990 Ga0209130_10039905 269
171 3300025295 Ga0209564_1008534 Ga0209564_10085343 269
172 3300025297 Ga0209758_1011315 Ga0209758_10113156 269
173 3300025297 Ga0209758_1012324 Ga0209758_10123243 269
174 3300025298 Ga0209050_1000555 Ga0209050_100055526 269
175 3300025302 Ga0207426_1000493 Ga0207426_100049326 269
176 3300025302 Ga0207426_1000514 Ga0207426_100051421 269
177 3300025302 Ga0207426_1000883 Ga0207426_10008839 269
178 3300025303 Ga0209051_1037251 Ga0209051_10372512 269
179 3300025304 Ga0209257_1000001 Ga0209257_10000011245 269
180 3300025903 Ga0207680_10047382 Ga0207680_100473824 269
181 3300025903 Ga0207680_10210022 Ga0207680_102100222 269
182 3300025904 Ga0207647_10015219 Ga0207647_100152194 269
183 3300025909 Ga0207705_10195836 Ga0207705_101958361 269
184 3300025913 Ga0207695_10012565 Ga0207695_100125652 269
185 3300025914 Ga0207671_10000030 Ga0207671_1000003080 269
186 3300025919 Ga0207657_10007892 Ga0207657_1000789210 269
187 3300025919 Ga0207657_10203664 Ga0207657_102036642 269
188 3300025921 Ga0207652_10000942 Ga0207652_1000094223 269
189 3300025931 Ga0207644_10003616 Ga0207644_100036164 269
190 3300025931 Ga0207644_10296907 Ga0207644_102969071 269
191 3300025940 Ga0207691_10344927 Ga0207691_103449272 269
192 3300025942 Ga0207689_10018291 Ga0207689_100182911 269
193 3300025960 Ga0207651_10258081 Ga0207651_102580812 269
194 3300025961 Ga0207712_10045084 Ga0207712_100450842 269
195 3300025981 Ga0207640_10057686 Ga0207640_100576862 269
196 3300025981 Ga0207640_10064402 Ga0207640_100644022 269
197 3300026088 Ga0207641_10037149 Ga0207641_100371494 269
198 3300026089 Ga0207648_10028862 Ga0207648_100288624 269
199 3300026095 Ga0207676_10464196 Ga0207676_104641961 269
200 3300028379 Ga0268266_10013344 Ga0268266_100133445 269
201 3300028381 Ga0268264_10060376 Ga0268264_100603763 269
202 3300037418 Ga0395900_0046549 Ga0395900_0046549_2772_3590 269
203 3300039437 Ga0436365_0785409 Ga0436365_0785409_7735_8556 269
204 3300041997 Ga0439431_0004736 Ga0439431_0004736_1048_1872 269
205 3300042876 Ga0451577_0043507 Ga0451577_0043507_1347_2165 269
206 3300044658 Ga0466972_0058744 Ga0466972_0058744_639_1454 269
207 3300044683 Ga0466965_0028230 Ga0466965_0028230_382_1257 269
208 3300044712 Ga0453684_0050218 Ga0453684_0050218_1602_2417 269
209 3300045049 Ga0466959_0071946 Ga0466959_0071946_332_1147 269
210 3300045051 Ga0451576_0190156 Ga0451576_0190156_364_1179 269
211 3300046453 Ga0495627_001544 Ga0495627_001544_2876_3700 269
212 3300046519 Ga0495632_0092237 Ga0495632_0092237_427_1254 269
213 3300046558 Ga0495633_0000154 Ga0495633_0000154_5798_6622 269
214 3300048904 Ga0496101_0028716 Ga0496101_0028716_2937_3755 269
215 3300048924 Ga0496121_0000020 Ga0496121_0000020_273577_274398 269
216 3300048929 Ga0496126_0003667 Ga0496126_0003667_767_1591 269
217 3300049571 Ga0501034_0095890 Ga0501034_0095890_406_1224 269
218 3300049579 Ga0501043_0072677 Ga0501043_0072677_1731_2549 269
219 3300049581 Ga0501047_0204429 Ga0501047_0204429_843_1661 269
220 3300049673 Ga0501240_016844 Ga0501240_016844_165_989 269
221 3300049758 Ga0501241_000580 Ga0501241_000580_6558_7382 269
222 3300053088 Ga0500644_0000108 Ga0500644_0000108_497_1324 269
223 3300053092 Ga0500583_0002339 Ga0500583_0002339_3510_4337 269
224 3300053121 Ga0500607_081521 Ga0500607_081521_773_1600 269
225 3300053131 Ga0500652_011727 Ga0500652_011727_396_1241 269
226 3300053134 Ga0500658_0005805 Ga0500658_0005805_3162_3989 269
227 3300053142 Ga0500577_0008558 Ga0500577_0008558_1744_2571 269
228 3300053148 Ga0500590_042656 Ga0500590_042656_261_1088 269
229 3300053153 Ga0500616_0013004 Ga0500616_0013004_1915_2742 269
230 3300053156 Ga0500622_0000077 Ga0500622_0000077_75672_76496 269
231 3300053160 Ga0500633_0006718 Ga0500633_0006718_304_1131 269
232 3300053161 Ga0500634_0015518 Ga0500634_0015518_1576_2403 269
233 3300053177 Ga0500636_0002666 Ga0500636_0002666_3387_4214 269
234 iso_pu_bacteria 2738541278 2738726384 269
235 iso_pu_bacteria 2818991442 2819573817 269
236 iso_pu_bacteria 2818991460 2819680452 269
237 iso_pu_bacteria 2821136567 2821137151 269
238 iso_pu_bacteria 2904467357 2904468107 269
239 iso_pu_bacteria 2929239360 2929241434 269
240 2162886011 MRS1b_contig_5332534 MRS1b_0461.00002540 270
241 3300002773 JGI25152J39213_1000647 JGI25152J39213_100064713 270
242 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009226 270
243 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017226 270
244 3300003203 JGI25406J46586_10000525 JGI25406J46586_1000052518 270
245 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002313 270
246 3300003316 rootH1_10002677 rootH1_100026772 270
247 3300003316 rootH1_10068633 rootH1_100686332 270
248 3300003316 rootH1_10135481 rootH1_101354812 270
249 3300003320 rootH2_10040458 rootH2_100404584 270
250 3300003320 rootH2_10047580 rootH2_1004758014 270
251 3300003320 rootH2_10069535 rootH2_1006953513 270
252 3300003320 rootH2_10096794 rootH2_100967947 270
253 3300003322 rootL2_10037159 rootL2_100371593 270
254 3300003322 rootL2_10176488 rootL2_101764882 270
255 3300003322 rootL2_10283503 rootL2_102835031 270
256 3300003323 rootH1_10002262 rootH1_100022626 270
257 3300003323 rootH1_10208372 rootH1_102083722 270
258 3300003354 JGI25160J50197_1001273 JGI25160J50197_10012738 270
259 3300003791 Ga0055530_10002755 Ga0055530_100027555 270
260 3300005288 Ga0065714_10002310 Ga0065714_100023102 270
261 3300005288 Ga0065714_10004769 Ga0065714_100047691 270
262 3300005288 Ga0065714_10023632 Ga0065714_100236321 270
263 3300005288 Ga0065714_10123017 Ga0065714_101230173 270
264 3300005290 Ga0065712_10173878 Ga0065712_101738782 270
265 3300005327 Ga0070658_10001041 Ga0070658_100010416 270
266 3300005327 Ga0070658_10046802 Ga0070658_100468021 270
267 3300005328 Ga0070676_10001302 Ga0070676_1000130211 270
268 3300005328 Ga0070676_10001325 Ga0070676_100013256 270
269 3300005328 Ga0070676_10039691 Ga0070676_100396912 270
270 3300005329 Ga0070683_100000163 Ga0070683_10000016313 270
271 3300005329 Ga0070683_100002968 Ga0070683_1000029689 270
272 3300005329 Ga0070683_100006525 Ga0070683_1000065254 270
273 3300005329 Ga0070683_100062783 Ga0070683_1000627832 270
274 3300005329 Ga0070683_100236447 Ga0070683_1002364472 270
275 3300005330 Ga0070690_100007549 Ga0070690_1000075494 270
276 3300005330 Ga0070690_100055790 Ga0070690_1000557902 270
277 3300005330 Ga0070690_100126964 Ga0070690_1001269641 270
278 3300005331 Ga0070670_100062169 Ga0070670_1000621691 270
279 3300005331 Ga0070670_100069074 Ga0070670_1000690742 270
280 3300005331 Ga0070670_100130431 Ga0070670_1001304312 270
281 3300005333 Ga0070677_10035784 Ga0070677_100357842 270
282 3300005334 Ga0068869_100018339 Ga0068869_1000183392 270
283 3300005334 Ga0068869_100023955 Ga0068869_1000239552 270
284 3300005334 Ga0068869_100033372 Ga0068869_1000333722 270
285 3300005334 Ga0068869_100056074 Ga0068869_1000560743 270
286 3300005334 Ga0068869_100077989 Ga0068869_1000779893 270
287 3300005334 Ga0068869_100102195 Ga0068869_1001021952 270
288 3300005335 Ga0070666_10000470 Ga0070666_100004703 270
289 3300005335 Ga0070666_10002147 Ga0070666_100021473 270
290 3300005335 Ga0070666_10007390 Ga0070666_100073902 270
291 3300005336 Ga0070680_100019950 Ga0070680_1000199504 270
292 3300005336 Ga0070680_100108378 Ga0070680_1001083782 270
293 3300005336 Ga0070680_100256235 Ga0070680_1002562352 270
294 3300005337 Ga0070682_100000763 Ga0070682_10000076314 270
295 3300005338 Ga0068868_100009542 Ga0068868_1000095424 270
296 3300005338 Ga0068868_100010057 Ga0068868_1000100572 270
297 3300005338 Ga0068868_100020797 Ga0068868_1000207973 270
298 3300005338 Ga0068868_100023201 Ga0068868_1000232011 270
299 3300005338 Ga0068868_100029528 Ga0068868_1000295285 270
300 3300005338 Ga0068868_100222541 Ga0068868_1002225411 270
