F491033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1162 | 928 | 532 | 278 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221659|2644336357 |
| Length | 331 |
| Sequence | GHNRRWRFRQPSVLPGFGLALGVTLFWLVLIILIPLSGLIWRSSGLGWSQFMTLALDTRTLNALRISFGTAFVAAIVNLIFGVILAWVLVRYRFPGKRVIDAMVAATRTLNALRISFGTAFVAAIVNLIFGVILAWVLVRYRFPGKRVIDAMVDLPXALPTAVAGIALATLYAPNGWIGALLAPLGIKIAFTPIGIVIALIFVGLPFVVRTVQPIMEEIDKEVEEAAATLGASRFQTIRRVLLPGLLPAGLTGFALAFARGVGEYGSVIFIAGNLPYVSEIAPLXIVIRLEEFNYPAATAIAAVMLVISFAMLLVINSIQAWSRRRYVYVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 29 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 30 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 33 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 34 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 35 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 36 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 37 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 42 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 43 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 44 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 45 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 46 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 47 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 48 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 49 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 50 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 51 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 52 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 53 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 54 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 55 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 56 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 57 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 58 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 59 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 60 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 61 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 62 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 63 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 64 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 65 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 66 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 67 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 68 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 69 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 70 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 71 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 72 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 73 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 74 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 75 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 76 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 77 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 78 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 79 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 80 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 81 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 82 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 83 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 84 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 85 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 86 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 87 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 88 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 89 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 90 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 91 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 92 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 93 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 94 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 95 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 96 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 97 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 98 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 99 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 100 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 101 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 102 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 103 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 104 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 105 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 106 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 107 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 108 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 109 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 110 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 111 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 112 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 113 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 114 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 115 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 116 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 117 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 118 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 119 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 120 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 121 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 122 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 123 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 124 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 125 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 126 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 127 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 128 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 129 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 130 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 131 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 132 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 133 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 134 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 135 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 136 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 137 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 138 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 139 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 140 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 141 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 142 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 143 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 144 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 145 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 146 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 147 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 148 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 149 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 150 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 151 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 152 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 153 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 154 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 155 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 156 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 157 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 158 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 159 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 160 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 161 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 162 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 163 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 164 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 165 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 166 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 167 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 168 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 169 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 170 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 171 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 172 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 173 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 174 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 175 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 176 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 177 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 178 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 179 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 180 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 181 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 182 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 183 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 184 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 185 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 186 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 187 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 188 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 189 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 190 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 191 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 192 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 193 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 194 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 195 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 196 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 197 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 198 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 199 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 200 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 201 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 202 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 203 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 204 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 205 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 206 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 207 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 208 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 209 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 210 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 211 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 212 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 213 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 214 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 215 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 216 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 217 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 218 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 219 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 220 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 221 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 222 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 223 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 224 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 225 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 226 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 227 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 228 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 229 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 230 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 231 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 232 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 233 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 234 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 235 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 236 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 237 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 238 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 239 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 240 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 241 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 242 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 243 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 244 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 245 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 246 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 247 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 248 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 249 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 250 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 251 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 252 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 253 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 254 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 255 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 256 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 257 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 258 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 259 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 260 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 261 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 262 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 263 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 264 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 265 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 266 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 267 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 268 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 269 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 270 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 271 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 272 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 273 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 274 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 275 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 276 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 277 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 278 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 279 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 280 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 281 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 282 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 283 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 284 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 285 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 286 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 287 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 288 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 289 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 290 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 291 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 292 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 293 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 294 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 295 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 296 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 297 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 298 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 299 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 300 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 301 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 302 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 303 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 304 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 305 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 306 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 307 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 308 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 309 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 310 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 311 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 312 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 313 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 314 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 315 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 316 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 317 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 318 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 319 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 320 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 321 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 322 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 323 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 324 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 325 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 326 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 327 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 328 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 329 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 330 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 331 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 332 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 333 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 334 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 335 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 336 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 337 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 338 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 339 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 340 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 341 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 342 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 343 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 344 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 345 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 346 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 347 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 348 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 349 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 350 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 351 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 352 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 353 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 354 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 355 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 356 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 357 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 358 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 359 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 360 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 361 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 362 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 363 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 364 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 365 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 366 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 