301 3300005338 Ga0068868_100486689 Ga0068868_1004866891 270
302 3300005338 Ga0068868_100525858 Ga0068868_1005258581 270
303 3300005339 Ga0070660_100007237 Ga0070660_1000072374 270
304 3300005339 Ga0070660_100015655 Ga0070660_1000156553 270
305 3300005340 Ga0070689_100371436 Ga0070689_1003714362 270
306 3300005340 Ga0070689_100578495 Ga0070689_1005784951 270
307 3300005341 Ga0070691_10003781 Ga0070691_100037815 270
308 3300005341 Ga0070691_10080700 Ga0070691_100807002 270
309 3300005343 Ga0070687_100060562 Ga0070687_1000605622 270
310 3300005344 Ga0070661_100008117 Ga0070661_1000081174 270
311 3300005344 Ga0070661_100013480 Ga0070661_1000134804 270
312 3300005344 Ga0070661_100015221 Ga0070661_1000152215 270
313 3300005344 Ga0070661_100278994 Ga0070661_1002789942 270
314 3300005347 Ga0070668_100000043 Ga0070668_1000000436 270
315 3300005347 Ga0070668_100055178 Ga0070668_1000551783 270
316 3300005353 Ga0070669_100021225 Ga0070669_1000212252 270
317 3300005353 Ga0070669_100027147 Ga0070669_1000271472 270
318 3300005354 Ga0070675_100012773 Ga0070675_1000127736 270
319 3300005354 Ga0070675_100022391 Ga0070675_1000223914 270
320 3300005354 Ga0070675_100419922 Ga0070675_1004199221 270
321 3300005355 Ga0070671_100075054 Ga0070671_1000750541 270
322 3300005355 Ga0070671_100098121 Ga0070671_1000981212 270
323 3300005355 Ga0070671_100116745 Ga0070671_1001167452 270
324 3300005355 Ga0070671_100347355 Ga0070671_1003473552 270
325 3300005356 Ga0070674_100007210 Ga0070674_1000072103 270
326 3300005356 Ga0070674_100048543 Ga0070674_1000485432 270
327 3300005356 Ga0070674_100093218 Ga0070674_1000932183 270
328 3300005356 Ga0070674_100108558 Ga0070674_1001085583 270
329 3300005356 Ga0070674_100545728 Ga0070674_1005457281 270
330 3300005364 Ga0070673_100000327 Ga0070673_10000032718 270
331 3300005364 Ga0070673_100025591 Ga0070673_1000255913 270
332 3300005364 Ga0070673_100026841 Ga0070673_1000268414 270
333 3300005364 Ga0070673_100029665 Ga0070673_1000296655 270
334 3300005364 Ga0070673_100076951 Ga0070673_1000769513 270
335 3300005364 Ga0070673_100101829 Ga0070673_1001018293 270
336 3300005364 Ga0070673_100105793 Ga0070673_1001057933 270
337 3300005364 Ga0070673_100113300 Ga0070673_1001133001 270
338 3300005365 Ga0070688_100008996 Ga0070688_1000089962 270
339 3300005365 Ga0070688_100010503 Ga0070688_1000105033 270
340 3300005365 Ga0070688_100066198 Ga0070688_1000661982 270
341 3300005365 Ga0070688_100169717 Ga0070688_1001697172 270
342 3300005366 Ga0070659_100003048 Ga0070659_1000030485 270
343 3300005366 Ga0070659_100340092 Ga0070659_1003400922 270
344 3300005366 Ga0070659_100512500 Ga0070659_1005125001 270
345 3300005367 Ga0070667_100002415 Ga0070667_1000024159 270
346 3300005367 Ga0070667_100003720 Ga0070667_10000372011 270
347 3300005367 Ga0070667_100013202 Ga0070667_1000132022 270
348 3300005367 Ga0070667_100014132 Ga0070667_1000141323 270
349 3300005367 Ga0070667_100172908 Ga0070667_1001729082 270
350 3300005367 Ga0070667_100181840 Ga0070667_1001818402 270
351 3300005367 Ga0070667_100192966 Ga0070667_1001929662 270
352 3300005441 Ga0070700_100073234 Ga0070700_1000732342 270
353 3300005455 Ga0070663_100127377 Ga0070663_1001273772 270
354 3300005455 Ga0070663_100164210 Ga0070663_1001642101 270
355 3300005455 Ga0070663_100212572 Ga0070663_1002125722 270
356 3300005456 Ga0070678_100119132 Ga0070678_1001191322 270
357 3300005456 Ga0070678_100151186 Ga0070678_1001511862 270
358 3300005457 Ga0070662_100000634 Ga0070662_10000063410 270
359 3300005457 Ga0070662_100006198 Ga0070662_1000061983 270
360 3300005457 Ga0070662_100011578 Ga0070662_1000115782 270
361 3300005457 Ga0070662_100024164 Ga0070662_1000241642 270
362 3300005457 Ga0070662_100351813 Ga0070662_1003518132 270
363 3300005458 Ga0070681_10171808 Ga0070681_101718081 270
364 3300005459 Ga0068867_100007977 Ga0068867_1000079776 270
365 3300005459 Ga0068867_100033229 Ga0068867_1000332292 270
366 3300005459 Ga0068867_100110092 Ga0068867_1001100922 270
367 3300005466 Ga0070685_10020801 Ga0070685_100208014 270
368 3300005466 Ga0070685_10020953 Ga0070685_100209534 270
369 3300005466 Ga0070685_10023651 Ga0070685_100236514 270
370 3300005466 Ga0070685_10294017 Ga0070685_102940171 270
371 3300005468 Ga0070707_100237998 Ga0070707_1002379982 270
372 3300005471 Ga0070698_100000297 Ga0070698_10000029748 270
373 3300005471 Ga0070698_100044656 Ga0070698_1000446565 270
374 3300005471 Ga0070698_100306542 Ga0070698_1003065422 270
375 3300005530 Ga0070679_100009706 Ga0070679_1000097066 270
376 3300005530 Ga0070679_100017964 Ga0070679_1000179647 270
377 3300005535 Ga0070684_100002223 Ga0070684_1000022235 270
378 3300005535 Ga0070684_100003255 Ga0070684_1000032556 270
379 3300005535 Ga0070684_100036799 Ga0070684_1000367995 270
380 3300005535 Ga0070684_100123368 Ga0070684_1001233682 270
381 3300005539 Ga0068853_100000393 Ga0068853_10000039323 270
382 3300005539 Ga0068853_100012039 Ga0068853_1000120393 270
383 3300005539 Ga0068853_100012865 Ga0068853_1000128657 270
384 3300005539 Ga0068853_100035117 Ga0068853_1000351173 270
385 3300005539 Ga0068853_100038576 Ga0068853_1000385764 270
386 3300005539 Ga0068853_100047147 Ga0068853_1000471474 270
387 3300005539 Ga0068853_100086173 Ga0068853_1000861732 270
388 3300005539 Ga0068853_100134818 Ga0068853_1001348182 270
389 3300005539 Ga0068853_100187668 Ga0068853_1001876682 270
390 3300005539 Ga0068853_100198341 Ga0068853_1001983412 270
391 3300005539 Ga0068853_100249885 Ga0068853_1002498853 270
392 3300005539 Ga0068853_100539848 Ga0068853_1005398481 270
393 3300005543 Ga0070672_100000109 Ga0070672_10000010929 270
394 3300005543 Ga0070672_100025040 Ga0070672_1000250403 270
395 3300005543 Ga0070672_100404349 Ga0070672_1004043492 270
396 3300005544 Ga0070686_100116157 Ga0070686_1001161572 270
397 3300005546 Ga0070696_100127934 Ga0070696_1001279342 270
398 3300005547 Ga0070693_100029934 Ga0070693_1000299343 270
399 3300005548 Ga0070665_100000013 Ga0070665_100000013222 270
400 3300005548 Ga0070665_100033784 Ga0070665_1000337843 270
401 3300005563 Ga0068855_100000424 Ga0068855_10000042438 270
402 3300005563 Ga0068855_100007894 Ga0068855_1000078943 270
403 3300005563 Ga0068855_100042418 Ga0068855_1000424184 270
404 3300005563 Ga0068855_100043267 Ga0068855_1000432672 270
405 3300005563 Ga0068855_100125412 Ga0068855_1001254123 270
406 3300005563 Ga0068855_100129313 Ga0068855_1001293133 270
407 3300005563 Ga0068855_100260832 Ga0068855_1002608321 270
408 3300005564 Ga0070664_100003401 Ga0070664_10000340110 270
409 3300005564 Ga0070664_100014457 Ga0070664_1000144572 270
410 3300005564 Ga0070664_100181958 Ga0070664_1001819582 270
411 3300005564 Ga0070664_100246686 Ga0070664_1002466863 270
412 3300005577 Ga0068857_100026465 Ga0068857_1000264653 270
413 3300005577 Ga0068857_100041415 Ga0068857_1000414152 270
414 3300005577 Ga0068857_100164522 Ga0068857_1001645222 270
415 3300005577 Ga0068857_100295396 Ga0068857_1002953962 270
416 3300005578 Ga0068854_100068897 Ga0068854_1000688973 270
417 3300005578 Ga0068854_100298702 Ga0068854_1002987021 270
418 3300005578 Ga0068854_100681855 Ga0068854_1006818551 270
419 3300005614 Ga0068856_100036956 Ga0068856_1000369563 270
420 3300005614 Ga0068856_100184238 Ga0068856_1001842381 270
421 3300005615 Ga0070702_100332360 Ga0070702_1003323601 270
422 3300005616 Ga0068852_100002256 Ga0068852_1000022569 270
423 3300005616 Ga0068852_100007763 Ga0068852_1000077636 270
424 3300005616 Ga0068852_100008104 Ga0068852_1000081041 270
425 3300005616 Ga0068852_100028525 Ga0068852_1000285253 270
426 3300005616 Ga0068852_100061314 Ga0068852_1000613143 270
427 3300005616 Ga0068852_100124699 Ga0068852_1001246992 270
428 3300005616 Ga0068852_100169367 Ga0068852_1001693672 270
429 3300005616 Ga0068852_100173333 Ga0068852_1001733333 270