367 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 368 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 369 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 370 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 371 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 372 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 373 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 374 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 375 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 376 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 377 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 378 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 379 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 380 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 381 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 382 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 383 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 384 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 385 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 386 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 387 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 388 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 389 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 390 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 391 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 392 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 393 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 394 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 395 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 396 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 397 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 398 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 399 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 400 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 401 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 402 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 403 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 404 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 405 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 406 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 407 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 408 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 409 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 410 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 411 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 412 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 413 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 414 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 415 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 416 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 417 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 418 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 419 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 420 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 421 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 422 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 423 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 424 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 425 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 426 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 427 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 428 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 429 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 430 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 431 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 432 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 433 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 434 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 435 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 436 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 437 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 438 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 439 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 440 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 441 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 442 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 443 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 444 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 445 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 446 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 447 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 448 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 449 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 450 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 451 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 452 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 453 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 454 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 455 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 456 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 457 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 458 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 459 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 460 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 461 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 462 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 463 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 464 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 465 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 466 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 467 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 468 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 469 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 470 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 471 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 472 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 473 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 474 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 475 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 476 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 477 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 478 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 479 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 480 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 481 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 482 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 483 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 484 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 485 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 486 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 487 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 488 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 489 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 490 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 491 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 492 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 493 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 494 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 495 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 496 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 497 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 498 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 499 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 500 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 501 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 502 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 503 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 504 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 505 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 506 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 507 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 508 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 509 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 510 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 511 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 512 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 513 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 514 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 515 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 516 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 517 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 518 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 519 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 520 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 521 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 522 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 523 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 524 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 525 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 526 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 527 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 528 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 529 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 530 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 531 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 532 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 533 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 534 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 535 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 536 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 537 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 538 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 539 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 540 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 541 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 542 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 543 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 544 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 545 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 546 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 547 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 548 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 549 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 550 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 551 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 552 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 553 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 554 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 555 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 556 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 557 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 558 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 559 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 560 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 561 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 562 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 563 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 564 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 565 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 566 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 567 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 568 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 569 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 570 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 571 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 572 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 573 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 574 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 575 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 576 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 577 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 578 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 579 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 580 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 581 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 582 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 583 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 584 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 585 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 586 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 587 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 588 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 589 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 590 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 591 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 592 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 593 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 594 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 595 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 596 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 597 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 598 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 599 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 600 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 601 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 602 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 603 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 604 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 605 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 606 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 607 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 608 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 609 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 610 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 611 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 612 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 613 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 614 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 615 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 616 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 617 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 618 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 619 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 620 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 621 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 622 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 623 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 624 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 625 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 626 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 627 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 629 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 630 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 632 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 633 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 634 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 636 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 637 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 638 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 639 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 640 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 641 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 642 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 643 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 644 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 645 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 646 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 647 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 648 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 649 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 650 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 651 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 652 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 653 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 654 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 655 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 656 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 657 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 658 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 659 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 660 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 661 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 662 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 663 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 664 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 665 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 666 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 667 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 668 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 669 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 670 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 671 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 672 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 673 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 674 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 675 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 676 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 677 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 678 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 679 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 684 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 703 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 705 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 706 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 707 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 708 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 709 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 711 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 712 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 713 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 714 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 715 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 716 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 717 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 718 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 719 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 720 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 721 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 722 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 723 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 724 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 725 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 726 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 727 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 728 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 729 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 730 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 731 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 732 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 733 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 734 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 735 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 736 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 737 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 738 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 739 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 740 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 741 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 742 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 743 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 744 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 745 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 746 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 747 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 748 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 749 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 750 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 751 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 752 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 753 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 754 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 755 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 756 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 757 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 758 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 759 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 791 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 792 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 793 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 794 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 795 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 796 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 797 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 798 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 799 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 800 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 801 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 802 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 803 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 804 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 805 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 806 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 807 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 808 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 809 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 810 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 811 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 812 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 813 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 814 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 815 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 816 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 817 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 818 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 819 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 820 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 821 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 823 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 824 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 825 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 826 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 827 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 828 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 829 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 830 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 831 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 832 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 833 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 834 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 835 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 836 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 837 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 839 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 840 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 841 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 842 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 843 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 844 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 845 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 846 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 847 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 848 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 849 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 850 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 851 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 852 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 853 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 854 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 855 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 856 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 857 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 858 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 859 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 860 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 861 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 862 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 863 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 864 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 865 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 866 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 867 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 868 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 869 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 870 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 871 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 872 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 873 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 874 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 875 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 876 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 877 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 878 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 879 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 880 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 881 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 882 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 883 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 884 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 885 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 886 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 887 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 888 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 889 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 890 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 891 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 892 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 893 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 894 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 895 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 896 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 897 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 898 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 899 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 900 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 901 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 902 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 903 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 904 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 905 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 906 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 907 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 908 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 909 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 910 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 911 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 912 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 913 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 914 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 915 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 916 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 917 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 918 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 919 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 920 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 921 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 922 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 923 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 924 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 925 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 926 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 927 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 928 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 45.78 |
| Metatranscriptomes | 0 |
| Isolates | 54.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 11.96 |
| Nodule | 44.41 |
| Rhizoplane | 1.64 |
| Rhizosphere | 29.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013439 | 3300001979 | Bacteria | 3052 |
| 2 | JGI25158J39367_1000612 | 3300002739 | Bacteria | 7083 |
| 3 | JGI25152J39213_1002543 | 3300002773 | Bacteria | 6869 |
| 4 | JGI25152J39213_1004158 | 3300002773 | Bacteria | 4668 |
| 5 | JGI25150J39212_1000746 | 3300002774 | Bacteria | 11487 |
| 6 | JGI25159J45721_1000089 | 3300002987 | Bacteria | 43695 |
| 7 | JGI25151J46595_10000632 | 3300003187 | Bacteria | 30374 |
| 8 | JGI25151J46595_10078334 | 3300003187 | Bacteria | 967 |
| 9 | JGI25153J46596_10003277 | 3300003215 | Bacteria | 9095 |
| 10 | rootH1_10007030 | 3300003316 | Bacteria | 3759 |
| 11 | rootL2_10028121 | 3300003322 | Bacteria | 4009 |
| 12 | JGI25160J50197_1000726 | 3300003354 | Bacteria | 18068 |
| 13 | JGI25160J50197_1004162 | 3300003354 | Bacteria | 6296 |
| 14 | JGI25161J50226_1001711 | 3300003374 | Bacteria | 6238 |
| 15 | JGI25161J50226_1003754 | 3300003374 | Bacteria | 3370 |
| 16 | Ga0055542_1000406 | 3300003762 | Bacteria | 42163 |
| 17 | Ga0055526_1005972 | 3300003771 | Bacteria | 6774 |
| 18 | Ga0055526_1023052 | 3300003771 | Bacteria | 2090 |
| 19 | Ga0055524_1009871 | 3300003775 | Bacteria | 3844 |
| 20 | Ga0055524_1013258 | 3300003775 | Bacteria | 3116 |
| 21 | Ga0055524_1026599 | 3300003775 | Bacteria | 1782 |
| 22 | Ga0055536_1015627 | 3300003781 | Bacteria | 2585 |
| 23 | Ga0055528_1000514 | 3300003790 | Bacteria | 30392 |
| 24 | Ga0055528_1001577 | 3300003790 | Bacteria | 13583 |
| 25 | Ga0055528_1001960 | 3300003790 | Bacteria | 11625 |
| 26 | Ga0055528_1004369 | 3300003790 | Bacteria | 6817 |
| 27 | Ga0055540_1000050 | 3300003792 | Bacteria | 145565 |
| 28 | Ga0055540_1006737 | 3300003792 | Bacteria | 4493 |
| 29 | Ga0055540_1008653 | 3300003792 | Bacteria | 3637 |
| 30 | Ga0055540_1022646 | 3300003792 | Bacteria | 1601 |
| 31 | Ga0058692_1003904 | 3300003856 | Bacteria | 4520 |
| 32 | Ga0058692_1006922 | 3300003856 | Bacteria | 3059 |
| 33 | Ga0055543_1000021 | 3300004625 | Bacteria | 150116 |
| 34 | Ga0055543_1001872 | 3300004625 | Bacteria | 7654 |
| 35 | Ga0065165_1008053 | 3300005262 | Bacteria | 5032 |
| 36 | Ga0065165_1010256 | 3300005262 | Bacteria | 4077 |
| 37 | Ga0065165_1013986 | 3300005262 | Bacteria | 3144 |
| 38 | Ga0070658_10000306 | 3300005327 | Bacteria | 42420 |
| 39 | Ga0070666_10007956 | 3300005335 | Bacteria | 6555 |
| 40 | Ga0070680_100061370 | 3300005336 | Bacteria | 3077 |
| 41 | Ga0070680_100237580 | 3300005336 | Bacteria | 1540 |
| 42 | Ga0070660_100013010 | 3300005339 | Bacteria | 5955 |
| 43 | Ga0070660_100054084 | 3300005339 | Bacteria | 3098 |
| 44 | Ga0070660_100266434 | 3300005339 | Bacteria | 1400 |
| 45 | Ga0070691_10005336 | 3300005341 | Bacteria | 5844 |
| 46 | Ga0070710_10047776 | 3300005437 | Bacteria | 2388 |
| 47 | Ga0070694_100422365 | 3300005444 | Bacteria | 1048 |
| 48 | Ga0070663_100055676 | 3300005455 | Bacteria | 2832 |
| 49 | Ga0070663_100203964 | 3300005455 | Bacteria | 1545 |
| 50 | Ga0070678_100001773 | 3300005456 | Bacteria | 11631 |
| 51 | Ga0070681_10054794 | 3300005458 | Bacteria | 3973 |
| 52 | Ga0070681_10109686 | 3300005458 | Bacteria | 2700 |
| 53 | Ga0070679_100058190 | 3300005530 | Bacteria | 3851 |
| 54 | Ga0070665_100000259 | 3300005548 | Bacteria | 86776 |
| 55 | Ga0070665_100012214 | 3300005548 | Bacteria | 8658 |
| 56 | Ga0070665_100020770 | 3300005548 | Bacteria | 6599 |
| 57 | Ga0070665_100051533 | 3300005548 | Bacteria | 4127 |
| 58 | Ga0070665_100388784 | 3300005548 | Bacteria | 1403 |
| 59 | Ga0068855_100046104 | 3300005563 | Bacteria | 5154 |
| 60 | Ga0068855_100120651 | 3300005563 | Bacteria | 3001 |
| 61 | Ga0068855_100449938 | 3300005563 | Bacteria | 1405 |
| 62 | Ga0068854_100243624 | 3300005578 | Bacteria | 1433 |
| 63 | Ga0068856_100458768 | 3300005614 | Bacteria | 1295 |
| 64 | Ga0068864_100015795 | 3300005618 | Bacteria | 6281 |
| 65 | Ga0068864_100292261 | 3300005618 | Bacteria | 1523 |
| 66 | Ga0068866_10172455 | 3300005718 | Bacteria | 1271 |
| 67 | Ga0068870_10231163 | 3300005840 | Bacteria | 1137 |
| 68 | Ga0068863_100007513 | 3300005841 | Bacteria | 10659 |
| 69 | Ga0068863_100260509 | 3300005841 | Bacteria | 1676 |
| 70 | Ga0081455_10001242 | 3300005937 | Bacteria | 31869 |
| 71 | Ga0081539_10041427 | 3300005985 | Bacteria | 2692 |
| 72 | Ga0070717_10107994 | 3300006028 | Bacteria | 2371 |
| 73 | Ga0075365_10009120 | 3300006038 | Bacteria | 5681 |
| 74 | Ga0075365_10058866 | 3300006038 | Bacteria | 2559 |
| 75 | Ga0075368_10002017 | 3300006042 | Bacteria | 6566 |
| 76 | Ga0075364_10041976 | 3300006051 | Bacteria | 2971 |
| 77 | Ga0070715_10002984 | 3300006163 | Bacteria | 5294 |
| 78 | Ga0070712_100043939 | 3300006175 | Bacteria | 3078 |
| 79 | Ga0075362_10054467 | 3300006177 | Bacteria | 1798 |
| 80 | Ga0075367_10005310 | 3300006178 | Bacteria | 6378 |
| 81 | Ga0075367_10068887 | 3300006178 | Bacteria | 2123 |
| 82 | Ga0075367_10236798 | 3300006178 | Bacteria | 1143 |
| 83 | Ga0075369_10006778 | 3300006186 | Bacteria | 4343 |
| 84 | Ga0075369_10044423 | 3300006186 | Bacteria | 1909 |
| 85 | Ga0075366_10047182 | 3300006195 | Bacteria | 2553 |
| 86 | Ga0075366_10075960 | 3300006195 | Bacteria | 2005 |
| 87 | Ga0097621_100002147 | 3300006237 | Bacteria | 13495 |
| 88 | Ga0097621_100023769 | 3300006237 | Bacteria | 4775 |
| 89 | Ga0097621_100065912 | 3300006237 | Bacteria | 2982 |
| 90 | Ga0068871_100000379 | 3300006358 | Bacteria | 31123 |
| 91 | Ga0068871_100032006 | 3300006358 | Bacteria | 4150 |
| 92 | Ga0068871_100067275 | 3300006358 | Bacteria | 2939 |
| 93 | Ga0068871_100077735 | 3300006358 | Bacteria | 2743 |
| 94 | Ga0068871_100295841 | 3300006358 | Bacteria | 1420 |
| 95 | Ga0068865_100002567 | 3300006881 | Bacteria | 10774 |
| 96 | Ga0068865_100036475 | 3300006881 | Bacteria | 3315 |
| 97 | Ga0097620_100432734 | 3300006931 | Bacteria | 1412 |
| 98 | Ga0079104_1024883 | 3300006946 | Bacteria | 1571 |
| 99 | Ga0099826_10000070 | 3300006948 | Bacteria | 53527 |
| 100 | Ga0099826_10004568 | 3300006948 | Bacteria | 9732 |
| 101 | Ga0105240_10108595 | 3300009093 | Bacteria | 3361 |
| 102 | Ga0111539_10549964 | 3300009094 | Bacteria | 1345 |
| 103 | Ga0105245_10066293 | 3300009098 | Bacteria | 3267 |
| 104 | Ga0105242_10531969 | 3300009176 | Bacteria | 1124 |
| 105 | Ga0105248_10000125 | 3300009177 | Bacteria | 88470 |
| 106 | Ga0105237_10430051 | 3300009545 | Bacteria | 1326 |
| 107 | Ga0105238_10027478 | 3300009551 | Bacteria | 5800 |
| 108 | Ga0105238_10474781 | 3300009551 | Bacteria | 1249 |
| 109 | Ga0123341_1000109 | 3300009765 | Bacteria | 36496 |
| 110 | Ga0123342_1028378 | 3300009766 | Bacteria | 3028 |
| 111 | Ga0157373_10008462 | 3300013100 | Bacteria | 7639 |
| 112 | Ga0157371_10000200 | 3300013102 | Bacteria | 87804 |
| 113 | Ga0157370_10000090 | 3300013104 | Bacteria | 103336 |
| 114 | Ga0157370_10188324 | 3300013104 | Bacteria | 1916 |
| 115 | Ga0157369_10083569 | 3300013105 | Bacteria | 3414 |
| 116 | Ga0171463_1010 | 3300013249 | Bacteria | 269975 |
| 117 | Ga0157374_10037596 | 3300013296 | Bacteria | 4444 |
| 118 | Ga0163162_10020835 | 3300013306 | Bacteria | 6445 |
| 119 | Ga0163162_10065009 | 3300013306 | Bacteria | 3694 |
| 120 | Ga0157372_10063316 | 3300013307 | Bacteria | 4147 |
| 121 | Ga0157375_10158012 | 3300013308 | Bacteria | 2407 |
| 122 | Ga0163163_10000021 | 3300014325 | Bacteria | 191799 |
| 123 | Ga0163163_10042855 | 3300014325 | Bacteria | 4435 |
| 124 | Ga0157380_10002315 | 3300014326 | Bacteria | 12792 |
| 125 | Ga0157380_10040338 | 3300014326 | Bacteria | 3636 |
| 126 | Ga0157379_10004679 | 3300014968 | Bacteria | 11746 |
| 127 | Ga0157376_10013994 | 3300014969 | Bacteria | 6004 |
| 128 | Ga0157376_10427211 | 3300014969 | Bacteria | 1287 |
| 129 | Ga0183365_10468 | 3300015684 | Bacteria | 1313 |
| 130 | Ga0183363_1056 | 3300015690 | Bacteria | 35540 |
| 131 | Ga0214544_1000123 | 3300021320 | Bacteria | 110258 |
| 132 | Ga0214542_1000027 | 3300021321 | Bacteria | 175107 |
| 133 | Ga0214542_1000141 | 3300021321 | Bacteria | 104386 |
| 134 | Ga0214542_1025614 | 3300021321 | Bacteria | 3038 |
| 135 | Ga0214543_1000025 | 3300021327 | Bacteria | 225351 |
| 136 | Ga0214543_1000026 | 3300021327 | Bacteria | 220652 |
| 137 | Ga0214543_1000047 | 3300021327 | Bacteria | 150894 |
| 138 | Ga0228711_1015241 | 3300022739 | Bacteria | 8428 |
| 139 | Ga0228710_1006811 | 3300022740 | Bacteria | 17155 |
| 140 | Ga0207425_1020985 | 3300025245 | Bacteria | 1389 |
| 141 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 142 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 143 | Ga0209129_1000536 | 3300025258 | Bacteria | 26442 |
| 144 | Ga0209565_1010175 | 3300025263 | Bacteria | 2344 |
| 145 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 146 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 147 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 148 | Ga0209673_1002729 | 3300025273 | Bacteria | 11649 |
| 149 | Ga0209673_1002876 | 3300025273 | Bacteria | 10948 |
| 150 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 151 | Ga0209130_1013126 | 3300025284 | Bacteria | 2134 |
| 152 | Ga0209675_1020239 | 3300025291 | Bacteria | 1809 |
| 153 | Ga0209676_1000666 | 3300025292 | Bacteria | 49043 |
| 154 | Ga0209676_1002188 | 3300025292 | Bacteria | 14649 |
| 155 | Ga0209676_1004240 | 3300025292 | Bacteria | 8103 |
| 156 | Ga0209025_1000072 | 3300025294 | Bacteria | 283452 |
| 157 | Ga0209025_1000593 | 3300025294 | Bacteria | 65364 |
| 158 | Ga0209025_1005657 | 3300025294 | Bacteria | 10066 |
| 159 | Ga0209564_1000081 | 3300025295 | Bacteria | 261592 |
| 160 | Ga0209564_1000100 | 3300025295 | Bacteria | 224016 |
| 161 | Ga0209564_1001437 | 3300025295 | Bacteria | 24420 |
| 162 | Ga0209564_1002441 | 3300025295 | Bacteria | 14707 |
| 163 | Ga0209758_1000053 | 3300025297 | Bacteria | 337751 |
| 164 | Ga0209758_1000712 | 3300025297 | Bacteria | 49095 |
| 165 | Ga0209758_1000937 | 3300025297 | Bacteria | 39370 |
| 166 | Ga0209758_1004308 | 3300025297 | Bacteria | 11994 |
| 167 | Ga0209758_1007213 | 3300025297 | Bacteria | 7652 |
| 168 | Ga0209050_1000852 | 3300025298 | Bacteria | 41567 |
| 169 | Ga0209256_1000146 | 3300025299 | Bacteria | 149440 |
| 170 | Ga0209256_1000458 | 3300025299 | Bacteria | 61611 |
| 171 | Ga0209256_1000818 | 3300025299 | Bacteria | 39749 |