430 3300005616 Ga0068852_100184267 Ga0068852_1001842673 270
431 3300005617 Ga0068859_100000012 Ga0068859_10000001215 270
432 3300005617 Ga0068859_100009837 Ga0068859_10000983710 270
433 3300005617 Ga0068859_100291434 Ga0068859_1002914342 270
434 3300005617 Ga0068859_100330486 Ga0068859_1003304862 270
435 3300005617 Ga0068859_100411599 Ga0068859_1004115992 270
436 3300005618 Ga0068864_100002855 Ga0068864_1000028552 270
437 3300005618 Ga0068864_100002925 Ga0068864_1000029255 270
438 3300005618 Ga0068864_100334473 Ga0068864_1003344731 270
439 3300005618 Ga0068864_100414635 Ga0068864_1004146352 270
440 3300005618 Ga0068864_100434066 Ga0068864_1004340662 270
441 3300005718 Ga0068866_10031108 Ga0068866_100311082 270
442 3300005718 Ga0068866_10039537 Ga0068866_100395373 270
443 3300005719 Ga0068861_100096503 Ga0068861_1000965032 270
444 3300005834 Ga0068851_10000757 Ga0068851_100007579 270
445 3300005834 Ga0068851_10023638 Ga0068851_100236382 270
446 3300005834 Ga0068851_10033342 Ga0068851_100333422 270
447 3300005834 Ga0068851_10061988 Ga0068851_100619882 270
448 3300005834 Ga0068851_10099080 Ga0068851_100990802 270
449 3300005834 Ga0068851_10123477 Ga0068851_101234772 270
450 3300005840 Ga0068870_10086437 Ga0068870_100864372 270
451 3300005841 Ga0068863_100000837 Ga0068863_10000083715 270
452 3300005841 Ga0068863_100004877 Ga0068863_1000048773 270
453 3300005841 Ga0068863_100031428 Ga0068863_1000314285 270
454 3300005841 Ga0068863_100167215 Ga0068863_1001672153 270
455 3300005841 Ga0068863_100241607 Ga0068863_1002416072 270
456 3300005841 Ga0068863_100912930 Ga0068863_1009129301 270
457 3300005842 Ga0068858_100000199 Ga0068858_10000019910 270
458 3300005842 Ga0068858_100003623 Ga0068858_10000362310 270
459 3300005842 Ga0068858_100044704 Ga0068858_1000447041 270
460 3300005842 Ga0068858_100062898 Ga0068858_1000628982 270
461 3300005842 Ga0068858_100138918 Ga0068858_1001389183 270
462 3300005843 Ga0068860_100000060 Ga0068860_100000060141 270
463 3300005843 Ga0068860_100001065 Ga0068860_10000106526 270
464 3300005843 Ga0068860_100002282 Ga0068860_10000228214 270
465 3300005843 Ga0068860_100006172 Ga0068860_1000061726 270
466 3300005843 Ga0068860_100015467 Ga0068860_1000154672 270
467 3300005843 Ga0068860_100024334 Ga0068860_1000243341 270
468 3300005985 Ga0081539_10000037 Ga0081539_10000037167 270
469 3300005985 Ga0081539_10021605 Ga0081539_100216053 270
470 3300006195 Ga0075366_10128799 Ga0075366_101287992 270
471 3300006195 Ga0075366_10145746 Ga0075366_101457462 270
472 3300006195 Ga0075366_10185617 Ga0075366_101856171 270
473 3300006195 Ga0075366_10262687 Ga0075366_102626871 270
474 3300006237 Ga0097621_100027698 Ga0097621_1000276984 270
475 3300006237 Ga0097621_100080231 Ga0097621_1000802312 270
476 3300006237 Ga0097621_100116128 Ga0097621_1001161282 270
477 3300006237 Ga0097621_100139561 Ga0097621_1001395612 270
478 3300006237 Ga0097621_100193836 Ga0097621_1001938361 270
479 3300006237 Ga0097621_100296828 Ga0097621_1002968282 270
480 3300006358 Ga0068871_100012310 Ga0068871_1000123103 270
481 3300006358 Ga0068871_100025288 Ga0068871_1000252883 270
482 3300006358 Ga0068871_100035662 Ga0068871_1000356626 270
483 3300006358 Ga0068871_100076489 Ga0068871_1000764892 270
484 3300006358 Ga0068871_100097438 Ga0068871_1000974383 270
485 3300006358 Ga0068871_100302487 Ga0068871_1003024872 270
486 3300006881 Ga0068865_100029956 Ga0068865_1000299563 270
487 3300006881 Ga0068865_100169183 Ga0068865_1001691832 270
488 3300006881 Ga0068865_100214390 Ga0068865_1002143902 270
489 3300006881 Ga0068865_100625544 Ga0068865_1006255441 270
490 3300006931 Ga0097620_100000012 Ga0097620_10000001215 270
491 3300006931 Ga0097620_100009837 Ga0097620_10000983710 270
492 3300006931 Ga0097620_100291442 Ga0097620_1002914422 270
493 3300006931 Ga0097620_100330498 Ga0097620_1003304982 270
494 3300006931 Ga0097620_100411639 Ga0097620_1004116392 270
495 3300009093 Ga0105240_10000486 Ga0105240_1000048662 270
496 3300009093 Ga0105240_10001336 Ga0105240_1000133634 270
497 3300009093 Ga0105240_10001733 Ga0105240_1000173316 270
498 3300009093 Ga0105240_10002769 Ga0105240_1000276913 270
499 3300009093 Ga0105240_10092055 Ga0105240_100920552 270
500 3300009093 Ga0105240_10140580 Ga0105240_101405803 270
501 3300009093 Ga0105240_10187278 Ga0105240_101872781 270
502 3300009093 Ga0105240_10260537 Ga0105240_102605372 270
503 3300009093 Ga0105240_10385880 Ga0105240_103858802 270
504 3300009093 Ga0105240_10474576 Ga0105240_104745762 270
505 3300009094 Ga0111539_10029443 Ga0111539_100294432 270
506 3300009094 Ga0111539_10223014 Ga0111539_102230142 270
507 3300009098 Ga0105245_10707957 Ga0105245_107079571 270
508 3300009101 Ga0105247_10087178 Ga0105247_100871783 270
509 3300009101 Ga0105247_10179217 Ga0105247_101792172 270
510 3300009147 Ga0114129_10201912 Ga0114129_102019123 270
511 3300009174 Ga0105241_10000160 Ga0105241_1000016016 270
512 3300009174 Ga0105241_10005397 Ga0105241_100053974 270
513 3300009174 Ga0105241_10006798 Ga0105241_100067987 270
514 3300009176 Ga0105242_10010378 Ga0105242_100103788 270
515 3300009176 Ga0105242_10040136 Ga0105242_100401364 270
516 3300009176 Ga0105242_10043339 Ga0105242_100433392 270
517 3300009176 Ga0105242_10045988 Ga0105242_100459883 270
518 3300009176 Ga0105242_10086591 Ga0105242_100865913 270
519 3300009176 Ga0105242_10140101 Ga0105242_101401013 270
520 3300009176 Ga0105242_10155242 Ga0105242_101552422 270
521 3300009177 Ga0105248_10031239 Ga0105248_100312393 270
522 3300009545 Ga0105237_10000651 Ga0105237_1000065139 270
523 3300009545 Ga0105237_10001003 Ga0105237_1000100334 270
524 3300009545 Ga0105237_10010984 Ga0105237_100109846 270
525 3300009545 Ga0105237_10012955 Ga0105237_100129556 270
526 3300009545 Ga0105237_10031701 Ga0105237_100317015 270
527 3300009545 Ga0105237_10061473 Ga0105237_100614732 270
528 3300009545 Ga0105237_10096161 Ga0105237_100961613 270
529 3300009545 Ga0105237_10229777 Ga0105237_102297772 270
530 3300009545 Ga0105237_10327524 Ga0105237_103275242 270
531 3300009551 Ga0105238_10006277 Ga0105238_100062777 270
532 3300009551 Ga0105238_10035934 Ga0105238_100359344 270
533 3300009551 Ga0105238_10041567 Ga0105238_100415673 270
534 3300009553 Ga0105249_10003523 Ga0105249_100035234 270
535 3300009553 Ga0105249_10034299 Ga0105249_100342994 270
536 3300009553 Ga0105249_10056871 Ga0105249_100568713 270
537 3300009553 Ga0105249_10095840 Ga0105249_100958403 270
538 3300009553 Ga0105249_10170736 Ga0105249_101707362 270
539 3300009553 Ga0105249_10208189 Ga0105249_102081892 270
540 3300009553 Ga0105249_10283174 Ga0105249_102831742 270
541 3300009553 Ga0105249_10294582 Ga0105249_102945822 270
542 3300010375 Ga0105239_10000457 Ga0105239_1000045710 270
543 3300010375 Ga0105239_10001481 Ga0105239_1000148113 270
544 3300010375 Ga0105239_10014988 Ga0105239_100149885 270
545 3300010375 Ga0105239_10018841 Ga0105239_100188413 270
546 3300010375 Ga0105239_10046890 Ga0105239_100468902 270
547 3300010375 Ga0105239_10049269 Ga0105239_100492692 270
548 3300010375 Ga0105239_10098424 Ga0105239_100984245 270
549 3300010375 Ga0105239_10207254 Ga0105239_102072543 270
550 3300011119 Ga0105246_10013049 Ga0105246_100130493 270
551 3300011119 Ga0105246_10034419 Ga0105246_100344194 270
552 3300011119 Ga0105246_10145743 Ga0105246_101457431 270
553 3300013100 Ga0157373_10010365 Ga0157373_100103654 270
554 3300013100 Ga0157373_10011057 Ga0157373_100110573 270
555 3300013100 Ga0157373_10011567 Ga0157373_100115676 270
556 3300013100 Ga0157373_10044643 Ga0157373_100446431 270
557 3300013100 Ga0157373_10127960 Ga0157373_101279601 270
558 3300013102 Ga0157371_10000009 Ga0157371_10000009327 270
559 3300013102 Ga0157371_10004069 Ga0157371_100040697 270
560 3300013102 Ga0157371_10022986 Ga0157371_100229864 270