| 172 | Ga0209256_1002209 | 3300025299 | Bacteria | 16647 |
| 173 | Ga0209256_1002923 | 3300025299 | Bacteria | 12843 |
| 174 | Ga0209256_1003989 | 3300025299 | Bacteria | 9683 |
| 175 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 176 | Ga0207426_1000035 | 3300025302 | Bacteria | 448327 |
| 177 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 178 | Ga0209051_1003025 | 3300025303 | Bacteria | 11387 |
| 179 | Ga0209051_1020955 | 3300025303 | Bacteria | 2798 |
| 180 | Ga0209051_1021053 | 3300025303 | Bacteria | 2789 |
| 181 | Ga0209051_1025528 | 3300025303 | Bacteria | 2401 |
| 182 | Ga0209257_1011007 | 3300025304 | Bacteria | 4442 |
| 183 | Ga0207642_10073489 | 3300025899 | Bacteria | 1635 |
| 184 | Ga0207680_10022847 | 3300025903 | Bacteria | 3407 |
| 185 | Ga0207647_10209785 | 3300025904 | Bacteria | 1125 |
| 186 | Ga0207705_10004544 | 3300025909 | Bacteria | 10479 |
| 187 | Ga0207705_10013932 | 3300025909 | Bacteria | 5798 |
| 188 | Ga0207705_10037604 | 3300025909 | Bacteria | 3463 |
| 189 | Ga0207707_10021399 | 3300025912 | Bacteria | 5654 |
| 190 | Ga0207707_10160952 | 3300025912 | Bacteria | 1963 |
| 191 | Ga0207695_10069592 | 3300025913 | Bacteria | 3601 |
| 192 | Ga0207695_10111937 | 3300025913 | Bacteria | 2708 |
| 193 | Ga0207695_10176098 | 3300025913 | Bacteria | 2062 |
| 194 | Ga0207660_10052792 | 3300025917 | Bacteria | 2895 |
| 195 | Ga0207657_10001927 | 3300025919 | Bacteria | 22401 |
| 196 | Ga0207657_10001958 | 3300025919 | Bacteria | 22216 |
| 197 | Ga0207657_10069253 | 3300025919 | Bacteria | 2995 |
| 198 | Ga0207657_10133893 | 3300025919 | Bacteria | 2029 |
| 199 | Ga0207652_10061712 | 3300025921 | Bacteria | 3238 |
| 200 | Ga0207694_10020708 | 3300025924 | Bacteria | 4980 |
| 201 | Ga0207694_10443010 | 3300025924 | Bacteria | 1084 |
| 202 | Ga0207687_10025592 | 3300025927 | Bacteria | 3948 |
| 203 | Ga0207687_10119625 | 3300025927 | Bacteria | 1968 |
| 204 | Ga0207664_10395722 | 3300025929 | Bacteria | 1228 |
| 205 | Ga0207704_10004470 | 3300025938 | Bacteria | 6390 |
| 206 | Ga0207704_10004497 | 3300025938 | Bacteria | 6374 |
| 207 | Ga0207665_10005349 | 3300025939 | Bacteria | 8575 |
| 208 | Ga0207711_10000728 | 3300025941 | Bacteria | 32348 |
| 209 | Ga0207689_10300203 | 3300025942 | Bacteria | 1331 |
| 210 | Ga0207667_10017868 | 3300025949 | Bacteria | 7971 |
| 211 | Ga0207667_10082776 | 3300025949 | Bacteria | 3323 |
| 212 | Ga0207703_10049780 | 3300026035 | Bacteria | 3388 |
| 213 | Ga0207639_10240659 | 3300026041 | Bacteria | 1573 |
| 214 | Ga0207678_10073345 | 3300026067 | Bacteria | 2933 |
| 215 | Ga0207708_10033943 | 3300026075 | Bacteria | 3880 |
| 216 | Ga0207641_10300947 | 3300026088 | Bacteria | 1515 |
| 217 | Ga0207648_10224926 | 3300026089 | Bacteria | 1668 |
| 218 | Ga0207676_10253596 | 3300026095 | Bacteria | 1585 |
| 219 | Ga0207674_10165747 | 3300026116 | Bacteria | 2164 |
| 220 | Ga0207698_10174810 | 3300026142 | Bacteria | 1895 |
| 221 | Ga0209281_1000314 | 3300027111 | Bacteria | 86424 |
| 222 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 223 | Ga0209371_1014017 | 3300027312 | Bacteria | 2218 |
| 224 | Ga0209282_1000068 | 3300027666 | Bacteria | 85817 |
| 225 | Ga0209282_1000143 | 3300027666 | Bacteria | 42143 |
| 226 | Ga0209282_1089835 | 3300027666 | Bacteria | 1612 |
| 227 | Ga0209813_10057344 | 3300027866 | Bacteria | 1235 |
| 228 | Ga0268266_10000373 | 3300028379 | Bacteria | 68755 |
| 229 | Ga0268266_10035496 | 3300028379 | Bacteria | 4241 |
| 230 | Ga0268266_10036484 | 3300028379 | Bacteria | 4184 |
| 231 | Ga0268266_10143372 | 3300028379 | Bacteria | 2145 |
| 232 | Ga0265334_10015983 | 3300028573 | Bacteria | 3109 |
| 233 | Ga0307515_10029779 | 3300028794 | Bacteria | 9206 |
| 234 | Ga0307515_10085478 | 3300028794 | Bacteria | 4036 |
| 235 | Ga0265338_10015741 | 3300028800 | Bacteria | 8284 |
| 236 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 237 | Ga0268256_1014365 | 3300030500 | Bacteria | 2354 |
| 238 | Ga0265325_10035604 | 3300031241 | Bacteria | 2642 |
| 239 | Ga0265339_10000080 | 3300031249 | Bacteria | 83570 |
| 240 | Ga0265327_10034836 | 3300031251 | Bacteria | 2789 |
| 241 | Ga0307513_10040412 | 3300031456 | Bacteria | 5158 |
| 242 | Ga0265313_10000948 | 3300031595 | Bacteria | 28784 |
| 243 | Ga0265313_10007576 | 3300031595 | Bacteria | 7379 |
| 244 | Ga0265314_10034328 | 3300031711 | Bacteria | 3709 |
| 245 | Ga0265314_10273734 | 3300031711 | Bacteria | 958 |
| 246 | Ga0307406_10111744 | 3300031901 | Bacteria | 1883 |
| 247 | Ga0315914_1014431 | 3300031967 | Bacteria | 8428 |
| 248 | Ga0307409_100424024 | 3300031995 | Bacteria | 1277 |
| 249 | Ga0307414_10029633 | 3300032004 | Bacteria | 3564 |
| 250 | Ga0307414_10236724 | 3300032004 | Bacteria | 1509 |
| 251 | Ga0315913_1002536 | 3300033430 | Bacteria | 21509 |
| 252 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 253 | Ga0373936_0003176 | 3300035113 | Bacteria | 6152 |
| 254 | Ga0373936_0054161 | 3300035113 | Bacteria | 1627 |
| 255 | Ga0373955_0100915 | 3300035172 | Bacteria | 1657 |
| 256 | Ga0373925_0022477 | 3300037068 | Bacteria | 4600 |
| 257 | Ga0373925_0187104 | 3300037068 | Bacteria | 1642 |
| 258 | Ga0395899_0002226 | 3300037312 | Bacteria | 15895 |
| 259 | Ga0395900_0016936 | 3300037418 | Bacteria | 7438 |
| 260 | Ga0395905_0010004 | 3300037471 | Bacteria | 9243 |
| 261 | Ga0436364_0074250 | 3300037853 | Bacteria | 26320 |
| 262 | Ga0395901_0298144 | 3300038443 | Bacteria | 1671 |
| 263 | Ga0439436_0010057 | 3300041404 | Bacteria | 2892 |
| 264 | Ga0439447_040756 | 3300041407 | Bacteria | 1132 |
| 265 | Ga0439461_0001099 | 3300041410 | Bacteria | 4087 |
| 266 | Ga0439465_0000331 | 3300041413 | Bacteria | 13474 |
| 267 | Ga0439465_0058241 | 3300041413 | Bacteria | 1276 |
| 268 | Ga0451835_1159006 | 3300041492 | Bacteria | 1987 |
| 269 | Ga0451839_1391203 | 3300041496 | Bacteria | 870 |
| 270 | Ga0451845_0361943 | 3300041501 | Bacteria | 2099 |
| 271 | Ga0451847_0154624 | 3300041503 | Bacteria | 2057 |
| 272 | Ga0451849_0654528 | 3300041505 | Bacteria | 1187 |
| 273 | Ga0451843_0361168 | 3300041509 | Bacteria | 2397 |
| 274 | Ga0439431_0000025 | 3300041997 | Bacteria | 23749 |
| 275 | Ga0439431_0004392 | 3300041997 | Bacteria | 3098 |
| 276 | Ga0439442_001856 | 3300042002 | Bacteria | 4137 |
| 277 | Ga0439445_0000671 | 3300042004 | Bacteria | 7091 |
| 278 | Ga0439432_000185 | 3300042006 | Bacteria | 22317 |
| 279 | Ga0439449_0013823 | 3300042007 | Bacteria | 3036 |
| 280 | Ga0439452_031698 | 3300042010 | Bacteria | 1295 |
| 281 | Ga0439462_0005489 | 3300042015 | Bacteria | 3126 |
| 282 | Ga0439462_0010247 | 3300042015 | Bacteria | 2374 |
| 283 | Ga0450920_005630 | 3300042122 | Bacteria | 2231 |
| 284 | Ga0450907_009023 | 3300042146 | Bacteria | 1654 |
| 285 | Ga0439434_0000905 | 3300042435 | Bacteria | 8537 |
| 286 | Ga0439434_0001835 | 3300042435 | Bacteria | 6170 |
| 287 | Ga0439464_0070185 | 3300042439 | Bacteria | 1036 |
| 288 | Ga0450918_007499 | 3300042531 | Bacteria | 1928 |
| 289 | Ga0453684_0086457 | 3300044712 | Bacteria | 3891 |
| 290 | Ga0453684_0201649 | 3300044712 | Bacteria | 2319 |
| 291 | Ga0466968_0003080 | 3300044735 | Bacteria | 6155 |
| 292 | Ga0451576_0207840 | 3300045051 | Bacteria | 2044 |
| 293 | Ga0495627_040982 | 3300046453 | Bacteria | 1424 |
| 294 | Ga0495629_0022804 | 3300046459 | Bacteria | 4460 |
| 295 | Ga0495638_0029873 | 3300046460 | Bacteria | 3513 |
| 296 | Ga0495638_0102511 | 3300046460 | Bacteria | 1710 |
| 297 | Ga0495662_0015511 | 3300046476 | Bacteria | 3697 |
| 298 | Ga0495584_0126831 | 3300046491 | Bacteria | 1294 |
| 299 | Ga0495596_0022759 | 3300046500 | Bacteria | 2549 |
| 300 | Ga0495607_0029974 | 3300046501 | Bacteria | 3345 |
| 301 | Ga0495583_0000175 | 3300046506 | Bacteria | 108912 |
| 302 | Ga0495583_0116195 | 3300046506 | Bacteria | 1130 |
| 303 | Ga0495606_0042235 | 3300046507 | Bacteria | 3051 |
| 304 | Ga0495610_0039363 | 3300046512 | Bacteria | 2391 |
| 305 | Ga0495620_0049605 | 3300046515 | Bacteria | 1795 |
| 306 | Ga0495630_0244549 | 3300046517 | Bacteria | 1371 |
| 307 | Ga0495643_0013377 | 3300046522 | Bacteria | 4914 |
| 308 | Ga0495643_0016075 | 3300046522 | Bacteria | 4404 |
| 309 | Ga0495643_0120282 | 3300046522 | Bacteria | 1327 |
| 310 | Ga0495648_0131084 | 3300046524 | Bacteria | 1333 |
| 311 | Ga0495654_0118400 | 3300046530 | Bacteria | 1201 |
| 312 | Ga0495609_0098722 | 3300046538 | Bacteria | 1266 |
| 313 | Ga0495609_0114940 | 3300046538 | Bacteria | 1160 |
| 314 | Ga0495633_0049396 | 3300046558 | Bacteria | 1985 |
| 315 | Ga0495656_0055800 | 3300046615 | Bacteria | 1705 |
| 316 | Ga0495668_0232695 | 3300046616 | Bacteria | 1009 |
| 317 | Ga0495625_0049528 | 3300046660 | Bacteria | 3019 |
| 318 | Ga0495625_0083634 | 3300046660 | Bacteria | 2218 |
| 319 | Ga0495625_0116418 | 3300046660 | Bacteria | 1823 |
| 320 | Ga0495635_0020442 | 3300046663 | Bacteria | 4611 |
| 321 | Ga0495661_0069699 | 3300046665 | Bacteria | 2060 |
| 322 | Ga0495661_0153885 | 3300046665 | Bacteria | 1240 |
| 323 | Ga0495588_0022539 | 3300046674 | Bacteria | 3113 |
| 324 | Ga0495588_0223814 | 3300046674 | Bacteria | 993 |
| 325 | Ga0495658_0177247 | 3300046683 | Bacteria | 1321 |
| 326 | Ga0495671_0071215 | 3300046692 | Bacteria | 1708 |
| 327 | Ga0495671_0087595 | 3300046692 | Bacteria | 1525 |
| 328 | Ga0495649_0156236 | 3300046694 | Bacteria | 1197 |
| 329 | Ga0495649_0219438 | 3300046694 | Bacteria | 984 |
| 330 | Ga0495660_0023601 | 3300046810 | Bacteria | 3508 |
| 331 | Ga0495687_075188 | 3300047443 | Bacteria | 1341 |
| 332 | Ga0495687_081467 | 3300047443 | Bacteria | 1266 |
| 333 | Ga0495681_0035137 | 3300047470 | Bacteria | 2491 |
| 334 | Ga0495686_0009312 | 3300047472 | Bacteria | 7086 |
| 335 | Ga0495626_0115938 | 3300048091 | Bacteria | 1156 |
| 336 | Ga0496100_0281381 | 3300048903 | Bacteria | 1240 |
| 337 | Ga0496101_0160491 | 3300048904 | Bacteria | 1724 |
| 338 | Ga0496101_0213643 | 3300048904 | Bacteria | 1495 |
| 339 | Ga0496103_0040182 | 3300048906 | Bacteria | 2875 |
| 340 | Ga0496104_0069375 | 3300048907 | Bacteria | 3350 |
| 341 | Ga0496106_0012227 | 3300048909 | Bacteria | 6334 |
| 342 | Ga0496106_0014872 | 3300048909 | Bacteria | 5757 |
| 343 | Ga0496107_0136026 | 3300048910 | Bacteria | 1815 |
| 344 | Ga0496112_0039486 | 3300048915 | Bacteria | 4613 |
| 345 | Ga0496112_0131359 | 3300048915 | Bacteria | 2475 |
| 346 | Ga0496113_0046156 | 3300048916 | Bacteria | 3234 |
| 347 | Ga0496115_0091441 | 3300048918 | Bacteria | 2487 |
| 348 | Ga0496116_0089668 | 3300048919 | Bacteria | 1875 |
| 349 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 350 | Ga0496117_0071837 | 3300048920 | Bacteria | 2317 |
| 351 | Ga0496118_0002809 | 3300048921 | Bacteria | 22813 |
| 352 | Ga0496118_0012231 | 3300048921 | Bacteria | 8269 |
| 353 | Ga0496118_0065839 | 3300048921 | Bacteria | 2648 |
| 354 | Ga0496119_0016100 | 3300048922 | Bacteria | 5711 |
| 355 | Ga0496119_0030332 | 3300048922 | Bacteria | 3648 |
| 356 | Ga0496120_0003418 | 3300048923 | Bacteria | 14503 |
| 357 | Ga0496120_0028404 | 3300048923 | Bacteria | 3429 |
| 358 | Ga0496121_0000154 | 3300048924 | Bacteria | 150013 |
| 359 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 360 | Ga0496122_0013033 | 3300048925 | Bacteria | 8189 |
| 361 | Ga0496122_0013828 | 3300048925 | Bacteria | 7860 |
| 362 | Ga0496122_0088340 | 3300048925 | Bacteria | 2124 |
| 363 | Ga0496122_0153458 | 3300048925 | Bacteria | 1417 |
| 364 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 365 | Ga0496123_0025431 | 3300048926 | Bacteria | 4464 |
| 366 | Ga0496123_0027291 | 3300048926 | Bacteria | 4256 |
| 367 | Ga0496123_0045179 | 3300048926 | Bacteria | 3003 |
| 368 | Ga0496124_0020416 | 3300048927 | Bacteria | 6120 |
| 369 | Ga0496124_0104233 | 3300048927 | Bacteria | 2293 |
| 370 | Ga0496124_0167694 | 3300048927 | Bacteria | 1704 |
| 371 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 372 | Ga0496125_0033579 | 3300048928 | Bacteria | 4537 |
| 373 | Ga0496125_0038861 | 3300048928 | Bacteria | 4109 |
| 374 | Ga0501031_0033507 | 3300049568 | Bacteria | 3351 |
| 375 | Ga0501031_0087248 | 3300049568 | Bacteria | 2035 |
| 376 | Ga0501032_0001269 | 3300049569 | Bacteria | 20225 |
| 377 | Ga0501032_0086516 | 3300049569 | Bacteria | 2083 |
| 378 | Ga0501033_0000318 | 3300049570 | Bacteria | 45707 |
| 379 | Ga0501033_0126451 | 3300049570 | Bacteria | 1853 |
| 380 | Ga0501034_0081106 | 3300049571 | Bacteria | 3247 |
| 381 | Ga0501034_0140012 | 3300049571 | Bacteria | 2399 |
| 382 | Ga0501034_0553025 | 3300049571 | Bacteria | 1060 |
| 383 | Ga0501036_0033807 | 3300049572 | Bacteria | 4324 |
| 384 | Ga0501037_0000136 | 3300049573 | Bacteria | 68536 |
| 385 | Ga0501037_0046547 | 3300049573 | Bacteria | 3181 |
| 386 | Ga0501038_0128496 | 3300049574 | Bacteria | 2083 |
| 387 | Ga0501038_0129095 | 3300049574 | Bacteria | 2078 |
| 388 | Ga0501038_0147419 | 3300049574 | Bacteria | 1920 |
| 389 | Ga0501039_0009703 | 3300049575 | Bacteria | 7336 |
| 390 | Ga0501039_0037960 | 3300049575 | Bacteria | 3720 |
| 391 | Ga0501039_0421288 | 3300049575 | Bacteria | 1049 |
| 392 | Ga0501040_0030291 | 3300049576 | Bacteria | 3655 |
| 393 | Ga0501040_0059833 | 3300049576 | Bacteria | 2617 |
| 394 | Ga0501040_0134422 | 3300049576 | Bacteria | 1740 |
| 395 | Ga0501040_0384178 | 3300049576 | Bacteria | 1007 |
| 396 | Ga0501041_0010339 | 3300049577 | Bacteria | 5499 |
| 397 | Ga0501041_0011071 | 3300049577 | Bacteria | 5325 |
| 398 | Ga0501041_0106441 | 3300049577 | Bacteria | 1738 |
| 399 | Ga0501042_0000994 | 3300049578 | Bacteria | 16079 |
| 400 | Ga0501042_0012081 | 3300049578 | Bacteria | 5841 |
| 401 | Ga0501043_0000006 | 3300049579 | Bacteria | 234413 |
| 402 | Ga0501043_0049763 | 3300049579 | Bacteria | 3295 |
| 403 | Ga0501043_0074808 | 3300049579 | Bacteria | 2661 |
| 404 | Ga0501043_0097190 | 3300049579 | Bacteria | 2315 |
| 405 | Ga0501043_0248765 | 3300049579 | Bacteria | 1370 |
| 406 | Ga0501046_0002236 | 3300049580 | Bacteria | 18265 |
| 407 | Ga0501046_0005715 | 3300049580 | Bacteria | 11096 |
| 408 | Ga0501046_0050202 | 3300049580 | Bacteria | 3296 |
| 409 | Ga0501046_0314688 | 3300049580 | Bacteria | 1141 |
| 410 | Ga0501047_0006051 | 3300049581 | Bacteria | 11377 |
| 411 | Ga0501048_0024176 | 3300049582 | Bacteria | 4435 |
| 412 | Ga0501048_0055868 | 3300049582 | Bacteria | 2802 |
| 413 | Ga0501048_0362041 | 3300049582 | Bacteria | 1035 |
| 414 | Ga0501068_0025041 | 3300049584 | Bacteria | 3508 |
| 415 | Ga0501068_0212678 | 3300049584 | Bacteria | 1228 |
| 416 | Ga0501068_0336219 | 3300049584 | Bacteria | 969 |
| 417 | Ga0501069_0000024 | 3300049585 | Bacteria | 117140 |
| 418 | Ga0501069_0007683 | 3300049585 | Bacteria | 5657 |
| 419 | Ga0501070_0000093 | 3300049586 | Bacteria | 76623 |
| 420 | Ga0501070_0001707 | 3300049586 | Bacteria | 19484 |
| 421 | Ga0501070_0046834 | 3300049586 | Bacteria | 3596 |
| 422 | Ga0501071_0000498 | 3300049587 | Bacteria | 19943 |
| 423 | Ga0501071_0019437 | 3300049587 | Bacteria | 4713 |
| 424 | Ga0501071_0161800 | 3300049587 | Bacteria | 1673 |
| 425 | Ga0501072_0026183 | 3300049588 | Bacteria | 4546 |
| 426 | Ga0501072_0027986 | 3300049588 | Bacteria | 4399 |
| 427 | Ga0501073_0044343 | 3300049589 | Bacteria | 3135 |
| 428 | Ga0501073_0046579 | 3300049589 | Bacteria | 3049 |
| 429 | Ga0501073_0235412 | 3300049589 | Bacteria | 1265 |
| 430 | Ga0501074_0001523 | 3300049590 | Bacteria | 15668 |
| 431 | Ga0501074_0004462 | 3300049590 | Bacteria | 10014 |
| 432 | Ga0501074_0004835 | 3300049590 | Bacteria | 9654 |
| 433 | Ga0501074_0030237 | 3300049590 | Bacteria | 3925 |
| 434 | Ga0501075_0000282 | 3300049591 | Bacteria | 28099 |
| 435 | Ga0501075_0044949 | 3300049591 | Bacteria | 3313 |
| 436 | Ga0501075_0046245 | 3300049591 | Bacteria | 3269 |
| 437 | Ga0501076_0001466 | 3300049592 | Bacteria | 15817 |
| 438 | Ga0501076_0060257 | 3300049592 | Bacteria | 3019 |
| 439 | Ga0501076_0329103 | 3300049592 | Bacteria | 1253 |
| 440 | Ga0501077_0001714 | 3300049593 | Bacteria | 13219 |
| 441 | Ga0501077_0020704 | 3300049593 | Bacteria | 4164 |
| 442 | Ga0501079_0003632 | 3300049741 | Bacteria | 11359 |
| 443 | Ga0501079_0016612 | 3300049741 | Bacteria | 5621 |
| 444 | Ga0501079_0022511 | 3300049741 | Bacteria | 4832 |
| 445 | Ga0501079_0117239 | 3300049741 | Bacteria | 2070 |
| 446 | Ga0501080_0005371 | 3300049742 | Bacteria | 11425 |
| 447 | Ga0501080_0031943 | 3300049742 | Bacteria | 4907 |
| 448 | Ga0501080_0048025 | 3300049742 | Bacteria | 3974 |
| 449 | Ga0501080_0149623 | 3300049742 | Bacteria | 2158 |
| 450 | Ga0501080_0172952 | 3300049742 | Bacteria | 1991 |
| 451 | Ga0501080_0196357 | 3300049742 | Bacteria | 1853 |
| 452 | Ga0501081_0000147 | 3300049743 | Bacteria | 32041 |
| 453 | Ga0501081_0002678 | 3300049743 | Bacteria | 11259 |
| 454 | Ga0501081_0069023 | 3300049743 | Bacteria | 2461 |
| 455 | Ga0501081_0085620 | 3300049743 | Bacteria | 2212 |
| 456 | Ga0501083_0000097 | 3300049744 | Bacteria | 59474 |
| 457 | Ga0501083_0051158 | 3300049744 | Bacteria | 2778 |
| 458 | Ga0501083_0065996 | 3300049744 | Bacteria | 2410 |
| 459 | Ga0501035_0000068 | 3300049822 | Bacteria | 128392 |
| 460 | Ga0501035_0022486 | 3300049822 | Bacteria | 5791 |
| 461 | Ga0501035_0038033 | 3300049822 | Bacteria | 4357 |
| 462 | Ga0501035_0107130 | 3300049822 | Bacteria | 2450 |
| 463 | Ga0501044_0000096 | 3300049823 | Bacteria | 109532 |
| 464 | Ga0501044_0002553 | 3300049823 | Bacteria | 20731 |
| 465 | Ga0501044_0019940 | 3300049823 | Bacteria | 7162 |
| 466 | Ga0501045_0000846 | 3300049824 | Bacteria | 19862 |
| 467 | Ga0501045_0015524 | 3300049824 | Bacteria | 5402 |
| 468 | Ga0501045_0076965 | 3300049824 | Bacteria | 2458 |
| 469 | nmdc:mga03n38_14126_c1 | 3300050490 | Bacteria | 3054 |
| 470 | nmdc:mga00v17_532_c1 | 3300050491 | Bacteria | 21380 |
| 471 | nmdc:mga00v17_64067_c1 | 3300050491 | Bacteria | 2265 |
| 472 | nmdc:mga0yw44_5021_c1 | 3300050492 | Bacteria | 6181 |
| 473 | nmdc:mga0yw44_5970_c1 | 3300050492 | Bacteria | 5829 |
| 474 | nmdc:mga0k408_158631_c1 | 3300050493 | Bacteria | 1348 |
| 475 | nmdc:mga0k408_201700_c1 | 3300050493 | Bacteria | 1187 |
| 476 | nmdc:mga06z11_115810_c1 | 3300050494 | Bacteria | 1490 |
| 477 | nmdc:mga06z11_170861_c1 | 3300050494 | Bacteria | 1248 |
| 478 | nmdc:mga06z11_79050_c1 | 3300050494 | Bacteria | 1760 |
| 479 | nmdc:mga04h51_109654_c1 | 3300050495 | Bacteria | 1016 |
| 480 | nmdc:mga07m45_163969_c1 | 3300050496 | Bacteria | 1291 |
| 481 | nmdc:mga07m45_25346_c1 | 3300050496 | Bacteria | 3252 |
| 482 | nmdc:mga08y16_348915_c1 | 3300050511 | Bacteria | 1520 |
| 483 | nmdc:mga0sz30_368_c1 | 3300050516 | Bacteria | 17149 |
| 484 | Ga0495601_0007500 | 3300053077 | Bacteria | 6400 |
| 485 | Ga0495595_0061418 | 3300053084 | Bacteria | 1760 |
| 486 | Ga0500578_0035016 | 3300053086 | Bacteria | 3226 |
| 487 | Ga0500578_0276041 | 3300053086 | Bacteria | 1004 |
| 488 | Ga0500646_0051808 | 3300053090 | Bacteria | 1186 |
| 489 | Ga0500651_0131582 | 3300053093 | Bacteria | 1513 |
| 490 | Ga0500654_090411 | 3300053099 | Bacteria | 1368 |
| 491 | Ga0500555_002637 | 3300053103 | Bacteria | 5163 |
| 492 | Ga0500560_014107 | 3300053107 | Bacteria | 2120 |
| 493 | Ga0500569_057561 | 3300053109 | Bacteria | 1191 |
| 494 | Ga0500572_005128 | 3300053111 | Bacteria | 2962 |
| 495 | Ga0500595_011352 | 3300053119 | Bacteria | 3492 |
| 496 | Ga0500595_015812 | 3300053119 | Bacteria | 2825 |
| 497 | Ga0500595_016287 | 3300053119 | Bacteria | 2772 |
| 498 | Ga0500642_0002054 | 3300053130 | Bacteria | 5842 |
| 499 | Ga0500658_0004494 | 3300053134 | Bacteria | 5205 |
| 500 | Ga0500658_0013777 | 3300053134 | Bacteria | 2990 |
| 501 | Ga0500658_0109323 | 3300053134 | Bacteria | 1215 |
| 502 | Ga0500658_0134423 | 3300053134 | Bacteria | 1105 |
| 503 | Ga0500559_0065905 | 3300053136 | Bacteria | 1623 |
| 504 | Ga0500561_0000035 | 3300053137 | Bacteria | 27996 |
| 505 | Ga0500568_0000109 | 3300053139 | Bacteria | 76714 |
| 506 | Ga0500568_0008275 | 3300053139 | Bacteria | 5029 |
| 507 | Ga0500568_0031408 | 3300053139 | Bacteria | 2191 |
| 508 | Ga0500588_0001742 | 3300053146 | Bacteria | 4228 |
| 509 | Ga0500588_0019831 | 3300053146 | Bacteria | 1794 |
| 510 | Ga0500590_000026 | 3300053148 | Bacteria | 36766 |
| 511 | Ga0500604_0001996 | 3300053151 | Bacteria | 5651 |
| 512 | Ga0500604_0086449 | 3300053151 | Bacteria | 1019 |
| 513 | Ga0500616_0034527 | 3300053153 | Bacteria | 2754 |
| 514 | Ga0500616_0036048 | 3300053153 | Bacteria | 2686 |
| 515 | Ga0500622_0002690 | 3300053156 | Bacteria | 12594 |
| 516 | Ga0500624_001616 | 3300053157 | Bacteria | 3420 |
| 517 | Ga0500624_006190 | 3300053157 | Bacteria | 1613 |
| 518 | Ga0500627_0084793 | 3300053158 | Bacteria | 1414 |
| 519 | Ga0500633_0012429 | 3300053160 | Bacteria | 2352 |
| 520 | Ga0500636_0000149 | 3300053177 | Bacteria | 36257 |
| 521 | Ga0500636_0005980 | 3300053177 | Bacteria | 6973 |
| 522 | Ga0500611_004761 | 3300053727 | Bacteria | 1856 |
| 523 | Ga0501084_0008285 | 3300054114 | Bacteria | 8575 |
| 524 | Ga0501084_0116654 | 3300054114 | Bacteria | 2244 |
| 525 | Ga0501082_0002793 | 3300060353 | Bacteria | 15231 |
| 526 | Ga0501082_0021564 | 3300060353 | Bacteria | 5556 |
| 527 | Ga0501082_0058908 | 3300060353 | Bacteria | 3309 |
| 528 | Ga0501082_0113292 | 3300060353 | Bacteria | 2348 |
| 529 | Ga0530510_0003176 | 3300061734 | Bacteria | 11293 |
| 530 | Ga0530510_0018557 | 3300061734 | Bacteria | 4931 |
| 531 | Ga0530510_0049503 | 3300061734 | Bacteria | 3036 |
| 532 | Ga0530510_0127494 | 3300061734 | Bacteria | 1871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003781 | Ga0055536_1015627 | Ga0055536_10156273 | 219 |
| 2 | 3300025292 | Ga0209676_1004240 | Ga0209676_10042404 | 219 |
| 3 | 3300046491 | Ga0495584_0126831 | Ga0495584_0126831_309_1103 | 229 |
| 4 | 3300048091 | Ga0495626_0115938 | Ga0495626_0115938_58_852 | 229 |
| 5 | 3300049592 | Ga0501076_0329103 | Ga0501076_0329103_65_841 | 241 |
| 6 | 3300050495 | nmdc:mga04h51_109654_c1 | nmdc:mga04h51_109654_c1_10_786 | 241 |
| 7 | 3300053134 | Ga0500658_0134423 | Ga0500658_0134423_257_1033 | 241 |
| 8 | 3300009765 | Ga0123341_1000109 | Ga0123341_10001097 | 247 |
| 9 | 3300009766 | Ga0123342_1028378 | Ga0123342_10283781 | 247 |
| 10 | 3300025303 | Ga0209051_1000062 | Ga0209051_1000062195 | 247 |
| 11 | 3300025304 | Ga0209257_1011007 | Ga0209257_10110074 | 247 |
| 12 | 3300041413 | Ga0439465_0058241 | Ga0439465_0058241_99_893 | 247 |
| 13 | 3300041492 | Ga0451835_1159006 | Ga0451835_1159006_31_825 | 247 |
| 14 | 3300041496 | Ga0451839_1391203 | Ga0451839_1391203_31_825 | 247 |
| 15 | 3300041501 | Ga0451845_0361943 | Ga0451845_0361943_832_1626 | 247 |
| 16 | 3300041503 | Ga0451847_0154624 | Ga0451847_0154624_574_1368 | 247 |
| 17 | 3300041505 | Ga0451849_0654528 | Ga0451849_0654528_370_1164 | 247 |
| 18 | 3300041509 | Ga0451843_0361168 | Ga0451843_0361168_430_1224 | 247 |
| 19 | 3300042146 | Ga0450907_009023 | Ga0450907_009023_761_1555 | 247 |
| 20 | 3300046460 | Ga0495638_0029873 | Ga0495638_0029873_495_1289 | 247 |
| 21 | 3300046500 | Ga0495596_0022759 | Ga0495596_0022759_1179_1973 | 247 |
| 22 | 3300046501 | Ga0495607_0029974 | Ga0495607_0029974_303_1097 | 247 |
| 23 | 3300046506 | Ga0495583_0116195 | Ga0495583_0116195_128_922 | 247 |
| 24 | 3300046507 | Ga0495606_0042235 | Ga0495606_0042235_1593_2387 | 247 |
| 25 | 3300046512 | Ga0495610_0039363 | Ga0495610_0039363_1147_1941 | 247 |
| 26 | 3300046515 | Ga0495620_0049605 | Ga0495620_0049605_10_804 | 247 |
| 27 | 3300046522 | Ga0495643_0013377 | Ga0495643_0013377_953_1747 | 247 |
| 28 | 3300046522 | Ga0495643_0120282 | Ga0495643_0120282_270_1064 | 247 |
| 29 | 3300046524 | Ga0495648_0131084 | Ga0495648_0131084_458_1252 | 247 |
| 30 | 3300046530 | Ga0495654_0118400 | Ga0495654_0118400_83_877 | 247 |
| 31 | 3300046538 | Ga0495609_0098722 | Ga0495609_0098722_131_925 | 247 |
| 32 | 3300046538 | Ga0495609_0114940 | Ga0495609_0114940_128_922 | 247 |
| 33 | 3300046615 | Ga0495656_0055800 | Ga0495656_0055800_801_1595 | 247 |
| 34 | 3300046616 | Ga0495668_0232695 | Ga0495668_0232695_151_945 | 247 |
| 35 | 3300046660 | Ga0495625_0049528 | Ga0495625_0049528_1721_2515 | 247 |
| 36 | 3300046665 | Ga0495661_0153885 | Ga0495661_0153885_130_924 | 247 |
| 37 | 3300046694 | Ga0495649_0156236 | Ga0495649_0156236_384_1178 | 247 |
| 38 | 3300046810 | Ga0495660_0023601 | Ga0495660_0023601_2178_2972 | 247 |
| 39 | 3300047443 | Ga0495687_075188 | Ga0495687_075188_293_1087 | 247 |
| 40 | 3300047443 | Ga0495687_081467 | Ga0495687_081467_74_868 | 247 |
| 41 | 3300047472 | Ga0495686_0009312 | Ga0495686_0009312_3484_4278 | 247 |
| 42 | 3300048903 | Ga0496100_0281381 | Ga0496100_0281381_370_1158 | 247 |
| 43 | 3300048904 | Ga0496101_0160491 | Ga0496101_0160491_573_1361 | 247 |
| 44 | 3300048906 | Ga0496103_0040182 | Ga0496103_0040182_545_1333 | 247 |
| 45 | 3300048907 | Ga0496104_0069375 | Ga0496104_0069375_1953_2741 | 247 |
| 46 | 3300048921 | Ga0496118_0012231 | Ga0496118_0012231_406_1200 | 247 |
| 47 | 3300049571 | Ga0501034_0140012 | Ga0501034_0140012_686_1480 | 247 |
| 48 | 3300049573 | Ga0501037_0046547 | Ga0501037_0046547_2026_2820 | 247 |
| 49 | 3300049574 | Ga0501038_0147419 | Ga0501038_0147419_471_1265 | 247 |
| 50 | 3300049742 | Ga0501080_0149623 | Ga0501080_0149623_538_1332 | 247 |
| 51 | 3300050494 | nmdc:mga06z11_170861_c1 | nmdc:mga06z11_170861_c1_287_1081 | 247 |
| 52 | 3300050496 | nmdc:mga07m45_163969_c1 | nmdc:mga07m45_163969_c1_405_1199 | 247 |
| 53 | 3300053086 | Ga0500578_0035016 | Ga0500578_0035016_194_988 | 247 |
| 54 | 3300053086 | Ga0500578_0276041 | Ga0500578_0276041_78_872 | 247 |
| 55 | 3300053109 | Ga0500569_057561 | Ga0500569_057561_323_1117 | 247 |
| 56 | 3300053134 | Ga0500658_0004494 | Ga0500658_0004494_679_1473 | 247 |
| 57 | 3300053134 | Ga0500658_0013777 | Ga0500658_0013777_381_1175 | 247 |
| 58 | 3300053139 | Ga0500568_0000109 | Ga0500568_0000109_5151_5945 | 247 |
| 59 | 3300053153 | Ga0500616_0034527 | Ga0500616_0034527_51_845 | 247 |
| 60 | 3300053153 | Ga0500616_0036048 | Ga0500616_0036048_1832_2626 | 247 |
| 61 | 3300031901 | Ga0307406_10111744 | Ga0307406_101117442 | 249 |
| 62 | 3300049568 | Ga0501031_0087248 | Ga0501031_0087248_1004_1852 | 249 |
| 63 | 3300049576 | Ga0501040_0030291 | Ga0501040_0030291_2777_3625 | 249 |
| 64 | 3300049577 | Ga0501041_0010339 | Ga0501041_0010339_3541_4389 | 249 |
| 65 | 3300049582 | Ga0501048_0024176 | Ga0501048_0024176_2648_3496 | 249 |
| 66 | 3300049588 | Ga0501072_0027986 | Ga0501072_0027986_1486_2334 | 249 |
| 67 | 3300049590 | Ga0501074_0030237 | Ga0501074_0030237_2825_3673 | 249 |
| 68 | 3300049742 | Ga0501080_0172952 | Ga0501080_0172952_1062_1910 | 249 |
| 69 | 3300049743 | Ga0501081_0085620 | Ga0501081_0085620_1284_2132 | 249 |
| 70 | 3300049824 | Ga0501045_0076965 | Ga0501045_0076965_1313_2161 | 249 |
| 71 | 3300054114 | Ga0501084_0116654 | Ga0501084_0116654_219_1067 | 249 |
| 72 | 3300060353 | Ga0501082_0113292 | Ga0501082_0113292_1168_2016 | 249 |
| 73 | iso_pu_bacteria | 2818991441 | 2819571520 | 249 |
| 74 | iso_pu_bacteria | 2844163670 | 2844170238 | 249 |
| 75 | 3300028573 | Ga0265334_10015983 | Ga0265334_100159832 | 250 |
| 76 | 3300053119 | Ga0500595_016287 | Ga0500595_016287_475_1329 | 250 |
| 77 | 3300002773 | JGI25152J39213_1002543 | JGI25152J39213_10025432 | 251 |
| 78 | 3300005262 | Ga0065165_1013986 | Ga0065165_10139863 | 251 |
| 79 | 3300025245 | Ga0207425_1020985 | Ga0207425_10209852 | 251 |
| 80 | 3300025258 | Ga0209129_1000019 | Ga0209129_1000019100 | 251 |
| 81 | 3300025284 | Ga0209130_1013126 | Ga0209130_10131262 | 251 |
| 82 | 3300013249 | Ga0171463_1010 | Ga0171463_10102 | 252 |
| 83 | 3300025263 | Ga0209565_1010175 | Ga0209565_10101752 | 252 |
| 84 | 3300025295 | Ga0209564_1000081 | Ga0209564_100008126 | 252 |
| 85 | 3300025298 | Ga0209050_1000852 | Ga0209050_100085225 | 252 |
| 86 | 3300025303 | Ga0209051_1003025 | Ga0209051_10030259 | 252 |
| 87 | 3300048921 | Ga0496118_0065839 | Ga0496118_0065839_1739_2545 | 252 |
| 88 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_762994_763800 | 252 |
| 89 | 3300006881 | Ga0068865_100002567 | Ga0068865_1000025673 | 253 |
| 90 | 3300009094 | Ga0111539_10549964 | Ga0111539_105499642 | 253 |
| 91 | 3300014326 | Ga0157380_10002315 | Ga0157380_100023153 | 253 |
| 92 | 3300025938 | Ga0207704_10004497 | Ga0207704_100044972 | 253 |
| 93 | 3300044735 | Ga0466968_0003080 | Ga0466968_0003080_130_939 | 253 |
| 94 | 3300048919 | Ga0496116_0089668 | Ga0496116_0089668_335_1144 | 253 |
| 95 | 3300048922 | Ga0496119_0030332 | Ga0496119_0030332_2303_3112 | 253 |
| 96 | 3300048927 | Ga0496124_0020416 | Ga0496124_0020416_1887_2696 | 253 |
| 97 | 3300050490 | nmdc:mga03n38_14126_c1 | nmdc:mga03n38_14126_c1_1752_2561 | 253 |
| 98 | 3300050494 | nmdc:mga06z11_115810_c1 | nmdc:mga06z11_115810_c1_82_891 | 253 |
| 99 | 3300050511 | nmdc:mga08y16_348915_c1 | nmdc:mga08y16_348915_c1_182_994 | 253 |
| 100 | 3300053139 | Ga0500568_0031408 | Ga0500568_0031408_849_1658 | 253 |
| 101 | 3300021321 | Ga0214542_1025614 | Ga0214542_10256142 | 254 |
| 102 | 3300021327 | Ga0214543_1000025 | Ga0214543_1000025138 | 254 |
| 103 | 3300028800 | Ga0265338_10015741 | Ga0265338_100157415 | 254 |
| 104 | 3300031241 | Ga0265325_10035604 | Ga0265325_100356043 | 254 |
| 105 | 3300031249 | Ga0265339_10000080 | Ga0265339_1000008055 | 254 |
| 106 | 3300031595 | Ga0265313_10000948 | Ga0265313_1000094822 | 254 |
| 107 | iso_pu_bacteria | 2989392574 | 2989394122 | 254 |
| 108 | 3300005339 | Ga0070660_100054084 | Ga0070660_1000540844 | 256 |
| 109 | 3300005563 | Ga0068855_100449938 | Ga0068855_1004499382 | 256 |
| 110 | 3300006946 | Ga0079104_1024883 | Ga0079104_10248832 | 256 |
| 111 | 3300009093 | Ga0105240_10108595 | Ga0105240_101085954 | 256 |
| 112 | 3300013307 | Ga0157372_10063316 | Ga0157372_100633162 | 256 |
| 113 | 3300022739 | Ga0228711_1015241 | Ga0228711_10152419 | 256 |
| 114 | 3300022740 | Ga0228710_1006811 | Ga0228710_10068112 | 256 |
| 115 | 3300025913 | Ga0207695_10069592 | Ga0207695_100695924 | 256 |
| 116 | 3300025919 | Ga0207657_10001958 | Ga0207657_1000195818 | 256 |
| 117 | 3300025949 | Ga0207667_10017868 | Ga0207667_100178687 | 256 |
| 118 | 3300027111 | Ga0209281_1000314 | Ga0209281_100031466 | 256 |
| 119 | 3300027666 | Ga0209282_1000068 | Ga0209282_100006866 | 256 |
| 120 | 3300031595 | Ga0265313_10007576 | Ga0265313_100075766 | 256 |
| 121 | 3300031967 | Ga0315914_1014431 | Ga0315914_10144319 | 256 |
| 122 | 3300033430 | Ga0315913_1002536 | Ga0315913_100253618 | 256 |
| 123 | 3300033464 | Ga0315915_1000007 | Ga0315915_1000007307 | 256 |
| 124 | iso_pu_bacteria | 2643221726 | 2644691131 | 256 |
| 125 | 3300009177 | Ga0105248_10000125 | Ga0105248_1000012522 | 257 |
| 126 | 3300035113 | Ga0373936_0003176 | Ga0373936_0003176_1774_2592 | 257 |
| 127 | 3300046517 | Ga0495630_0244549 | Ga0495630_0244549_516_1334 | 257 |
| 128 | iso_pu_bacteria | 2558860983 | 2561469184 | 257 |
| 129 | 3300041997 | Ga0439431_0000025 | Ga0439431_0000025_7013_7834 | 258 |
| 130 | 3300042435 | Ga0439434_0001835 | Ga0439434_0001835_2158_2979 | 258 |
| 131 | 3300044712 | Ga0453684_0201649 | Ga0453684_0201649_167_994 | 258 |
| 132 | 3300048920 | Ga0496117_0071837 | Ga0496117_0071837_1285_2112 | 258 |
| 133 | 3300048927 | Ga0496124_0167694 | Ga0496124_0167694_311_1138 | 258 |
| 134 | iso_pu_bacteria | 8055632911 | 8055636028 | 258 |
| 135 | 3300005548 | Ga0070665_100020770 | Ga0070665_1000207703 | 259 |
| 136 | 3300005614 | Ga0068856_100458768 | Ga0068856_1004587682 | 259 |
| 137 | 3300005618 | Ga0068864_100015795 | Ga0068864_1000157952 | 259 |
| 138 | 3300005841 | Ga0068863_100260509 | Ga0068863_1002605092 | 259 |
| 139 | 3300005937 | Ga0081455_10001242 | Ga0081455_1000124217 | 259 |
| 140 | 3300006237 | Ga0097621_100065912 | Ga0097621_1000659122 | 259 |
| 141 | 3300006358 | Ga0068871_100067275 | Ga0068871_1000672752 | 259 |
| 142 | 3300013308 | Ga0157375_10158012 | Ga0157375_101580122 | 259 |
| 143 | 3300025927 | Ga0207687_10119625 | Ga0207687_101196252 | 259 |
| 144 | 3300028379 | Ga0268266_10036484 | Ga0268266_100364843 | 259 |
| 145 | iso_pu_bacteria | 2808606364 | 2808867191 | 259 |
| 146 | iso_pu_bacteria | 2842871566 | 2842875298 | 259 |
| 147 | 3300003316 | rootH1_10007030 | rootH1_100070302 | 260 |
| 148 | 3300003322 | rootL2_10028121 | rootL2_100281213 | 260 |
| 149 | 3300005335 | Ga0070666_10007956 | Ga0070666_100079565 | 260 |
| 150 | 3300005339 | Ga0070660_100013010 | Ga0070660_1000130105 | 260 |
| 151 | 3300005339 | Ga0070660_100266434 | Ga0070660_1002664341 | 260 |
| 152 | 3300005437 | Ga0070710_10047776 | Ga0070710_100477761 | 260 |
| 153 | 3300005456 | Ga0070678_100001773 | Ga0070678_1000017735 | 260 |
| 154 | 3300005458 | Ga0070681_10109686 | Ga0070681_101096862 | 260 |
| 155 | 3300005548 | Ga0070665_100000259 | Ga0070665_10000025958 | 260 |
| 156 | 3300005548 | Ga0070665_100051533 | Ga0070665_1000515333 | 260 |
| 157 | 3300005618 | Ga0068864_100292261 | Ga0068864_1002922612 | 260 |
| 158 | 3300005718 | Ga0068866_10172455 | Ga0068866_101724551 | 260 |
| 159 | 3300005840 | Ga0068870_10231163 | Ga0068870_102311632 | 260 |
| 160 | 3300006028 | Ga0070717_10107994 | Ga0070717_101079943 | 260 |
| 161 | 3300006163 | Ga0070715_10002984 | Ga0070715_100029844 | 260 |
| 162 | 3300006175 | Ga0070712_100043939 | Ga0070712_1000439392 | 260 |
| 163 | 3300006237 | Ga0097621_100002147 | Ga0097621_10000214710 | 260 |
| 164 | 3300006237 | Ga0097621_100023769 | Ga0097621_1000237694 | 260 |
| 165 | 3300006358 | Ga0068871_100000379 | Ga0068871_10000037926 | 260 |
| 166 | 3300006358 | Ga0068871_100032006 | Ga0068871_1000320062 | 260 |
| 167 | 3300006358 | Ga0068871_100077735 | Ga0068871_1000777353 | 260 |
| 168 | 3300006358 | Ga0068871_100295841 | Ga0068871_1002958412 | 260 |
| 169 | 3300006881 | Ga0068865_100036475 | Ga0068865_1000364752 | 260 |
| 170 | 3300009176 | Ga0105242_10531969 | Ga0105242_105319692 | 260 |
| 171 | 3300009551 | Ga0105238_10474781 | Ga0105238_104747812 | 260 |
| 172 | 3300013296 | Ga0157374_10037596 | Ga0157374_100375963 | 260 |
| 173 | 3300013306 | Ga0163162_10065009 | Ga0163162_100650093 | 260 |
| 174 | 3300014969 | Ga0157376_10013994 | Ga0157376_100139944 | 260 |
| 175 | 3300014969 | Ga0157376_10427211 | Ga0157376_104272112 | 260 |
| 176 | 3300025899 | Ga0207642_10073489 | Ga0207642_100734892 | 260 |
| 177 | 3300025903 | Ga0207680_10022847 | Ga0207680_100228472 | 260 |
| 178 | 3300025909 | Ga0207705_10013932 | Ga0207705_100139324 | 260 |
| 179 | 3300025909 | Ga0207705_10037604 | Ga0207705_100376044 | 260 |
| 180 | 3300025912 | Ga0207707_10160952 | Ga0207707_101609522 | 260 |
| 181 | 3300025917 | Ga0207660_10052792 | Ga0207660_100527923 | 260 |
| 182 | 3300025919 | Ga0207657_10001927 | Ga0207657_100019279 | 260 |
| 183 | 3300025919 | Ga0207657_10069253 | Ga0207657_100692532 | 260 |
| 184 | 3300025921 | Ga0207652_10061712 | Ga0207652_100617121 | 260 |
| 185 | 3300025924 | Ga0207694_10020708 | Ga0207694_100207084 | 260 |
| 186 | 3300025924 | Ga0207694_10443010 | Ga0207694_104430101 | 260 |
| 187 | 3300025929 | Ga0207664_10395722 | Ga0207664_103957222 | 260 |
| 188 | 3300025938 | Ga0207704_10004470 | Ga0207704_100044702 | 260 |
| 189 | 3300025939 | Ga0207665_10005349 | Ga0207665_100053495 | 260 |
| 190 | 3300025942 | Ga0207689_10300203 | Ga0207689_103002032 | 260 |
| 191 | 3300026035 | Ga0207703_10049780 | Ga0207703_100497804 | 260 |
| 192 | 3300026088 | Ga0207641_10300947 | Ga0207641_103009472 | 260 |
| 193 | 3300026089 | Ga0207648_10224926 | Ga0207648_102249262 | 260 |
| 194 | 3300026095 | Ga0207676_10253596 | Ga0207676_102535962 | 260 |
| 195 | 3300028379 | Ga0268266_10000373 | Ga0268266_1000037321 | 260 |
| 196 | 3300028379 | Ga0268266_10143372 | Ga0268266_101433722 | 260 |
| 197 | 3300031711 | Ga0265314_10273734 | Ga0265314_102737341 | 260 |
| 198 | 3300046694 | Ga0495649_0219438 | Ga0495649_0219438_118_963 | 260 |
| 199 | 3300048904 | Ga0496101_0213643 | Ga0496101_0213643_497_1327 | 260 |
| 200 | 3300048909 | Ga0496106_0014872 | Ga0496106_0014872_3440_4270 | 260 |
| 201 | 3300048924 | Ga0496121_0000154 | Ga0496121_0000154_128126_128971 | 260 |
| 202 | 3300053119 | Ga0500595_011352 | Ga0500595_011352_513_1358 | 260 |
| 203 | 3300053119 | Ga0500595_015812 | Ga0500595_015812_1623_2468 | 260 |
| 204 | 3300053136 | Ga0500559_0065905 | Ga0500559_0065905_743_1588 | 260 |
| 205 | iso_pu_bacteria | 2977915119 | 2977922120 | 260 |
| 206 | 3300003775 | Ga0055524_1013258 | Ga0055524_10132583 | 261 |
| 207 | 3300025299 | Ga0209256_1000146 | Ga0209256_100014663 | 261 |
| 208 | 3300025941 | Ga0207711_10000728 | Ga0207711_100007288 | 261 |
| 209 | 3300031711 | Ga0265314_10034328 | Ga0265314_100343283 | 261 |
| 210 | 3300035172 | Ga0373955_0100915 | Ga0373955_0100915_186_1025 | 261 |
| 211 | 3300037068 | Ga0373925_0187104 | Ga0373925_0187104_23_862 | 261 |
| 212 | iso_pu_bacteria | 8004312739 | 8004320378 | 261 |
| 213 | 3300005327 | Ga0070658_10000306 | Ga0070658_100003065 | 262 |
| 214 | 3300005444 | Ga0070694_100422365 | Ga0070694_1004223651 | 262 |
| 215 | 3300014326 | Ga0157380_10040338 | Ga0157380_100403382 | 262 |
| 216 | 3300025909 | Ga0207705_10004544 | Ga0207705_100045446 | 262 |
| 217 | 3300044712 | Ga0453684_0086457 | Ga0453684_0086457_1726_2574 | 262 |
| 218 | 3300045051 | Ga0451576_0207840 | Ga0451576_0207840_651_1499 | 262 |
| 219 | iso_pu_bacteria | 2643221653 | 2644300536 | 262 |
| 220 | iso_pu_bacteria | 2643221719 | 2644658877 | 262 |
| 221 | iso_pu_bacteria | 2773857925 | 2774868951 | 262 |
| 222 | iso_pu_bacteria | 2773857925 | 2774874087 | 262 |
| 223 | iso_pu_bacteria | 2882456835 | 2882459532 | 262 |
| 224 | iso_pu_bacteria | 2882456835 | 2882459765 | 262 |
| 225 | iso_pu_bacteria | 2894232714 | 2894237903 | 262 |
| 226 | iso_pu_bacteria | 2894232714 | 2894238305 | 262 |
| 227 | iso_pu_bacteria | 2989776772 | 2989781091 | 262 |
| 228 | iso_pu_bacteria | 8005246636 | 8005248666 | 262 |
| 229 | 3300006931 | Ga0097620_100432734 | Ga0097620_1004327341 | 263 |
| 230 | 3300013306 | Ga0163162_10020835 | Ga0163162_100208355 | 263 |
| 231 | 3300014325 | Ga0163163_10000021 | Ga0163163_1000002134 | 263 |
| 232 | 3300014968 | Ga0157379_10004679 | Ga0157379_100046795 | 263 |
| 233 | 3300032004 | Ga0307414_10236724 | Ga0307414_102367242 | 263 |
| 234 | 3300037068 | Ga0373925_0022477 | Ga0373925_0022477_3069_3908 | 263 |
| 235 | 3300041404 | Ga0439436_0010057 | Ga0439436_0010057_1672_2529 | 263 |
| 236 | 3300042015 | Ga0439462_0010247 | Ga0439462_0010247_88_945 | 263 |
| 237 | 3300042122 | Ga0450920_005630 | Ga0450920_005630_427_1284 | 263 |
| 238 | 3300042531 | Ga0450918_007499 | Ga0450918_007499_985_1842 | 263 |
| 239 | 3300046660 | Ga0495625_0116418 | Ga0495625_0116418_716_1573 | 263 |
| 240 | 3300053099 | Ga0500654_090411 | Ga0500654_090411_125_982 | 263 |
| 241 | 3300053157 | Ga0500624_006190 | Ga0500624_006190_485_1342 | 263 |
| 242 | 3300005563 | Ga0068855_100120651 | Ga0068855_1001206513 | 264 |
| 243 | 3300009545 | Ga0105237_10430051 | Ga0105237_104300511 | 264 |
| 244 | 3300032004 | Ga0307414_10029633 | Ga0307414_100296334 | 264 |
| 245 | 3300041407 | Ga0439447_040756 | Ga0439447_040756_137_994 | 264 |
| 246 | 3300046460 | Ga0495638_0102511 | Ga0495638_0102511_541_1389 | 264 |
| 247 | 3300046506 | Ga0495583_0000175 | Ga0495583_0000175_56308_57156 | 264 |
| 248 | 3300046665 | Ga0495661_0069699 | Ga0495661_0069699_215_1063 | 264 |
| 249 | 3300046692 | Ga0495671_0087595 | Ga0495671_0087595_237_1085 | 264 |
| 250 | 3300053103 | Ga0500555_002637 | Ga0500555_002637_3640_4488 | 264 |
| 251 | iso_pu_bacteria | 2508501122 | 2509112283 | 264 |
| 252 | iso_pu_bacteria | 2509276019 | 2509379408 | 264 |