561 3300013102 Ga0157371_10053517 Ga0157371_100535172 270
562 3300013102 Ga0157371_10112606 Ga0157371_101126061 270
563 3300013102 Ga0157371_10150197 Ga0157371_101501972 270
564 3300013102 Ga0157371_10174230 Ga0157371_101742301 270
565 3300013104 Ga0157370_10001064 Ga0157370_1000106416 270
566 3300013104 Ga0157370_10002306 Ga0157370_1000230617 270
567 3300013104 Ga0157370_10004498 Ga0157370_100044982 270
568 3300013104 Ga0157370_10011684 Ga0157370_100116844 270
569 3300013104 Ga0157370_10012352 Ga0157370_100123524 270
570 3300013104 Ga0157370_10020896 Ga0157370_100208964 270
571 3300013104 Ga0157370_10059442 Ga0157370_100594421 270
572 3300013104 Ga0157370_10179665 Ga0157370_101796652 270
573 3300013104 Ga0157370_10526036 Ga0157370_105260362 270
574 3300013104 Ga0157370_10551105 Ga0157370_105511051 270
575 3300013105 Ga0157369_10000006 Ga0157369_10000006353 270
576 3300013105 Ga0157369_10008134 Ga0157369_100081346 270
577 3300013105 Ga0157369_10015578 Ga0157369_100155784 270
578 3300013105 Ga0157369_10080689 Ga0157369_100806893 270
579 3300013105 Ga0157369_10180230 Ga0157369_101802302 270
580 3300013105 Ga0157369_10373796 Ga0157369_103737962 270
581 3300013296 Ga0157374_10000007 Ga0157374_10000007164 270
582 3300013296 Ga0157374_10000629 Ga0157374_100006296 270
583 3300013296 Ga0157374_10029588 Ga0157374_100295883 270
584 3300013296 Ga0157374_10059605 Ga0157374_100596053 270
585 3300013296 Ga0157374_10065532 Ga0157374_100655324 270
586 3300013296 Ga0157374_10075514 Ga0157374_100755144 270
587 3300013296 Ga0157374_10180871 Ga0157374_101808712 270
588 3300013296 Ga0157374_10214026 Ga0157374_102140262 270
589 3300013296 Ga0157374_10242203 Ga0157374_102422032 270
590 3300013296 Ga0157374_10954962 Ga0157374_109549621 270
591 3300013297 Ga0157378_10006049 Ga0157378_1000604913 270
592 3300013297 Ga0157378_10006118 Ga0157378_100061183 270
593 3300013297 Ga0157378_10006926 Ga0157378_100069268 270
594 3300013297 Ga0157378_10007878 Ga0157378_100078783 270
595 3300013297 Ga0157378_10025320 Ga0157378_100253203 270
596 3300013297 Ga0157378_10057639 Ga0157378_100576393 270
597 3300013297 Ga0157378_10072304 Ga0157378_100723044 270
598 3300013297 Ga0157378_10139500 Ga0157378_101395002 270
599 3300013306 Ga0163162_10000140 Ga0163162_1000014048 270
600 3300013306 Ga0163162_10000177 Ga0163162_1000017743 270
601 3300013306 Ga0163162_10000213 Ga0163162_1000021338 270
602 3300013306 Ga0163162_10004487 Ga0163162_100044879 270
603 3300013306 Ga0163162_10008778 Ga0163162_100087785 270
604 3300013306 Ga0163162_10011211 Ga0163162_100112114 270
605 3300013306 Ga0163162_10022548 Ga0163162_100225484 270
606 3300013306 Ga0163162_10041859 Ga0163162_100418595 270
607 3300013306 Ga0163162_10050767 Ga0163162_100507673 270
608 3300013306 Ga0163162_10058353 Ga0163162_100583531 270
609 3300013306 Ga0163162_10150916 Ga0163162_101509162 270
610 3300013306 Ga0163162_10207695 Ga0163162_102076951 270
611 3300013307 Ga0157372_10002277 Ga0157372_1000227716 270
612 3300013307 Ga0157372_10007751 Ga0157372_100077514 270
613 3300013307 Ga0157372_10008222 Ga0157372_100082224 270
614 3300013307 Ga0157372_10016773 Ga0157372_100167735 270
615 3300013307 Ga0157372_10028931 Ga0157372_100289314 270
616 3300013307 Ga0157372_10088920 Ga0157372_100889203 270
617 3300013307 Ga0157372_10096272 Ga0157372_100962722 270
618 3300013307 Ga0157372_10133614 Ga0157372_101336143 270
619 3300013307 Ga0157372_10193945 Ga0157372_101939452 270
620 3300013308 Ga0157375_10001313 Ga0157375_1000131315 270
621 3300013308 Ga0157375_10050973 Ga0157375_100509734 270
622 3300013308 Ga0157375_10054532 Ga0157375_100545324 270
623 3300013308 Ga0157375_10074533 Ga0157375_100745333 270
624 3300013308 Ga0157375_10160367 Ga0157375_101603671 270
625 3300013308 Ga0157375_10321264 Ga0157375_103212642 270
626 3300013308 Ga0157375_10353298 Ga0157375_103532982 270
627 3300014325 Ga0163163_10000332 Ga0163163_100003325 270
628 3300014325 Ga0163163_10000457 Ga0163163_100004573 270
629 3300014325 Ga0163163_10044180 Ga0163163_100441802 270
630 3300014325 Ga0163163_10128627 Ga0163163_101286272 270
631 3300014325 Ga0163163_10232691 Ga0163163_102326911 270
632 3300014325 Ga0163163_10353516 Ga0163163_103535162 270
633 3300014325 Ga0163163_10767535 Ga0163163_107675351 270
634 3300014326 Ga0157380_10000022 Ga0157380_1000002268 270
635 3300014326 Ga0157380_10046770 Ga0157380_100467704 270
636 3300014326 Ga0157380_10079325 Ga0157380_100793253 270
637 3300014326 Ga0157380_10088288 Ga0157380_100882882 270
638 3300014497 Ga0182008_10009414 Ga0182008_100094144 270
639 3300014745 Ga0157377_10060152 Ga0157377_100601522 270
640 3300014968 Ga0157379_10000340 Ga0157379_1000034027 270
641 3300014968 Ga0157379_10042488 Ga0157379_100424882 270
642 3300014968 Ga0157379_10080869 Ga0157379_100808691 270
643 3300014968 Ga0157379_10168863 Ga0157379_101688632 270
644 3300014968 Ga0157379_10268519 Ga0157379_102685192 270
645 3300014969 Ga0157376_10000771 Ga0157376_1000077110 270
646 3300014969 Ga0157376_10003394 Ga0157376_100033944 270
647 3300014969 Ga0157376_10058992 Ga0157376_100589921 270
648 3300014969 Ga0157376_10131972 Ga0157376_101319721 270
649 3300014969 Ga0157376_10248818 Ga0157376_102488183 270
650 3300014969 Ga0157376_10389068 Ga0157376_103890682 270
651 3300015261 Ga0182006_1000322 Ga0182006_10003226 270
652 3300015261 Ga0182006_1008844 Ga0182006_10088443 270
653 3300015262 Ga0182007_10000001 Ga0182007_10000001302 270
654 3300015682 Ga0183373_1006 Ga0183373_1006198 270
655 3300017792 Ga0163161_10001740 Ga0163161_100017402 270
656 3300017792 Ga0163161_10002015 Ga0163161_100020152 270
657 3300017792 Ga0163161_10005625 Ga0163161_100056254 270
658 3300017792 Ga0163161_10014448 Ga0163161_100144482 270
659 3300017792 Ga0163161_10022817 Ga0163161_100228173 270
660 3300017792 Ga0163161_10274892 Ga0163161_102748922 270
661 3300017792 Ga0163161_10295845 Ga0163161_102958452 270
662 3300020078 Ga0206352_10602261 Ga0206352_106022611 270
663 3300025245 Ga0207425_1000007 Ga0207425_1000007330 270
664 3300025246 Ga0209646_1000770 Ga0209646_10007707 270
665 3300025258 Ga0209129_1000006 Ga0209129_1000006330 270
666 3300025271 Ga0207666_1004201 Ga0207666_10042012 270
667 3300025294 Ga0209025_1000025 Ga0209025_1000025160 270
668 3300025297 Ga0209758_1000016 Ga0209758_1000016330 270
669 3300025302 Ga0207426_1000230 Ga0207426_1000230102 270
670 3300025315 Ga0207697_10061167 Ga0207697_100611672 270
671 3300025315 Ga0207697_10068184 Ga0207697_100681842 270
672 3300025321 Ga0207656_10005150 Ga0207656_100051505 270
673 3300025893 Ga0207682_10009398 Ga0207682_100093983 270
674 3300025893 Ga0207682_10108183 Ga0207682_101081831 270
675 3300025899 Ga0207642_10041343 Ga0207642_100413432 270
676 3300025899 Ga0207642_10119113 Ga0207642_101191132 270
677 3300025900 Ga0207710_10000804 Ga0207710_1000080412 270
678 3300025900 Ga0207710_10016472 Ga0207710_100164723 270
679 3300025900 Ga0207710_10093631 Ga0207710_100936311 270
680 3300025901 Ga0207688_10007738 Ga0207688_100077382 270
681 3300025901 Ga0207688_10011124 Ga0207688_100111243 270
682 3300025903 Ga0207680_10000031 Ga0207680_1000003141 270
683 3300025903 Ga0207680_10001651 Ga0207680_100016518 270
684 3300025903 Ga0207680_10041946 Ga0207680_100419462 270
685 3300025903 Ga0207680_10162839 Ga0207680_101628392 270
686 3300025904 Ga0207647_10000288 Ga0207647_1000028829 270
687 3300025904 Ga0207647_10065300 Ga0207647_100653003 270
688 3300025907 Ga0207645_10000713 Ga0207645_1000071318 270
689 3300025907 Ga0207645_10001819 Ga0207645_1000181913 270
690 3300025907 Ga0207645_10042582 Ga0207645_100425823 270
691 3300025908 Ga0207643_10010031 Ga0207643_100100316 270
692 3300025909 Ga0207705_10119645 Ga0207705_101196452 270
693 3300025911 Ga0207654_10001314 Ga0207654_100013145 270