| 253 | iso_pu_bacteria | 2509276033 | 2509448460 | 264 |
| 254 | iso_pu_bacteria | 2510065019 | 2510136509 | 264 |
| 255 | iso_pu_bacteria | 2513237084 | 2513569639 | 264 |
| 256 | iso_pu_bacteria | 2513237085 | 2513576464 | 264 |
| 257 | iso_pu_bacteria | 2513237093 | 2513635132 | 264 |
| 258 | iso_pu_bacteria | 2513237103 | 2513709802 | 264 |
| 259 | iso_pu_bacteria | 2513237162 | 2514018779 | 264 |
| 260 | iso_pu_bacteria | 2515075009 | 2515115081 | 264 |
| 261 | iso_pu_bacteria | 2515154113 | 2515633257 | 264 |
| 262 | iso_pu_bacteria | 2515154114 | 2515642482 | 264 |
| 263 | iso_pu_bacteria | 2515154116 | 2515658459 | 264 |
| 264 | iso_pu_bacteria | 2515154134 | 2515741933 | 264 |
| 265 | iso_pu_bacteria | 2516143018 | 2516207531 | 264 |
| 266 | iso_pu_bacteria | 2516653077 | 2517041918 | 264 |
| 267 | iso_pu_bacteria | 2516653085 | 2517081051 | 264 |
| 268 | iso_pu_bacteria | 2517093000 | 2517098609 | 264 |
| 269 | iso_pu_bacteria | 2517287029 | 2517410844 | 264 |
| 270 | iso_pu_bacteria | 2519899620 | 2520380745 | 264 |
| 271 | iso_pu_bacteria | 2529292951 | 2530644501 | 264 |
| 272 | iso_pu_bacteria | 2534681796 | 2535520007 | 264 |
| 273 | iso_pu_bacteria | 2558860100 | 2558861463 | 264 |
| 274 | iso_pu_bacteria | 2582581298 | 2585221609 | 264 |
| 275 | iso_pu_bacteria | 2582581306 | 2585267579 | 264 |
| 276 | iso_pu_bacteria | 2582581865 | 2585386639 | 264 |
| 277 | iso_pu_bacteria | 2582581866 | 2585393125 | 264 |
| 278 | iso_pu_bacteria | 2585427526 | 2585524183 | 264 |
| 279 | iso_pu_bacteria | 2585427528 | 2585539219 | 264 |
| 280 | iso_pu_bacteria | 2585427529 | 2585544221 | 264 |
| 281 | iso_pu_bacteria | 2585427593 | 2585837172 | 264 |
| 282 | iso_pu_bacteria | 2595698237 | 2596374959 | 264 |
| 283 | iso_pu_bacteria | 2599185156 | 2599331629 | 264 |
| 284 | iso_pu_bacteria | 2615840624 | 2616295212 | 264 |
| 285 | iso_pu_bacteria | 2617270742 | 2617381226 | 264 |
| 286 | iso_pu_bacteria | 2643221607 | 2644050650 | 264 |
| 287 | iso_pu_bacteria | 2643221636 | 2644205124 | 264 |
| 288 | iso_pu_bacteria | 2643221637 | 2644210158 | 264 |
| 289 | iso_pu_bacteria | 2643221643 | 2644240828 | 264 |
| 290 | iso_pu_bacteria | 2643221686 | 2644483568 | 264 |
| 291 | iso_pu_bacteria | 2643221718 | 2644653710 | 264 |
| 292 | iso_pu_bacteria | 2657244999 | 2657684292 | 264 |
| 293 | iso_pu_bacteria | 2690316117 | 2692318424 | 264 |
| 294 | iso_pu_bacteria | 2718217882 | 2719183772 | 264 |
| 295 | iso_pu_bacteria | 2718218009 | 2719728213 | 264 |
| 296 | iso_pu_bacteria | 2718218363 | 2721145074 | 264 |
| 297 | iso_pu_bacteria | 2718218365 | 2721155811 | 264 |
| 298 | iso_pu_bacteria | 2718218366 | 2721167161 | 264 |
| 299 | iso_pu_bacteria | 2721755514 | 2722838139 | 264 |
| 300 | iso_pu_bacteria | 2721755810 | 2724042407 | 264 |
| 301 | iso_pu_bacteria | 2724679232 | 2725952215 | 264 |
| 302 | iso_pu_bacteria | 2728369365 | 2730161912 | 264 |
| 303 | iso_pu_bacteria | 2728369397 | 2730300918 | 264 |
| 304 | iso_pu_bacteria | 2738541333 | 2739033667 | 264 |
| 305 | iso_pu_bacteria | 2751185821 | 2753459468 | 264 |
| 306 | iso_pu_bacteria | 2756170246 | 2756678153 | 264 |
| 307 | iso_pu_bacteria | 2765235942 | 2766068389 | 264 |
| 308 | iso_pu_bacteria | 2791355082 | 2792580477 | 264 |
| 309 | iso_pu_bacteria | 2791355091 | 2792619484 | 264 |
| 310 | iso_pu_bacteria | 2791355092 | 2792627255 | 264 |
| 311 | iso_pu_bacteria | 2791355094 | 2792639848 | 264 |
| 312 | iso_pu_bacteria | 2791355253 | 2793279986 | 264 |
| 313 | iso_pu_bacteria | 2791355259 | 2793317204 | 264 |
| 314 | iso_pu_bacteria | 2791355260 | 2793324043 | 264 |
| 315 | iso_pu_bacteria | 2791355261 | 2793325648 | 264 |
| 316 | iso_pu_bacteria | 2791355262 | 2793333072 | 264 |
| 317 | iso_pu_bacteria | 2791355263 | 2793340124 | 264 |
| 318 | iso_pu_bacteria | 2791355264 | 2793346248 | 264 |
| 319 | iso_pu_bacteria | 2791355265 | 2793355466 | 264 |
| 320 | iso_pu_bacteria | 2791355266 | 2793357796 | 264 |
| 321 | iso_pu_bacteria | 2791355267 | 2793366534 | 264 |
| 322 | iso_pu_bacteria | 2802429268 | 2804754698 | 264 |
| 323 | iso_pu_bacteria | 2802429605 | 2805929057 | 264 |
| 324 | iso_pu_bacteria | 2802429606 | 2805937241 | 264 |
| 325 | iso_pu_bacteria | 2802429633 | 2806044834 | 264 |
| 326 | iso_pu_bacteria | 2802429634 | 2806054006 | 264 |
| 327 | iso_pu_bacteria | 2802429635 | 2806059902 | 264 |
| 328 | iso_pu_bacteria | 2802429636 | 2806066045 | 264 |
| 329 | iso_pu_bacteria | 2802429637 | 2806073373 | 264 |
| 330 | iso_pu_bacteria | 2838035591 | 2838039561 | 264 |
| 331 | iso_pu_bacteria | 2838042994 | 2838045949 | 264 |
| 332 | iso_pu_bacteria | 2838061910 | 2838062865 | 264 |
| 333 | iso_pu_bacteria | 2838074704 | 2838077734 | 264 |
| 334 | iso_pu_bacteria | 2838661181 | 2838667962 | 264 |
| 335 | iso_pu_bacteria | 2838686498 | 2838693569 | 264 |
| 336 | iso_pu_bacteria | 2838729681 | 2838735462 | 264 |
| 337 | iso_pu_bacteria | 2838742623 | 2838748364 | 264 |
| 338 | iso_pu_bacteria | 2841851746 | 2841858428 | 264 |
| 339 | iso_pu_bacteria | 2841864319 | 2841869762 | 264 |
| 340 | iso_pu_bacteria | 2842110456 | 2842115808 | 264 |
| 341 | iso_pu_bacteria | 2842156927 | 2842162676 | 264 |
| 342 | iso_pu_bacteria | 2842163707 | 2842167047 | 264 |
| 343 | iso_pu_bacteria | 2842180545 | 2842186180 | 264 |
| 344 | iso_pu_bacteria | 2842217011 | 2842222253 | 264 |
| 345 | iso_pu_bacteria | 2842229732 | 2842236055 | 264 |
| 346 | iso_pu_bacteria | 2842243621 | 2842249986 | 264 |
| 347 | iso_pu_bacteria | 2842257432 | 2842263282 | 264 |
| 348 | iso_pu_bacteria | 2842264693 | 2842268017 | 264 |
| 349 | iso_pu_bacteria | 2842271015 | 2842278038 | 264 |
| 350 | iso_pu_bacteria | 2842304105 | 2842310040 | 264 |
| 351 | iso_pu_bacteria | 2842341865 | 2842344000 | 264 |
| 352 | iso_pu_bacteria | 2842363717 | 2842369688 | 264 |
| 353 | iso_pu_bacteria | 2842402390 | 2842407173 | 264 |
| 354 | iso_pu_bacteria | 2842409023 | 2842414065 | 264 |
| 355 | iso_pu_bacteria | 2842415677 | 2842420706 | 264 |
| 356 | iso_pu_bacteria | 2842447887 | 2842450140 | 264 |
| 357 | iso_pu_bacteria | 2842521101 | 2842522772 | 264 |
| 358 | iso_pu_bacteria | 2842922631 | 2842924029 | 264 |
| 359 | iso_pu_bacteria | 2844454524 | 2844461099 | 264 |
| 360 | iso_pu_bacteria | 2847417321 | 2847423074 | 264 |
| 361 | iso_pu_bacteria | 2848992105 | 2848997533 | 264 |
| 362 | iso_pu_bacteria | 2850079185 | 2850084569 | 264 |
| 363 | iso_pu_bacteria | 2855825444 | 2855829031 | 264 |
| 364 | iso_pu_bacteria | 2855839649 | 2855844149 | 264 |
| 365 | iso_pu_bacteria | 2855872281 | 2855874061 | 264 |
| 366 | iso_pu_bacteria | 2857516855 | 2857519190 | 264 |
| 367 | iso_pu_bacteria | 2858800743 | 2858806601 | 264 |
| 368 | iso_pu_bacteria | 2861691609 | 2861696103 | 264 |
| 369 | iso_pu_bacteria | 2871466892 | 2871471903 | 264 |
| 370 | iso_pu_bacteria | 2889306138 | 2889306481 | 264 |
| 371 | iso_pu_bacteria | 2896384573 | 2896391848 | 264 |
| 372 | iso_pu_bacteria | 2902330777 | 2902332836 | 264 |
| 373 | iso_pu_bacteria | 2913295892 | 2913296779 | 264 |
| 374 | iso_pu_bacteria | 2915980308 | 2915983621 | 264 |
| 375 | iso_pu_bacteria | 2915986958 | 2915992197 | 264 |
| 376 | iso_pu_bacteria | 2915993759 | 2915999271 | 264 |
| 377 | iso_pu_bacteria | 2916000859 | 2916001348 | 264 |
| 378 | iso_pu_bacteria | 2916007675 | 2916011600 | 264 |
| 379 | iso_pu_bacteria | 2916014648 | 2916018867 | 264 |
| 380 | iso_pu_bacteria | 2916021584 | 2916026074 | 264 |
| 381 | iso_pu_bacteria | 2916028427 | 2916032099 | 264 |
| 382 | iso_pu_bacteria | 2916035215 | 2916039045 | 264 |
| 383 | iso_pu_bacteria | 2916041962 | 2916046164 | 264 |
| 384 | iso_pu_bacteria | 2916048683 | 2916051899 | 264 |
| 385 | iso_pu_bacteria | 2916055098 | 2916060888 | 264 |
| 386 | iso_pu_bacteria | 2916061851 | 2916065319 | 264 |
| 387 | iso_pu_bacteria | 2916068649 | 2916070113 | 264 |
| 388 | iso_pu_bacteria | 2916076590 | 2916077896 | 264 |
| 389 | iso_pu_bacteria | 2919100787 | 2919103472 | 264 |
| 390 | iso_pu_bacteria | 2920760137 | 2920765012 | 264 |
| 391 | iso_pu_bacteria | 2921201388 | 2921203576 | 264 |
| 392 | iso_pu_bacteria | 2921208531 | 2921209964 | 264 |
| 393 | iso_pu_bacteria | 2921237296 | 2921237768 | 264 |
| 394 | iso_pu_bacteria | 2921244191 | 2921248301 | 264 |
| 395 | iso_pu_bacteria | 2921250672 | 2921256860 | 264 |
| 396 | iso_pu_bacteria | 2921257292 | 2921260992 | 264 |
| 397 | iso_pu_bacteria | 2921263974 | 2921267907 | 264 |
| 398 | iso_pu_bacteria | 2921282425 | 2921283706 | 264 |
| 399 | iso_pu_bacteria | 2921289301 | 2921289711 | 264 |
| 400 | iso_pu_bacteria | 2921296804 | 2921300447 | 264 |
| 401 | iso_pu_bacteria | 2924144063 | 2924145724 | 264 |
| 402 | iso_pu_bacteria | 2924150972 | 2924155834 | 264 |
| 403 | iso_pu_bacteria | 2924158325 | 2924162435 | 264 |
| 404 | iso_pu_bacteria | 2924165586 | 2924166688 | 264 |
| 405 | iso_pu_bacteria | 2924172951 | 2924179577 | 264 |
| 406 | iso_pu_bacteria | 2924179722 | 2924183388 | 264 |
| 407 | iso_pu_bacteria | 2924186466 | 2924186845 | 264 |
| 408 | iso_pu_bacteria | 2924200457 | 2924204581 | 264 |
| 409 | iso_pu_bacteria | 2924207177 | 2924213688 | 264 |
| 410 | iso_pu_bacteria | 2924214083 | 2924217232 | 264 |
| 411 | iso_pu_bacteria | 2924221636 | 2924222619 | 264 |
| 412 | iso_pu_bacteria | 2924228884 | 2924233886 | 264 |
| 413 | iso_pu_bacteria | 2928125067 | 2928129881 | 264 |
| 414 | iso_pu_bacteria | 2933570622 | 2933576481 | 264 |
| 415 | iso_pu_bacteria | 2933586486 | 2933591774 | 264 |
| 416 | iso_pu_bacteria | 2935894831 | 2935898244 | 264 |
| 417 | iso_pu_bacteria | 2935901341 | 2935905759 | 264 |
| 418 | iso_pu_bacteria | 2936367885 | 2936370197 | 264 |
| 419 | iso_pu_bacteria | 2936375103 | 2936377869 | 264 |
| 420 | iso_pu_bacteria | 2936381700 | 2936384144 | 264 |
| 421 | iso_pu_bacteria | 2996893221 | 2996896955 | 264 |
| 422 | iso_pu_bacteria | 3005409236 | 3005416280 | 264 |
| 423 | iso_pu_bacteria | 3005445848 | 3005451446 | 264 |
| 424 | iso_pu_bacteria | 639633055 | 639651722 | 264 |
| 425 | iso_pu_bacteria | 643692032 | 643823029 | 264 |
| 426 | iso_pu_bacteria | 8005275841 | 8005277161 | 264 |
| 427 | iso_pu_bacteria | 8005289223 | 8005290665 | 264 |
| 428 | iso_pu_bacteria | 8005301065 | 8005305013 | 264 |
| 429 | iso_pu_bacteria | 8005307578 | 8005313113 | 264 |
| 430 | iso_pu_bacteria | 8005376324 | 8005381877 | 264 |
| 431 | iso_pu_bacteria | 8005382845 | 8005388469 | 264 |
| 432 | iso_pu_bacteria | 8005395548 | 8005397635 | 264 |
| 433 | iso_pu_bacteria | 8005430974 | 8005436986 | 264 |
| 434 | iso_pu_bacteria | 8005460587 | 8005466808 | 264 |
| 435 | iso_pu_bacteria | 8005497431 | 8005503083 | 264 |
| 436 | iso_pu_bacteria | 8005556819 | 8005562119 | 264 |
| 437 | iso_pu_bacteria | 8005563573 | 8005567124 | 264 |
| 438 | iso_pu_bacteria | 8005570704 | 8005576306 | 264 |
| 439 | iso_pu_bacteria | 8005619151 | 8005625605 | 264 |
| 440 | iso_pu_bacteria | 8005668836 | 8005675001 | 264 |
| 441 | iso_pu_bacteria | 8005688590 | 8005689443 | 264 |
| 442 | iso_pu_bacteria | 8005695170 | 8005701927 | 264 |
| 443 | iso_pu_bacteria | 8018127388 | 8018130443 | 264 |
| 444 | iso_pu_bacteria | 8018163183 | 8018165911 | 264 |
| 445 | iso_pu_bacteria | 8018176218 | 8018182236 | 264 |
| 446 | iso_pu_bacteria | 8023680758 | 8023682373 | 264 |
| 447 | iso_pu_bacteria | 8024479707 | 8024483699 | 264 |
| 448 | iso_pu_bacteria | 8024486573 | 8024487602 | 264 |
| 449 | iso_pu_bacteria | 8049293176 | 8049298484 | 264 |
| 450 | iso_pu_bacteria | 8056375014 | 8056375181 | 264 |
| 451 | iso_pu_bacteria | 8056382006 | 8056383525 | 264 |
| 452 | iso_pu_bacteria | 8057874678 | 8057878344 | 264 |
| 453 | 3300005336 | Ga0070680_100237580 | Ga0070680_1002375802 | 265 |
| 454 | 3300026075 | Ga0207708_10033943 | Ga0207708_100339433 | 265 |
| 455 | 3300028794 | Ga0307515_10085478 | Ga0307515_100854783 | 265 |
| 456 | 3300035113 | Ga0373936_0054161 | Ga0373936_0054161_693_1544 | 265 |
| 457 | 3300042439 | Ga0439464_0070185 | Ga0439464_0070185_71_928 | 265 |
| 458 | 3300048910 | Ga0496107_0136026 | Ga0496107_0136026_471_1316 | 265 |
| 459 | 3300048915 | Ga0496112_0039486 | Ga0496112_0039486_2030_2875 | 265 |
| 460 | 3300048918 | Ga0496115_0091441 | Ga0496115_0091441_1028_1873 | 265 |
| 461 | 3300049576 | Ga0501040_0384178 | Ga0501040_0384178_135_983 | 265 |
| 462 | 3300049579 | Ga0501043_0248765 | Ga0501043_0248765_301_1149 | 265 |
| 463 | 3300049580 | Ga0501046_0050202 | Ga0501046_0050202_994_1842 | 265 |
| 464 | 3300049584 | Ga0501068_0212678 | Ga0501068_0212678_157_1005 | 265 |
| 465 | 3300049591 | Ga0501075_0046245 | Ga0501075_0046245_1191_2039 | 265 |
| 466 | 3300049741 | Ga0501079_0022511 | Ga0501079_0022511_3709_4557 | 265 |
| 467 | 3300049743 | Ga0501081_0069023 | Ga0501081_0069023_317_1165 | 265 |
| 468 | 3300049744 | Ga0501083_0065996 | Ga0501083_0065996_214_1062 | 265 |
| 469 | 3300053077 | Ga0495601_0007500 | Ga0495601_0007500_3686_4534 | 265 |
| 470 | 3300061734 | Ga0530510_0049503 | Ga0530510_0049503_155_1003 | 265 |
| 471 | 3300061734 | Ga0530510_0127494 | Ga0530510_0127494_903_1751 | 265 |
| 472 | iso_pu_bacteria | 2503198000 | 2503201483 | 265 |
| 473 | iso_pu_bacteria | 2508501123 | 2509113089 | 265 |
| 474 | iso_pu_bacteria | 2508501127 | 2509143937 | 265 |
| 475 | iso_pu_bacteria | 2509276018 | 2509367870 | 265 |
| 476 | iso_pu_bacteria | 2509276022 | 2509396263 | 265 |
| 477 | iso_pu_bacteria | 2510065059 | 2510315554 | 265 |
| 478 | iso_pu_bacteria | 2512875024 | 2512959380 | 265 |
| 479 | iso_pu_bacteria | 2513237090 | 2513611338 | 265 |
| 480 | iso_pu_bacteria | 2513237164 | 2514033563 | 265 |
| 481 | iso_pu_bacteria | 2537561587 | 2537873780 | 265 |
| 482 | iso_pu_bacteria | 2554235003 | 2554246845 | 265 |
| 483 | iso_pu_bacteria | 2558860242 | 2559294071 | 265 |
| 484 | iso_pu_bacteria | 2588253730 | 2588517386 | 265 |
| 485 | iso_pu_bacteria | 2597489875 | 2597813275 | 265 |
| 486 | iso_pu_bacteria | 2599185210 | 2599603601 | 265 |
| 487 | iso_pu_bacteria | 2599185301 | 2599936795 | 265 |
| 488 | iso_pu_bacteria | 2600255279 | 2601608949 | 265 |
| 489 | iso_pu_bacteria | 2600255308 | 2601745724 | 265 |
| 490 | iso_pu_bacteria | 2643221550 | 2643771143 | 265 |
| 491 | iso_pu_bacteria | 2643221558 | 2643813980 | 265 |
| 492 | iso_pu_bacteria | 2643221568 | 2643856128 | 265 |
| 493 | iso_pu_bacteria | 2643221582 | 2643920934 | 265 |
| 494 | iso_pu_bacteria | 2643221623 | 2644129421 | 265 |
| 495 | iso_pu_bacteria | 2643221626 | 2644151283 | 265 |
| 496 | iso_pu_bacteria | 2643221659 | 2644336357 | 265 |
| 497 | iso_pu_bacteria | 2643221693 | 2644519013 | 265 |
| 498 | iso_pu_bacteria | 2643221698 | 2644547193 | 265 |
| 499 | iso_pu_bacteria | 2687453392 | 2688598397 | 265 |
| 500 | iso_pu_bacteria | 2721755686 | 2723575332 | 265 |
| 501 | iso_pu_bacteria | 2738543024 | 2739307131 | 265 |
| 502 | iso_pu_bacteria | 2767802442 | 2770197868 | 265 |
| 503 | iso_pu_bacteria | 2775506902 | 2776269056 | 265 |
| 504 | iso_pu_bacteria | 2775506904 | 2776283805 | 265 |
| 505 | iso_pu_bacteria | 2791355123 | 2792752741 | 265 |
| 506 | iso_pu_bacteria | 2808606387 | 2808986154 | 265 |
| 507 | iso_pu_bacteria | 2818991439 | 2819556280 | 265 |
| 508 | iso_pu_bacteria | 2838675328 | 2838677005 | 265 |
| 509 | iso_pu_bacteria | 2838714209 | 2838715892 | 265 |
| 510 | iso_pu_bacteria | 2838719591 | 2838720307 | 265 |
| 511 | iso_pu_bacteria | 2838724970 | 2838726645 | 265 |
| 512 | iso_pu_bacteria | 2839993093 | 2839993766 | 265 |
| 513 | iso_pu_bacteria | 2841734538 | 2841739154 | 265 |
| 514 | iso_pu_bacteria | 2841846520 | 2841847237 | 265 |
| 515 | iso_pu_bacteria | 2841859092 | 2841860227 | 265 |
| 516 | iso_pu_bacteria | 2842124991 | 2842126733 | 265 |
| 517 | iso_pu_bacteria | 2842130223 | 2842131898 | 265 |
| 518 | iso_pu_bacteria | 2842152218 | 2842152932 | 265 |
| 519 | iso_pu_bacteria | 2842170452 | 2842172136 | 265 |
| 520 | iso_pu_bacteria | 2842175837 | 2842176551 | 265 |
| 521 | iso_pu_bacteria | 2842187318 | 2842189001 | 265 |
| 522 | iso_pu_bacteria | 2842211629 | 2842213313 | 265 |
| 523 | iso_pu_bacteria | 2842224351 | 2842225069 | 265 |
| 524 | iso_pu_bacteria | 2842515876 | 2842517012 | 265 |
| 525 | iso_pu_bacteria | 2842698319 | 2842699684 | 265 |
| 526 | iso_pu_bacteria | 2844002411 | 2844007479 | 265 |
| 527 | iso_pu_bacteria | 2844009547 | 2844013652 | 265 |
| 528 | iso_pu_bacteria | 2856320880 | 2856327528 | 265 |
| 529 | iso_pu_bacteria | 2856328259 | 2856334516 | 265 |
| 530 | iso_pu_bacteria | 2856334872 | 2856340362 | 265 |
| 531 | iso_pu_bacteria | 2856342000 | 2856343891 | 265 |
| 532 | iso_pu_bacteria | 2856364286 | 2856369413 | 265 |
| 533 | iso_pu_bacteria | 2857367948 | 2857371498 | 265 |
| 534 | iso_pu_bacteria | 2869162929 | 2869168239 | 265 |
| 535 | iso_pu_bacteria | 2869169390 | 2869171917 | 265 |
| 536 | iso_pu_bacteria | 2869242130 | 2869242552 | 265 |
| 537 | iso_pu_bacteria | 2869249662 | 2869254084 | 265 |
| 538 | iso_pu_bacteria | 2869256925 | 2869260796 | 265 |
| 539 | iso_pu_bacteria | 2869264136 | 2869269414 | 265 |
| 540 | iso_pu_bacteria | 2869271264 | 2869276483 | 265 |
| 541 | iso_pu_bacteria | 2869278585 | 2869280417 | 265 |
| 542 | iso_pu_bacteria | 2869285874 | 2869286514 | 265 |
| 543 | iso_pu_bacteria | 2871429161 | 2871434667 | 265 |
| 544 | iso_pu_bacteria | 2871435913 | 2871437348 | 265 |
| 545 | iso_pu_bacteria | 2871451962 | 2871459213 | 265 |
| 546 | iso_pu_bacteria | 2871459585 | 2871463866 | 265 |
| 547 | iso_pu_bacteria | 2871474448 | 2871474619 | 265 |
| 548 | iso_pu_bacteria | 2871481445 | 2871482593 | 265 |
| 549 | iso_pu_bacteria | 2874109183 | 2874111720 | 265 |
| 550 | iso_pu_bacteria | 2874116593 | 2874122992 | 265 |
| 551 | iso_pu_bacteria | 2874123672 | 2874130558 | 265 |
| 552 | iso_pu_bacteria | 2874131515 | 2874137854 | 265 |
| 553 | iso_pu_bacteria | 2874139085 | 2874144171 | 265 |
| 554 | iso_pu_bacteria | 2874146452 | 2874149872 | 265 |
| 555 | iso_pu_bacteria | 2874155637 | 2874158130 | 265 |
| 556 | iso_pu_bacteria | 2874162495 | 2874164473 | 265 |
| 557 | iso_pu_bacteria | 2874168670 | 2874169802 | 265 |
| 558 | iso_pu_bacteria | 2876363079 | 2876368529 | 265 |
| 559 | iso_pu_bacteria | 2876369609 | 2876374073 | 265 |
| 560 | iso_pu_bacteria | 2876386047 | 2876387012 | 265 |
| 561 | iso_pu_bacteria | 2876392853 | 2876398395 | 265 |
| 562 | iso_pu_bacteria | 2876399893 | 2876403680 | 265 |
| 563 | iso_pu_bacteria | 2876406927 | 2876412866 | 265 |
| 564 | iso_pu_bacteria | 2876413966 | 2876416334 | 265 |
| 565 | iso_pu_bacteria | 2876420981 | 2876427810 | 265 |
| 566 | iso_pu_bacteria | 2878730984 | 2878732772 | 265 |
| 567 | iso_pu_bacteria | 2878738818 | 2878745166 | 265 |
| 568 | iso_pu_bacteria | 2878745973 | 2878751800 | 265 |
| 569 | iso_pu_bacteria | 2878774303 | 2878775658 | 265 |
| 570 | iso_pu_bacteria | 2878781027 | 2878786825 | 265 |
| 571 | iso_pu_bacteria | 2878788777 | 2878795221 | 265 |
| 572 | iso_pu_bacteria | 2881147464 | 2881151285 | 265 |
| 573 | iso_pu_bacteria | 2881161766 | 2881167485 | 265 |
| 574 | iso_pu_bacteria | 2882632389 | 2882636227 | 265 |
| 575 | iso_pu_bacteria | 2885312484 | 2885318028 | 265 |
| 576 | iso_pu_bacteria | 2888337043 | 2888339376 | 265 |
| 577 | iso_pu_bacteria | 2888343758 | 2888346752 | 265 |
| 578 | iso_pu_bacteria | 2899792073 | 2899792292 | 265 |
| 579 | iso_pu_bacteria | 2899845264 | 2899846567 | 265 |
| 580 | iso_pu_bacteria | 2903448605 | 2903451265 | 265 |
| 581 | iso_pu_bacteria | 2903492973 | 2903504746 | 265 |
| 582 | iso_pu_bacteria | 2903513507 | 2903521023 | 265 |
| 583 | iso_pu_bacteria | 2903521522 | 2903527528 | 265 |
| 584 | iso_pu_bacteria | 2903528002 | 2903533982 | 265 |
| 585 | iso_pu_bacteria | 2904659560 | 2904664950 | 265 |
| 586 | iso_pu_bacteria | 2906308376 | 2906314198 | 265 |
| 587 | iso_pu_bacteria | 2906321335 | 2906327364 | 265 |
| 588 | iso_pu_bacteria | 2906363423 | 2906363724 | 265 |
| 589 | iso_pu_bacteria | 2906370794 | 2906371561 | 265 |
| 590 | iso_pu_bacteria | 2906386501 | 2906391602 | 265 |
| 591 | iso_pu_bacteria | 2906393657 | 2906393703 | 265 |
| 592 | iso_pu_bacteria | 2906401398 | 2906402848 | 265 |
| 593 | iso_pu_bacteria | 2906408224 | 2906408855 | 265 |
| 594 | iso_pu_bacteria | 2906427513 | 2906432819 | 265 |
| 595 | iso_pu_bacteria | 2919114240 | 2919116094 | 265 |
| 596 | iso_pu_bacteria | 2919166419 | 2919167106 | 265 |
| 597 | iso_pu_bacteria | 2920822456 | 2920826783 | 265 |
| 598 | iso_pu_bacteria | 2922151315 | 2922152228 | 265 |
| 599 | iso_pu_bacteria | 2922172374 | 2922175283 | 265 |
| 600 | iso_pu_bacteria | 2924710171 | 2924718688 | 265 |
| 601 | iso_pu_bacteria | 2924718760 | 2924726534 | 265 |
| 602 | iso_pu_bacteria | 2924733363 | 2924735894 | 265 |
| 603 | iso_pu_bacteria | 2924741084 | 2924742222 | 265 |
| 604 | iso_pu_bacteria | 2924754689 | 2924758656 | 265 |
| 605 | iso_pu_bacteria | 2924762789 | 2924765072 | 265 |
| 606 | iso_pu_bacteria | 2924776078 | 2924783303 | 265 |
| 607 | iso_pu_bacteria | 2926754445 | 2926757048 | 265 |
| 608 | iso_pu_bacteria | 2926760298 | 2926761274 | 265 |
| 609 | iso_pu_bacteria | 2929138655 | 2929139187 | 265 |
| 610 | iso_pu_bacteria | 2933006813 | 2933007577 | 265 |
| 611 | iso_pu_bacteria | 2933011516 | 2933012345 | 265 |
| 612 | iso_pu_bacteria | 2933594066 | 2933594789 | 265 |
| 613 | iso_pu_bacteria | 2937813078 | 2937815692 | 265 |
| 614 | iso_pu_bacteria | 2937822353 | 2937824405 | 265 |
| 615 | iso_pu_bacteria | 2937836603 | 2937839341 | 265 |
| 616 | iso_pu_bacteria | 2937848649 | 2937851870 | 265 |
| 617 | iso_pu_bacteria | 2937861824 | 2937867934 | 265 |
| 618 | iso_pu_bacteria | 2937868953 | 2937868964 | 265 |
| 619 | iso_pu_bacteria | 2937877337 | 2937882170 | 265 |
| 620 | iso_pu_bacteria | 2937972304 | 2937978631 | 265 |
| 621 | iso_pu_bacteria | 2937980651 | 2937985651 | 265 |
| 622 | iso_pu_bacteria | 2958034702 | 2958036287 | 265 |
| 623 | iso_pu_bacteria | 2958041894 | 2958045651 | 265 |
| 624 | iso_pu_bacteria | 2958064165 | 2958064418 | 265 |
| 625 | iso_pu_bacteria | 2958071322 | 2958072078 | 265 |
| 626 | iso_pu_bacteria | 2958084443 | 2958089292 | 265 |
| 627 | iso_pu_bacteria | 2958108152 | 2958111579 | 265 |
| 628 | iso_pu_bacteria | 2958122699 | 2958122754 | 265 |
| 629 | iso_pu_bacteria | 2958130278 | 2958130917 | 265 |
| 630 | iso_pu_bacteria | 2958144490 | 2958146791 | 265 |
| 631 | iso_pu_bacteria | 2958158011 | 2958160179 | 265 |
| 632 | iso_pu_bacteria | 2958179912 | 2958184838 | 265 |
| 633 | iso_pu_bacteria | 2961077736 | 2961083005 | 265 |
| 634 | iso_pu_bacteria | 2961114664 | 2961119949 | 265 |
| 635 | iso_pu_bacteria | 2961136820 | 2961142484 | 265 |
| 636 | iso_pu_bacteria | 2961183825 | 2961184321 | 265 |
| 637 | iso_pu_bacteria | 2963644680 | 2963647664 | 265 |
| 638 | iso_pu_bacteria | 2965025482 | 2965031803 | 265 |
| 639 | iso_pu_bacteria | 2965040258 | 2965041821 | 265 |
| 640 | iso_pu_bacteria | 2965047637 | 2965052881 | 265 |
| 641 | iso_pu_bacteria | 2965089291 | 2965091812 | 265 |
| 642 | iso_pu_bacteria | 2965102966 | 2965109388 | 265 |
| 643 | iso_pu_bacteria | 2965110997 | 2965117344 | 265 |
| 644 | iso_pu_bacteria | 2968016561 | 2968018498 | 265 |
| 645 | iso_pu_bacteria | 2968083720 | 2968090295 | 265 |
| 646 | iso_pu_bacteria | 2968110612 | 2968116306 | 265 |
| 647 | iso_pu_bacteria | 2968138860 | 2968143953 | 265 |
| 648 | iso_pu_bacteria | 2970469710 | 2970471329 | 265 |
| 649 | iso_pu_bacteria | 2970489779 | 2970492932 | 265 |
| 650 | iso_pu_bacteria | 2970510686 | 2970515554 | 265 |
| 651 | iso_pu_bacteria | 2970524798 | 2970528535 | 265 |
| 652 | iso_pu_bacteria | 2970532167 | 2970538796 | 265 |
| 653 | iso_pu_bacteria | 2970540015 | 2970544686 | 265 |
| 654 | iso_pu_bacteria | 2970547951 | 2970548957 | 265 |
| 655 | iso_pu_bacteria | 2970593180 | 2970595014 | 265 |
| 656 | iso_pu_bacteria | 2970619444 | 2970620502 | 265 |
| 657 | iso_pu_bacteria | 2970627176 | 2970628095 | 265 |
| 658 | iso_pu_bacteria | 2977843712 | 2977845928 | 265 |
| 659 | iso_pu_bacteria | 2977851361 | 2977855869 | 265 |
| 660 | iso_pu_bacteria | 2977864932 | 2977867129 | 265 |
| 661 | iso_pu_bacteria | 2977872689 | 2977874829 | 265 |
| 662 | iso_pu_bacteria | 2977898635 | 2977906715 | 265 |
| 663 | iso_pu_bacteria | 2977907340 | 2977909255 | 265 |
| 664 | iso_pu_bacteria | 2977922695 | 2977924172 | 265 |
| 665 | iso_pu_bacteria | 2977935797 | 2977936064 | 265 |
| 666 | iso_pu_bacteria | 2977950692 | 2977954881 | 265 |
| 667 | iso_pu_bacteria | 2977957713 | 2977960850 | 265 |
| 668 | iso_pu_bacteria | 2977986579 | 2977992171 | 265 |
| 669 | iso_pu_bacteria | 2978969890 | 2978973524 | 265 |
| 670 | iso_pu_bacteria | 2979089926 | 2979093446 | 265 |
| 671 | iso_pu_bacteria | 2979095461 | 2979099168 | 265 |
| 672 | iso_pu_bacteria | 2979100975 | 2979105420 | 265 |
| 673 | iso_pu_bacteria | 2979764755 | 2979770877 | 265 |
| 674 | iso_pu_bacteria | 2979793036 | 2979799341 | 265 |
| 675 | iso_pu_bacteria | 2984509177 | 2984512729 | 265 |
| 676 | iso_pu_bacteria | 2984518228 | 2984520909 | 265 |
| 677 | iso_pu_bacteria | 2984537506 | 2984540204 | 265 |
| 678 | iso_pu_bacteria | 2984587000 | 2984591807 | 265 |
| 679 | iso_pu_bacteria | 2984601300 | 2984602398 | 265 |
| 680 | iso_pu_bacteria | 2987645492 | 2987649723 | 265 |
| 681 | iso_pu_bacteria | 2987666974 | 2987667978 | 265 |
| 682 | iso_pu_bacteria | 2987673487 | 2987675183 | 265 |
| 683 | iso_pu_bacteria | 2996310559 | 2996314112 | 265 |
| 684 | iso_pu_bacteria | 2996336353 | 2996339055 | 265 |
| 685 | iso_pu_bacteria | 2996348954 | 2996350121 | 265 |
| 686 | iso_pu_bacteria | 2996386984 | 2996392301 | 265 |
| 687 | iso_pu_bacteria | 3000135777 | 3000140709 | 265 |
| 688 | iso_pu_bacteria | 3004167301 | 3004168844 | 265 |
| 689 | iso_pu_bacteria | 3004195979 | 3004197472 | 265 |
| 690 | iso_pu_bacteria | 3004211236 | 3004215906 | 265 |
| 691 | iso_pu_bacteria | 3004218560 | 3004221928 | 265 |
| 692 | iso_pu_bacteria | 3004232784 | 3004236654 | 265 |
| 693 | iso_pu_bacteria | 3004239961 | 3004242819 | 265 |
| 694 | iso_pu_bacteria | 3004248173 | 3004250496 | 265 |
| 695 | iso_pu_bacteria | 3004268573 | 3004274891 | 265 |
| 696 | iso_pu_bacteria | 3004275668 | 3004276820 | 265 |
| 697 | iso_pu_bacteria | 3004289098 | 3004293183 | 265 |
| 698 | iso_pu_bacteria | 3004334049 | 3004334412 | 265 |
| 699 | iso_pu_bacteria | 637000159 | 637074647 | 265 |
| 700 | iso_pu_bacteria | 649633066 | 649872924 | 265 |
| 701 | iso_pu_bacteria | 650716007 | 650739264 | 265 |
| 702 | iso_pu_bacteria | 8002285264 | 8002289082 | 265 |
| 703 | iso_pu_bacteria | 8003570095 | 8003570299 | 265 |
| 704 | iso_pu_bacteria | 8004300914 | 8004302852 | 265 |
| 705 | iso_pu_bacteria | 8004361976 | 8004367194 | 265 |
| 706 | iso_pu_bacteria | 8004387939 | 8004393688 | 265 |
| 707 | iso_pu_bacteria | 8004395343 | 8004399223 | 265 |
| 708 | iso_pu_bacteria | 8004633249 | 8004638623 | 265 |
| 709 | iso_pu_bacteria | 8004695233 | 8004699737 | 265 |
| 710 | iso_pu_bacteria | 8004714634 | 8004720456 | 265 |
| 711 | iso_pu_bacteria | 8004727605 | 8004729339 | 265 |
| 712 | iso_pu_bacteria | 8054460903 | 8054461608 | 265 |
| 713 | iso_pu_bacteria | 8055617313 | 8055620731 | 265 |
| 714 | 3300049584 | Ga0501068_0025041 | Ga0501068_0025041_1475_2329 | 266 |
| 715 | iso_pu_bacteria | 2899803654 | 2899805515 | 266 |
| 716 | 3300005985 | Ga0081539_10041427 | Ga0081539_100414272 | 267 |
| 717 | 3300053084 | Ga0495595_0061418 | Ga0495595_0061418_890_1744 | 267 |
| 718 | 3300053146 | Ga0500588_0019831 | Ga0500588_0019831_651_1505 | 267 |
| 719 | iso_pu_bacteria | 2510065057 | 2510308672 | 267 |
| 720 | iso_pu_bacteria | 2511231052 | 2511498213 | 267 |
| 721 | iso_pu_bacteria | 2512047086 | 2512529369 | 267 |
| 722 | iso_pu_bacteria | 2512875026 | 2512969526 | 267 |
| 723 | iso_pu_bacteria | 2513237086 | 2513587908 | 267 |
| 724 | iso_pu_bacteria | 2513237089 | 2513606250 | 267 |
| 725 | iso_pu_bacteria | 2513237091 | 2513619672 | 267 |
| 726 | iso_pu_bacteria | 2513237140 | 2513885166 | 267 |
| 727 | iso_pu_bacteria | 2513237143 | 2513906245 | 267 |
| 728 | iso_pu_bacteria | 2513237156 | 2513985042 | 267 |
| 729 | iso_pu_bacteria | 2513237160 | 2514007965 | 267 |
| 730 | iso_pu_bacteria | 2515154107 | 2515610786 | 267 |
| 731 | iso_pu_bacteria | 2516653046 | 2516896144 | 267 |
| 732 | iso_pu_bacteria | 2517487022 | 2517565596 | 267 |
| 733 | iso_pu_bacteria | 2524023207 | 2524449578 | 267 |
| 734 | iso_pu_bacteria | 2551306084 | 2551674955 | 267 |
| 735 | iso_pu_bacteria | 2551306085 | 2551687271 | 267 |
| 736 | iso_pu_bacteria | 2551306086 | 2551692447 | 267 |
| 737 | iso_pu_bacteria | 2551306087 | 2551697825 | 267 |
| 738 | iso_pu_bacteria | 2551306089 | 2551708275 | 267 |
| 739 | iso_pu_bacteria | 2551306090 | 2551721588 | 267 |
| 740 | iso_pu_bacteria | 2551306091 | 2551728193 | 267 |
| 741 | iso_pu_bacteria | 2551306092 | 2551734447 | 267 |
| 742 | iso_pu_bacteria | 2551306093 | 2551743250 | 267 |
| 743 | iso_pu_bacteria | 2802428858 | 2802722047 | 267 |
| 744 | iso_pu_bacteria | 2802428859 | 2802723020 | 267 |
| 745 | iso_pu_bacteria | 2802428860 | 2802728847 | 267 |
| 746 | iso_pu_bacteria | 2802428861 | 2802735214 | 267 |
| 747 | iso_pu_bacteria | 2802428862 | 2802742182 | 267 |
| 748 | iso_pu_bacteria | 2802428863 | 2802748629 | 267 |
| 749 | iso_pu_bacteria | 2915650412 | 2915650834 | 267 |
| 750 | iso_pu_bacteria | 2936996657 | 2937002245 | 267 |
| 751 | iso_pu_bacteria | 2937002841 | 2937007237 | 267 |
| 752 | iso_pu_bacteria | 2937009748 | 2937016031 | 267 |
| 753 | iso_pu_bacteria | 2937016420 | 2937020758 | 267 |
| 754 | iso_pu_bacteria | 2937023124 | 2937026938 | 267 |
| 755 | iso_pu_bacteria | 2937029754 | 2937034973 | 267 |
| 756 | iso_pu_bacteria | 2937036028 | 2937039204 | 267 |
| 757 | iso_pu_bacteria | 2937042894 | 2937048050 | 267 |
| 758 | iso_pu_bacteria | 2937049772 | 2937054137 | 267 |
| 759 | iso_pu_bacteria | 2937056579 | 2937060592 | 267 |
| 760 | iso_pu_bacteria | 2937063883 | 2937068026 | 267 |
| 761 | iso_pu_bacteria | 2937071275 | 2937071594 | 267 |
| 762 | iso_pu_bacteria | 2937078374 | 2937084383 | 267 |
| 763 | iso_pu_bacteria | 2937084907 | 2937091404 | 267 |
| 764 | iso_pu_bacteria | 2937091812 | 2937095323 | 267 |
| 765 | iso_pu_bacteria | 2937098957 | 2937103588 | 267 |
| 766 | iso_pu_bacteria | 2937106411 | 2937110313 | 267 |
| 767 | iso_pu_bacteria | 2937113482 | 2937117180 | 267 |
| 768 | iso_pu_bacteria | 2937119839 | 2937123599 | 267 |
| 769 | iso_pu_bacteria | 2937126314 | 2937130534 | 267 |
| 770 | iso_pu_bacteria | 2957375807 | 2957379112 | 267 |
| 771 | iso_pu_bacteria | 2957382221 | 2957386354 | 267 |
| 772 | iso_pu_bacteria | 2957388812 | 2957392775 | 267 |
| 773 | iso_pu_bacteria | 2957395598 | 2957401467 | 267 |
| 774 | iso_pu_bacteria | 2957402308 | 2957406658 | 267 |
| 775 | iso_pu_bacteria | 2957408893 | 2957414653 | 267 |
| 776 | iso_pu_bacteria | 2957415311 | 2957415715 | 267 |
| 777 | iso_pu_bacteria | 2957422303 | 2957427374 | 267 |
| 778 | iso_pu_bacteria | 2957437181 | 2957437911 | 267 |
| 779 | iso_pu_bacteria | 2957443900 | 2957450478 | 267 |
| 780 | iso_pu_bacteria | 2957450854 | 2957457517 | 267 |
| 781 | iso_pu_bacteria | 2957457609 | 2957461455 | 267 |
| 782 | iso_pu_bacteria | 2957464669 | 2957468593 | 267 |
| 783 | iso_pu_bacteria | 2957471148 | 2957471582 | 267 |
| 784 | iso_pu_bacteria | 2957478035 | 2957484258 | 267 |
| 785 | iso_pu_bacteria | 2957484790 | 2957488625 | 267 |
| 786 | iso_pu_bacteria | 2957491536 | 2957497258 | 267 |
| 787 | iso_pu_bacteria | 2957498199 | 2957505325 | 267 |
| 788 | iso_pu_bacteria | 2957505466 | 2957509672 | 267 |
| 789 | iso_pu_bacteria | 2960584000 | 2960585873 | 267 |
| 790 | iso_pu_bacteria | 2960591022 | 2960596436 | 267 |
| 791 | iso_pu_bacteria | 2960597568 | 2960601091 | 267 |
| 792 | iso_pu_bacteria | 2960603979 | 2960608833 | 267 |
| 793 | iso_pu_bacteria | 2960610863 | 2960617135 | 267 |
| 794 | iso_pu_bacteria | 2960617483 | 2960623592 | 267 |
| 795 | iso_pu_bacteria | 2960624210 | 2960625723 | 267 |
| 796 | iso_pu_bacteria | 2960631154 | 2960634340 | 267 |
| 797 | iso_pu_bacteria | 2960637947 | 2960645321 | 267 |
| 798 | iso_pu_bacteria | 2960645483 | 2960649765 | 267 |
| 799 | iso_pu_bacteria | 2960652885 | 2960655386 | 267 |
| 800 | iso_pu_bacteria | 2960660292 | 2960667282 | 267 |
| 801 | iso_pu_bacteria | 2960667422 | 2960671622 | 267 |
| 802 | iso_pu_bacteria | 2960674078 | 2960679885 | 267 |
| 803 | iso_pu_bacteria | 2960680706 | 2960683431 | 267 |
| 804 | iso_pu_bacteria | 2960687367 | 2960693828 | 267 |
| 805 | iso_pu_bacteria | 2960693952 | 2960695283 | 267 |
| 806 | iso_pu_bacteria | 2964607997 | 2964611947 | 267 |
| 807 | iso_pu_bacteria | 2964615318 | 2964619646 | 267 |
| 808 | iso_pu_bacteria | 2964621998 | 2964624905 | 267 |
| 809 | iso_pu_bacteria | 2964628898 | 2964636011 | 267 |
| 810 | iso_pu_bacteria | 2964636051 | 2964640069 | 267 |
| 811 | iso_pu_bacteria | 2964643177 | 2964647448 | 267 |
| 812 | iso_pu_bacteria | 2964649959 | 2964653797 | 267 |
| 813 | iso_pu_bacteria | 2964656573 | 2964663401 | 267 |
| 814 | iso_pu_bacteria | 2964663802 | 2964670544 | 267 |
| 815 | iso_pu_bacteria | 2964670856 | 2964673145 | 267 |
| 816 | iso_pu_bacteria | 2964678106 | 2964682786 | 267 |
| 817 | iso_pu_bacteria | 2964685014 | 2964690172 | 267 |
| 818 | iso_pu_bacteria | 2964691889 | 2964695601 | 267 |
| 819 | iso_pu_bacteria | 2964698721 | 2964703759 | 267 |
| 820 | iso_pu_bacteria | 2964705432 | 2964712629 | 267 |
| 821 | iso_pu_bacteria | 2964712639 | 2964716263 | 267 |
| 822 | iso_pu_bacteria | 2964719344 | 2964720629 | 267 |
| 823 | iso_pu_bacteria | 2967664464 | 2967665759 | 267 |
| 824 | iso_pu_bacteria | 2967671571 | 2967672519 | 267 |
| 825 | iso_pu_bacteria | 2967678726 | 2967683343 | 267 |
| 826 | iso_pu_bacteria | 2967686174 | 2967688004 | 267 |
| 827 | iso_pu_bacteria | 2967693043 | 2967696997 | 267 |
| 828 | iso_pu_bacteria | 2967699805 | 2967703946 | 267 |
| 829 | iso_pu_bacteria | 2967706974 | 2967711169 | 267 |
| 830 | iso_pu_bacteria | 2967714385 | 2967718414 | 267 |
| 831 | iso_pu_bacteria | 2967721400 | 2967727003 | 267 |
| 832 | iso_pu_bacteria | 2967728569 | 2967734052 | 267 |
| 833 | iso_pu_bacteria | 2967735183 | 2967738809 | 267 |
| 834 | iso_pu_bacteria | 2967742019 | 2967747974 | 267 |
| 835 | iso_pu_bacteria | 2967755722 | 2967759414 | 267 |
| 836 | iso_pu_bacteria | 2967762386 | 2967766273 | 267 |
| 837 | iso_pu_bacteria | 2967769361 | 2967773552 | 267 |
| 838 | iso_pu_bacteria | 2967775926 | 2967780793 | 267 |
| 839 | iso_pu_bacteria | 2970019648 | 2970020133 | 267 |
| 840 | iso_pu_bacteria | 2970026789 | 2970028926 | 267 |
| 841 | iso_pu_bacteria | 2970033650 | 2970034230 | 267 |
| 842 | iso_pu_bacteria | 2970040964 | 2970042405 | 267 |
| 843 | iso_pu_bacteria | 2970047711 | 2970051668 | 267 |
| 844 | iso_pu_bacteria | 2970054988 | 2970059185 | 267 |
| 845 | iso_pu_bacteria | 2970061556 | 2970065410 | 267 |
| 846 | iso_pu_bacteria | 2970068827 | 2970074093 | 267 |
| 847 | iso_pu_bacteria | 2970076120 | 2970080736 | 267 |
| 848 | iso_pu_bacteria | 2970082768 | 2970087094 | 267 |
| 849 | iso_pu_bacteria | 2970088815 | 2970093142 | 267 |
| 850 | iso_pu_bacteria | 2970095765 | 2970099662 | 267 |
| 851 | iso_pu_bacteria | 2970102677 | 2970106503 | 267 |
| 852 | iso_pu_bacteria | 2970109326 | 2970113702 | 267 |
| 853 | iso_pu_bacteria | 2970116247 | 2970120070 | 267 |
| 854 | iso_pu_bacteria | 2970122695 | 2970128485 | 267 |
| 855 | iso_pu_bacteria | 2970129317 | 2970135712 | 267 |
| 856 | iso_pu_bacteria | 2970136068 | 2970141914 | 267 |
| 857 | iso_pu_bacteria | 2970143518 | 2970147816 | 267 |
| 858 | iso_pu_bacteria | 2970149975 | 2970154082 | 267 |
| 859 | iso_pu_bacteria | 2970156795 | 2970161912 | 267 |
| 860 | iso_pu_bacteria | 2970164137 | 2970168097 | 267 |
| 861 | iso_pu_bacteria | 2970170962 | 2970171611 | 267 |
| 862 | iso_pu_bacteria | 2970177841 | 2970184551 | 267 |
| 863 | iso_pu_bacteria | 2970184632 | 2970190228 | 267 |
| 864 | iso_pu_bacteria | 2970191845 | 2970195939 | 267 |
| 865 | iso_pu_bacteria | 2977516862 | 2977517621 | 267 |
| 866 | iso_pu_bacteria | 2977523885 | 2977530689 | 267 |
| 867 | iso_pu_bacteria | 2977530762 | 2977533929 | 267 |
| 868 | iso_pu_bacteria | 2977537788 | 2977541600 | 267 |
| 869 | iso_pu_bacteria | 2977544691 | 2977548017 | 267 |
| 870 | iso_pu_bacteria | 2977551784 | 2977556292 | 267 |
| 871 | iso_pu_bacteria | 2977558990 | 2977565768 | 267 |
| 872 | iso_pu_bacteria | 2977565890 | 2977570193 | 267 |
| 873 | iso_pu_bacteria | 2977572785 | 2977576932 | 267 |
| 874 | iso_pu_bacteria | 2977579622 | 2977583433 | 267 |
| 875 | iso_pu_bacteria | 648276728 | 648738317 | 267 |
| 876 | iso_pu_bacteria | 8003992118 | 8003996730 | 267 |
| 877 | iso_pu_bacteria | 8003999396 | 8004004073 | 267 |
| 878 | 3300002739 | JGI25158J39367_1000612 | JGI25158J39367_10006124 | 268 |
| 879 | 3300002773 | JGI25152J39213_1004158 | JGI25152J39213_10041584 | 268 |
| 880 | 3300002774 | JGI25150J39212_1000746 | JGI25150J39212_10007465 | 268 |
| 881 | 3300002987 | JGI25159J45721_1000089 | JGI25159J45721_100008910 | 268 |
| 882 | 3300003187 | JGI25151J46595_10000632 | JGI25151J46595_1000063223 | 268 |
| 883 | 3300003215 | JGI25153J46596_10003277 | JGI25153J46596_100032778 | 268 |
| 884 | 3300003354 | JGI25160J50197_1000726 | JGI25160J50197_10007268 | 268 |
| 885 | 3300003354 | JGI25160J50197_1004162 | JGI25160J50197_10041625 | 268 |
| 886 | 3300003374 | JGI25161J50226_1001711 | JGI25161J50226_10017113 | 268 |
| 887 | 3300003374 | JGI25161J50226_1003754 | JGI25161J50226_10037543 | 268 |
| 888 | 3300003771 | Ga0055526_1005972 | Ga0055526_10059725 | 268 |
| 889 | 3300003771 | Ga0055526_1023052 | Ga0055526_10230522 | 268 |
| 890 | 3300003775 | Ga0055524_1009871 | Ga0055524_10098712 | 268 |
| 891 | 3300003790 | Ga0055528_1000514 | Ga0055528_100051425 | 268 |
| 892 | 3300003790 | Ga0055528_1001577 | Ga0055528_10015773 | 268 |
| 893 | 3300003790 | Ga0055528_1001960 | Ga0055528_100196010 | 268 |
| 894 | 3300003790 | Ga0055528_1004369 | Ga0055528_10043694 | 268 |
| 895 | 3300003792 | Ga0055540_1000050 | Ga0055540_1000050132 | 268 |
| 896 | 3300003792 | Ga0055540_1006737 | Ga0055540_10067372 | 268 |
| 897 | 3300003792 | Ga0055540_1022646 | Ga0055540_10226462 | 268 |
| 898 | 3300004625 | Ga0055543_1000021 | Ga0055543_100002151 | 268 |
| 899 | 3300004625 | Ga0055543_1001872 | Ga0055543_10018724 | 268 |
| 900 | 3300005262 | Ga0065165_1008053 | Ga0065165_10080535 | 268 |
| 901 | 3300005262 | Ga0065165_1010256 | Ga0065165_10102562 | 268 |
| 902 | 3300005336 | Ga0070680_100061370 | Ga0070680_1000613702 | 268 |
| 903 | 3300005341 | Ga0070691_10005336 | Ga0070691_100053364 | 268 |
| 904 | 3300005455 | Ga0070663_100055676 | Ga0070663_1000556763 | 268 |
| 905 | 3300005458 | Ga0070681_10054794 | Ga0070681_100547944 | 268 |
| 906 | 3300005530 | Ga0070679_100058190 | Ga0070679_1000581903 | 268 |
| 907 | 3300005563 | Ga0068855_100046104 | Ga0068855_1000461043 | 268 |
| 908 | 3300005841 | Ga0068863_100007513 | Ga0068863_1000075134 | 268 |
| 909 | 3300006038 | Ga0075365_10058866 | Ga0075365_100588663 | 268 |
| 910 | 3300006177 | Ga0075362_10054467 | Ga0075362_100544672 | 268 |
| 911 | 3300006186 | Ga0075369_10006778 | Ga0075369_100067786 | 268 |
| 912 | 3300006186 | Ga0075369_10044423 | Ga0075369_100444232 | 268 |
| 913 | 3300006195 | Ga0075366_10047182 | Ga0075366_100471822 | 268 |
| 914 | 3300009098 | Ga0105245_10066293 | Ga0105245_100662932 | 268 |
| 915 | 3300009551 | Ga0105238_10027478 | Ga0105238_100274784 | 268 |
| 916 | 3300014325 | Ga0163163_10042855 | Ga0163163_100428555 | 268 |
| 917 | 3300021321 | Ga0214542_1000027 | Ga0214542_100002770 | 268 |
| 918 | 3300021327 | Ga0214543_1000047 | Ga0214543_100004744 | 268 |