694 3300025911 Ga0207654_10003003 Ga0207654_100030036 270
695 3300025912 Ga0207707_10000323 Ga0207707_1000032335 270
696 3300025913 Ga0207695_10000130 Ga0207695_1000013054 270
697 3300025913 Ga0207695_10000170 Ga0207695_10000170113 270
698 3300025913 Ga0207695_10003034 Ga0207695_1000303413 270
699 3300025913 Ga0207695_10004097 Ga0207695_100040977 270
700 3300025913 Ga0207695_10011079 Ga0207695_100110799 270
701 3300025913 Ga0207695_10037565 Ga0207695_100375654 270
702 3300025913 Ga0207695_10047325 Ga0207695_100473254 270
703 3300025913 Ga0207695_10130257 Ga0207695_101302572 270
704 3300025913 Ga0207695_10173850 Ga0207695_101738503 270
705 3300025913 Ga0207695_10179390 Ga0207695_101793902 270
706 3300025914 Ga0207671_10004377 Ga0207671_1000437710 270
707 3300025914 Ga0207671_10005384 Ga0207671_100053845 270
708 3300025914 Ga0207671_10012131 Ga0207671_100121318 270
709 3300025914 Ga0207671_10020567 Ga0207671_100205674 270
710 3300025914 Ga0207671_10124741 Ga0207671_101247412 270
711 3300025914 Ga0207671_10275579 Ga0207671_102755792 270
712 3300025917 Ga0207660_10017192 Ga0207660_100171923 270
713 3300025917 Ga0207660_10174603 Ga0207660_101746032 270
714 3300025918 Ga0207662_10011934 Ga0207662_100119342 270
715 3300025919 Ga0207657_10003020 Ga0207657_1000302014 270
716 3300025919 Ga0207657_10013457 Ga0207657_100134573 270
717 3300025919 Ga0207657_10058434 Ga0207657_100584342 270
718 3300025919 Ga0207657_10107784 Ga0207657_101077843 270
719 3300025920 Ga0207649_10013964 Ga0207649_100139641 270
720 3300025920 Ga0207649_10111205 Ga0207649_101112051 270
721 3300025921 Ga0207652_10015975 Ga0207652_100159752 270
722 3300025921 Ga0207652_10031715 Ga0207652_100317155 270
723 3300025923 Ga0207681_10109044 Ga0207681_101090443 270
724 3300025923 Ga0207681_10179303 Ga0207681_101793032 270
725 3300025924 Ga0207694_10020325 Ga0207694_100203251 270
726 3300025924 Ga0207694_10031981 Ga0207694_100319812 270
727 3300025925 Ga0207650_10105187 Ga0207650_101051872 270
728 3300025925 Ga0207650_10200158 Ga0207650_102001582 270
729 3300025925 Ga0207650_10272361 Ga0207650_102723612 270
730 3300025926 Ga0207659_10014768 Ga0207659_100147682 270
731 3300025926 Ga0207659_10057168 Ga0207659_100571681 270
732 3300025926 Ga0207659_10115671 Ga0207659_101156712 270
733 3300025926 Ga0207659_10130354 Ga0207659_101303541 270
734 3300025926 Ga0207659_10483281 Ga0207659_104832811 270
735 3300025931 Ga0207644_10024353 Ga0207644_100243533 270
736 3300025931 Ga0207644_10219411 Ga0207644_102194112 270
737 3300025932 Ga0207690_10044183 Ga0207690_100441833 270
738 3300025933 Ga0207706_10001885 Ga0207706_1000188513 270
739 3300025933 Ga0207706_10002590 Ga0207706_100025907 270
740 3300025933 Ga0207706_10024967 Ga0207706_100249675 270
741 3300025933 Ga0207706_10096610 Ga0207706_100966103 270
742 3300025933 Ga0207706_10574188 Ga0207706_105741881 270
743 3300025934 Ga0207686_10003787 Ga0207686_100037872 270
744 3300025934 Ga0207686_10043510 Ga0207686_100435103 270
745 3300025934 Ga0207686_10113308 Ga0207686_101133082 270
746 3300025934 Ga0207686_10139321 Ga0207686_101393212 270
747 3300025936 Ga0207670_10023950 Ga0207670_100239502 270
748 3300025936 Ga0207670_10056611 Ga0207670_100566112 270
749 3300025937 Ga0207669_10194024 Ga0207669_101940242 270
750 3300025937 Ga0207669_10195968 Ga0207669_101959681 270
751 3300025938 Ga0207704_10004827 Ga0207704_100048272 270
752 3300025938 Ga0207704_10106478 Ga0207704_101064781 270
753 3300025938 Ga0207704_10138656 Ga0207704_101386562 270
754 3300025940 Ga0207691_10000228 Ga0207691_100002282 270
755 3300025940 Ga0207691_10005384 Ga0207691_100053848 270
756 3300025940 Ga0207691_10121506 Ga0207691_101215061 270
757 3300025940 Ga0207691_10138922 Ga0207691_101389222 270
758 3300025942 Ga0207689_10001966 Ga0207689_100019663 270
759 3300025942 Ga0207689_10003756 Ga0207689_100037568 270
760 3300025942 Ga0207689_10008218 Ga0207689_100082187 270
761 3300025942 Ga0207689_10010467 Ga0207689_100104672 270
762 3300025942 Ga0207689_10018417 Ga0207689_100184176 270
763 3300025942 Ga0207689_10026108 Ga0207689_100261084 270
764 3300025942 Ga0207689_10032751 Ga0207689_100327513 270
765 3300025942 Ga0207689_10155145 Ga0207689_101551451 270
766 3300025942 Ga0207689_10570749 Ga0207689_105707491 270
767 3300025944 Ga0207661_10046137 Ga0207661_100461373 270
768 3300025944 Ga0207661_10151429 Ga0207661_101514291 270
769 3300025944 Ga0207661_10176161 Ga0207661_101761612 270
770 3300025945 Ga0207679_10001677 Ga0207679_100016776 270
771 3300025945 Ga0207679_10011282 Ga0207679_100112824 270
772 3300025945 Ga0207679_10385025 Ga0207679_103850252 270
773 3300025945 Ga0207679_10543041 Ga0207679_105430412 270
774 3300025949 Ga0207667_10004780 Ga0207667_100047806 270
775 3300025949 Ga0207667_10005051 Ga0207667_1000505112 270
776 3300025949 Ga0207667_10024155 Ga0207667_100241552 270
777 3300025949 Ga0207667_10035134 Ga0207667_100351345 270
778 3300025949 Ga0207667_10035973 Ga0207667_100359733 270
779 3300025949 Ga0207667_10762084 Ga0207667_107620841 270
780 3300025960 Ga0207651_10000190 Ga0207651_1000019018 270
781 3300025960 Ga0207651_10154886 Ga0207651_101548861 270
782 3300025960 Ga0207651_10203249 Ga0207651_102032492 270
783 3300025960 Ga0207651_10250917 Ga0207651_102509172 270
784 3300025961 Ga0207712_10014998 Ga0207712_100149985 270
785 3300025961 Ga0207712_10032303 Ga0207712_100323032 270
786 3300025961 Ga0207712_10062100 Ga0207712_100621002 270
787 3300025961 Ga0207712_10132946 Ga0207712_101329462 270
788 3300025961 Ga0207712_10225630 Ga0207712_102256301 270
789 3300025961 Ga0207712_10266743 Ga0207712_102667432 270
790 3300025961 Ga0207712_10365795 Ga0207712_103657952 270
791 3300025961 Ga0207712_10412282 Ga0207712_104122822 270
792 3300025972 Ga0207668_10012446 Ga0207668_100124463 270
793 3300025972 Ga0207668_10421421 Ga0207668_104214212 270
794 3300025981 Ga0207640_10021295 Ga0207640_100212954 270
795 3300025981 Ga0207640_10126770 Ga0207640_101267702 270
796 3300025981 Ga0207640_10580324 Ga0207640_105803241 270
797 3300025986 Ga0207658_10000176 Ga0207658_100001766 270
798 3300025986 Ga0207658_10031222 Ga0207658_100312224 270
799 3300025986 Ga0207658_10033227 Ga0207658_100332273 270
800 3300025986 Ga0207658_10155566 Ga0207658_101555662 270
801 3300025986 Ga0207658_10296265 Ga0207658_102962651 270
802 3300026023 Ga0207677_10005124 Ga0207677_100051246 270
803 3300026023 Ga0207677_10107854 Ga0207677_101078542 270
804 3300026023 Ga0207677_10282990 Ga0207677_102829902 270
805 3300026023 Ga0207677_10292051 Ga0207677_102920512 270
806 3300026023 Ga0207677_10324851 Ga0207677_103248511 270
807 3300026035 Ga0207703_10000433 Ga0207703_100004339 270
808 3300026035 Ga0207703_10036338 Ga0207703_100363382 270
809 3300026035 Ga0207703_10187141 Ga0207703_101871412 270
810 3300026041 Ga0207639_10028406 Ga0207639_100284064 270
811 3300026041 Ga0207639_10029884 Ga0207639_100298842 270
812 3300026041 Ga0207639_10035919 Ga0207639_100359192 270
813 3300026041 Ga0207639_10104095 Ga0207639_101040952 270
814 3300026041 Ga0207639_10111906 Ga0207639_101119063 270
815 3300026041 Ga0207639_10118486 Ga0207639_101184862 270
816 3300026041 Ga0207639_10143323 Ga0207639_101433232 270
817 3300026041 Ga0207639_10224074 Ga0207639_102240742 270
818 3300026041 Ga0207639_10316101 Ga0207639_103161011 270
819 3300026067 Ga0207678_10088678 Ga0207678_100886783 270
820 3300026078 Ga0207702_10041909 Ga0207702_100419093 270
821 3300026078 Ga0207702_10062526 Ga0207702_100625263 270
822 3300026078 Ga0207702_10139589 Ga0207702_101395891 270
823 3300026088 Ga0207641_10000048 Ga0207641_10000048133 270
824 3300026088 Ga0207641_10000601 Ga0207641_100006017 270
825 3300026088 Ga0207641_10002006 Ga0207641_1000200611 270
826 3300026088 Ga0207641_10037593 Ga0207641_100375935 270
827 3300026088 Ga0207641_10142918 Ga0207641_101429183 270
828 3300026088 Ga0207641_10220204 Ga0207641_102202042 270
829 3300026088 Ga0207641_10289879 Ga0207641_102898792 270
830 3300026088 Ga0207641_10805310 Ga0207641_108053101 270
831 3300026089 Ga0207648_10006817 Ga0207648_100068175 270
832 3300026089 Ga0207648_10020665 Ga0207648_100206656 270
833 3300026089 Ga0207648_10067423 Ga0207648_100674234 270
834 3300026089 Ga0207648_10273293 Ga0207648_102732932 270
835 3300026095 Ga0207676_10001236 Ga0207676_100012366 270
836 3300026095 Ga0207676_10044893 Ga0207676_100448933 270
837 3300026095 Ga0207676_10093368 Ga0207676_100933683 270
838 3300026095 Ga0207676_10196680 Ga0207676_101966802 270
839 3300026095 Ga0207676_10225999 Ga0207676_102259992 270
840 3300026095 Ga0207676_10680237 Ga0207676_106802371 270
841 3300026116 Ga0207674_10007789 Ga0207674_1000778910 270
842 3300026116 Ga0207674_10015679 Ga0207674_100156794 270
843 3300026116 Ga0207674_10106874 Ga0207674_101068742 270
844 3300026116 Ga0207674_10111062 Ga0207674_101110622 270
845 3300026118 Ga0207675_100007107 Ga0207675_1000071079 270
846 3300026118 Ga0207675_100038046 Ga0207675_1000380464 270
847 3300026118 Ga0207675_100130205 Ga0207675_1001302053 270
848 3300026121 Ga0207683_10008436 Ga0207683_100084365 270
849 3300026121 Ga0207683_10013033 Ga0207683_100130335 270
850 3300026121 Ga0207683_10152583 Ga0207683_101525832 270
851 3300026142 Ga0207698_10021707 Ga0207698_100217073 270
852 3300026142 Ga0207698_10026986 Ga0207698_100269862 270
853 3300026142 Ga0207698_10049049 Ga0207698_100490492 270
854 3300026142 Ga0207698_10132979 Ga0207698_101329792 270
855 3300026142 Ga0207698_10257712 Ga0207698_102577122 270
856 3300026142 Ga0207698_10323409 Ga0207698_103234092 270
857 3300026142 Ga0207698_10372766 Ga0207698_103727662 270
858 3300026142 Ga0207698_10454248 Ga0207698_104542481 270
859 3300026142 Ga0207698_10456237 Ga0207698_104562371 270
860 3300027462 Ga0210000_1022266 Ga0210000_10222661 270
861 3300027471 Ga0209995_1005032 Ga0209995_10050322 270
862 3300028379 Ga0268266_10000024 Ga0268266_10000024180 270
863 3300028379 Ga0268266_10007977 Ga0268266_100079774 270
864 3300028380 Ga0268265_10087313 Ga0268265_100873131 270
865 3300028380 Ga0268265_10226556 Ga0268265_102265562 270
866 3300028381 Ga0268264_10000109 Ga0268264_10000109145 270
867 3300028381 Ga0268264_10001271 Ga0268264_100012716 270
868 3300028381 Ga0268264_10001954 Ga0268264_1000195411 270
869 3300028381 Ga0268264_10004274 Ga0268264_100042743 270
870 3300028653 Ga0265323_10000975 Ga0265323_1000097514 270
871 3300028786 Ga0307517_10006013 Ga0307517_100060136 270
872 3300028786 Ga0307517_10088779 Ga0307517_100887792 270
873 3300028794 Ga0307515_10000002 Ga0307515_10000002322 270
874 3300028794 Ga0307515_10000072 Ga0307515_1000007242 270
875 3300028794 Ga0307515_10249372 Ga0307515_102493722 270
876 3300030521 Ga0307511_10004747 Ga0307511_100047475 270
877 3300031251 Ga0265327_10000093 Ga0265327_1000009347 270
878 3300031251 Ga0265327_10000148 Ga0265327_10000148116 270
879 3300031251 Ga0265327_10105839 Ga0265327_101058392 270
880 3300031344 Ga0265316_10000618 Ga0265316_1000061814 270
881 3300031344 Ga0265316_10001145 Ga0265316_1000114511 270
882 3300031507 Ga0307509_10025075 Ga0307509_100250753 270
883 3300031548 Ga0307408_100000305 Ga0307408_10000030530 270
884 3300031616 Ga0307508_10001286 Ga0307508_1000128616 270
885 3300031727 Ga0316576_10099200 Ga0316576_100992002 270
886 3300031727 Ga0316576_10146162 Ga0316576_101461623 270
887 3300031731 Ga0307405_10000010 Ga0307405_1000001046 270
888 3300031733 Ga0316577_10099416 Ga0316577_100994162 270
889 3300031852 Ga0307410_10140025 Ga0307410_101400252 270
890 3300031903 Ga0307407_10000042 Ga0307407_1000004242 270
891 3300031911 Ga0307412_10003261 Ga0307412_100032612 270
892 3300032002 Ga0307416_100000019 Ga0307416_10000001913 270
893 3300032004 Ga0307414_10002825 Ga0307414_100028253 270
894 3300035171 Ga0373946_0212995 Ga0373946_0212995_95_916 270
895 3300035172 Ga0373955_0039844 Ga0373955_0039844_987_1814 270
896 3300035398 Ga0316574_0132073 Ga0316574_0132073_533_1354 270
897 3300035410 Ga0373924_0007228 Ga0373924_0007228_1915_2742 270
898 3300035724 Ga0373933_0062270 Ga0373933_0062270_987_1814 270
899 3300035725 Ga0373947_0021674 Ga0373947_0021674_2453_3274 270
900 3300035725 Ga0373947_0058903 Ga0373947_0058903_411_1232 270
901 3300036401 Ga0373937_0005153 Ga0373937_0005153_1247_2074 270
902 3300036401 Ga0373937_0168582 Ga0373937_0168582_894_1715 270
903 3300037312 Ga0395899_0003607 Ga0395899_0003607_7644_8465 270
904 3300037312 Ga0395899_0180455 Ga0395899_0180455_188_1009 270
905 3300037418 Ga0395900_0016503 Ga0395900_0016503_1388_2209 270
906 3300037418 Ga0395900_0109393 Ga0395900_0109393_284_1162 270
907 3300037418 Ga0395900_0321332 Ga0395900_0321332_37_864 270
908 3300037418 Ga0395900_0337680 Ga0395900_0337680_421_1245 270
909 3300037418 Ga0395900_0814931 Ga0395900_0814931_18_842 270
910 3300037466 Ga0395898_0001425 Ga0395898_0001425_32895_33716 270
911 3300037466 Ga0395898_0071097 Ga0395898_0071097_585_1463 270
912 3300037471 Ga0395905_0000003 Ga0395905_0000003_329427_330242 270
913 3300037471 Ga0395905_0073040 Ga0395905_0073040_2036_2863 270
914 3300037471 Ga0395905_0092206 Ga0395905_0092206_807_1631 270
915 3300038443 Ga0395901_0006414 Ga0395901_0006414_5448_6269 270
916 3300038443 Ga0395901_0329352 Ga0395901_0329352_301_1179 270
917 3300039093 Ga0400489_27519 Ga0400489_27519_2016_2840 270
918 3300039437 Ga0436365_0480954 Ga0436365_0480954_4590_5423 270
919 3300041404 Ga0439436_0013332 Ga0439436_0013332_683_1504 270
920 3300041413 Ga0439465_0063206 Ga0439465_0063206_278_1099 270
921 3300041509 Ga0451843_1146337 Ga0451843_1146337_73_894 270
922 3300041997 Ga0439431_0035757 Ga0439431_0035757_222_1061 270
923 3300042007 Ga0439449_0118971 Ga0439449_0118971_128_949 270
924 3300042014 Ga0439457_001586 Ga0439457_001586_2060_2881 270
925 3300042015 Ga0439462_0023582 Ga0439462_0023582_510_1331 270
926 3300042876 Ga0451577_0038696 Ga0451577_0038696_2206_3036 270
927 3300042876 Ga0451577_0053904 Ga0451577_0053904_270_1082 270
928 3300042876 Ga0451577_0252122 Ga0451577_0252122_454_1275 270
929 3300042876 Ga0451577_0400323 Ga0451577_0400323_48_878 270
930 3300042876 Ga0451577_0604840 Ga0451577_0604840_162_983 270
931 3300044656 Ga0466969_0000665 Ga0466969_0000665_13632_14456 270
932 3300044658 Ga0466972_0000013 Ga0466972_0000013_61983_62804 270
933 3300044658 Ga0466972_0000064 Ga0466972_0000064_89713_90537 270
934 3300044658 Ga0466972_0000347 Ga0466972_0000347_17174_17998 270
935 3300044658 Ga0466972_0032268 Ga0466972_0032268_891_1805 270
936 3300044684 Ga0466966_0000806 Ga0466966_0000806_6659_7483 270
937 3300044712 Ga0453684_0000724 Ga0453684_0000724_93120_93950 270
938 3300044712 Ga0453684_0004378 Ga0453684_0004378_2724_3554 270
939 3300044712 Ga0453684_0004818 Ga0453684_0004818_12349_13170 270
940 3300044712 Ga0453684_0019698 Ga0453684_0019698_7668_8489 270
941 3300044712 Ga0453684_0024450 Ga0453684_0024450_1891_2721 270
942 3300044712 Ga0453684_0041364 Ga0453684_0041364_3395_4228 270
943 3300044712 Ga0453684_0047360 Ga0453684_0047360_1967_2788 270
944 3300044712 Ga0453684_0071263 Ga0453684_0071263_902_1726 270
945 3300044712 Ga0453684_0096856 Ga0453684_0096856_85_906 270
946 3300044712 Ga0453684_0143346 Ga0453684_0143346_1732_2562 270
947 3300044712 Ga0453684_0179836 Ga0453684_0179836_1349_2173 270
948 3300044712 Ga0453684_0189010 Ga0453684_0189010_949_1767 270
949 3300044712 Ga0453684_0275112 Ga0453684_0275112_724_1539 270
950 3300044712 Ga0453684_0315998 Ga0453684_0315998_494_1312 270
951 3300044712 Ga0453684_0469802 Ga0453684_0469802_530_1354 270
952 3300044712 Ga0453684_0707475 Ga0453684_0707475_40_867 270
953 3300044712 Ga0453684_0858102 Ga0453684_0858102_92_922 270
954 3300044735 Ga0466968_0010784 Ga0466968_0010784_687_1511 270
955 3300044765 Ga0466970_0000094 Ga0466970_0000094_7190_8014 270
956 3300044765 Ga0466970_0028240 Ga0466970_0028240_1279_2103 270
957 3300044842 Ga0466957_0000070 Ga0466957_0000070_11288_12100 270
958 3300044842 Ga0466957_0009587 Ga0466957_0009587_1280_2101 270
959 3300045049 Ga0466959_0000023 Ga0466959_0000023_105219_106043 270
960 3300045051 Ga0451576_0005479 Ga0451576_0005479_4632_5450 270
961 3300045051 Ga0451576_0042016 Ga0451576_0042016_1501_2316 270
962 3300045051 Ga0451576_0797954 Ga0451576_0797954_137_967 270
963 3300045976 Ga0466967_0059978 Ga0466967_0059978_1944_2768 270
964 3300046453 Ga0495627_089317 Ga0495627_089317_54_866 270
965 3300046460 Ga0495638_0116054 Ga0495638_0116054_279_1103 270
966 3300046463 Ga0495653_0112063 Ga0495653_0112063_987_1814 270
967 3300046471 Ga0495650_0067874 Ga0495650_0067874_170_1003 270
968 3300046472 Ga0495580_0143758 Ga0495580_0143758_189_1010 270
969 3300046472 Ga0495580_0253227 Ga0495580_0253227_204_1025 270
970 3300046473 Ga0495582_0087882 Ga0495582_0087882_54_875 270
971 3300046476 Ga0495662_0142510 Ga0495662_0142510_182_997 270
972 3300046507 Ga0495606_0005411 Ga0495606_0005411_2924_3748 270
973 3300046512 Ga0495610_0001760 Ga0495610_0001760_2319_3131 270
974 3300046512 Ga0495610_0003107 Ga0495610_0003107_2370_3182 270
975 3300046514 Ga0495618_0012660 Ga0495618_0012660_3966_4793 270
976 3300046517 Ga0495630_0021010 Ga0495630_0021010_1986_2813 270
977 3300046524 Ga0495648_0006590 Ga0495648_0006590_465_1289 270
978 3300046535 Ga0495586_0048106 Ga0495586_0048106_1344_2171 270
979 3300046535 Ga0495586_0123057 Ga0495586_0123057_84_905 270
980 3300046536 Ga0495587_0118595 Ga0495587_0118595_394_1221 270
981 3300046559 Ga0495667_0068369 Ga0495667_0068369_1099_1926 270
982 3300046616 Ga0495668_0000191 Ga0495668_0000191_8867_9688 270
983 3300046616 Ga0495668_0002342 Ga0495668_0002342_8496_9317 270
984 3300046642 Ga0495634_0052705 Ga0495634_0052705_898_1719 270
985 3300046642 Ga0495634_0304744 Ga0495634_0304744_19_834 270
986 3300046648 Ga0495611_0000252 Ga0495611_0000252_9341_10165 270
987 3300046648 Ga0495611_0025805 Ga0495611_0025805_1293_2117 270
988 3300046683 Ga0495658_0036056 Ga0495658_0036056_1393_2214 270
989 3300046691 Ga0495670_0078629 Ga0495670_0078629_667_1488 270
990 3300046809 Ga0495600_0094655 Ga0495600_0094655_30_851 270
991 3300047318 Ga0495636_0000049 Ga0495636_0000049_3376_4203 270
992 3300047319 Ga0495674_0012090 Ga0495674_0012090_3995_4816 270
993 3300047320 Ga0495672_0031702 Ga0495672_0031702_1767_2591 270
994 3300047320 Ga0495672_0047219 Ga0495672_0047219_1165_1989 270
995 3300047320 Ga0495672_0120137 Ga0495672_0120137_149_979 270
996 3300047321 Ga0495676_0081222 Ga0495676_0081222_29_850 270
997 3300047321 Ga0495676_0315195 Ga0495676_0315195_48_875 270
998 3300047443 Ga0495687_000014 Ga0495687_000014_171447_172271 270
999 3300047472 Ga0495686_0000034 Ga0495686_0000034_196847_197671 270
1000 3300047472 Ga0495686_0031850 Ga0495686_0031850_330_1151 270
1001 3300047472 Ga0495686_0126490 Ga0495686_0126490_560_1384 270
1002 3300047472 Ga0495686_0148618 Ga0495686_0148618_459_1283 270
1003 3300048908 Ga0496105_0353723 Ga0496105_0353723_80_979 270
1004 3300048909 Ga0496106_0343792 Ga0496106_0343792_153_974 270
1005 3300048911 Ga0496108_0286981 Ga0496108_0286981_175_996 270
1006 3300048912 Ga0496109_0159922 Ga0496109_0159922_195_1016 270
1007 3300048912 Ga0496109_0494019 Ga0496109_0494019_225_1046 270
1008 3300048913 Ga0496110_0543207 Ga0496110_0543207_201_1022 270
1009 3300048918 Ga0496115_0025603 Ga0496115_0025603_2562_3425 270
1010 3300048918 Ga0496115_0369102 Ga0496115_0369102_109_936 270
1011 3300048927 Ga0496124_0028833 Ga0496124_0028833_850_1674 270
1012 3300049568 Ga0501031_0008920 Ga0501031_0008920_1610_2431 270
1013 3300049569 Ga0501032_0006744 Ga0501032_0006744_7493_8314 270
1014 3300049569 Ga0501032_0056211 Ga0501032_0056211_1072_1893 270
1015 3300049570 Ga0501033_0035991 Ga0501033_0035991_742_1563 270
1016 3300049570 Ga0501033_0062187 Ga0501033_0062187_77_898 270
1017 3300049571 Ga0501034_0000399 Ga0501034_0000399_37084_37905 270
1018 3300049571 Ga0501034_0007132 Ga0501034_0007132_8172_8993 270
1019 3300049571 Ga0501034_0027512 Ga0501034_0027512_657_1481 270
1020 3300049571 Ga0501034_0034359 Ga0501034_0034359_3756_4577 270
1021 3300049571 Ga0501034_0114355 Ga0501034_0114355_1210_2037 270
1022 3300049571 Ga0501034_0155149 Ga0501034_0155149_290_1123 270
1023 3300049571 Ga0501034_0315125 Ga0501034_0315125_359_1183 270
1024 3300049571 Ga0501034_0316000 Ga0501034_0316000_136_963 270
1025 3300049572 Ga0501036_0021107 Ga0501036_0021107_2009_2830 270
1026 3300049572 Ga0501036_0031265 Ga0501036_0031265_3513_4337 270
1027 3300049572 Ga0501036_0031936 Ga0501036_0031936_1222_2043 270
1028 3300049573 Ga0501037_0004614 Ga0501037_0004614_6662_7483 270
1029 3300049573 Ga0501037_0037569 Ga0501037_0037569_1078_1899 270
1030 3300049574 Ga0501038_0008621 Ga0501038_0008621_6154_6975 270
1031 3300049574 Ga0501038_0009237 Ga0501038_0009237_2923_3744 270
1032 3300049574 Ga0501038_0014450 Ga0501038_0014450_2477_3301 270
1033 3300049575 Ga0501039_0082895 Ga0501039_0082895_831_1655 270
1034 3300049575 Ga0501039_0083623 Ga0501039_0083623_860_1681 270
1035 3300049579 Ga0501043_0006099 Ga0501043_0006099_4519_5340 270
1036 3300049579 Ga0501043_0011618 Ga0501043_0011618_3654_4478 270
1037 3300049579 Ga0501043_0033806 Ga0501043_0033806_1409_2230 270
1038 3300049579 Ga0501043_0076043 Ga0501043_0076043_388_1209 270
1039 3300049579 Ga0501043_0362232 Ga0501043_0362232_245_1072 270
1040 3300049580 Ga0501046_0007340 Ga0501046_0007340_5646_6470 270
1041 3300049581 Ga0501047_0021899 Ga0501047_0021899_4283_5107 270
1042 3300049581 Ga0501047_0040807 Ga0501047_0040807_1079_1900 270
1043 3300049581 Ga0501047_0054822 Ga0501047_0054822_2216_3037 270
1044 3300049582 Ga0501048_0116127 Ga0501048_0116127_970_1791 270
1045 3300049583 Ga0501067_0009624 Ga0501067_0009624_2691_3515 270
1046 3300049583 Ga0501067_0039532 Ga0501067_0039532_721_1548 270
1047 3300049584 Ga0501068_0162628 Ga0501068_0162628_346_1167 270
1048 3300049586 Ga0501070_0083168 Ga0501070_0083168_91_915 270
1049 3300049587 Ga0501071_0202825 Ga0501071_0202825_571_1398 270
1050 3300049589 Ga0501073_0001901 Ga0501073_0001901_5548_6372 270
1051 3300049589 Ga0501073_0081407 Ga0501073_0081407_1242_2069 270
1052 3300049590 Ga0501074_0001080 Ga0501074_0001080_12749_13573 270
1053 3300049652 Ga0501202_000051 Ga0501202_000051_7327_8154 270
1054 3300049652 Ga0501202_005033 Ga0501202_005033_249_1070 270
1055 3300049660 Ga0501216_020232 Ga0501216_020232_189_1016 270
1056 3300049661 Ga0501217_022286 Ga0501217_022286_654_1481 270
1057 3300049663 Ga0501223_003413 Ga0501223_003413_439_1251 270
1058 3300049663 Ga0501223_004449 Ga0501223_004449_1132_1959 270
1059 3300049686 Ga0501257_001076 Ga0501257_001076_2510_3331 270
1060 3300049688 Ga0501259_000915 Ga0501259_000915_558_1379 270
1061 3300049703 Ga0501219_000752 Ga0501219_000752_2011_2832 270
1062 3300049705 Ga0501225_0011343 Ga0501225_0011343_1624_2445 270
1063 3300049708 Ga0501245_002468 Ga0501245_002468_1072_1893 270
1064 3300049741 Ga0501079_0200118 Ga0501079_0200118_166_990 270
1065 3300049742 Ga0501080_0033602 Ga0501080_0033602_354_1178 270
1066 3300049742 Ga0501080_0133390 Ga0501080_0133390_1039_1866 270
1067 3300049744 Ga0501083_0008410 Ga0501083_0008410_5543_6367 270
1068 3300049744 Ga0501083_0014634 Ga0501083_0014634_2093_2920 270
1069 3300049763 Ga0501266_004672 Ga0501266_004672_113_934 270
1070 3300049822 Ga0501035_0015725 Ga0501035_0015725_5800_6621 270
1071 3300049822 Ga0501035_0017194 Ga0501035_0017194_3562_4383 270
1072 3300049822 Ga0501035_0023744 Ga0501035_0023744_1194_2018 270
1073 3300049822 Ga0501035_0360903 Ga0501035_0360903_169_990 270
1074 3300049822 Ga0501035_0540226 Ga0501035_0540226_20_853 270
1075 3300049823 Ga0501044_0003839 Ga0501044_0003839_9572_10393 270
1076 3300049823 Ga0501044_0009313 Ga0501044_0009313_450_1274 270
1077 3300049823 Ga0501044_0018183 Ga0501044_0018183_3496_4317 270
1078 3300049823 Ga0501044_0067496 Ga0501044_0067496_572_1393 270
1079 3300049823 Ga0501044_0389642 Ga0501044_0389642_179_1006 270
1080 3300049823 Ga0501044_0403448 Ga0501044_0403448_37_858 270
1081 3300050005 Ga0501284_00019 Ga0501284_00019_20732_21553 270
1082 3300050493 nmdc:mga0k408_7375_c1 nmdc:mga0k408_7375_c1_2929_3750 270
1083 3300050507 nmdc:mga05p37_288459_c1 nmdc:mga05p37_288459_c1_653_1474 270
1084 3300050507 nmdc:mga05p37_3288_c1 nmdc:mga05p37_3288_c1_17894_18715 270
1085 3300050508 nmdc:mga09592_108348_c1 nmdc:mga09592_108348_c1_542_1363 270
1086 3300050511 nmdc:mga08y16_160301_c1 nmdc:mga08y16_160301_c1_1401_2222 270
1087 3300050511 nmdc:mga08y16_22514_c1 nmdc:mga08y16_22514_c1_875_1696 270
1088 3300050511 nmdc:mga08y16_511295_c1 nmdc:mga08y16_511295_c1_374_1195 270
1089 3300050511 nmdc:mga08y16_783501_c1 nmdc:mga08y16_783501_c1_93_914 270
1090 3300053077 Ga0495601_0179435 Ga0495601_0179435_472_1293 270
1091 3300053086 Ga0500578_0000150 Ga0500578_0000150_6258_7079 270
1092 3300053090 Ga0500646_0000820 Ga0500646_0000820_4884_5765 270
1093 3300053092 Ga0500583_0000108 Ga0500583_0000108_35806_36627 270
1094 3300053092 Ga0500583_0004734 Ga0500583_0004734_3029_3850 270
1095 3300053118 Ga0500594_0008751 Ga0500594_0008751_1466_2287 270
1096 3300053118 Ga0500594_0041262 Ga0500594_0041262_89_910 270
1097 3300053130 Ga0500642_0034331 Ga0500642_0034331_1011_1835 270
1098 3300053139 Ga0500568_0000789 Ga0500568_0000789_16369_17190 270
1099 3300053150 Ga0500603_068004 Ga0500603_068004_11_832 270
1100 3300053151 Ga0500604_0000484 Ga0500604_0000484_2205_3026 270
1101 3300053153 Ga0500616_0075315 Ga0500616_0075315_600_1421 270
1102 3300053153 Ga0500616_0104336 Ga0500616_0104336_382_1206 270
1103 3300053156 Ga0500622_0000304 Ga0500622_0000304_23946_24770 270
1104 3300053156 Ga0500622_0007889 Ga0500622_0007889_90_911 270
1105 3300053156 Ga0500622_0008720 Ga0500622_0008720_2107_2931 270
1106 3300053156 Ga0500622_0023113 Ga0500622_0023113_898_1719 270
1107 3300053178 Ga0500637_0157527 Ga0500637_0157527_403_1227 270
1108 3300053730 Ga0500645_004553 Ga0500645_004553_772_1713 270
1109 3300054114 Ga0501084_0069145 Ga0501084_0069145_1794_2618 270
1110 3300054114 Ga0501084_0307219 Ga0501084_0307219_372_1199 270
1111 3300055283 Ga0500661_005721 Ga0500661_005721_1275_2099 270
1112 3300060353 Ga0501082_0366013 Ga0501082_0366013_343_1164 270
1113 3300061719 Ga0466962_0136586 Ga0466962_0136586_154_978 270
1114 iso_pu_bacteria 2818991444 2819588687 270
1115 iso_pu_bacteria 2914759650 2914760382 270
1116 iso_pu_bacteria 2929154850 2929157628 270
1117 2162886007 SwRhRL2b_contig_2039605 SwRhRL2b_0824.00004670 271
1118 2162886007 SwRhRL2b_contig_2513460 SwRhRL2b_0966.00006370 271
1119 3300005288 Ga0065714_10003657 Ga0065714_1000365723 271
1120 3300005288 Ga0065714_10004961 Ga0065714_100049614 271
1121 3300005288 Ga0065714_10064664 Ga0065714_100646642 271
1122 3300005288 Ga0065714_10064897 Ga0065714_1006489716 271
1123 3300005288 Ga0065714_10118971 Ga0065714_101189712 271
1124 3300005289 Ga0065704_10000193 Ga0065704_1000019350 271
1125 3300009545 Ga0105237_10006737 Ga0105237_100067376 271
1126 3300013100 Ga0157373_10000136 Ga0157373_100001362 271
1127 3300013102 Ga0157371_10004753 Ga0157371_1000475311 271
1128 3300013102 Ga0157371_10007420 Ga0157371_100074202 271
1129 3300013102 Ga0157371_10011958 Ga0157371_100119582 271
1130 3300013104 Ga0157370_10011097 Ga0157370_100110977 271
1131 3300013104 Ga0157370_10029726 Ga0157370_100297262 271
1132 3300013104 Ga0157370_10084627 Ga0157370_100846272 271
1133 3300013104 Ga0157370_10144239 Ga0157370_101442392 271
1134 3300013104 Ga0157370_10190126 Ga0157370_101901262 271
1135 3300013308 Ga0157375_10531593 Ga0157375_105315931 271
1136 3300014497 Ga0182008_10000018 Ga0182008_10000018151 271
1137 3300014497 Ga0182008_10000378 Ga0182008_1000037831 271
1138 3300014497 Ga0182008_10033160 Ga0182008_100331602 271
1139 3300015261 Ga0182006_1000382 Ga0182006_100038218 271
1140 3300015261 Ga0182006_1007681 Ga0182006_10076815 271
1141 3300015261 Ga0182006_1044752 Ga0182006_10447522 271
1142 3300017792 Ga0163161_10000153 Ga0163161_1000015357 271
1143 3300017792 Ga0163161_10006269 Ga0163161_100062696 271
1144 3300025914 Ga0207671_10011928 Ga0207671_100119283 271
1145 3300025935 Ga0207709_10000006 Ga0207709_10000006383 271
1146 3300030731 Ga0316177_1057164 Ga0316177_10571643 271
1147 3300030732 Ga0316176_1020373 Ga0316176_10203738 271
1148 3300030742 Ga0316183_1111132 Ga0316183_111113236 271
1149 3300030744 Ga0316181_1134699 Ga0316181_11346997 271
1150 3300030745 Ga0316182_1300351 Ga0316182_13003512 271
1151 3300031911 Ga0307412_10000077 Ga0307412_1000007739 271
1152 3300032004 Ga0307414_10011145 Ga0307414_100111454 271
1153 3300032004 Ga0307414_10054109 Ga0307414_100541092 271
1154 3300032004 Ga0307414_10055748 Ga0307414_100557482 271
1155 3300032004 Ga0307414_10491851 Ga0307414_104918511 271
1156 3300032004 Ga0307414_10634722 Ga0307414_106347222 271
1157 3300036712 Ga0316584_0005044 Ga0316584_0005044_7676_8521 271
1158 3300048919 Ga0496116_0001546 Ga0496116_0001546_15247_16062 271
1159 3300048920 Ga0496117_0007089 Ga0496117_0007089_6779_7594 271
1160 3300048921 Ga0496118_0195100 Ga0496118_0195100_329_1144 271
1161 3300048925 Ga0496122_0000746 Ga0496122_0000746_12785_13600 271
1162 3300048925 Ga0496122_0008031 Ga0496122_0008031_5739_6554 271
1163 3300048926 Ga0496123_0030182 Ga0496123_0030182_2859_3674 271
1164 3300048926 Ga0496123_0096201 Ga0496123_0096201_204_1019 271
1165 3300048927 Ga0496124_0113530 Ga0496124_0113530_604_1419 271
1166 3300048928 Ga0496125_0211980 Ga0496125_0211980_343_1158 271
1167 3300053093 Ga0500651_0000127 Ga0500651_0000127_35662_36477 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

11

264

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fs2-assembly1.cif.gz_B crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.9772 16 270
3fs2-assembly1.cif.gz_A crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from bruciella melitensis at 1.85a resolution 0.9761 14 270
2nxh-assembly2.cif.gz_H structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase. 0.9684 16 270
1lrn-assembly1.cif.gz_B-2 aquifex aeolicus kdo8p synthase h185g mutant in complex with cadmium 0.9681 16 270
1lrq-assembly1.cif.gz_B aquifex aeolicus kdo8p synthase h185g mutant in complex with pep, a5p and cadmium 0.9681 16 270
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9624 15 270 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9428 9 270 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9339 15 270 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9241 16 269 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.913 15 269 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A800F255-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9967 93 198 GO:0005737
GO:0008676
GO:0009103
AF-A0A6P1B415-F1-model_v4 deleted 0.9923 119 203
AF-A0A519WMH6-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9914 8 142 GO:0005737
GO:0008676
GO:0009103
AF-A0A1I3IEC6-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9913 3 269 GO:0005737
GO:0008676
GO:0009103
AF-A0A2S1Q9C8-F1-model_v4 3-deoxy-8-phosphooctulonate synthase (EC 2.5.1.55) 0.9911 8 270 GO:0005737
GO:0008676
GO:0009103

Feature Viewer

pLDDT pTM Quality
92.46 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map