| 919 | 3300025258 | Ga0209129_1000536 | Ga0209129_100053621 | 268 |
| 920 | 3300025273 | Ga0209673_1000023 | Ga0209673_1000023235 | 268 |
| 921 | 3300025273 | Ga0209673_1000132 | Ga0209673_100013298 | 268 |
| 922 | 3300025273 | Ga0209673_1002729 | Ga0209673_10027293 | 268 |
| 923 | 3300025273 | Ga0209673_1002876 | Ga0209673_100287610 | 268 |
| 924 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001219 | 268 |
| 925 | 3300025291 | Ga0209675_1020239 | Ga0209675_10202392 | 268 |
| 926 | 3300025294 | Ga0209025_1000072 | Ga0209025_100007290 | 268 |
| 927 | 3300025295 | Ga0209564_1000100 | Ga0209564_1000100147 | 268 |
| 928 | 3300025295 | Ga0209564_1001437 | Ga0209564_100143719 | 268 |
| 929 | 3300025295 | Ga0209564_1002441 | Ga0209564_10024413 | 268 |
| 930 | 3300025297 | Ga0209758_1000053 | Ga0209758_1000053142 | 268 |
| 931 | 3300025297 | Ga0209758_1000712 | Ga0209758_100071220 | 268 |
| 932 | 3300025297 | Ga0209758_1000937 | Ga0209758_100093711 | 268 |
| 933 | 3300025297 | Ga0209758_1004308 | Ga0209758_10043083 | 268 |
| 934 | 3300025297 | Ga0209758_1007213 | Ga0209758_10072137 | 268 |
| 935 | 3300025299 | Ga0209256_1000458 | Ga0209256_100045832 | 268 |
| 936 | 3300025299 | Ga0209256_1000818 | Ga0209256_10008189 | 268 |
| 937 | 3300025299 | Ga0209256_1002923 | Ga0209256_100292313 | 268 |
| 938 | 3300025299 | Ga0209256_1003989 | Ga0209256_10039893 | 268 |
| 939 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005824 | 268 |
| 940 | 3300025302 | Ga0207426_1000035 | Ga0207426_1000035217 | 268 |
| 941 | 3300025303 | Ga0209051_1020955 | Ga0209051_10209552 | 268 |
| 942 | 3300025303 | Ga0209051_1021053 | Ga0209051_10210533 | 268 |
| 943 | 3300025303 | Ga0209051_1025528 | Ga0209051_10255282 | 268 |
| 944 | 3300025912 | Ga0207707_10021399 | Ga0207707_100213992 | 268 |
| 945 | 3300025913 | Ga0207695_10111937 | Ga0207695_101119372 | 268 |
| 946 | 3300025913 | Ga0207695_10176098 | Ga0207695_101760982 | 268 |
| 947 | 3300025927 | Ga0207687_10025592 | Ga0207687_100255923 | 268 |
| 948 | 3300025949 | Ga0207667_10082776 | Ga0207667_100827763 | 268 |
| 949 | 3300026067 | Ga0207678_10073345 | Ga0207678_100733453 | 268 |
| 950 | 3300028794 | Ga0307515_10029779 | Ga0307515_100297796 | 268 |
| 951 | 3300031251 | Ga0265327_10034836 | Ga0265327_100348363 | 268 |
| 952 | 3300031456 | Ga0307513_10040412 | Ga0307513_100404125 | 268 |
| 953 | 3300037312 | Ga0395899_0002226 | Ga0395899_0002226_3289_4167 | 268 |
| 954 | 3300037418 | Ga0395900_0016936 | Ga0395900_0016936_1449_2327 | 268 |
| 955 | 3300037471 | Ga0395905_0010004 | Ga0395905_0010004_2610_3488 | 268 |
| 956 | 3300037853 | Ga0436364_0074250 | Ga0436364_0074250_6434_7300 | 268 |
| 957 | 3300038443 | Ga0395901_0298144 | Ga0395901_0298144_83_961 | 268 |
| 958 | 3300041410 | Ga0439461_0001099 | Ga0439461_0001099_1034_1885 | 268 |
| 959 | 3300041413 | Ga0439465_0000331 | Ga0439465_0000331_5702_6553 | 268 |
| 960 | 3300041997 | Ga0439431_0004392 | Ga0439431_0004392_718_1569 | 268 |
| 961 | 3300042002 | Ga0439442_001856 | Ga0439442_001856_156_1007 | 268 |
| 962 | 3300042004 | Ga0439445_0000671 | Ga0439445_0000671_2075_2926 | 268 |
| 963 | 3300042006 | Ga0439432_000185 | Ga0439432_000185_4567_5418 | 268 |
| 964 | 3300042007 | Ga0439449_0013823 | Ga0439449_0013823_962_1819 | 268 |
| 965 | 3300042010 | Ga0439452_031698 | Ga0439452_031698_199_1050 | 268 |
| 966 | 3300042015 | Ga0439462_0005489 | Ga0439462_0005489_1189_2040 | 268 |
| 967 | 3300042435 | Ga0439434_0000905 | Ga0439434_0000905_6299_7150 | 268 |
| 968 | 3300046459 | Ga0495629_0022804 | Ga0495629_0022804_2671_3528 | 268 |
| 969 | 3300046476 | Ga0495662_0015511 | Ga0495662_0015511_911_1768 | 268 |
| 970 | 3300046522 | Ga0495643_0016075 | Ga0495643_0016075_535_1392 | 268 |
| 971 | 3300046663 | Ga0495635_0020442 | Ga0495635_0020442_2161_3018 | 268 |
| 972 | 3300046674 | Ga0495588_0022539 | Ga0495588_0022539_236_1093 | 268 |
| 973 | 3300046683 | Ga0495658_0177247 | Ga0495658_0177247_260_1117 | 268 |
| 974 | 3300046692 | Ga0495671_0071215 | Ga0495671_0071215_616_1473 | 268 |
| 975 | 3300047470 | Ga0495681_0035137 | Ga0495681_0035137_1201_2058 | 268 |
| 976 | 3300048909 | Ga0496106_0012227 | Ga0496106_0012227_5179_6036 | 268 |
| 977 | 3300048915 | Ga0496112_0131359 | Ga0496112_0131359_629_1528 | 268 |
| 978 | 3300048925 | Ga0496122_0013828 | Ga0496122_0013828_6696_7553 | 268 |
| 979 | 3300048925 | Ga0496122_0153458 | Ga0496122_0153458_82_936 | 268 |
| 980 | 3300048926 | Ga0496123_0025431 | Ga0496123_0025431_3067_3921 | 268 |
| 981 | 3300048926 | Ga0496123_0027291 | Ga0496123_0027291_405_1262 | 268 |
| 982 | 3300048927 | Ga0496124_0104233 | Ga0496124_0104233_962_1819 | 268 |
| 983 | 3300048928 | Ga0496125_0038861 | Ga0496125_0038861_2030_2887 | 268 |
| 984 | 3300049570 | Ga0501033_0126451 | Ga0501033_0126451_224_1093 | 268 |
| 985 | 3300049572 | Ga0501036_0033807 | Ga0501036_0033807_708_1577 | 268 |
| 986 | 3300049575 | Ga0501039_0037960 | Ga0501039_0037960_2107_2976 | 268 |
| 987 | 3300049576 | Ga0501040_0134422 | Ga0501040_0134422_773_1642 | 268 |
| 988 | 3300049577 | Ga0501041_0011071 | Ga0501041_0011071_3684_4553 | 268 |
| 989 | 3300049578 | Ga0501042_0000994 | Ga0501042_0000994_773_1642 | 268 |
| 990 | 3300049579 | Ga0501043_0049763 | Ga0501043_0049763_2274_3131 | 268 |
| 991 | 3300049579 | Ga0501043_0097190 | Ga0501043_0097190_1102_1971 | 268 |
| 992 | 3300049580 | Ga0501046_0002236 | Ga0501046_0002236_7009_7878 | 268 |
| 993 | 3300049580 | Ga0501046_0314688 | Ga0501046_0314688_80_937 | 268 |
| 994 | 3300049587 | Ga0501071_0000498 | Ga0501071_0000498_773_1642 | 268 |
| 995 | 3300049588 | Ga0501072_0026183 | Ga0501072_0026183_2909_3778 | 268 |
| 996 | 3300049589 | Ga0501073_0044343 | Ga0501073_0044343_471_1340 | 268 |
| 997 | 3300049590 | Ga0501074_0004835 | Ga0501074_0004835_6523_7392 | 268 |
| 998 | 3300049591 | Ga0501075_0000282 | Ga0501075_0000282_26529_27398 | 268 |
| 999 | 3300049592 | Ga0501076_0001466 | Ga0501076_0001466_9138_10007 | 268 |
| 1000 | 3300049593 | Ga0501077_0001714 | Ga0501077_0001714_11623_12492 | 268 |
| 1001 | 3300049741 | Ga0501079_0016612 | Ga0501079_0016612_746_1615 | 268 |
| 1002 | 3300049742 | Ga0501080_0048025 | Ga0501080_0048025_840_1709 | 268 |
| 1003 | 3300049743 | Ga0501081_0000147 | Ga0501081_0000147_747_1616 | 268 |
| 1004 | 3300049744 | Ga0501083_0051158 | Ga0501083_0051158_1168_2025 | 268 |
| 1005 | 3300049822 | Ga0501035_0038033 | Ga0501035_0038033_3091_3960 | 268 |
| 1006 | 3300049824 | Ga0501045_0000846 | Ga0501045_0000846_10813_11682 | 268 |
| 1007 | 3300053090 | Ga0500646_0051808 | Ga0500646_0051808_278_1132 | 268 |
| 1008 | 3300053093 | Ga0500651_0131582 | Ga0500651_0131582_401_1258 | 268 |
| 1009 | 3300053107 | Ga0500560_014107 | Ga0500560_014107_585_1442 | 268 |
| 1010 | 3300053130 | Ga0500642_0002054 | Ga0500642_0002054_1804_2658 | 268 |
| 1011 | 3300053134 | Ga0500658_0109323 | Ga0500658_0109323_217_1071 | 268 |
| 1012 | 3300053139 | Ga0500568_0008275 | Ga0500568_0008275_932_1789 | 268 |
| 1013 | 3300053146 | Ga0500588_0001742 | Ga0500588_0001742_3198_4052 | 268 |
| 1014 | 3300053148 | Ga0500590_000026 | Ga0500590_000026_30522_31379 | 268 |
| 1015 | 3300053151 | Ga0500604_0001996 | Ga0500604_0001996_242_1096 | 268 |
| 1016 | 3300053156 | Ga0500622_0002690 | Ga0500622_0002690_8549_9406 | 268 |
| 1017 | 3300053160 | Ga0500633_0012429 | Ga0500633_0012429_225_1082 | 268 |
| 1018 | 3300054114 | Ga0501084_0008285 | Ga0501084_0008285_773_1642 | 268 |
| 1019 | 3300060353 | Ga0501082_0002793 | Ga0501082_0002793_10042_10911 | 268 |
| 1020 | 3300061734 | Ga0530510_0003176 | Ga0530510_0003176_667_1536 | 268 |
| 1021 | 3300001979 | JGI24740J21852_10013439 | JGI24740J21852_100134393 | 269 |
| 1022 | 3300003187 | JGI25151J46595_10078334 | JGI25151J46595_100783341 | 269 |
| 1023 | 3300003762 | Ga0055542_1000406 | Ga0055542_10004066 | 269 |
| 1024 | 3300003775 | Ga0055524_1026599 | Ga0055524_10265992 | 269 |
| 1025 | 3300003792 | Ga0055540_1008653 | Ga0055540_10086533 | 269 |
| 1026 | 3300003856 | Ga0058692_1003904 | Ga0058692_10039044 | 269 |
| 1027 | 3300003856 | Ga0058692_1006922 | Ga0058692_10069222 | 269 |
| 1028 | 3300005455 | Ga0070663_100203964 | Ga0070663_1002039642 | 269 |
| 1029 | 3300005548 | Ga0070665_100012214 | Ga0070665_1000122148 | 269 |
| 1030 | 3300005548 | Ga0070665_100388784 | Ga0070665_1003887842 | 269 |
| 1031 | 3300005578 | Ga0068854_100243624 | Ga0068854_1002436242 | 269 |
| 1032 | 3300006038 | Ga0075365_10009120 | Ga0075365_100091204 | 269 |
| 1033 | 3300006042 | Ga0075368_10002017 | Ga0075368_100020176 | 269 |
| 1034 | 3300006051 | Ga0075364_10041976 | Ga0075364_100419762 | 269 |
| 1035 | 3300006178 | Ga0075367_10005310 | Ga0075367_100053103 | 269 |
| 1036 | 3300006178 | Ga0075367_10068887 | Ga0075367_100688872 | 269 |
| 1037 | 3300006178 | Ga0075367_10236798 | Ga0075367_102367982 | 269 |
| 1038 | 3300006195 | Ga0075366_10075960 | Ga0075366_100759602 | 269 |
| 1039 | 3300006948 | Ga0099826_10000070 | Ga0099826_1000007024 | 269 |
| 1040 | 3300006948 | Ga0099826_10004568 | Ga0099826_1000456810 | 269 |
| 1041 | 3300013100 | Ga0157373_10008462 | Ga0157373_100084625 | 269 |
| 1042 | 3300013102 | Ga0157371_10000200 | Ga0157371_1000020058 | 269 |
| 1043 | 3300013104 | Ga0157370_10000090 | Ga0157370_10000090113 | 269 |
| 1044 | 3300013104 | Ga0157370_10188324 | Ga0157370_101883242 | 269 |
| 1045 | 3300013105 | Ga0157369_10083569 | Ga0157369_100835694 | 269 |
| 1046 | 3300015684 | Ga0183365_10468 | Ga0183365_104682 | 269 |
| 1047 | 3300015690 | Ga0183363_1056 | Ga0183363_105626 | 269 |
| 1048 | 3300021320 | Ga0214544_1000123 | Ga0214544_100012333 | 269 |
| 1049 | 3300021321 | Ga0214542_1000141 | Ga0214542_100014166 | 269 |
| 1050 | 3300021327 | Ga0214543_1000026 | Ga0214543_1000026167 | 269 |
| 1051 | 3300025254 | Ga0209148_1000181 | Ga0209148_100018147 | 269 |
| 1052 | 3300025272 | Ga0209455_1000127 | Ga0209455_100012747 | 269 |
| 1053 | 3300025292 | Ga0209676_1000666 | Ga0209676_100066612 | 269 |
| 1054 | 3300025292 | Ga0209676_1002188 | Ga0209676_10021883 | 269 |
| 1055 | 3300025294 | Ga0209025_1000593 | Ga0209025_100059353 | 269 |
| 1056 | 3300025294 | Ga0209025_1005657 | Ga0209025_100565712 | 269 |
| 1057 | 3300025299 | Ga0209256_1002209 | Ga0209256_10022093 | 269 |
| 1058 | 3300025904 | Ga0207647_10209785 | Ga0207647_102097852 | 269 |
| 1059 | 3300025919 | Ga0207657_10133893 | Ga0207657_101338932 | 269 |
| 1060 | 3300026041 | Ga0207639_10240659 | Ga0207639_102406592 | 269 |
| 1061 | 3300026116 | Ga0207674_10165747 | Ga0207674_101657472 | 269 |
| 1062 | 3300026142 | Ga0207698_10174810 | Ga0207698_101748102 | 269 |
| 1063 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009212 | 269 |
| 1064 | 3300027312 | Ga0209371_1014017 | Ga0209371_10140171 | 269 |
| 1065 | 3300027666 | Ga0209282_1000143 | Ga0209282_100014330 | 269 |
| 1066 | 3300027666 | Ga0209282_1089835 | Ga0209282_10898351 | 269 |
| 1067 | 3300027866 | Ga0209813_10057344 | Ga0209813_100573442 | 269 |
| 1068 | 3300028379 | Ga0268266_10035496 | Ga0268266_100354964 | 269 |
| 1069 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010211 | 269 |
| 1070 | 3300030500 | Ga0268256_1014365 | Ga0268256_10143652 | 269 |
| 1071 | 3300031995 | Ga0307409_100424024 | Ga0307409_1004240242 | 269 |
| 1072 | 3300046453 | Ga0495627_040982 | Ga0495627_040982_302_1159 | 269 |
| 1073 | 3300046558 | Ga0495633_0049396 | Ga0495633_0049396_38_895 | 269 |
| 1074 | 3300046660 | Ga0495625_0083634 | Ga0495625_0083634_853_1704 | 269 |
| 1075 | 3300046674 | Ga0495588_0223814 | Ga0495588_0223814_107_964 | 269 |
| 1076 | 3300048916 | Ga0496113_0046156 | Ga0496113_0046156_893_1750 | 269 |
| 1077 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1744125_1744982 | 269 |
| 1078 | 3300048921 | Ga0496118_0002809 | Ga0496118_0002809_2281_3138 | 269 |
| 1079 | 3300048922 | Ga0496119_0016100 | Ga0496119_0016100_2673_3530 | 269 |
| 1080 | 3300048923 | Ga0496120_0003418 | Ga0496120_0003418_11683_12540 | 269 |
| 1081 | 3300048923 | Ga0496120_0028404 | Ga0496120_0028404_817_1668 | 269 |
| 1082 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1114915_1115772 | 269 |
| 1083 | 3300048925 | Ga0496122_0013033 | Ga0496122_0013033_2202_3059 | 269 |
| 1084 | 3300048925 | Ga0496122_0088340 | Ga0496122_0088340_1140_1997 | 269 |
| 1085 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1118646_1119503 | 269 |
| 1086 | 3300048926 | Ga0496123_0045179 | Ga0496123_0045179_879_1736 | 269 |
| 1087 | 3300048928 | Ga0496125_0033579 | Ga0496125_0033579_3175_4032 | 269 |
| 1088 | 3300049568 | Ga0501031_0033507 | Ga0501031_0033507_2428_3288 | 269 |
| 1089 | 3300049569 | Ga0501032_0001269 | Ga0501032_0001269_12168_13028 | 269 |
| 1090 | 3300049569 | Ga0501032_0086516 | Ga0501032_0086516_540_1403 | 269 |
| 1091 | 3300049570 | Ga0501033_0000318 | Ga0501033_0000318_22099_22959 | 269 |
| 1092 | 3300049571 | Ga0501034_0081106 | Ga0501034_0081106_2118_2981 | 269 |
| 1093 | 3300049571 | Ga0501034_0553025 | Ga0501034_0553025_115_975 | 269 |
| 1094 | 3300049573 | Ga0501037_0000136 | Ga0501037_0000136_47496_48356 | 269 |
| 1095 | 3300049574 | Ga0501038_0128496 | Ga0501038_0128496_445_1308 | 269 |
| 1096 | 3300049574 | Ga0501038_0129095 | Ga0501038_0129095_549_1409 | 269 |
| 1097 | 3300049575 | Ga0501039_0009703 | Ga0501039_0009703_4149_5012 | 269 |
| 1098 | 3300049575 | Ga0501039_0421288 | Ga0501039_0421288_74_934 | 269 |
| 1099 | 3300049576 | Ga0501040_0059833 | Ga0501040_0059833_979_1842 | 269 |
| 1100 | 3300049577 | Ga0501041_0106441 | Ga0501041_0106441_141_1004 | 269 |
| 1101 | 3300049578 | Ga0501042_0012081 | Ga0501042_0012081_4000_4863 | 269 |
| 1102 | 3300049579 | Ga0501043_0000006 | Ga0501043_0000006_72052_72912 | 269 |
| 1103 | 3300049579 | Ga0501043_0074808 | Ga0501043_0074808_1249_2130 | 269 |
| 1104 | 3300049580 | Ga0501046_0005715 | Ga0501046_0005715_2361_3224 | 269 |
| 1105 | 3300049581 | Ga0501047_0006051 | Ga0501047_0006051_6304_7164 | 269 |
| 1106 | 3300049582 | Ga0501048_0055868 | Ga0501048_0055868_1359_2222 | 269 |
| 1107 | 3300049582 | Ga0501048_0362041 | Ga0501048_0362041_69_935 | 269 |
| 1108 | 3300049584 | Ga0501068_0336219 | Ga0501068_0336219_36_896 | 269 |
| 1109 | 3300049585 | Ga0501069_0000024 | Ga0501069_0000024_46574_47434 | 269 |
| 1110 | 3300049585 | Ga0501069_0007683 | Ga0501069_0007683_4178_5038 | 269 |
| 1111 | 3300049586 | Ga0501070_0000093 | Ga0501070_0000093_27374_28234 | 269 |
| 1112 | 3300049586 | Ga0501070_0001707 | Ga0501070_0001707_12791_13651 | 269 |
| 1113 | 3300049586 | Ga0501070_0046834 | Ga0501070_0046834_525_1376 | 269 |
| 1114 | 3300049587 | Ga0501071_0019437 | Ga0501071_0019437_3075_3938 | 269 |
| 1115 | 3300049587 | Ga0501071_0161800 | Ga0501071_0161800_130_990 | 269 |
| 1116 | 3300049589 | Ga0501073_0046579 | Ga0501073_0046579_387_1247 | 269 |
| 1117 | 3300049589 | Ga0501073_0235412 | Ga0501073_0235412_127_987 | 269 |
| 1118 | 3300049590 | Ga0501074_0001523 | Ga0501074_0001523_13763_14623 | 269 |
| 1119 | 3300049590 | Ga0501074_0004462 | Ga0501074_0004462_2512_3375 | 269 |
| 1120 | 3300049591 | Ga0501075_0044949 | Ga0501075_0044949_1632_2495 | 269 |
| 1121 | 3300049592 | Ga0501076_0060257 | Ga0501076_0060257_716_1579 | 269 |
| 1122 | 3300049593 | Ga0501077_0020704 | Ga0501077_0020704_2318_3181 | 269 |
| 1123 | 3300049741 | Ga0501079_0003632 | Ga0501079_0003632_1224_2087 | 269 |
| 1124 | 3300049741 | Ga0501079_0117239 | Ga0501079_0117239_197_1057 | 269 |
| 1125 | 3300049742 | Ga0501080_0005371 | Ga0501080_0005371_8221_9081 | 269 |
| 1126 | 3300049742 | Ga0501080_0031943 | Ga0501080_0031943_3444_4307 | 269 |
| 1127 | 3300049742 | Ga0501080_0196357 | Ga0501080_0196357_63_923 | 269 |
| 1128 | 3300049743 | Ga0501081_0002678 | Ga0501081_0002678_10173_11036 | 269 |
| 1129 | 3300049744 | Ga0501083_0000097 | Ga0501083_0000097_21100_21960 | 269 |
| 1130 | 3300049822 | Ga0501035_0000068 | Ga0501035_0000068_79271_80131 | 269 |
| 1131 | 3300049822 | Ga0501035_0022486 | Ga0501035_0022486_1082_1942 | 269 |
| 1132 | 3300049822 | Ga0501035_0107130 | Ga0501035_0107130_1211_2071 | 269 |
| 1133 | 3300049823 | Ga0501044_0000096 | Ga0501044_0000096_62099_62959 | 269 |
| 1134 | 3300049823 | Ga0501044_0002553 | Ga0501044_0002553_13175_14035 | 269 |
| 1135 | 3300049823 | Ga0501044_0019940 | Ga0501044_0019940_4487_5368 | 269 |
| 1136 | 3300049824 | Ga0501045_0015524 | Ga0501045_0015524_3136_3999 | 269 |
| 1137 | 3300050491 | nmdc:mga00v17_532_c1 | nmdc:mga00v17_532_c1_10779_11636 | 269 |
| 1138 | 3300050491 | nmdc:mga00v17_64067_c1 | nmdc:mga00v17_64067_c1_892_1749 | 269 |
| 1139 | 3300050492 | nmdc:mga0yw44_5021_c1 | nmdc:mga0yw44_5021_c1_909_1766 | 269 |
| 1140 | 3300050492 | nmdc:mga0yw44_5970_c1 | nmdc:mga0yw44_5970_c1_2044_2895 | 269 |
| 1141 | 3300050493 | nmdc:mga0k408_158631_c1 | nmdc:mga0k408_158631_c1_204_1061 | 269 |
| 1142 | 3300050493 | nmdc:mga0k408_201700_c1 | nmdc:mga0k408_201700_c1_109_960 | 269 |
| 1143 | 3300050494 | nmdc:mga06z11_79050_c1 | nmdc:mga06z11_79050_c1_284_1135 | 269 |
| 1144 | 3300050496 | nmdc:mga07m45_25346_c1 | nmdc:mga07m45_25346_c1_416_1267 | 269 |
| 1145 | 3300050516 | nmdc:mga0sz30_368_c1 | nmdc:mga0sz30_368_c1_15237_16094 | 269 |
| 1146 | 3300053111 | Ga0500572_005128 | Ga0500572_005128_1103_2014 | 269 |
| 1147 | 3300053137 | Ga0500561_0000035 | Ga0500561_0000035_10780_11637 | 269 |
| 1148 | 3300053151 | Ga0500604_0086449 | Ga0500604_0086449_145_996 | 269 |
| 1149 | 3300053157 | Ga0500624_001616 | Ga0500624_001616_511_1368 | 269 |
| 1150 | 3300053158 | Ga0500627_0084793 | Ga0500627_0084793_310_1161 | 269 |
| 1151 | 3300053177 | Ga0500636_0000149 | Ga0500636_0000149_12390_13247 | 269 |
| 1152 | 3300053177 | Ga0500636_0005980 | Ga0500636_0005980_3953_4810 | 269 |
| 1153 | 3300053727 | Ga0500611_004761 | Ga0500611_004761_718_1569 | 269 |
| 1154 | 3300060353 | Ga0501082_0021564 | Ga0501082_0021564_2303_3163 | 269 |
| 1155 | 3300060353 | Ga0501082_0058908 | Ga0501082_0058908_1128_1991 | 269 |
| 1156 | 3300061734 | Ga0530510_0018557 | Ga0530510_0018557_3375_4238 | 269 |
| 1157 | iso_pu_bacteria | 2503198000 | 2503200143 | 269 |
| 1158 | iso_pu_bacteria | 2643221595 | 2643986457 | 269 |
| 1159 | iso_pu_bacteria | 2643221627 | 2644152689 | 269 |
| 1160 | iso_pu_bacteria | 2738543032 | 2739354186 | 269 |
| 1161 | iso_pu_bacteria | 2844002411 | 2844005008 | 269 |
| 1162 | iso_pu_bacteria | 2906378014 | 2906381075 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
127
329
0.92
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.7858 | 21 | 260 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.7763 | 19 | 261 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.7751 | 19 | 260 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.7624 | 21 | 260 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.7452 | 19 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P16701_14_273_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8467 | 23 | 266 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8442 | 24 | 264 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8276 | 24 | 269 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8101 | 24 | 264 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8095 | 61 | 264 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5K5L0-F1-model_v4 | deleted | 0.8826 | 43 | 269 |
|
| AF-A0A0A6ZEM7-F1-model_v4 | Sulfate transport system permease protein CysT | 0.8778 | 30 | 266 |
GO:0005886
GO:0015419 GO:0031969 |
| AF-A0A081GN24-F1-model_v4 | Sulfate transport system permease protein CysT | 0.8766 | 27 | 269 |
GO:0005886
GO:0015419 |
| AF-A0A0J6LE06-F1-model_v4 | Sulfate transport system permease protein CysT | 0.875 | 30 | 268 |
GO:0005886
GO:0015419 |
| AF-A0A109K1T2-F1-model_v4 | Sulfate transport system permease protein CysT | 0.872 | 26 | 269 |
GO:0005886
GO:0015419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar