F491033

General Info

Members Datasets Scaffolds Average Seq Length
1162 928 532 278

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221659|2644336357
Length 331
Sequence GHNRRWRFRQPSVLPGFGLALGVTLFWLVLIILIPLSGLIWRSSGLGWSQFMTLALDTRTLNALRISFGTAFVAAIVNLIFGVILAWVLVRYRFPGKRVIDAMVAATRTLNALRISFGTAFVAAIVNLIFGVILAWVLVRYRFPGKRVIDAMVDLPXALPTAVAGIALATLYAPNGWIGALLAPLGIKIAFTPIGIVIALIFVGLPFVVRTVQPIMEEIDKEVEEAAATLGASRFQTIRRVLLPGLLPAGLTGFALAFARGVGEYGSVIFIAGNLPYVSEIAPLXIVIRLEEFNYPAATAIAAVMLVISFAMLLVINSIQAWSRRRYVYVA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
30 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
33 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
34 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
35 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
36 2516143018 Ensifer sp. BR816 Isolate Nodule
37 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
42 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
43 2519899620 Rhizobium sp. Pop5 Isolate Nodule
44 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
45 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
46 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
47 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
48 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
49 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
50 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
51 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
52 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
53 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
54 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
55 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
56 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
57 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
58 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
59 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
60 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
61 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
62 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
63 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
64 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
65 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
66 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
67 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
68 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
69 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
70 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
71 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
72 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
73 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
74 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
75 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
76 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
77 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
78 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
79 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
80 2643221558 Rhizobium sp. Root149 Isolate Unclassified
81 2643221568 Rhizobium sp. Root564 Isolate Unclassified
82 2643221582 Rhizobium sp. Root651 Isolate Unclassified
83 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
84 2643221607 Rhizobium sp. Root73 Isolate Unclassified
85 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
86 2643221626 Ensifer sp. Root31 Isolate Unclassified
87 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
88 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
89 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
90 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
91 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
92 2643221659 Ensifer sp. Root127 Isolate Unclassified
93 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
94 2643221693 Rhizobium sp. Root491 Isolate Unclassified
95 2643221698 Ensifer sp. Root142 Isolate Unclassified
96 2643221718 Rhizobium sp. Root268 Isolate Unclassified
97 2643221719 Rhizobium sp. Root274 Isolate Unclassified
98 2643221726 Ensifer sp. Root954 Isolate Unclassified
99 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
100 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
101 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
102 2718217882 Rhizobium sp. N741 Isolate Nodule
103 2718218009 Rhizobium sp. N561 Isolate Nodule
104 2718218363 Rhizobium sp. N113 Isolate Nodule
105 2718218365 Rhizobium sp. N731 Isolate Nodule
106 2718218366 Rhizobium sp. N621 Isolate Nodule
107 2721755514 Rhizobium sp. N6212 Isolate Nodule
108 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
109 2721755810 Rhizobium sp. N871 Isolate Nodule
110 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
111 2728369365 Rhizobium sp. N1341 Isolate Nodule
112 2728369397 Rhizobium sp. N1314 Isolate Nodule
113 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
114 2738543024 Aminobacter sp. AP02 Isolate Unclassified
115 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
116 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
117 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
118 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
119 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
120 2773857925 Microvirga vignae BR3299 Isolate Unclassified
121 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
122 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
123 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
124 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
125 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
126 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
127 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
128 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
129 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
130 2791355260 Rhizobium sp. L9 Isolate Nodule
131 2791355261 Rhizobium sp. J15 Isolate Nodule
132 2791355262 Rhizobium sp. M1 Isolate Nodule
133 2791355263 Rhizobium chutanense C5 Isolate Nodule
134 2791355264 Rhizobium sp. S9 Isolate Nodule
135 2791355265 Rhizobium sp. H4 Isolate Nodule
136 2791355266 Rhizobium sp. L43 Isolate Nodule
137 2791355267 Rhizobium sp. L18 Isolate Nodule
138 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
139 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
140 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
141 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
142 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
143 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
144 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
145 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
146 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
147 2802429633 Rhizobium anhuiense J3 Isolate Nodule
148 2802429634 Rhizobium anhuiense S10 Isolate Nodule
149 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
150 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
151 2802429637 Rhizobium anhuiense C15 Isolate Nodule
152 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
153 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
154 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
155 2818991441 Niallia circulans 3243 Isolate Rhizosphere
156 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
157 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
158 2838061910 Rhizobium phaseoli L15 Isolate Nodule
159 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
160 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
161 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
162 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
163 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
164 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
165 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
166 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
167 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
168 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
169 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
170 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
171 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
172 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
173 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
174 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
175 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
176 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
177 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
178 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
179 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
180 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
181 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
182 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
183 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
184 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
185 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
186 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
187 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
188 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
189 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
190 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
191 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
192 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
193 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
194 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
195 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
196 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
197 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
198 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
199 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
200 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
201 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
202 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
203 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
204 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
205 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
206 2844163670 Ensifer sp. 1H6 Isolate Unclassified
207 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
208 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
209 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
210 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
211 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
212 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
213 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
214 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
215 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
216 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
217 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
218 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
219 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
220 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
221 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
222 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
223 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
224 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
225 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
226 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
227 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
228 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
229 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
230 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
231 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
232 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
233 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
234 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
235 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
236 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
237 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
238 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
239 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
240 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
241 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
242 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
243 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
244 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
245 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
246 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
247 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
248 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
249 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
250 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
251 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
252 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
253 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
254 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
255 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
256 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
257 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
258 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
259 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
260 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
261 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
262 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
263 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
264 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
265 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
266 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
267 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
268 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
269 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
270 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
271 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
272 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
273 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
274 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
275 2902330777 Methylobacterium sp. 2A Isolate Unclassified
276 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
277 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
278 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
279 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
280 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
281 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
282 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
283 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
284 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
285 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
286 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
287 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
288 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
289 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
290 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
291 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
292 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
293 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
294 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
295 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
296 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
297 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
298 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
299 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
300 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
301 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
302 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
303 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
304 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
305 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
306 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
307 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
308 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
309 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
310 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
311 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
312 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
313 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
314 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
315 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
316 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
317 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
318 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
319 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
320 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
321 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
322 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
323 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
324 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
325 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
326 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
327 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
328 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
329 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
330 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
331 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
332 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
333 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
334 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
335 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
336 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
337 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
338 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
339 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
340 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
341 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
342 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
343 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
344 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
345 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
346 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
347 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
348 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
349 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
350 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
351 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
352 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
353 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
354 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
355 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
356 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
357 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
358 2936381700 Rhizobium chutanense C16 Isolate Unclassified
359 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
360 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
361 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
362 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
363 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
364 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
365 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
366 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
367 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
368 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
369 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
370 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
371 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
372 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
373 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
374 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
375 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
376 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
377 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
378 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
379 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
380 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
381 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
382 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
383 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
384 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
385 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
386 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
387 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
388 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
389 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
390 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
391 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
392 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
393 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
394 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
395 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
396 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
397 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
398 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
399 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
400 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
401 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
402 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
403 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
404 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
405 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
406 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
407 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
408 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
409 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
410 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
411 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
412 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
413 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
414 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
415 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
416 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
417 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
418 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
419 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
420 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
421 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
422 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
423 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
424 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
425 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
426 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
427 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
428 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
429 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
430 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
431 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
432 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
433 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
434 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
435 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
436 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
437 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
438 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
439 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
440 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
441 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
442 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
443 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
444 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
445 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
446 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
447 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
448 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
449 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
450 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
451 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
452 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
453 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
454 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
455 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
456 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
457 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
458 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
459 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
460 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
461 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
462 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
463 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
464 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
465 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
466 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
467 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
468 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
469 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
470 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
471 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
472 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
473 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
474 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
475 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
476 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
477 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
478 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
479 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
480 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
481 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
482 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
483 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
484 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
485 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
486 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
487 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
488 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
489 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
490 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
491 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
492 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
493 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
494 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
495 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
496 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
497 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
498 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
499 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
500 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
501 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
502 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
503 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
504 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
505 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
506 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
507 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
508 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
509 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
510 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
511 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
512 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
513 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
514 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
515 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
516 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
517 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
518 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
519 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
520 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
521 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
522 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
523 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
524 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
525 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
526 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
527 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
528 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
529 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
530 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
531 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
532 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
533 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
534 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
535 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
536 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
537 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
538 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
539 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
540 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
541 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
542 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
543 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
544 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
545 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
546 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
547 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
548 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
549 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
550 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
551 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
552 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
553 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
554 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
555 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
556 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
557 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
558 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
559 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
560 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
561 2996893221 Rhizobium sp. R635 Isolate Nodule
562 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
563 3004167301 Mesorhizobium loti 582 Isolate Unclassified
564 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
565 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
566 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
567 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
568 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
569 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
570 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
571 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
572 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
573 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
574 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
575 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
576 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
577 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
578 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
579 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
580 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
581 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
582 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
583 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
584 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
585 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
586 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
587 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
588 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
589 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
590 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
591 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
592 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
593 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
594 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
595 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
596 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
597 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
598 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
599 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
600 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
601 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
602 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
603 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
604 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
605 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
606 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
607 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
608 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
609 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
610 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
611 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
612 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
613 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
614 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
615 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
616 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
617 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
618 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
619 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
620 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
621 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
622 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
623 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
624 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
625 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
626 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
627 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
628 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
629 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
630 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
631 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
632 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
633 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
634 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
635 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
636 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
637 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
638 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
639 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
640 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
641 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
642 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
643 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
644 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
645 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
646 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
647 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
648 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
649 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
650 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
651 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
652 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
653 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
654 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
655 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
656 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
657 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
658 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
659 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
660 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
661 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
662 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
663 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
664 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
665 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
666 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
667 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
668 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
669 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
670 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
671 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
672 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
673 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
674 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
675 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
676 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
677 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
678 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
679 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
696 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
697 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
698 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
702 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
703 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
705 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
706 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
707 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
708 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
709 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
710 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
711 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
712 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
713 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
714 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
715 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
716 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
717 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
718 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
719 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
720 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
721 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
722 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
723 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
724 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
725 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
726 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
727 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
728 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
729 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
730 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
731 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
732 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
733 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
734 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
735 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
736 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
737 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
738 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
739 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
740 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
741 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
742 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
743 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
744 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
745 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
746 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
747 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
748 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
749 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
750 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
751 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
752 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
753 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
754 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
755 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
756 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
757 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
758 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
759 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
760 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
761 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
762 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
763 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
764 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
765 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
766 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
767 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
768 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
769 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
770 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
771 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
772 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
773 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
774 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
775 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
776 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
777 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
778 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
779 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
780 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
781 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
782 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
783 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
784 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
785 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
786 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
787 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
788 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
789 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
790 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
791 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
792 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
793 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
794 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
795 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
796 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
797 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
798 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
799 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
800 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
801 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
802 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
803 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
804 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
805 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
806 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
807 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
808 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
809 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
810 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
811 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
812 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
813 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
814 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
815 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
816 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
817 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
818 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
819 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
820 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
821 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
822 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
823 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
824 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
825 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
826 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
827 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
828 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
829 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
830 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
831 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
832 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
833 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
834 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
835 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
836 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
837 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
838 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
839 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
840 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
841 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
842 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
843 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
844 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
845 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
846 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
847 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
848 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
849 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
850 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
851 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
852 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
853 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
854 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
855 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
856 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
857 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
858 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
859 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
860 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
861 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
862 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
863 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
864 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
865 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
866 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
867 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
868 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
869 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
870 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
871 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
872 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
873 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
874 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
875 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
876 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
877 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
878 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
879 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
880 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
881 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
882 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
883 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
884 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
885 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
886 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
887 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
888 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
889 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
890 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
891 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
892 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
893 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
894 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
895 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
896 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
897 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
898 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
899 8005275841 Rhizobium sp. N4311 Isolate Nodule
900 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
901 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
902 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
903 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
904 8005382845 Rhizobium sp. R634 Isolate Nodule
905 8005395548 Rhizobium sp. R339 Isolate Nodule
906 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
907 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
908 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
909 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
910 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
911 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
912 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
913 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
914 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
915 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
916 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
917 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
918 8018176218 Rhizobium sp. N122 Isolate Nodule
919 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
920 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
921 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
922 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
923 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
924 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
925 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
926 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
927 8056382006 Rhizobium croatiense 13T Isolate Nodule
928 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.78
Metatranscriptomes 0
Isolates 54.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 11.96
Nodule 44.41
Rhizoplane 1.64
Rhizosphere 29.78
Stem 0
Stem Tuber 0
Unclassified 11.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013439 3300001979 Bacteria 3052
2 JGI25158J39367_1000612 3300002739 Bacteria 7083
3 JGI25152J39213_1002543 3300002773 Bacteria 6869
4 JGI25152J39213_1004158 3300002773 Bacteria 4668
5 JGI25150J39212_1000746 3300002774 Bacteria 11487
6 JGI25159J45721_1000089 3300002987 Bacteria 43695
7 JGI25151J46595_10000632 3300003187 Bacteria 30374
8 JGI25151J46595_10078334 3300003187 Bacteria 967
9 JGI25153J46596_10003277 3300003215 Bacteria 9095
10 rootH1_10007030 3300003316 Bacteria 3759
11 rootL2_10028121 3300003322 Bacteria 4009
12 JGI25160J50197_1000726 3300003354 Bacteria 18068
13 JGI25160J50197_1004162 3300003354 Bacteria 6296
14 JGI25161J50226_1001711 3300003374 Bacteria 6238
15 JGI25161J50226_1003754 3300003374 Bacteria 3370
16 Ga0055542_1000406 3300003762 Bacteria 42163
17 Ga0055526_1005972 3300003771 Bacteria 6774
18 Ga0055526_1023052 3300003771 Bacteria 2090
19 Ga0055524_1009871 3300003775 Bacteria 3844
20 Ga0055524_1013258 3300003775 Bacteria 3116
21 Ga0055524_1026599 3300003775 Bacteria 1782
22 Ga0055536_1015627 3300003781 Bacteria 2585
23 Ga0055528_1000514 3300003790 Bacteria 30392
24 Ga0055528_1001577 3300003790 Bacteria 13583
25 Ga0055528_1001960 3300003790 Bacteria 11625
26 Ga0055528_1004369 3300003790 Bacteria 6817
27 Ga0055540_1000050 3300003792 Bacteria 145565
28 Ga0055540_1006737 3300003792 Bacteria 4493
29 Ga0055540_1008653 3300003792 Bacteria 3637
30 Ga0055540_1022646 3300003792 Bacteria 1601
31 Ga0058692_1003904 3300003856 Bacteria 4520
32 Ga0058692_1006922 3300003856 Bacteria 3059
33 Ga0055543_1000021 3300004625 Bacteria 150116
34 Ga0055543_1001872 3300004625 Bacteria 7654
35 Ga0065165_1008053 3300005262 Bacteria 5032
36 Ga0065165_1010256 3300005262 Bacteria 4077
37 Ga0065165_1013986 3300005262 Bacteria 3144
38 Ga0070658_10000306 3300005327 Bacteria 42420
39 Ga0070666_10007956 3300005335 Bacteria 6555
40 Ga0070680_100061370 3300005336 Bacteria 3077
41 Ga0070680_100237580 3300005336 Bacteria 1540
42 Ga0070660_100013010 3300005339 Bacteria 5955
43 Ga0070660_100054084 3300005339 Bacteria 3098
44 Ga0070660_100266434 3300005339 Bacteria 1400
45 Ga0070691_10005336 3300005341 Bacteria 5844
46 Ga0070710_10047776 3300005437 Bacteria 2388
47 Ga0070694_100422365 3300005444 Bacteria 1048
48 Ga0070663_100055676 3300005455 Bacteria 2832
49 Ga0070663_100203964 3300005455 Bacteria 1545
50 Ga0070678_100001773 3300005456 Bacteria 11631
51 Ga0070681_10054794 3300005458 Bacteria 3973
52 Ga0070681_10109686 3300005458 Bacteria 2700
53 Ga0070679_100058190 3300005530 Bacteria 3851
54 Ga0070665_100000259 3300005548 Bacteria 86776
55 Ga0070665_100012214 3300005548 Bacteria 8658
56 Ga0070665_100020770 3300005548 Bacteria 6599
57 Ga0070665_100051533 3300005548 Bacteria 4127
58 Ga0070665_100388784 3300005548 Bacteria 1403
59 Ga0068855_100046104 3300005563 Bacteria 5154
60 Ga0068855_100120651 3300005563 Bacteria 3001
61 Ga0068855_100449938 3300005563 Bacteria 1405
62 Ga0068854_100243624 3300005578 Bacteria 1433
63 Ga0068856_100458768 3300005614 Bacteria 1295
64 Ga0068864_100015795 3300005618 Bacteria 6281
65 Ga0068864_100292261 3300005618 Bacteria 1523
66 Ga0068866_10172455 3300005718 Bacteria 1271
67 Ga0068870_10231163 3300005840 Bacteria 1137
68 Ga0068863_100007513 3300005841 Bacteria 10659
69 Ga0068863_100260509 3300005841 Bacteria 1676
70 Ga0081455_10001242 3300005937 Bacteria 31869
71 Ga0081539_10041427 3300005985 Bacteria 2692
72 Ga0070717_10107994 3300006028 Bacteria 2371
73 Ga0075365_10009120 3300006038 Bacteria 5681
74 Ga0075365_10058866 3300006038 Bacteria 2559
75 Ga0075368_10002017 3300006042 Bacteria 6566
76 Ga0075364_10041976 3300006051 Bacteria 2971
77 Ga0070715_10002984 3300006163 Bacteria 5294
78 Ga0070712_100043939 3300006175 Bacteria 3078
79 Ga0075362_10054467 3300006177 Bacteria 1798
80 Ga0075367_10005310 3300006178 Bacteria 6378
81 Ga0075367_10068887 3300006178 Bacteria 2123
82 Ga0075367_10236798 3300006178 Bacteria 1143
83 Ga0075369_10006778 3300006186 Bacteria 4343
84 Ga0075369_10044423 3300006186 Bacteria 1909
85 Ga0075366_10047182 3300006195 Bacteria 2553
86 Ga0075366_10075960 3300006195 Bacteria 2005
87 Ga0097621_100002147 3300006237 Bacteria 13495
88 Ga0097621_100023769 3300006237 Bacteria 4775
89 Ga0097621_100065912 3300006237 Bacteria 2982
90 Ga0068871_100000379 3300006358 Bacteria 31123
91 Ga0068871_100032006 3300006358 Bacteria 4150
92 Ga0068871_100067275 3300006358 Bacteria 2939
93 Ga0068871_100077735 3300006358 Bacteria 2743
94 Ga0068871_100295841 3300006358 Bacteria 1420
95 Ga0068865_100002567 3300006881 Bacteria 10774
96 Ga0068865_100036475 3300006881 Bacteria 3315
97 Ga0097620_100432734 3300006931 Bacteria 1412
98 Ga0079104_1024883 3300006946 Bacteria 1571
99 Ga0099826_10000070 3300006948 Bacteria 53527
100 Ga0099826_10004568 3300006948 Bacteria 9732
101 Ga0105240_10108595 3300009093 Bacteria 3361
102 Ga0111539_10549964 3300009094 Bacteria 1345
103 Ga0105245_10066293 3300009098 Bacteria 3267
104 Ga0105242_10531969 3300009176 Bacteria 1124
105 Ga0105248_10000125 3300009177 Bacteria 88470
106 Ga0105237_10430051 3300009545 Bacteria 1326
107 Ga0105238_10027478 3300009551 Bacteria 5800
108 Ga0105238_10474781 3300009551 Bacteria 1249
109 Ga0123341_1000109 3300009765 Bacteria 36496
110 Ga0123342_1028378 3300009766 Bacteria 3028
111 Ga0157373_10008462 3300013100 Bacteria 7639
112 Ga0157371_10000200 3300013102 Bacteria 87804
113 Ga0157370_10000090 3300013104 Bacteria 103336
114 Ga0157370_10188324 3300013104 Bacteria 1916
115 Ga0157369_10083569 3300013105 Bacteria 3414
116 Ga0171463_1010 3300013249 Bacteria 269975
117 Ga0157374_10037596 3300013296 Bacteria 4444
118 Ga0163162_10020835 3300013306 Bacteria 6445
119 Ga0163162_10065009 3300013306 Bacteria 3694
120 Ga0157372_10063316 3300013307 Bacteria 4147
121 Ga0157375_10158012 3300013308 Bacteria 2407
122 Ga0163163_10000021 3300014325 Bacteria 191799
123 Ga0163163_10042855 3300014325 Bacteria 4435
124 Ga0157380_10002315 3300014326 Bacteria 12792
125 Ga0157380_10040338 3300014326 Bacteria 3636
126 Ga0157379_10004679 3300014968 Bacteria 11746
127 Ga0157376_10013994 3300014969 Bacteria 6004
128 Ga0157376_10427211 3300014969 Bacteria 1287
129 Ga0183365_10468 3300015684 Bacteria 1313
130 Ga0183363_1056 3300015690 Bacteria 35540
131 Ga0214544_1000123 3300021320 Bacteria 110258
132 Ga0214542_1000027 3300021321 Bacteria 175107
133 Ga0214542_1000141 3300021321 Bacteria 104386
134 Ga0214542_1025614 3300021321 Bacteria 3038
135 Ga0214543_1000025 3300021327 Bacteria 225351
136 Ga0214543_1000026 3300021327 Bacteria 220652
137 Ga0214543_1000047 3300021327 Bacteria 150894
138 Ga0228711_1015241 3300022739 Bacteria 8428
139 Ga0228710_1006811 3300022740 Bacteria 17155
140 Ga0207425_1020985 3300025245 Bacteria 1389
141 Ga0209148_1000181 3300025254 Bacteria 124691
142 Ga0209129_1000019 3300025258 Bacteria 460802
143 Ga0209129_1000536 3300025258 Bacteria 26442
144 Ga0209565_1010175 3300025263 Bacteria 2344
145 Ga0209455_1000127 3300025272 Bacteria 162518
146 Ga0209673_1000023 3300025273 Bacteria 411385
147 Ga0209673_1000132 3300025273 Bacteria 162349
148 Ga0209673_1002729 3300025273 Bacteria 11649
149 Ga0209673_1002876 3300025273 Bacteria 10948
150 Ga0209130_1000001 3300025284 Bacteria 831557
151 Ga0209130_1013126 3300025284 Bacteria 2134
152 Ga0209675_1020239 3300025291 Bacteria 1809
153 Ga0209676_1000666 3300025292 Bacteria 49043
154 Ga0209676_1002188 3300025292 Bacteria 14649
155 Ga0209676_1004240 3300025292 Bacteria 8103
156 Ga0209025_1000072 3300025294 Bacteria 283452
157 Ga0209025_1000593 3300025294 Bacteria 65364
158 Ga0209025_1005657 3300025294 Bacteria 10066
159 Ga0209564_1000081 3300025295 Bacteria 261592
160 Ga0209564_1000100 3300025295 Bacteria 224016
161 Ga0209564_1001437 3300025295 Bacteria 24420
162 Ga0209564_1002441 3300025295 Bacteria 14707
163 Ga0209758_1000053 3300025297 Bacteria 337751
164 Ga0209758_1000712 3300025297 Bacteria 49095
165 Ga0209758_1000937 3300025297 Bacteria 39370
166 Ga0209758_1004308 3300025297 Bacteria 11994
167 Ga0209758_1007213 3300025297 Bacteria 7652
168 Ga0209050_1000852 3300025298 Bacteria 41567
169 Ga0209256_1000146 3300025299 Bacteria 149440
170 Ga0209256_1000458 3300025299 Bacteria 61611
171 Ga0209256_1000818 3300025299 Bacteria 39749
172 Ga0209256_1002209 3300025299 Bacteria 16647
173 Ga0209256_1002923 3300025299 Bacteria 12843
174 Ga0209256_1003989 3300025299 Bacteria 9683
175 Ga0207426_1000005 3300025302 Bacteria 1037188
176 Ga0207426_1000035 3300025302 Bacteria 448327
177 Ga0209051_1000062 3300025303 Bacteria 251081
178 Ga0209051_1003025 3300025303 Bacteria 11387
179 Ga0209051_1020955 3300025303 Bacteria 2798
180 Ga0209051_1021053 3300025303 Bacteria 2789
181 Ga0209051_1025528 3300025303 Bacteria 2401
182 Ga0209257_1011007 3300025304 Bacteria 4442
183 Ga0207642_10073489 3300025899 Bacteria 1635
184 Ga0207680_10022847 3300025903 Bacteria 3407
185 Ga0207647_10209785 3300025904 Bacteria 1125
186 Ga0207705_10004544 3300025909 Bacteria 10479
187 Ga0207705_10013932 3300025909 Bacteria 5798
188 Ga0207705_10037604 3300025909 Bacteria 3463
189 Ga0207707_10021399 3300025912 Bacteria 5654
190 Ga0207707_10160952 3300025912 Bacteria 1963
191 Ga0207695_10069592 3300025913 Bacteria 3601
192 Ga0207695_10111937 3300025913 Bacteria 2708
193 Ga0207695_10176098 3300025913 Bacteria 2062
194 Ga0207660_10052792 3300025917 Bacteria 2895
195 Ga0207657_10001927 3300025919 Bacteria 22401
196 Ga0207657_10001958 3300025919 Bacteria 22216
197 Ga0207657_10069253 3300025919 Bacteria 2995
198 Ga0207657_10133893 3300025919 Bacteria 2029
199 Ga0207652_10061712 3300025921 Bacteria 3238
200 Ga0207694_10020708 3300025924 Bacteria 4980
201 Ga0207694_10443010 3300025924 Bacteria 1084
202 Ga0207687_10025592 3300025927 Bacteria 3948
203 Ga0207687_10119625 3300025927 Bacteria 1968
204 Ga0207664_10395722 3300025929 Bacteria 1228
205 Ga0207704_10004470 3300025938 Bacteria 6390
206 Ga0207704_10004497 3300025938 Bacteria 6374
207 Ga0207665_10005349 3300025939 Bacteria 8575
208 Ga0207711_10000728 3300025941 Bacteria 32348
209 Ga0207689_10300203 3300025942 Bacteria 1331
210 Ga0207667_10017868 3300025949 Bacteria 7971
211 Ga0207667_10082776 3300025949 Bacteria 3323
212 Ga0207703_10049780 3300026035 Bacteria 3388
213 Ga0207639_10240659 3300026041 Bacteria 1573
214 Ga0207678_10073345 3300026067 Bacteria 2933
215 Ga0207708_10033943 3300026075 Bacteria 3880
216 Ga0207641_10300947 3300026088 Bacteria 1515
217 Ga0207648_10224926 3300026089 Bacteria 1668
218 Ga0207676_10253596 3300026095 Bacteria 1585
219 Ga0207674_10165747 3300026116 Bacteria 2164
220 Ga0207698_10174810 3300026142 Bacteria 1895
221 Ga0209281_1000314 3300027111 Bacteria 86424
222 Ga0209371_1000009 3300027312 Bacteria 963030
223 Ga0209371_1014017 3300027312 Bacteria 2218
224 Ga0209282_1000068 3300027666 Bacteria 85817
225 Ga0209282_1000143 3300027666 Bacteria 42143
226 Ga0209282_1089835 3300027666 Bacteria 1612
227 Ga0209813_10057344 3300027866 Bacteria 1235
228 Ga0268266_10000373 3300028379 Bacteria 68755
229 Ga0268266_10035496 3300028379 Bacteria 4241
230 Ga0268266_10036484 3300028379 Bacteria 4184
231 Ga0268266_10143372 3300028379 Bacteria 2145
232 Ga0265334_10015983 3300028573 Bacteria 3109
233 Ga0307515_10029779 3300028794 Bacteria 9206
234 Ga0307515_10085478 3300028794 Bacteria 4036
235 Ga0265338_10015741 3300028800 Bacteria 8284
236 Ga0268256_1000010 3300030500 Bacteria 963034
237 Ga0268256_1014365 3300030500 Bacteria 2354
238 Ga0265325_10035604 3300031241 Bacteria 2642
239 Ga0265339_10000080 3300031249 Bacteria 83570
240 Ga0265327_10034836 3300031251 Bacteria 2789
241 Ga0307513_10040412 3300031456 Bacteria 5158
242 Ga0265313_10000948 3300031595 Bacteria 28784
243 Ga0265313_10007576 3300031595 Bacteria 7379
244 Ga0265314_10034328 3300031711 Bacteria 3709
245 Ga0265314_10273734 3300031711 Bacteria 958
246 Ga0307406_10111744 3300031901 Bacteria 1883
247 Ga0315914_1014431 3300031967 Bacteria 8428
248 Ga0307409_100424024 3300031995 Bacteria 1277
249 Ga0307414_10029633 3300032004 Bacteria 3564
250 Ga0307414_10236724 3300032004 Bacteria 1509
251 Ga0315913_1002536 3300033430 Bacteria 21509
252 Ga0315915_1000007 3300033464 Bacteria 319225
253 Ga0373936_0003176 3300035113 Bacteria 6152
254 Ga0373936_0054161 3300035113 Bacteria 1627
255 Ga0373955_0100915 3300035172 Bacteria 1657
256 Ga0373925_0022477 3300037068 Bacteria 4600
257 Ga0373925_0187104 3300037068 Bacteria 1642
258 Ga0395899_0002226 3300037312 Bacteria 15895
259 Ga0395900_0016936 3300037418 Bacteria 7438
260 Ga0395905_0010004 3300037471 Bacteria 9243
261 Ga0436364_0074250 3300037853 Bacteria 26320
262 Ga0395901_0298144 3300038443 Bacteria 1671
263 Ga0439436_0010057 3300041404 Bacteria 2892
264 Ga0439447_040756 3300041407 Bacteria 1132
265 Ga0439461_0001099 3300041410 Bacteria 4087
266 Ga0439465_0000331 3300041413 Bacteria 13474
267 Ga0439465_0058241 3300041413 Bacteria 1276
268 Ga0451835_1159006 3300041492 Bacteria 1987
269 Ga0451839_1391203 3300041496 Bacteria 870
270 Ga0451845_0361943 3300041501 Bacteria 2099
271 Ga0451847_0154624 3300041503 Bacteria 2057
272 Ga0451849_0654528 3300041505 Bacteria 1187
273 Ga0451843_0361168 3300041509 Bacteria 2397
274 Ga0439431_0000025 3300041997 Bacteria 23749
275 Ga0439431_0004392 3300041997 Bacteria 3098
276 Ga0439442_001856 3300042002 Bacteria 4137
277 Ga0439445_0000671 3300042004 Bacteria 7091
278 Ga0439432_000185 3300042006 Bacteria 22317
279 Ga0439449_0013823 3300042007 Bacteria 3036
280 Ga0439452_031698 3300042010 Bacteria 1295
281 Ga0439462_0005489 3300042015 Bacteria 3126
282 Ga0439462_0010247 3300042015 Bacteria 2374
283 Ga0450920_005630 3300042122 Bacteria 2231
284 Ga0450907_009023 3300042146 Bacteria 1654
285 Ga0439434_0000905 3300042435 Bacteria 8537
286 Ga0439434_0001835 3300042435 Bacteria 6170
287 Ga0439464_0070185 3300042439 Bacteria 1036
288 Ga0450918_007499 3300042531 Bacteria 1928
289 Ga0453684_0086457 3300044712 Bacteria 3891
290 Ga0453684_0201649 3300044712 Bacteria 2319
291 Ga0466968_0003080 3300044735 Bacteria 6155
292 Ga0451576_0207840 3300045051 Bacteria 2044
293 Ga0495627_040982 3300046453 Bacteria 1424
294 Ga0495629_0022804 3300046459 Bacteria 4460
295 Ga0495638_0029873 3300046460 Bacteria 3513
296 Ga0495638_0102511 3300046460 Bacteria 1710
297 Ga0495662_0015511 3300046476 Bacteria 3697
298 Ga0495584_0126831 3300046491 Bacteria 1294
299 Ga0495596_0022759 3300046500 Bacteria 2549
300 Ga0495607_0029974 3300046501 Bacteria 3345
301 Ga0495583_0000175 3300046506 Bacteria 108912
302 Ga0495583_0116195 3300046506 Bacteria 1130
303 Ga0495606_0042235 3300046507 Bacteria 3051
304 Ga0495610_0039363 3300046512 Bacteria 2391
305 Ga0495620_0049605 3300046515 Bacteria 1795
306 Ga0495630_0244549 3300046517 Bacteria 1371
307 Ga0495643_0013377 3300046522 Bacteria 4914
308 Ga0495643_0016075 3300046522 Bacteria 4404
309 Ga0495643_0120282 3300046522 Bacteria 1327
310 Ga0495648_0131084 3300046524 Bacteria 1333
311 Ga0495654_0118400 3300046530 Bacteria 1201
312 Ga0495609_0098722 3300046538 Bacteria 1266
313 Ga0495609_0114940 3300046538 Bacteria 1160
314 Ga0495633_0049396 3300046558 Bacteria 1985
315 Ga0495656_0055800 3300046615 Bacteria 1705
316 Ga0495668_0232695 3300046616 Bacteria 1009
317 Ga0495625_0049528 3300046660 Bacteria 3019
318 Ga0495625_0083634 3300046660 Bacteria 2218
319 Ga0495625_0116418 3300046660 Bacteria 1823
320 Ga0495635_0020442 3300046663 Bacteria 4611
321 Ga0495661_0069699 3300046665 Bacteria 2060
322 Ga0495661_0153885 3300046665 Bacteria 1240
323 Ga0495588_0022539 3300046674 Bacteria 3113
324 Ga0495588_0223814 3300046674 Bacteria 993
325 Ga0495658_0177247 3300046683 Bacteria 1321
326 Ga0495671_0071215 3300046692 Bacteria 1708
327 Ga0495671_0087595 3300046692 Bacteria 1525
328 Ga0495649_0156236 3300046694 Bacteria 1197
329 Ga0495649_0219438 3300046694 Bacteria 984
330 Ga0495660_0023601 3300046810 Bacteria 3508
331 Ga0495687_075188 3300047443 Bacteria 1341
332 Ga0495687_081467 3300047443 Bacteria 1266
333 Ga0495681_0035137 3300047470 Bacteria 2491
334 Ga0495686_0009312 3300047472 Bacteria 7086
335 Ga0495626_0115938 3300048091 Bacteria 1156
336 Ga0496100_0281381 3300048903 Bacteria 1240
337 Ga0496101_0160491 3300048904 Bacteria 1724
338 Ga0496101_0213643 3300048904 Bacteria 1495
339 Ga0496103_0040182 3300048906 Bacteria 2875
340 Ga0496104_0069375 3300048907 Bacteria 3350
341 Ga0496106_0012227 3300048909 Bacteria 6334
342 Ga0496106_0014872 3300048909 Bacteria 5757
343 Ga0496107_0136026 3300048910 Bacteria 1815
344 Ga0496112_0039486 3300048915 Bacteria 4613
345 Ga0496112_0131359 3300048915 Bacteria 2475
346 Ga0496113_0046156 3300048916 Bacteria 3234
347 Ga0496115_0091441 3300048918 Bacteria 2487
348 Ga0496116_0089668 3300048919 Bacteria 1875
349 Ga0496117_0000002 3300048920 Bacteria 2483758
350 Ga0496117_0071837 3300048920 Bacteria 2317
351 Ga0496118_0002809 3300048921 Bacteria 22813
352 Ga0496118_0012231 3300048921 Bacteria 8269
353 Ga0496118_0065839 3300048921 Bacteria 2648
354 Ga0496119_0016100 3300048922 Bacteria 5711
355 Ga0496119_0030332 3300048922 Bacteria 3648
356 Ga0496120_0003418 3300048923 Bacteria 14503
357 Ga0496120_0028404 3300048923 Bacteria 3429
358 Ga0496121_0000154 3300048924 Bacteria 150013
359 Ga0496122_0000001 3300048925 Bacteria 1827766
360 Ga0496122_0013033 3300048925 Bacteria 8189
361 Ga0496122_0013828 3300048925 Bacteria 7860
362 Ga0496122_0088340 3300048925 Bacteria 2124
363 Ga0496122_0153458 3300048925 Bacteria 1417
364 Ga0496123_0000001 3300048926 Bacteria 1831497
365 Ga0496123_0025431 3300048926 Bacteria 4464
366 Ga0496123_0027291 3300048926 Bacteria 4256
367 Ga0496123_0045179 3300048926 Bacteria 3003
368 Ga0496124_0020416 3300048927 Bacteria 6120
369 Ga0496124_0104233 3300048927 Bacteria 2293
370 Ga0496124_0167694 3300048927 Bacteria 1704
371 Ga0496125_0000001 3300048928 Bacteria 1766138
372 Ga0496125_0033579 3300048928 Bacteria 4537
373 Ga0496125_0038861 3300048928 Bacteria 4109
374 Ga0501031_0033507 3300049568 Bacteria 3351
375 Ga0501031_0087248 3300049568 Bacteria 2035
376 Ga0501032_0001269 3300049569 Bacteria 20225
377 Ga0501032_0086516 3300049569 Bacteria 2083
378 Ga0501033_0000318 3300049570 Bacteria 45707
379 Ga0501033_0126451 3300049570 Bacteria 1853
380 Ga0501034_0081106 3300049571 Bacteria 3247
381 Ga0501034_0140012 3300049571 Bacteria 2399
382 Ga0501034_0553025 3300049571 Bacteria 1060
383 Ga0501036_0033807 3300049572 Bacteria 4324
384 Ga0501037_0000136 3300049573 Bacteria 68536
385 Ga0501037_0046547 3300049573 Bacteria 3181
386 Ga0501038_0128496 3300049574 Bacteria 2083
387 Ga0501038_0129095 3300049574 Bacteria 2078
388 Ga0501038_0147419 3300049574 Bacteria 1920
389 Ga0501039_0009703 3300049575 Bacteria 7336
390 Ga0501039_0037960 3300049575 Bacteria 3720
391 Ga0501039_0421288 3300049575 Bacteria 1049
392 Ga0501040_0030291 3300049576 Bacteria 3655
393 Ga0501040_0059833 3300049576 Bacteria 2617
394 Ga0501040_0134422 3300049576 Bacteria 1740
395 Ga0501040_0384178 3300049576 Bacteria 1007
396 Ga0501041_0010339 3300049577 Bacteria 5499
397 Ga0501041_0011071 3300049577 Bacteria 5325
398 Ga0501041_0106441 3300049577 Bacteria 1738
399 Ga0501042_0000994 3300049578 Bacteria 16079
400 Ga0501042_0012081 3300049578 Bacteria 5841
401 Ga0501043_0000006 3300049579 Bacteria 234413
402 Ga0501043_0049763 3300049579 Bacteria 3295
403 Ga0501043_0074808 3300049579 Bacteria 2661
404 Ga0501043_0097190 3300049579 Bacteria 2315
405 Ga0501043_0248765 3300049579 Bacteria 1370
406 Ga0501046_0002236 3300049580 Bacteria 18265
407 Ga0501046_0005715 3300049580 Bacteria 11096
408 Ga0501046_0050202 3300049580 Bacteria 3296
409 Ga0501046_0314688 3300049580 Bacteria 1141
410 Ga0501047_0006051 3300049581 Bacteria 11377
411 Ga0501048_0024176 3300049582 Bacteria 4435
412 Ga0501048_0055868 3300049582 Bacteria 2802
413 Ga0501048_0362041 3300049582 Bacteria 1035
414 Ga0501068_0025041 3300049584 Bacteria 3508
415 Ga0501068_0212678 3300049584 Bacteria 1228
416 Ga0501068_0336219 3300049584 Bacteria 969
417 Ga0501069_0000024 3300049585 Bacteria 117140
418 Ga0501069_0007683 3300049585 Bacteria 5657
419 Ga0501070_0000093 3300049586 Bacteria 76623
420 Ga0501070_0001707 3300049586 Bacteria 19484
421 Ga0501070_0046834 3300049586 Bacteria 3596
422 Ga0501071_0000498 3300049587 Bacteria 19943
423 Ga0501071_0019437 3300049587 Bacteria 4713
424 Ga0501071_0161800 3300049587 Bacteria 1673
425 Ga0501072_0026183 3300049588 Bacteria 4546
426 Ga0501072_0027986 3300049588 Bacteria 4399
427 Ga0501073_0044343 3300049589 Bacteria 3135
428 Ga0501073_0046579 3300049589 Bacteria 3049
429 Ga0501073_0235412 3300049589 Bacteria 1265
430 Ga0501074_0001523 3300049590 Bacteria 15668
431 Ga0501074_0004462 3300049590 Bacteria 10014
432 Ga0501074_0004835 3300049590 Bacteria 9654
433 Ga0501074_0030237 3300049590 Bacteria 3925
434 Ga0501075_0000282 3300049591 Bacteria 28099
435 Ga0501075_0044949 3300049591 Bacteria 3313
436 Ga0501075_0046245 3300049591 Bacteria 3269
437 Ga0501076_0001466 3300049592 Bacteria 15817
438 Ga0501076_0060257 3300049592 Bacteria 3019
439 Ga0501076_0329103 3300049592 Bacteria 1253
440 Ga0501077_0001714 3300049593 Bacteria 13219
441 Ga0501077_0020704 3300049593 Bacteria 4164
442 Ga0501079_0003632 3300049741 Bacteria 11359
443 Ga0501079_0016612 3300049741 Bacteria 5621
444 Ga0501079_0022511 3300049741 Bacteria 4832
445 Ga0501079_0117239 3300049741 Bacteria 2070
446 Ga0501080_0005371 3300049742 Bacteria 11425
447 Ga0501080_0031943 3300049742 Bacteria 4907
448 Ga0501080_0048025 3300049742 Bacteria 3974
449 Ga0501080_0149623 3300049742 Bacteria 2158
450 Ga0501080_0172952 3300049742 Bacteria 1991
451 Ga0501080_0196357 3300049742 Bacteria 1853
452 Ga0501081_0000147 3300049743 Bacteria 32041
453 Ga0501081_0002678 3300049743 Bacteria 11259
454 Ga0501081_0069023 3300049743 Bacteria 2461
455 Ga0501081_0085620 3300049743 Bacteria 2212
456 Ga0501083_0000097 3300049744 Bacteria 59474
457 Ga0501083_0051158 3300049744 Bacteria 2778
458 Ga0501083_0065996 3300049744 Bacteria 2410
459 Ga0501035_0000068 3300049822 Bacteria 128392
460 Ga0501035_0022486 3300049822 Bacteria 5791
461 Ga0501035_0038033 3300049822 Bacteria 4357
462 Ga0501035_0107130 3300049822 Bacteria 2450
463 Ga0501044_0000096 3300049823 Bacteria 109532
464 Ga0501044_0002553 3300049823 Bacteria 20731
465 Ga0501044_0019940 3300049823 Bacteria 7162
466 Ga0501045_0000846 3300049824 Bacteria 19862
467 Ga0501045_0015524 3300049824 Bacteria 5402
468 Ga0501045_0076965 3300049824 Bacteria 2458
469 nmdc:mga03n38_14126_c1 3300050490 Bacteria 3054
470 nmdc:mga00v17_532_c1 3300050491 Bacteria 21380
471 nmdc:mga00v17_64067_c1 3300050491 Bacteria 2265
472 nmdc:mga0yw44_5021_c1 3300050492 Bacteria 6181
473 nmdc:mga0yw44_5970_c1 3300050492 Bacteria 5829
474 nmdc:mga0k408_158631_c1 3300050493 Bacteria 1348
475 nmdc:mga0k408_201700_c1 3300050493 Bacteria 1187
476 nmdc:mga06z11_115810_c1 3300050494 Bacteria 1490
477 nmdc:mga06z11_170861_c1 3300050494 Bacteria 1248
478 nmdc:mga06z11_79050_c1 3300050494 Bacteria 1760
479 nmdc:mga04h51_109654_c1 3300050495 Bacteria 1016
480 nmdc:mga07m45_163969_c1 3300050496 Bacteria 1291
481 nmdc:mga07m45_25346_c1 3300050496 Bacteria 3252
482 nmdc:mga08y16_348915_c1 3300050511 Bacteria 1520
483 nmdc:mga0sz30_368_c1 3300050516 Bacteria 17149
484 Ga0495601_0007500 3300053077 Bacteria 6400
485 Ga0495595_0061418 3300053084 Bacteria 1760
486 Ga0500578_0035016 3300053086 Bacteria 3226
487 Ga0500578_0276041 3300053086 Bacteria 1004
488 Ga0500646_0051808 3300053090 Bacteria 1186
489 Ga0500651_0131582 3300053093 Bacteria 1513
490 Ga0500654_090411 3300053099 Bacteria 1368
491 Ga0500555_002637 3300053103 Bacteria 5163
492 Ga0500560_014107 3300053107 Bacteria 2120
493 Ga0500569_057561 3300053109 Bacteria 1191
494 Ga0500572_005128 3300053111 Bacteria 2962
495 Ga0500595_011352 3300053119 Bacteria 3492
496 Ga0500595_015812 3300053119 Bacteria 2825
497 Ga0500595_016287 3300053119 Bacteria 2772
498 Ga0500642_0002054 3300053130 Bacteria 5842
499 Ga0500658_0004494 3300053134 Bacteria 5205
500 Ga0500658_0013777 3300053134 Bacteria 2990
501 Ga0500658_0109323 3300053134 Bacteria 1215
502 Ga0500658_0134423 3300053134 Bacteria 1105
503 Ga0500559_0065905 3300053136 Bacteria 1623
504 Ga0500561_0000035 3300053137 Bacteria 27996
505 Ga0500568_0000109 3300053139 Bacteria 76714
506 Ga0500568_0008275 3300053139 Bacteria 5029
507 Ga0500568_0031408 3300053139 Bacteria 2191
508 Ga0500588_0001742 3300053146 Bacteria 4228
509 Ga0500588_0019831 3300053146 Bacteria 1794
510 Ga0500590_000026 3300053148 Bacteria 36766
511 Ga0500604_0001996 3300053151 Bacteria 5651
512 Ga0500604_0086449 3300053151 Bacteria 1019
513 Ga0500616_0034527 3300053153 Bacteria 2754
514 Ga0500616_0036048 3300053153 Bacteria 2686
515 Ga0500622_0002690 3300053156 Bacteria 12594
516 Ga0500624_001616 3300053157 Bacteria 3420
517 Ga0500624_006190 3300053157 Bacteria 1613
518 Ga0500627_0084793 3300053158 Bacteria 1414
519 Ga0500633_0012429 3300053160 Bacteria 2352
520 Ga0500636_0000149 3300053177 Bacteria 36257
521 Ga0500636_0005980 3300053177 Bacteria 6973
522 Ga0500611_004761 3300053727 Bacteria 1856
523 Ga0501084_0008285 3300054114 Bacteria 8575
524 Ga0501084_0116654 3300054114 Bacteria 2244
525 Ga0501082_0002793 3300060353 Bacteria 15231
526 Ga0501082_0021564 3300060353 Bacteria 5556
527 Ga0501082_0058908 3300060353 Bacteria 3309
528 Ga0501082_0113292 3300060353 Bacteria 2348
529 Ga0530510_0003176 3300061734 Bacteria 11293
530 Ga0530510_0018557 3300061734 Bacteria 4931
531 Ga0530510_0049503 3300061734 Bacteria 3036
532 Ga0530510_0127494 3300061734 Bacteria 1871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1015627 Ga0055536_10156273 219
2 3300025292 Ga0209676_1004240 Ga0209676_10042404 219
3 3300046491 Ga0495584_0126831 Ga0495584_0126831_309_1103 229
4 3300048091 Ga0495626_0115938 Ga0495626_0115938_58_852 229
5 3300049592 Ga0501076_0329103 Ga0501076_0329103_65_841 241
6 3300050495 nmdc:mga04h51_109654_c1 nmdc:mga04h51_109654_c1_10_786 241
7 3300053134 Ga0500658_0134423 Ga0500658_0134423_257_1033 241
8 3300009765 Ga0123341_1000109 Ga0123341_10001097 247
9 3300009766 Ga0123342_1028378 Ga0123342_10283781 247
10 3300025303 Ga0209051_1000062 Ga0209051_1000062195 247
11 3300025304 Ga0209257_1011007 Ga0209257_10110074 247
12 3300041413 Ga0439465_0058241 Ga0439465_0058241_99_893 247
13 3300041492 Ga0451835_1159006 Ga0451835_1159006_31_825 247
14 3300041496 Ga0451839_1391203 Ga0451839_1391203_31_825 247
15 3300041501 Ga0451845_0361943 Ga0451845_0361943_832_1626 247
16 3300041503 Ga0451847_0154624 Ga0451847_0154624_574_1368 247
17 3300041505 Ga0451849_0654528 Ga0451849_0654528_370_1164 247
18 3300041509 Ga0451843_0361168 Ga0451843_0361168_430_1224 247
19 3300042146 Ga0450907_009023 Ga0450907_009023_761_1555 247
20 3300046460 Ga0495638_0029873 Ga0495638_0029873_495_1289 247
21 3300046500 Ga0495596_0022759 Ga0495596_0022759_1179_1973 247
22 3300046501 Ga0495607_0029974 Ga0495607_0029974_303_1097 247
23 3300046506 Ga0495583_0116195 Ga0495583_0116195_128_922 247
24 3300046507 Ga0495606_0042235 Ga0495606_0042235_1593_2387 247
25 3300046512 Ga0495610_0039363 Ga0495610_0039363_1147_1941 247
26 3300046515 Ga0495620_0049605 Ga0495620_0049605_10_804 247
27 3300046522 Ga0495643_0013377 Ga0495643_0013377_953_1747 247
28 3300046522 Ga0495643_0120282 Ga0495643_0120282_270_1064 247
29 3300046524 Ga0495648_0131084 Ga0495648_0131084_458_1252 247
30 3300046530 Ga0495654_0118400 Ga0495654_0118400_83_877 247
31 3300046538 Ga0495609_0098722 Ga0495609_0098722_131_925 247
32 3300046538 Ga0495609_0114940 Ga0495609_0114940_128_922 247
33 3300046615 Ga0495656_0055800 Ga0495656_0055800_801_1595 247
34 3300046616 Ga0495668_0232695 Ga0495668_0232695_151_945 247
35 3300046660 Ga0495625_0049528 Ga0495625_0049528_1721_2515 247
36 3300046665 Ga0495661_0153885 Ga0495661_0153885_130_924 247
37 3300046694 Ga0495649_0156236 Ga0495649_0156236_384_1178 247
38 3300046810 Ga0495660_0023601 Ga0495660_0023601_2178_2972 247
39 3300047443 Ga0495687_075188 Ga0495687_075188_293_1087 247
40 3300047443 Ga0495687_081467 Ga0495687_081467_74_868 247
41 3300047472 Ga0495686_0009312 Ga0495686_0009312_3484_4278 247
42 3300048903 Ga0496100_0281381 Ga0496100_0281381_370_1158 247
43 3300048904 Ga0496101_0160491 Ga0496101_0160491_573_1361 247
44 3300048906 Ga0496103_0040182 Ga0496103_0040182_545_1333 247
45 3300048907 Ga0496104_0069375 Ga0496104_0069375_1953_2741 247
46 3300048921 Ga0496118_0012231 Ga0496118_0012231_406_1200 247
47 3300049571 Ga0501034_0140012 Ga0501034_0140012_686_1480 247
48 3300049573 Ga0501037_0046547 Ga0501037_0046547_2026_2820 247
49 3300049574 Ga0501038_0147419 Ga0501038_0147419_471_1265 247
50 3300049742 Ga0501080_0149623 Ga0501080_0149623_538_1332 247
51 3300050494 nmdc:mga06z11_170861_c1 nmdc:mga06z11_170861_c1_287_1081 247
52 3300050496 nmdc:mga07m45_163969_c1 nmdc:mga07m45_163969_c1_405_1199 247
53 3300053086 Ga0500578_0035016 Ga0500578_0035016_194_988 247
54 3300053086 Ga0500578_0276041 Ga0500578_0276041_78_872 247
55 3300053109 Ga0500569_057561 Ga0500569_057561_323_1117 247
56 3300053134 Ga0500658_0004494 Ga0500658_0004494_679_1473 247
57 3300053134 Ga0500658_0013777 Ga0500658_0013777_381_1175 247
58 3300053139 Ga0500568_0000109 Ga0500568_0000109_5151_5945 247
59 3300053153 Ga0500616_0034527 Ga0500616_0034527_51_845 247
60 3300053153 Ga0500616_0036048 Ga0500616_0036048_1832_2626 247
61 3300031901 Ga0307406_10111744 Ga0307406_101117442 249
62 3300049568 Ga0501031_0087248 Ga0501031_0087248_1004_1852 249
63 3300049576 Ga0501040_0030291 Ga0501040_0030291_2777_3625 249
64 3300049577 Ga0501041_0010339 Ga0501041_0010339_3541_4389 249
65 3300049582 Ga0501048_0024176 Ga0501048_0024176_2648_3496 249
66 3300049588 Ga0501072_0027986 Ga0501072_0027986_1486_2334 249
67 3300049590 Ga0501074_0030237 Ga0501074_0030237_2825_3673 249
68 3300049742 Ga0501080_0172952 Ga0501080_0172952_1062_1910 249
69 3300049743 Ga0501081_0085620 Ga0501081_0085620_1284_2132 249
70 3300049824 Ga0501045_0076965 Ga0501045_0076965_1313_2161 249
71 3300054114 Ga0501084_0116654 Ga0501084_0116654_219_1067 249
72 3300060353 Ga0501082_0113292 Ga0501082_0113292_1168_2016 249
73 iso_pu_bacteria 2818991441 2819571520 249
74 iso_pu_bacteria 2844163670 2844170238 249
75 3300028573 Ga0265334_10015983 Ga0265334_100159832 250
76 3300053119 Ga0500595_016287 Ga0500595_016287_475_1329 250
77 3300002773 JGI25152J39213_1002543 JGI25152J39213_10025432 251
78 3300005262 Ga0065165_1013986 Ga0065165_10139863 251
79 3300025245 Ga0207425_1020985 Ga0207425_10209852 251
80 3300025258 Ga0209129_1000019 Ga0209129_1000019100 251
81 3300025284 Ga0209130_1013126 Ga0209130_10131262 251
82 3300013249 Ga0171463_1010 Ga0171463_10102 252
83 3300025263 Ga0209565_1010175 Ga0209565_10101752 252
84 3300025295 Ga0209564_1000081 Ga0209564_100008126 252
85 3300025298 Ga0209050_1000852 Ga0209050_100085225 252
86 3300025303 Ga0209051_1003025 Ga0209051_10030259 252
87 3300048921 Ga0496118_0065839 Ga0496118_0065839_1739_2545 252
88 3300048928 Ga0496125_0000001 Ga0496125_0000001_762994_763800 252
89 3300006881 Ga0068865_100002567 Ga0068865_1000025673 253
90 3300009094 Ga0111539_10549964 Ga0111539_105499642 253
91 3300014326 Ga0157380_10002315 Ga0157380_100023153 253
92 3300025938 Ga0207704_10004497 Ga0207704_100044972 253
93 3300044735 Ga0466968_0003080 Ga0466968_0003080_130_939 253
94 3300048919 Ga0496116_0089668 Ga0496116_0089668_335_1144 253
95 3300048922 Ga0496119_0030332 Ga0496119_0030332_2303_3112 253
96 3300048927 Ga0496124_0020416 Ga0496124_0020416_1887_2696 253
97 3300050490 nmdc:mga03n38_14126_c1 nmdc:mga03n38_14126_c1_1752_2561 253
98 3300050494 nmdc:mga06z11_115810_c1 nmdc:mga06z11_115810_c1_82_891 253
99 3300050511 nmdc:mga08y16_348915_c1 nmdc:mga08y16_348915_c1_182_994 253
100 3300053139 Ga0500568_0031408 Ga0500568_0031408_849_1658 253
101 3300021321 Ga0214542_1025614 Ga0214542_10256142 254
102 3300021327 Ga0214543_1000025 Ga0214543_1000025138 254
103 3300028800 Ga0265338_10015741 Ga0265338_100157415 254
104 3300031241 Ga0265325_10035604 Ga0265325_100356043 254
105 3300031249 Ga0265339_10000080 Ga0265339_1000008055 254
106 3300031595 Ga0265313_10000948 Ga0265313_1000094822 254
107 iso_pu_bacteria 2989392574 2989394122 254
108 3300005339 Ga0070660_100054084 Ga0070660_1000540844 256
109 3300005563 Ga0068855_100449938 Ga0068855_1004499382 256
110 3300006946 Ga0079104_1024883 Ga0079104_10248832 256
111 3300009093 Ga0105240_10108595 Ga0105240_101085954 256
112 3300013307 Ga0157372_10063316 Ga0157372_100633162 256
113 3300022739 Ga0228711_1015241 Ga0228711_10152419 256
114 3300022740 Ga0228710_1006811 Ga0228710_10068112 256
115 3300025913 Ga0207695_10069592 Ga0207695_100695924 256
116 3300025919 Ga0207657_10001958 Ga0207657_1000195818 256
117 3300025949 Ga0207667_10017868 Ga0207667_100178687 256
118 3300027111 Ga0209281_1000314 Ga0209281_100031466 256
119 3300027666 Ga0209282_1000068 Ga0209282_100006866 256
120 3300031595 Ga0265313_10007576 Ga0265313_100075766 256
121 3300031967 Ga0315914_1014431 Ga0315914_10144319 256
122 3300033430 Ga0315913_1002536 Ga0315913_100253618 256
123 3300033464 Ga0315915_1000007 Ga0315915_1000007307 256
124 iso_pu_bacteria 2643221726 2644691131 256
125 3300009177 Ga0105248_10000125 Ga0105248_1000012522 257
126 3300035113 Ga0373936_0003176 Ga0373936_0003176_1774_2592 257
127 3300046517 Ga0495630_0244549 Ga0495630_0244549_516_1334 257
128 iso_pu_bacteria 2558860983 2561469184 257
129 3300041997 Ga0439431_0000025 Ga0439431_0000025_7013_7834 258
130 3300042435 Ga0439434_0001835 Ga0439434_0001835_2158_2979 258
131 3300044712 Ga0453684_0201649 Ga0453684_0201649_167_994 258
132 3300048920 Ga0496117_0071837 Ga0496117_0071837_1285_2112 258
133 3300048927 Ga0496124_0167694 Ga0496124_0167694_311_1138 258
134 iso_pu_bacteria 8055632911 8055636028 258
135 3300005548 Ga0070665_100020770 Ga0070665_1000207703 259
136 3300005614 Ga0068856_100458768 Ga0068856_1004587682 259
137 3300005618 Ga0068864_100015795 Ga0068864_1000157952 259
138 3300005841 Ga0068863_100260509 Ga0068863_1002605092 259
139 3300005937 Ga0081455_10001242 Ga0081455_1000124217 259
140 3300006237 Ga0097621_100065912 Ga0097621_1000659122 259
141 3300006358 Ga0068871_100067275 Ga0068871_1000672752 259
142 3300013308 Ga0157375_10158012 Ga0157375_101580122 259
143 3300025927 Ga0207687_10119625 Ga0207687_101196252 259
144 3300028379 Ga0268266_10036484 Ga0268266_100364843 259
145 iso_pu_bacteria 2808606364 2808867191 259
146 iso_pu_bacteria 2842871566 2842875298 259
147 3300003316 rootH1_10007030 rootH1_100070302 260
148 3300003322 rootL2_10028121 rootL2_100281213 260
149 3300005335 Ga0070666_10007956 Ga0070666_100079565 260
150 3300005339 Ga0070660_100013010 Ga0070660_1000130105 260
151 3300005339 Ga0070660_100266434 Ga0070660_1002664341 260
152 3300005437 Ga0070710_10047776 Ga0070710_100477761 260
153 3300005456 Ga0070678_100001773 Ga0070678_1000017735 260
154 3300005458 Ga0070681_10109686 Ga0070681_101096862 260
155 3300005548 Ga0070665_100000259 Ga0070665_10000025958 260
156 3300005548 Ga0070665_100051533 Ga0070665_1000515333 260
157 3300005618 Ga0068864_100292261 Ga0068864_1002922612 260
158 3300005718 Ga0068866_10172455 Ga0068866_101724551 260
159 3300005840 Ga0068870_10231163 Ga0068870_102311632 260
160 3300006028 Ga0070717_10107994 Ga0070717_101079943 260
161 3300006163 Ga0070715_10002984 Ga0070715_100029844 260
162 3300006175 Ga0070712_100043939 Ga0070712_1000439392 260
163 3300006237 Ga0097621_100002147 Ga0097621_10000214710 260
164 3300006237 Ga0097621_100023769 Ga0097621_1000237694 260
165 3300006358 Ga0068871_100000379 Ga0068871_10000037926 260
166 3300006358 Ga0068871_100032006 Ga0068871_1000320062 260
167 3300006358 Ga0068871_100077735 Ga0068871_1000777353 260
168 3300006358 Ga0068871_100295841 Ga0068871_1002958412 260
169 3300006881 Ga0068865_100036475 Ga0068865_1000364752 260
170 3300009176 Ga0105242_10531969 Ga0105242_105319692 260
171 3300009551 Ga0105238_10474781 Ga0105238_104747812 260
172 3300013296 Ga0157374_10037596 Ga0157374_100375963 260
173 3300013306 Ga0163162_10065009 Ga0163162_100650093 260
174 3300014969 Ga0157376_10013994 Ga0157376_100139944 260
175 3300014969 Ga0157376_10427211 Ga0157376_104272112 260
176 3300025899 Ga0207642_10073489 Ga0207642_100734892 260
177 3300025903 Ga0207680_10022847 Ga0207680_100228472 260
178 3300025909 Ga0207705_10013932 Ga0207705_100139324 260
179 3300025909 Ga0207705_10037604 Ga0207705_100376044 260
180 3300025912 Ga0207707_10160952 Ga0207707_101609522 260
181 3300025917 Ga0207660_10052792 Ga0207660_100527923 260
182 3300025919 Ga0207657_10001927 Ga0207657_100019279 260
183 3300025919 Ga0207657_10069253 Ga0207657_100692532 260
184 3300025921 Ga0207652_10061712 Ga0207652_100617121 260
185 3300025924 Ga0207694_10020708 Ga0207694_100207084 260
186 3300025924 Ga0207694_10443010 Ga0207694_104430101 260
187 3300025929 Ga0207664_10395722 Ga0207664_103957222 260
188 3300025938 Ga0207704_10004470 Ga0207704_100044702 260
189 3300025939 Ga0207665_10005349 Ga0207665_100053495 260
190 3300025942 Ga0207689_10300203 Ga0207689_103002032 260
191 3300026035 Ga0207703_10049780 Ga0207703_100497804 260
192 3300026088 Ga0207641_10300947 Ga0207641_103009472 260
193 3300026089 Ga0207648_10224926 Ga0207648_102249262 260
194 3300026095 Ga0207676_10253596 Ga0207676_102535962 260
195 3300028379 Ga0268266_10000373 Ga0268266_1000037321 260
196 3300028379 Ga0268266_10143372 Ga0268266_101433722 260
197 3300031711 Ga0265314_10273734 Ga0265314_102737341 260
198 3300046694 Ga0495649_0219438 Ga0495649_0219438_118_963 260
199 3300048904 Ga0496101_0213643 Ga0496101_0213643_497_1327 260
200 3300048909 Ga0496106_0014872 Ga0496106_0014872_3440_4270 260
201 3300048924 Ga0496121_0000154 Ga0496121_0000154_128126_128971 260
202 3300053119 Ga0500595_011352 Ga0500595_011352_513_1358 260
203 3300053119 Ga0500595_015812 Ga0500595_015812_1623_2468 260
204 3300053136 Ga0500559_0065905 Ga0500559_0065905_743_1588 260
205 iso_pu_bacteria 2977915119 2977922120 260
206 3300003775 Ga0055524_1013258 Ga0055524_10132583 261
207 3300025299 Ga0209256_1000146 Ga0209256_100014663 261
208 3300025941 Ga0207711_10000728 Ga0207711_100007288 261
209 3300031711 Ga0265314_10034328 Ga0265314_100343283 261
210 3300035172 Ga0373955_0100915 Ga0373955_0100915_186_1025 261
211 3300037068 Ga0373925_0187104 Ga0373925_0187104_23_862 261
212 iso_pu_bacteria 8004312739 8004320378 261
213 3300005327 Ga0070658_10000306 Ga0070658_100003065 262
214 3300005444 Ga0070694_100422365 Ga0070694_1004223651 262
215 3300014326 Ga0157380_10040338 Ga0157380_100403382 262
216 3300025909 Ga0207705_10004544 Ga0207705_100045446 262
217 3300044712 Ga0453684_0086457 Ga0453684_0086457_1726_2574 262
218 3300045051 Ga0451576_0207840 Ga0451576_0207840_651_1499 262
219 iso_pu_bacteria 2643221653 2644300536 262
220 iso_pu_bacteria 2643221719 2644658877 262
221 iso_pu_bacteria 2773857925 2774868951 262
222 iso_pu_bacteria 2773857925 2774874087 262
223 iso_pu_bacteria 2882456835 2882459532 262
224 iso_pu_bacteria 2882456835 2882459765 262
225 iso_pu_bacteria 2894232714 2894237903 262
226 iso_pu_bacteria 2894232714 2894238305 262
227 iso_pu_bacteria 2989776772 2989781091 262
228 iso_pu_bacteria 8005246636 8005248666 262
229 3300006931 Ga0097620_100432734 Ga0097620_1004327341 263
230 3300013306 Ga0163162_10020835 Ga0163162_100208355 263
231 3300014325 Ga0163163_10000021 Ga0163163_1000002134 263
232 3300014968 Ga0157379_10004679 Ga0157379_100046795 263
233 3300032004 Ga0307414_10236724 Ga0307414_102367242 263
234 3300037068 Ga0373925_0022477 Ga0373925_0022477_3069_3908 263
235 3300041404 Ga0439436_0010057 Ga0439436_0010057_1672_2529 263
236 3300042015 Ga0439462_0010247 Ga0439462_0010247_88_945 263
237 3300042122 Ga0450920_005630 Ga0450920_005630_427_1284 263
238 3300042531 Ga0450918_007499 Ga0450918_007499_985_1842 263
239 3300046660 Ga0495625_0116418 Ga0495625_0116418_716_1573 263
240 3300053099 Ga0500654_090411 Ga0500654_090411_125_982 263
241 3300053157 Ga0500624_006190 Ga0500624_006190_485_1342 263
242 3300005563 Ga0068855_100120651 Ga0068855_1001206513 264
243 3300009545 Ga0105237_10430051 Ga0105237_104300511 264
244 3300032004 Ga0307414_10029633 Ga0307414_100296334 264
245 3300041407 Ga0439447_040756 Ga0439447_040756_137_994 264
246 3300046460 Ga0495638_0102511 Ga0495638_0102511_541_1389 264
247 3300046506 Ga0495583_0000175 Ga0495583_0000175_56308_57156 264
248 3300046665 Ga0495661_0069699 Ga0495661_0069699_215_1063 264
249 3300046692 Ga0495671_0087595 Ga0495671_0087595_237_1085 264
250 3300053103 Ga0500555_002637 Ga0500555_002637_3640_4488 264
251 iso_pu_bacteria 2508501122 2509112283 264
252 iso_pu_bacteria 2509276019 2509379408 264
253 iso_pu_bacteria 2509276033 2509448460 264
254 iso_pu_bacteria 2510065019 2510136509 264
255 iso_pu_bacteria 2513237084 2513569639 264
256 iso_pu_bacteria 2513237085 2513576464 264
257 iso_pu_bacteria 2513237093 2513635132 264
258 iso_pu_bacteria 2513237103 2513709802 264
259 iso_pu_bacteria 2513237162 2514018779 264
260 iso_pu_bacteria 2515075009 2515115081 264
261 iso_pu_bacteria 2515154113 2515633257 264
262 iso_pu_bacteria 2515154114 2515642482 264
263 iso_pu_bacteria 2515154116 2515658459 264
264 iso_pu_bacteria 2515154134 2515741933 264
265 iso_pu_bacteria 2516143018 2516207531 264
266 iso_pu_bacteria 2516653077 2517041918 264
267 iso_pu_bacteria 2516653085 2517081051 264
268 iso_pu_bacteria 2517093000 2517098609 264
269 iso_pu_bacteria 2517287029 2517410844 264
270 iso_pu_bacteria 2519899620 2520380745 264
271 iso_pu_bacteria 2529292951 2530644501 264
272 iso_pu_bacteria 2534681796 2535520007 264
273 iso_pu_bacteria 2558860100 2558861463 264
274 iso_pu_bacteria 2582581298 2585221609 264
275 iso_pu_bacteria 2582581306 2585267579 264
276 iso_pu_bacteria 2582581865 2585386639 264
277 iso_pu_bacteria 2582581866 2585393125 264
278 iso_pu_bacteria 2585427526 2585524183 264
279 iso_pu_bacteria 2585427528 2585539219 264
280 iso_pu_bacteria 2585427529 2585544221 264
281 iso_pu_bacteria 2585427593 2585837172 264
282 iso_pu_bacteria 2595698237 2596374959 264
283 iso_pu_bacteria 2599185156 2599331629 264
284 iso_pu_bacteria 2615840624 2616295212 264
285 iso_pu_bacteria 2617270742 2617381226 264
286 iso_pu_bacteria 2643221607 2644050650 264
287 iso_pu_bacteria 2643221636 2644205124 264
288 iso_pu_bacteria 2643221637 2644210158 264
289 iso_pu_bacteria 2643221643 2644240828 264
290 iso_pu_bacteria 2643221686 2644483568 264
291 iso_pu_bacteria 2643221718 2644653710 264
292 iso_pu_bacteria 2657244999 2657684292 264
293 iso_pu_bacteria 2690316117 2692318424 264
294 iso_pu_bacteria 2718217882 2719183772 264
295 iso_pu_bacteria 2718218009 2719728213 264
296 iso_pu_bacteria 2718218363 2721145074 264
297 iso_pu_bacteria 2718218365 2721155811 264
298 iso_pu_bacteria 2718218366 2721167161 264
299 iso_pu_bacteria 2721755514 2722838139 264
300 iso_pu_bacteria 2721755810 2724042407 264
301 iso_pu_bacteria 2724679232 2725952215 264
302 iso_pu_bacteria 2728369365 2730161912 264
303 iso_pu_bacteria 2728369397 2730300918 264
304 iso_pu_bacteria 2738541333 2739033667 264
305 iso_pu_bacteria 2751185821 2753459468 264
306 iso_pu_bacteria 2756170246 2756678153 264
307 iso_pu_bacteria 2765235942 2766068389 264
308 iso_pu_bacteria 2791355082 2792580477 264
309 iso_pu_bacteria 2791355091 2792619484 264
310 iso_pu_bacteria 2791355092 2792627255 264
311 iso_pu_bacteria 2791355094 2792639848 264
312 iso_pu_bacteria 2791355253 2793279986 264
313 iso_pu_bacteria 2791355259 2793317204 264
314 iso_pu_bacteria 2791355260 2793324043 264
315 iso_pu_bacteria 2791355261 2793325648 264
316 iso_pu_bacteria 2791355262 2793333072 264
317 iso_pu_bacteria 2791355263 2793340124 264
318 iso_pu_bacteria 2791355264 2793346248 264
319 iso_pu_bacteria 2791355265 2793355466 264
320 iso_pu_bacteria 2791355266 2793357796 264
321 iso_pu_bacteria 2791355267 2793366534 264
322 iso_pu_bacteria 2802429268 2804754698 264
323 iso_pu_bacteria 2802429605 2805929057 264
324 iso_pu_bacteria 2802429606 2805937241 264
325 iso_pu_bacteria 2802429633 2806044834 264
326 iso_pu_bacteria 2802429634 2806054006 264
327 iso_pu_bacteria 2802429635 2806059902 264
328 iso_pu_bacteria 2802429636 2806066045 264
329 iso_pu_bacteria 2802429637 2806073373 264
330 iso_pu_bacteria 2838035591 2838039561 264
331 iso_pu_bacteria 2838042994 2838045949 264
332 iso_pu_bacteria 2838061910 2838062865 264
333 iso_pu_bacteria 2838074704 2838077734 264
334 iso_pu_bacteria 2838661181 2838667962 264
335 iso_pu_bacteria 2838686498 2838693569 264
336 iso_pu_bacteria 2838729681 2838735462 264
337 iso_pu_bacteria 2838742623 2838748364 264
338 iso_pu_bacteria 2841851746 2841858428 264
339 iso_pu_bacteria 2841864319 2841869762 264
340 iso_pu_bacteria 2842110456 2842115808 264
341 iso_pu_bacteria 2842156927 2842162676 264
342 iso_pu_bacteria 2842163707 2842167047 264
343 iso_pu_bacteria 2842180545 2842186180 264
344 iso_pu_bacteria 2842217011 2842222253 264
345 iso_pu_bacteria 2842229732 2842236055 264
346 iso_pu_bacteria 2842243621 2842249986 264
347 iso_pu_bacteria 2842257432 2842263282 264
348 iso_pu_bacteria 2842264693 2842268017 264
349 iso_pu_bacteria 2842271015 2842278038 264
350 iso_pu_bacteria 2842304105 2842310040 264
351 iso_pu_bacteria 2842341865 2842344000 264
352 iso_pu_bacteria 2842363717 2842369688 264
353 iso_pu_bacteria 2842402390 2842407173 264
354 iso_pu_bacteria 2842409023 2842414065 264
355 iso_pu_bacteria 2842415677 2842420706 264
356 iso_pu_bacteria 2842447887 2842450140 264
357 iso_pu_bacteria 2842521101 2842522772 264
358 iso_pu_bacteria 2842922631 2842924029 264
359 iso_pu_bacteria 2844454524 2844461099 264
360 iso_pu_bacteria 2847417321 2847423074 264
361 iso_pu_bacteria 2848992105 2848997533 264
362 iso_pu_bacteria 2850079185 2850084569 264
363 iso_pu_bacteria 2855825444 2855829031 264
364 iso_pu_bacteria 2855839649 2855844149 264
365 iso_pu_bacteria 2855872281 2855874061 264
366 iso_pu_bacteria 2857516855 2857519190 264
367 iso_pu_bacteria 2858800743 2858806601 264
368 iso_pu_bacteria 2861691609 2861696103 264
369 iso_pu_bacteria 2871466892 2871471903 264
370 iso_pu_bacteria 2889306138 2889306481 264
371 iso_pu_bacteria 2896384573 2896391848 264
372 iso_pu_bacteria 2902330777 2902332836 264
373 iso_pu_bacteria 2913295892 2913296779 264
374 iso_pu_bacteria 2915980308 2915983621 264
375 iso_pu_bacteria 2915986958 2915992197 264
376 iso_pu_bacteria 2915993759 2915999271 264
377 iso_pu_bacteria 2916000859 2916001348 264
378 iso_pu_bacteria 2916007675 2916011600 264
379 iso_pu_bacteria 2916014648 2916018867 264
380 iso_pu_bacteria 2916021584 2916026074 264
381 iso_pu_bacteria 2916028427 2916032099 264
382 iso_pu_bacteria 2916035215 2916039045 264
383 iso_pu_bacteria 2916041962 2916046164 264
384 iso_pu_bacteria 2916048683 2916051899 264
385 iso_pu_bacteria 2916055098 2916060888 264
386 iso_pu_bacteria 2916061851 2916065319 264
387 iso_pu_bacteria 2916068649 2916070113 264
388 iso_pu_bacteria 2916076590 2916077896 264
389 iso_pu_bacteria 2919100787 2919103472 264
390 iso_pu_bacteria 2920760137 2920765012 264
391 iso_pu_bacteria 2921201388 2921203576 264
392 iso_pu_bacteria 2921208531 2921209964 264
393 iso_pu_bacteria 2921237296 2921237768 264
394 iso_pu_bacteria 2921244191 2921248301 264
395 iso_pu_bacteria 2921250672 2921256860 264
396 iso_pu_bacteria 2921257292 2921260992 264
397 iso_pu_bacteria 2921263974 2921267907 264
398 iso_pu_bacteria 2921282425 2921283706 264
399 iso_pu_bacteria 2921289301 2921289711 264
400 iso_pu_bacteria 2921296804 2921300447 264
401 iso_pu_bacteria 2924144063 2924145724 264
402 iso_pu_bacteria 2924150972 2924155834 264
403 iso_pu_bacteria 2924158325 2924162435 264
404 iso_pu_bacteria 2924165586 2924166688 264
405 iso_pu_bacteria 2924172951 2924179577 264
406 iso_pu_bacteria 2924179722 2924183388 264
407 iso_pu_bacteria 2924186466 2924186845 264
408 iso_pu_bacteria 2924200457 2924204581 264
409 iso_pu_bacteria 2924207177 2924213688 264
410 iso_pu_bacteria 2924214083 2924217232 264
411 iso_pu_bacteria 2924221636 2924222619 264
412 iso_pu_bacteria 2924228884 2924233886 264
413 iso_pu_bacteria 2928125067 2928129881 264
414 iso_pu_bacteria 2933570622 2933576481 264
415 iso_pu_bacteria 2933586486 2933591774 264
416 iso_pu_bacteria 2935894831 2935898244 264
417 iso_pu_bacteria 2935901341 2935905759 264
418 iso_pu_bacteria 2936367885 2936370197 264
419 iso_pu_bacteria 2936375103 2936377869 264
420 iso_pu_bacteria 2936381700 2936384144 264
421 iso_pu_bacteria 2996893221 2996896955 264
422 iso_pu_bacteria 3005409236 3005416280 264
423 iso_pu_bacteria 3005445848 3005451446 264
424 iso_pu_bacteria 639633055 639651722 264
425 iso_pu_bacteria 643692032 643823029 264
426 iso_pu_bacteria 8005275841 8005277161 264
427 iso_pu_bacteria 8005289223 8005290665 264
428 iso_pu_bacteria 8005301065 8005305013 264
429 iso_pu_bacteria 8005307578 8005313113 264
430 iso_pu_bacteria 8005376324 8005381877 264
431 iso_pu_bacteria 8005382845 8005388469 264
432 iso_pu_bacteria 8005395548 8005397635 264
433 iso_pu_bacteria 8005430974 8005436986 264
434 iso_pu_bacteria 8005460587 8005466808 264
435 iso_pu_bacteria 8005497431 8005503083 264
436 iso_pu_bacteria 8005556819 8005562119 264
437 iso_pu_bacteria 8005563573 8005567124 264
438 iso_pu_bacteria 8005570704 8005576306 264
439 iso_pu_bacteria 8005619151 8005625605 264
440 iso_pu_bacteria 8005668836 8005675001 264
441 iso_pu_bacteria 8005688590 8005689443 264
442 iso_pu_bacteria 8005695170 8005701927 264
443 iso_pu_bacteria 8018127388 8018130443 264
444 iso_pu_bacteria 8018163183 8018165911 264
445 iso_pu_bacteria 8018176218 8018182236 264
446 iso_pu_bacteria 8023680758 8023682373 264
447 iso_pu_bacteria 8024479707 8024483699 264
448 iso_pu_bacteria 8024486573 8024487602 264
449 iso_pu_bacteria 8049293176 8049298484 264
450 iso_pu_bacteria 8056375014 8056375181 264
451 iso_pu_bacteria 8056382006 8056383525 264
452 iso_pu_bacteria 8057874678 8057878344 264
453 3300005336 Ga0070680_100237580 Ga0070680_1002375802 265
454 3300026075 Ga0207708_10033943 Ga0207708_100339433 265
455 3300028794 Ga0307515_10085478 Ga0307515_100854783 265
456 3300035113 Ga0373936_0054161 Ga0373936_0054161_693_1544 265
457 3300042439 Ga0439464_0070185 Ga0439464_0070185_71_928 265
458 3300048910 Ga0496107_0136026 Ga0496107_0136026_471_1316 265
459 3300048915 Ga0496112_0039486 Ga0496112_0039486_2030_2875 265
460 3300048918 Ga0496115_0091441 Ga0496115_0091441_1028_1873 265
461 3300049576 Ga0501040_0384178 Ga0501040_0384178_135_983 265
462 3300049579 Ga0501043_0248765 Ga0501043_0248765_301_1149 265
463 3300049580 Ga0501046_0050202 Ga0501046_0050202_994_1842 265
464 3300049584 Ga0501068_0212678 Ga0501068_0212678_157_1005 265
465 3300049591 Ga0501075_0046245 Ga0501075_0046245_1191_2039 265
466 3300049741 Ga0501079_0022511 Ga0501079_0022511_3709_4557 265
467 3300049743 Ga0501081_0069023 Ga0501081_0069023_317_1165 265
468 3300049744 Ga0501083_0065996 Ga0501083_0065996_214_1062 265
469 3300053077 Ga0495601_0007500 Ga0495601_0007500_3686_4534 265
470 3300061734 Ga0530510_0049503 Ga0530510_0049503_155_1003 265
471 3300061734 Ga0530510_0127494 Ga0530510_0127494_903_1751 265
472 iso_pu_bacteria 2503198000 2503201483 265
473 iso_pu_bacteria 2508501123 2509113089 265
474 iso_pu_bacteria 2508501127 2509143937 265
475 iso_pu_bacteria 2509276018 2509367870 265
476 iso_pu_bacteria 2509276022 2509396263 265
477 iso_pu_bacteria 2510065059 2510315554 265
478 iso_pu_bacteria 2512875024 2512959380 265
479 iso_pu_bacteria 2513237090 2513611338 265
480 iso_pu_bacteria 2513237164 2514033563 265
481 iso_pu_bacteria 2537561587 2537873780 265
482 iso_pu_bacteria 2554235003 2554246845 265
483 iso_pu_bacteria 2558860242 2559294071 265
484 iso_pu_bacteria 2588253730 2588517386 265
485 iso_pu_bacteria 2597489875 2597813275 265
486 iso_pu_bacteria 2599185210 2599603601 265
487 iso_pu_bacteria 2599185301 2599936795 265
488 iso_pu_bacteria 2600255279 2601608949 265
489 iso_pu_bacteria 2600255308 2601745724 265
490 iso_pu_bacteria 2643221550 2643771143 265
491 iso_pu_bacteria 2643221558 2643813980 265
492 iso_pu_bacteria 2643221568 2643856128 265
493 iso_pu_bacteria 2643221582 2643920934 265
494 iso_pu_bacteria 2643221623 2644129421 265
495 iso_pu_bacteria 2643221626 2644151283 265
496 iso_pu_bacteria 2643221659 2644336357 265
497 iso_pu_bacteria 2643221693 2644519013 265
498 iso_pu_bacteria 2643221698 2644547193 265
499 iso_pu_bacteria 2687453392 2688598397 265
500 iso_pu_bacteria 2721755686 2723575332 265
501 iso_pu_bacteria 2738543024 2739307131 265
502 iso_pu_bacteria 2767802442 2770197868 265
503 iso_pu_bacteria 2775506902 2776269056 265
504 iso_pu_bacteria 2775506904 2776283805 265
505 iso_pu_bacteria 2791355123 2792752741 265
506 iso_pu_bacteria 2808606387 2808986154 265
507 iso_pu_bacteria 2818991439 2819556280 265
508 iso_pu_bacteria 2838675328 2838677005 265
509 iso_pu_bacteria 2838714209 2838715892 265
510 iso_pu_bacteria 2838719591 2838720307 265
511 iso_pu_bacteria 2838724970 2838726645 265
512 iso_pu_bacteria 2839993093 2839993766 265
513 iso_pu_bacteria 2841734538 2841739154 265
514 iso_pu_bacteria 2841846520 2841847237 265
515 iso_pu_bacteria 2841859092 2841860227 265
516 iso_pu_bacteria 2842124991 2842126733 265
517 iso_pu_bacteria 2842130223 2842131898 265
518 iso_pu_bacteria 2842152218 2842152932 265
519 iso_pu_bacteria 2842170452 2842172136 265
520 iso_pu_bacteria 2842175837 2842176551 265
521 iso_pu_bacteria 2842187318 2842189001 265
522 iso_pu_bacteria 2842211629 2842213313 265
523 iso_pu_bacteria 2842224351 2842225069 265
524 iso_pu_bacteria 2842515876 2842517012 265
525 iso_pu_bacteria 2842698319 2842699684 265
526 iso_pu_bacteria 2844002411 2844007479 265
527 iso_pu_bacteria 2844009547 2844013652 265
528 iso_pu_bacteria 2856320880 2856327528 265
529 iso_pu_bacteria 2856328259 2856334516 265
530 iso_pu_bacteria 2856334872 2856340362 265
531 iso_pu_bacteria 2856342000 2856343891 265
532 iso_pu_bacteria 2856364286 2856369413 265
533 iso_pu_bacteria 2857367948 2857371498 265
534 iso_pu_bacteria 2869162929 2869168239 265
535 iso_pu_bacteria 2869169390 2869171917 265
536 iso_pu_bacteria 2869242130 2869242552 265
537 iso_pu_bacteria 2869249662 2869254084 265
538 iso_pu_bacteria 2869256925 2869260796 265
539 iso_pu_bacteria 2869264136 2869269414 265
540 iso_pu_bacteria 2869271264 2869276483 265
541 iso_pu_bacteria 2869278585 2869280417 265
542 iso_pu_bacteria 2869285874 2869286514 265
543 iso_pu_bacteria 2871429161 2871434667 265
544 iso_pu_bacteria 2871435913 2871437348 265
545 iso_pu_bacteria 2871451962 2871459213 265
546 iso_pu_bacteria 2871459585 2871463866 265
547 iso_pu_bacteria 2871474448 2871474619 265
548 iso_pu_bacteria 2871481445 2871482593 265
549 iso_pu_bacteria 2874109183 2874111720 265
550 iso_pu_bacteria 2874116593 2874122992 265
551 iso_pu_bacteria 2874123672 2874130558 265
552 iso_pu_bacteria 2874131515 2874137854 265
553 iso_pu_bacteria 2874139085 2874144171 265
554 iso_pu_bacteria 2874146452 2874149872 265
555 iso_pu_bacteria 2874155637 2874158130 265
556 iso_pu_bacteria 2874162495 2874164473 265
557 iso_pu_bacteria 2874168670 2874169802 265
558 iso_pu_bacteria 2876363079 2876368529 265
559 iso_pu_bacteria 2876369609 2876374073 265
560 iso_pu_bacteria 2876386047 2876387012 265
561 iso_pu_bacteria 2876392853 2876398395 265
562 iso_pu_bacteria 2876399893 2876403680 265
563 iso_pu_bacteria 2876406927 2876412866 265
564 iso_pu_bacteria 2876413966 2876416334 265
565 iso_pu_bacteria 2876420981 2876427810 265
566 iso_pu_bacteria 2878730984 2878732772 265
567 iso_pu_bacteria 2878738818 2878745166 265
568 iso_pu_bacteria 2878745973 2878751800 265
569 iso_pu_bacteria 2878774303 2878775658 265
570 iso_pu_bacteria 2878781027 2878786825 265
571 iso_pu_bacteria 2878788777 2878795221 265
572 iso_pu_bacteria 2881147464 2881151285 265
573 iso_pu_bacteria 2881161766 2881167485 265
574 iso_pu_bacteria 2882632389 2882636227 265
575 iso_pu_bacteria 2885312484 2885318028 265
576 iso_pu_bacteria 2888337043 2888339376 265
577 iso_pu_bacteria 2888343758 2888346752 265
578 iso_pu_bacteria 2899792073 2899792292 265
579 iso_pu_bacteria 2899845264 2899846567 265
580 iso_pu_bacteria 2903448605 2903451265 265
581 iso_pu_bacteria 2903492973 2903504746 265
582 iso_pu_bacteria 2903513507 2903521023 265
583 iso_pu_bacteria 2903521522 2903527528 265
584 iso_pu_bacteria 2903528002 2903533982 265
585 iso_pu_bacteria 2904659560 2904664950 265
586 iso_pu_bacteria 2906308376 2906314198 265
587 iso_pu_bacteria 2906321335 2906327364 265
588 iso_pu_bacteria 2906363423 2906363724 265
589 iso_pu_bacteria 2906370794 2906371561 265
590 iso_pu_bacteria 2906386501 2906391602 265
591 iso_pu_bacteria 2906393657 2906393703 265
592 iso_pu_bacteria 2906401398 2906402848 265
593 iso_pu_bacteria 2906408224 2906408855 265
594 iso_pu_bacteria 2906427513 2906432819 265
595 iso_pu_bacteria 2919114240 2919116094 265
596 iso_pu_bacteria 2919166419 2919167106 265
597 iso_pu_bacteria 2920822456 2920826783 265
598 iso_pu_bacteria 2922151315 2922152228 265
599 iso_pu_bacteria 2922172374 2922175283 265
600 iso_pu_bacteria 2924710171 2924718688 265
601 iso_pu_bacteria 2924718760 2924726534 265
602 iso_pu_bacteria 2924733363 2924735894 265
603 iso_pu_bacteria 2924741084 2924742222 265
604 iso_pu_bacteria 2924754689 2924758656 265
605 iso_pu_bacteria 2924762789 2924765072 265
606 iso_pu_bacteria 2924776078 2924783303 265
607 iso_pu_bacteria 2926754445 2926757048 265
608 iso_pu_bacteria 2926760298 2926761274 265
609 iso_pu_bacteria 2929138655 2929139187 265
610 iso_pu_bacteria 2933006813 2933007577 265
611 iso_pu_bacteria 2933011516 2933012345 265
612 iso_pu_bacteria 2933594066 2933594789 265
613 iso_pu_bacteria 2937813078 2937815692 265
614 iso_pu_bacteria 2937822353 2937824405 265
615 iso_pu_bacteria 2937836603 2937839341 265
616 iso_pu_bacteria 2937848649 2937851870 265
617 iso_pu_bacteria 2937861824 2937867934 265
618 iso_pu_bacteria 2937868953 2937868964 265
619 iso_pu_bacteria 2937877337 2937882170 265
620 iso_pu_bacteria 2937972304 2937978631 265
621 iso_pu_bacteria 2937980651 2937985651 265
622 iso_pu_bacteria 2958034702 2958036287 265
623 iso_pu_bacteria 2958041894 2958045651 265
624 iso_pu_bacteria 2958064165 2958064418 265
625 iso_pu_bacteria 2958071322 2958072078 265
626 iso_pu_bacteria 2958084443 2958089292 265
627 iso_pu_bacteria 2958108152 2958111579 265
628 iso_pu_bacteria 2958122699 2958122754 265
629 iso_pu_bacteria 2958130278 2958130917 265
630 iso_pu_bacteria 2958144490 2958146791 265
631 iso_pu_bacteria 2958158011 2958160179 265
632 iso_pu_bacteria 2958179912 2958184838 265
633 iso_pu_bacteria 2961077736 2961083005 265
634 iso_pu_bacteria 2961114664 2961119949 265
635 iso_pu_bacteria 2961136820 2961142484 265
636 iso_pu_bacteria 2961183825 2961184321 265
637 iso_pu_bacteria 2963644680 2963647664 265
638 iso_pu_bacteria 2965025482 2965031803 265
639 iso_pu_bacteria 2965040258 2965041821 265
640 iso_pu_bacteria 2965047637 2965052881 265
641 iso_pu_bacteria 2965089291 2965091812 265
642 iso_pu_bacteria 2965102966 2965109388 265
643 iso_pu_bacteria 2965110997 2965117344 265
644 iso_pu_bacteria 2968016561 2968018498 265
645 iso_pu_bacteria 2968083720 2968090295 265
646 iso_pu_bacteria 2968110612 2968116306 265
647 iso_pu_bacteria 2968138860 2968143953 265
648 iso_pu_bacteria 2970469710 2970471329 265
649 iso_pu_bacteria 2970489779 2970492932 265
650 iso_pu_bacteria 2970510686 2970515554 265
651 iso_pu_bacteria 2970524798 2970528535 265
652 iso_pu_bacteria 2970532167 2970538796 265
653 iso_pu_bacteria 2970540015 2970544686 265
654 iso_pu_bacteria 2970547951 2970548957 265
655 iso_pu_bacteria 2970593180 2970595014 265
656 iso_pu_bacteria 2970619444 2970620502 265
657 iso_pu_bacteria 2970627176 2970628095 265
658 iso_pu_bacteria 2977843712 2977845928 265
659 iso_pu_bacteria 2977851361 2977855869 265
660 iso_pu_bacteria 2977864932 2977867129 265
661 iso_pu_bacteria 2977872689 2977874829 265
662 iso_pu_bacteria 2977898635 2977906715 265
663 iso_pu_bacteria 2977907340 2977909255 265
664 iso_pu_bacteria 2977922695 2977924172 265
665 iso_pu_bacteria 2977935797 2977936064 265
666 iso_pu_bacteria 2977950692 2977954881 265
667 iso_pu_bacteria 2977957713 2977960850 265
668 iso_pu_bacteria 2977986579 2977992171 265
669 iso_pu_bacteria 2978969890 2978973524 265
670 iso_pu_bacteria 2979089926 2979093446 265
671 iso_pu_bacteria 2979095461 2979099168 265
672 iso_pu_bacteria 2979100975 2979105420 265
673 iso_pu_bacteria 2979764755 2979770877 265
674 iso_pu_bacteria 2979793036 2979799341 265
675 iso_pu_bacteria 2984509177 2984512729 265
676 iso_pu_bacteria 2984518228 2984520909 265
677 iso_pu_bacteria 2984537506 2984540204 265
678 iso_pu_bacteria 2984587000 2984591807 265
679 iso_pu_bacteria 2984601300 2984602398 265
680 iso_pu_bacteria 2987645492 2987649723 265
681 iso_pu_bacteria 2987666974 2987667978 265
682 iso_pu_bacteria 2987673487 2987675183 265
683 iso_pu_bacteria 2996310559 2996314112 265
684 iso_pu_bacteria 2996336353 2996339055 265
685 iso_pu_bacteria 2996348954 2996350121 265
686 iso_pu_bacteria 2996386984 2996392301 265
687 iso_pu_bacteria 3000135777 3000140709 265
688 iso_pu_bacteria 3004167301 3004168844 265
689 iso_pu_bacteria 3004195979 3004197472 265
690 iso_pu_bacteria 3004211236 3004215906 265
691 iso_pu_bacteria 3004218560 3004221928 265
692 iso_pu_bacteria 3004232784 3004236654 265
693 iso_pu_bacteria 3004239961 3004242819 265
694 iso_pu_bacteria 3004248173 3004250496 265
695 iso_pu_bacteria 3004268573 3004274891 265
696 iso_pu_bacteria 3004275668 3004276820 265
697 iso_pu_bacteria 3004289098 3004293183 265
698 iso_pu_bacteria 3004334049 3004334412 265
699 iso_pu_bacteria 637000159 637074647 265
700 iso_pu_bacteria 649633066 649872924 265
701 iso_pu_bacteria 650716007 650739264 265
702 iso_pu_bacteria 8002285264 8002289082 265
703 iso_pu_bacteria 8003570095 8003570299 265
704 iso_pu_bacteria 8004300914 8004302852 265
705 iso_pu_bacteria 8004361976 8004367194 265
706 iso_pu_bacteria 8004387939 8004393688 265
707 iso_pu_bacteria 8004395343 8004399223 265
708 iso_pu_bacteria 8004633249 8004638623 265
709 iso_pu_bacteria 8004695233 8004699737 265
710 iso_pu_bacteria 8004714634 8004720456 265
711 iso_pu_bacteria 8004727605 8004729339 265
712 iso_pu_bacteria 8054460903 8054461608 265
713 iso_pu_bacteria 8055617313 8055620731 265
714 3300049584 Ga0501068_0025041 Ga0501068_0025041_1475_2329 266
715 iso_pu_bacteria 2899803654 2899805515 266
716 3300005985 Ga0081539_10041427 Ga0081539_100414272 267
717 3300053084 Ga0495595_0061418 Ga0495595_0061418_890_1744 267
718 3300053146 Ga0500588_0019831 Ga0500588_0019831_651_1505 267
719 iso_pu_bacteria 2510065057 2510308672 267
720 iso_pu_bacteria 2511231052 2511498213 267
721 iso_pu_bacteria 2512047086 2512529369 267
722 iso_pu_bacteria 2512875026 2512969526 267
723 iso_pu_bacteria 2513237086 2513587908 267
724 iso_pu_bacteria 2513237089 2513606250 267
725 iso_pu_bacteria 2513237091 2513619672 267
726 iso_pu_bacteria 2513237140 2513885166 267
727 iso_pu_bacteria 2513237143 2513906245 267
728 iso_pu_bacteria 2513237156 2513985042 267
729 iso_pu_bacteria 2513237160 2514007965 267
730 iso_pu_bacteria 2515154107 2515610786 267
731 iso_pu_bacteria 2516653046 2516896144 267
732 iso_pu_bacteria 2517487022 2517565596 267
733 iso_pu_bacteria 2524023207 2524449578 267
734 iso_pu_bacteria 2551306084 2551674955 267
735 iso_pu_bacteria 2551306085 2551687271 267
736 iso_pu_bacteria 2551306086 2551692447 267
737 iso_pu_bacteria 2551306087 2551697825 267
738 iso_pu_bacteria 2551306089 2551708275 267
739 iso_pu_bacteria 2551306090 2551721588 267
740 iso_pu_bacteria 2551306091 2551728193 267
741 iso_pu_bacteria 2551306092 2551734447 267
742 iso_pu_bacteria 2551306093 2551743250 267
743 iso_pu_bacteria 2802428858 2802722047 267
744 iso_pu_bacteria 2802428859 2802723020 267
745 iso_pu_bacteria 2802428860 2802728847 267
746 iso_pu_bacteria 2802428861 2802735214 267
747 iso_pu_bacteria 2802428862 2802742182 267
748 iso_pu_bacteria 2802428863 2802748629 267
749 iso_pu_bacteria 2915650412 2915650834 267
750 iso_pu_bacteria 2936996657 2937002245 267
751 iso_pu_bacteria 2937002841 2937007237 267
752 iso_pu_bacteria 2937009748 2937016031 267
753 iso_pu_bacteria 2937016420 2937020758 267
754 iso_pu_bacteria 2937023124 2937026938 267
755 iso_pu_bacteria 2937029754 2937034973 267
756 iso_pu_bacteria 2937036028 2937039204 267
757 iso_pu_bacteria 2937042894 2937048050 267
758 iso_pu_bacteria 2937049772 2937054137 267
759 iso_pu_bacteria 2937056579 2937060592 267
760 iso_pu_bacteria 2937063883 2937068026 267
761 iso_pu_bacteria 2937071275 2937071594 267
762 iso_pu_bacteria 2937078374 2937084383 267
763 iso_pu_bacteria 2937084907 2937091404 267
764 iso_pu_bacteria 2937091812 2937095323 267
765 iso_pu_bacteria 2937098957 2937103588 267
766 iso_pu_bacteria 2937106411 2937110313 267
767 iso_pu_bacteria 2937113482 2937117180 267
768 iso_pu_bacteria 2937119839 2937123599 267
769 iso_pu_bacteria 2937126314 2937130534 267
770 iso_pu_bacteria 2957375807 2957379112 267
771 iso_pu_bacteria 2957382221 2957386354 267
772 iso_pu_bacteria 2957388812 2957392775 267
773 iso_pu_bacteria 2957395598 2957401467 267
774 iso_pu_bacteria 2957402308 2957406658 267
775 iso_pu_bacteria 2957408893 2957414653 267
776 iso_pu_bacteria 2957415311 2957415715 267
777 iso_pu_bacteria 2957422303 2957427374 267
778 iso_pu_bacteria 2957437181 2957437911 267
779 iso_pu_bacteria 2957443900 2957450478 267
780 iso_pu_bacteria 2957450854 2957457517 267
781 iso_pu_bacteria 2957457609 2957461455 267
782 iso_pu_bacteria 2957464669 2957468593 267
783 iso_pu_bacteria 2957471148 2957471582 267
784 iso_pu_bacteria 2957478035 2957484258 267
785 iso_pu_bacteria 2957484790 2957488625 267
786 iso_pu_bacteria 2957491536 2957497258 267
787 iso_pu_bacteria 2957498199 2957505325 267
788 iso_pu_bacteria 2957505466 2957509672 267
789 iso_pu_bacteria 2960584000 2960585873 267
790 iso_pu_bacteria 2960591022 2960596436 267
791 iso_pu_bacteria 2960597568 2960601091 267
792 iso_pu_bacteria 2960603979 2960608833 267
793 iso_pu_bacteria 2960610863 2960617135 267
794 iso_pu_bacteria 2960617483 2960623592 267
795 iso_pu_bacteria 2960624210 2960625723 267
796 iso_pu_bacteria 2960631154 2960634340 267
797 iso_pu_bacteria 2960637947 2960645321 267
798 iso_pu_bacteria 2960645483 2960649765 267
799 iso_pu_bacteria 2960652885 2960655386 267
800 iso_pu_bacteria 2960660292 2960667282 267
801 iso_pu_bacteria 2960667422 2960671622 267
802 iso_pu_bacteria 2960674078 2960679885 267
803 iso_pu_bacteria 2960680706 2960683431 267
804 iso_pu_bacteria 2960687367 2960693828 267
805 iso_pu_bacteria 2960693952 2960695283 267
806 iso_pu_bacteria 2964607997 2964611947 267
807 iso_pu_bacteria 2964615318 2964619646 267
808 iso_pu_bacteria 2964621998 2964624905 267
809 iso_pu_bacteria 2964628898 2964636011 267
810 iso_pu_bacteria 2964636051 2964640069 267
811 iso_pu_bacteria 2964643177 2964647448 267
812 iso_pu_bacteria 2964649959 2964653797 267
813 iso_pu_bacteria 2964656573 2964663401 267
814 iso_pu_bacteria 2964663802 2964670544 267
815 iso_pu_bacteria 2964670856 2964673145 267
816 iso_pu_bacteria 2964678106 2964682786 267
817 iso_pu_bacteria 2964685014 2964690172 267
818 iso_pu_bacteria 2964691889 2964695601 267
819 iso_pu_bacteria 2964698721 2964703759 267
820 iso_pu_bacteria 2964705432 2964712629 267
821 iso_pu_bacteria 2964712639 2964716263 267
822 iso_pu_bacteria 2964719344 2964720629 267
823 iso_pu_bacteria 2967664464 2967665759 267
824 iso_pu_bacteria 2967671571 2967672519 267
825 iso_pu_bacteria 2967678726 2967683343 267
826 iso_pu_bacteria 2967686174 2967688004 267
827 iso_pu_bacteria 2967693043 2967696997 267
828 iso_pu_bacteria 2967699805 2967703946 267
829 iso_pu_bacteria 2967706974 2967711169 267
830 iso_pu_bacteria 2967714385 2967718414 267
831 iso_pu_bacteria 2967721400 2967727003 267
832 iso_pu_bacteria 2967728569 2967734052 267
833 iso_pu_bacteria 2967735183 2967738809 267
834 iso_pu_bacteria 2967742019 2967747974 267
835 iso_pu_bacteria 2967755722 2967759414 267
836 iso_pu_bacteria 2967762386 2967766273 267
837 iso_pu_bacteria 2967769361 2967773552 267
838 iso_pu_bacteria 2967775926 2967780793 267
839 iso_pu_bacteria 2970019648 2970020133 267
840 iso_pu_bacteria 2970026789 2970028926 267
841 iso_pu_bacteria 2970033650 2970034230 267
842 iso_pu_bacteria 2970040964 2970042405 267
843 iso_pu_bacteria 2970047711 2970051668 267
844 iso_pu_bacteria 2970054988 2970059185 267
845 iso_pu_bacteria 2970061556 2970065410 267
846 iso_pu_bacteria 2970068827 2970074093 267
847 iso_pu_bacteria 2970076120 2970080736 267
848 iso_pu_bacteria 2970082768 2970087094 267
849 iso_pu_bacteria 2970088815 2970093142 267
850 iso_pu_bacteria 2970095765 2970099662 267
851 iso_pu_bacteria 2970102677 2970106503 267
852 iso_pu_bacteria 2970109326 2970113702 267
853 iso_pu_bacteria 2970116247 2970120070 267
854 iso_pu_bacteria 2970122695 2970128485 267
855 iso_pu_bacteria 2970129317 2970135712 267
856 iso_pu_bacteria 2970136068 2970141914 267
857 iso_pu_bacteria 2970143518 2970147816 267
858 iso_pu_bacteria 2970149975 2970154082 267
859 iso_pu_bacteria 2970156795 2970161912 267
860 iso_pu_bacteria 2970164137 2970168097 267
861 iso_pu_bacteria 2970170962 2970171611 267
862 iso_pu_bacteria 2970177841 2970184551 267
863 iso_pu_bacteria 2970184632 2970190228 267
864 iso_pu_bacteria 2970191845 2970195939 267
865 iso_pu_bacteria 2977516862 2977517621 267
866 iso_pu_bacteria 2977523885 2977530689 267
867 iso_pu_bacteria 2977530762 2977533929 267
868 iso_pu_bacteria 2977537788 2977541600 267
869 iso_pu_bacteria 2977544691 2977548017 267
870 iso_pu_bacteria 2977551784 2977556292 267
871 iso_pu_bacteria 2977558990 2977565768 267
872 iso_pu_bacteria 2977565890 2977570193 267
873 iso_pu_bacteria 2977572785 2977576932 267
874 iso_pu_bacteria 2977579622 2977583433 267
875 iso_pu_bacteria 648276728 648738317 267
876 iso_pu_bacteria 8003992118 8003996730 267
877 iso_pu_bacteria 8003999396 8004004073 267
878 3300002739 JGI25158J39367_1000612 JGI25158J39367_10006124 268
879 3300002773 JGI25152J39213_1004158 JGI25152J39213_10041584 268
880 3300002774 JGI25150J39212_1000746 JGI25150J39212_10007465 268
881 3300002987 JGI25159J45721_1000089 JGI25159J45721_100008910 268
882 3300003187 JGI25151J46595_10000632 JGI25151J46595_1000063223 268
883 3300003215 JGI25153J46596_10003277 JGI25153J46596_100032778 268
884 3300003354 JGI25160J50197_1000726 JGI25160J50197_10007268 268
885 3300003354 JGI25160J50197_1004162 JGI25160J50197_10041625 268
886 3300003374 JGI25161J50226_1001711 JGI25161J50226_10017113 268
887 3300003374 JGI25161J50226_1003754 JGI25161J50226_10037543 268
888 3300003771 Ga0055526_1005972 Ga0055526_10059725 268
889 3300003771 Ga0055526_1023052 Ga0055526_10230522 268
890 3300003775 Ga0055524_1009871 Ga0055524_10098712 268
891 3300003790 Ga0055528_1000514 Ga0055528_100051425 268
892 3300003790 Ga0055528_1001577 Ga0055528_10015773 268
893 3300003790 Ga0055528_1001960 Ga0055528_100196010 268
894 3300003790 Ga0055528_1004369 Ga0055528_10043694 268
895 3300003792 Ga0055540_1000050 Ga0055540_1000050132 268
896 3300003792 Ga0055540_1006737 Ga0055540_10067372 268
897 3300003792 Ga0055540_1022646 Ga0055540_10226462 268
898 3300004625 Ga0055543_1000021 Ga0055543_100002151 268
899 3300004625 Ga0055543_1001872 Ga0055543_10018724 268
900 3300005262 Ga0065165_1008053 Ga0065165_10080535 268
901 3300005262 Ga0065165_1010256 Ga0065165_10102562 268
902 3300005336 Ga0070680_100061370 Ga0070680_1000613702 268
903 3300005341 Ga0070691_10005336 Ga0070691_100053364 268
904 3300005455 Ga0070663_100055676 Ga0070663_1000556763 268
905 3300005458 Ga0070681_10054794 Ga0070681_100547944 268
906 3300005530 Ga0070679_100058190 Ga0070679_1000581903 268
907 3300005563 Ga0068855_100046104 Ga0068855_1000461043 268
908 3300005841 Ga0068863_100007513 Ga0068863_1000075134 268
909 3300006038 Ga0075365_10058866 Ga0075365_100588663 268
910 3300006177 Ga0075362_10054467 Ga0075362_100544672 268
911 3300006186 Ga0075369_10006778 Ga0075369_100067786 268
912 3300006186 Ga0075369_10044423 Ga0075369_100444232 268
913 3300006195 Ga0075366_10047182 Ga0075366_100471822 268
914 3300009098 Ga0105245_10066293 Ga0105245_100662932 268
915 3300009551 Ga0105238_10027478 Ga0105238_100274784 268
916 3300014325 Ga0163163_10042855 Ga0163163_100428555 268
917 3300021321 Ga0214542_1000027 Ga0214542_100002770 268
918 3300021327 Ga0214543_1000047 Ga0214543_100004744 268
919 3300025258 Ga0209129_1000536 Ga0209129_100053621 268
920 3300025273 Ga0209673_1000023 Ga0209673_1000023235 268
921 3300025273 Ga0209673_1000132 Ga0209673_100013298 268
922 3300025273 Ga0209673_1002729 Ga0209673_10027293 268
923 3300025273 Ga0209673_1002876 Ga0209673_100287610 268
924 3300025284 Ga0209130_1000001 Ga0209130_1000001219 268
925 3300025291 Ga0209675_1020239 Ga0209675_10202392 268
926 3300025294 Ga0209025_1000072 Ga0209025_100007290 268
927 3300025295 Ga0209564_1000100 Ga0209564_1000100147 268
928 3300025295 Ga0209564_1001437 Ga0209564_100143719 268
929 3300025295 Ga0209564_1002441 Ga0209564_10024413 268
930 3300025297 Ga0209758_1000053 Ga0209758_1000053142 268
931 3300025297 Ga0209758_1000712 Ga0209758_100071220 268
932 3300025297 Ga0209758_1000937 Ga0209758_100093711 268
933 3300025297 Ga0209758_1004308 Ga0209758_10043083 268
934 3300025297 Ga0209758_1007213 Ga0209758_10072137 268
935 3300025299 Ga0209256_1000458 Ga0209256_100045832 268
936 3300025299 Ga0209256_1000818 Ga0209256_10008189 268
937 3300025299 Ga0209256_1002923 Ga0209256_100292313 268
938 3300025299 Ga0209256_1003989 Ga0209256_10039893 268
939 3300025302 Ga0207426_1000005 Ga0207426_1000005824 268
940 3300025302 Ga0207426_1000035 Ga0207426_1000035217 268
941 3300025303 Ga0209051_1020955 Ga0209051_10209552 268
942 3300025303 Ga0209051_1021053 Ga0209051_10210533 268
943 3300025303 Ga0209051_1025528 Ga0209051_10255282 268
944 3300025912 Ga0207707_10021399 Ga0207707_100213992 268
945 3300025913 Ga0207695_10111937 Ga0207695_101119372 268
946 3300025913 Ga0207695_10176098 Ga0207695_101760982 268
947 3300025927 Ga0207687_10025592 Ga0207687_100255923 268
948 3300025949 Ga0207667_10082776 Ga0207667_100827763 268
949 3300026067 Ga0207678_10073345 Ga0207678_100733453 268
950 3300028794 Ga0307515_10029779 Ga0307515_100297796 268
951 3300031251 Ga0265327_10034836 Ga0265327_100348363 268
952 3300031456 Ga0307513_10040412 Ga0307513_100404125 268
953 3300037312 Ga0395899_0002226 Ga0395899_0002226_3289_4167 268
954 3300037418 Ga0395900_0016936 Ga0395900_0016936_1449_2327 268
955 3300037471 Ga0395905_0010004 Ga0395905_0010004_2610_3488 268
956 3300037853 Ga0436364_0074250 Ga0436364_0074250_6434_7300 268
957 3300038443 Ga0395901_0298144 Ga0395901_0298144_83_961 268
958 3300041410 Ga0439461_0001099 Ga0439461_0001099_1034_1885 268
959 3300041413 Ga0439465_0000331 Ga0439465_0000331_5702_6553 268
960 3300041997 Ga0439431_0004392 Ga0439431_0004392_718_1569 268
961 3300042002 Ga0439442_001856 Ga0439442_001856_156_1007 268
962 3300042004 Ga0439445_0000671 Ga0439445_0000671_2075_2926 268
963 3300042006 Ga0439432_000185 Ga0439432_000185_4567_5418 268
964 3300042007 Ga0439449_0013823 Ga0439449_0013823_962_1819 268
965 3300042010 Ga0439452_031698 Ga0439452_031698_199_1050 268
966 3300042015 Ga0439462_0005489 Ga0439462_0005489_1189_2040 268
967 3300042435 Ga0439434_0000905 Ga0439434_0000905_6299_7150 268
968 3300046459 Ga0495629_0022804 Ga0495629_0022804_2671_3528 268
969 3300046476 Ga0495662_0015511 Ga0495662_0015511_911_1768 268
970 3300046522 Ga0495643_0016075 Ga0495643_0016075_535_1392 268
971 3300046663 Ga0495635_0020442 Ga0495635_0020442_2161_3018 268
972 3300046674 Ga0495588_0022539 Ga0495588_0022539_236_1093 268
973 3300046683 Ga0495658_0177247 Ga0495658_0177247_260_1117 268
974 3300046692 Ga0495671_0071215 Ga0495671_0071215_616_1473 268
975 3300047470 Ga0495681_0035137 Ga0495681_0035137_1201_2058 268
976 3300048909 Ga0496106_0012227 Ga0496106_0012227_5179_6036 268
977 3300048915 Ga0496112_0131359 Ga0496112_0131359_629_1528 268
978 3300048925 Ga0496122_0013828 Ga0496122_0013828_6696_7553 268
979 3300048925 Ga0496122_0153458 Ga0496122_0153458_82_936 268
980 3300048926 Ga0496123_0025431 Ga0496123_0025431_3067_3921 268
981 3300048926 Ga0496123_0027291 Ga0496123_0027291_405_1262 268
982 3300048927 Ga0496124_0104233 Ga0496124_0104233_962_1819 268
983 3300048928 Ga0496125_0038861 Ga0496125_0038861_2030_2887 268
984 3300049570 Ga0501033_0126451 Ga0501033_0126451_224_1093 268
985 3300049572 Ga0501036_0033807 Ga0501036_0033807_708_1577 268
986 3300049575 Ga0501039_0037960 Ga0501039_0037960_2107_2976 268
987 3300049576 Ga0501040_0134422 Ga0501040_0134422_773_1642 268
988 3300049577 Ga0501041_0011071 Ga0501041_0011071_3684_4553 268
989 3300049578 Ga0501042_0000994 Ga0501042_0000994_773_1642 268
990 3300049579 Ga0501043_0049763 Ga0501043_0049763_2274_3131 268
991 3300049579 Ga0501043_0097190 Ga0501043_0097190_1102_1971 268
992 3300049580 Ga0501046_0002236 Ga0501046_0002236_7009_7878 268
993 3300049580 Ga0501046_0314688 Ga0501046_0314688_80_937 268
994 3300049587 Ga0501071_0000498 Ga0501071_0000498_773_1642 268
995 3300049588 Ga0501072_0026183 Ga0501072_0026183_2909_3778 268
996 3300049589 Ga0501073_0044343 Ga0501073_0044343_471_1340 268
997 3300049590 Ga0501074_0004835 Ga0501074_0004835_6523_7392 268
998 3300049591 Ga0501075_0000282 Ga0501075_0000282_26529_27398 268
999 3300049592 Ga0501076_0001466 Ga0501076_0001466_9138_10007 268
1000 3300049593 Ga0501077_0001714 Ga0501077_0001714_11623_12492 268
1001 3300049741 Ga0501079_0016612 Ga0501079_0016612_746_1615 268
1002 3300049742 Ga0501080_0048025 Ga0501080_0048025_840_1709 268
1003 3300049743 Ga0501081_0000147 Ga0501081_0000147_747_1616 268
1004 3300049744 Ga0501083_0051158 Ga0501083_0051158_1168_2025 268
1005 3300049822 Ga0501035_0038033 Ga0501035_0038033_3091_3960 268
1006 3300049824 Ga0501045_0000846 Ga0501045_0000846_10813_11682 268
1007 3300053090 Ga0500646_0051808 Ga0500646_0051808_278_1132 268
1008 3300053093 Ga0500651_0131582 Ga0500651_0131582_401_1258 268
1009 3300053107 Ga0500560_014107 Ga0500560_014107_585_1442 268
1010 3300053130 Ga0500642_0002054 Ga0500642_0002054_1804_2658 268
1011 3300053134 Ga0500658_0109323 Ga0500658_0109323_217_1071 268
1012 3300053139 Ga0500568_0008275 Ga0500568_0008275_932_1789 268
1013 3300053146 Ga0500588_0001742 Ga0500588_0001742_3198_4052 268
1014 3300053148 Ga0500590_000026 Ga0500590_000026_30522_31379 268
1015 3300053151 Ga0500604_0001996 Ga0500604_0001996_242_1096 268
1016 3300053156 Ga0500622_0002690 Ga0500622_0002690_8549_9406 268
1017 3300053160 Ga0500633_0012429 Ga0500633_0012429_225_1082 268
1018 3300054114 Ga0501084_0008285 Ga0501084_0008285_773_1642 268
1019 3300060353 Ga0501082_0002793 Ga0501082_0002793_10042_10911 268
1020 3300061734 Ga0530510_0003176 Ga0530510_0003176_667_1536 268
1021 3300001979 JGI24740J21852_10013439 JGI24740J21852_100134393 269
1022 3300003187 JGI25151J46595_10078334 JGI25151J46595_100783341 269
1023 3300003762 Ga0055542_1000406 Ga0055542_10004066 269
1024 3300003775 Ga0055524_1026599 Ga0055524_10265992 269
1025 3300003792 Ga0055540_1008653 Ga0055540_10086533 269
1026 3300003856 Ga0058692_1003904 Ga0058692_10039044 269
1027 3300003856 Ga0058692_1006922 Ga0058692_10069222 269
1028 3300005455 Ga0070663_100203964 Ga0070663_1002039642 269
1029 3300005548 Ga0070665_100012214 Ga0070665_1000122148 269
1030 3300005548 Ga0070665_100388784 Ga0070665_1003887842 269
1031 3300005578 Ga0068854_100243624 Ga0068854_1002436242 269
1032 3300006038 Ga0075365_10009120 Ga0075365_100091204 269
1033 3300006042 Ga0075368_10002017 Ga0075368_100020176 269
1034 3300006051 Ga0075364_10041976 Ga0075364_100419762 269
1035 3300006178 Ga0075367_10005310 Ga0075367_100053103 269
1036 3300006178 Ga0075367_10068887 Ga0075367_100688872 269
1037 3300006178 Ga0075367_10236798 Ga0075367_102367982 269
1038 3300006195 Ga0075366_10075960 Ga0075366_100759602 269
1039 3300006948 Ga0099826_10000070 Ga0099826_1000007024 269
1040 3300006948 Ga0099826_10004568 Ga0099826_1000456810 269
1041 3300013100 Ga0157373_10008462 Ga0157373_100084625 269
1042 3300013102 Ga0157371_10000200 Ga0157371_1000020058 269
1043 3300013104 Ga0157370_10000090 Ga0157370_10000090113 269
1044 3300013104 Ga0157370_10188324 Ga0157370_101883242 269
1045 3300013105 Ga0157369_10083569 Ga0157369_100835694 269
1046 3300015684 Ga0183365_10468 Ga0183365_104682 269
1047 3300015690 Ga0183363_1056 Ga0183363_105626 269
1048 3300021320 Ga0214544_1000123 Ga0214544_100012333 269
1049 3300021321 Ga0214542_1000141 Ga0214542_100014166 269
1050 3300021327 Ga0214543_1000026 Ga0214543_1000026167 269
1051 3300025254 Ga0209148_1000181 Ga0209148_100018147 269
1052 3300025272 Ga0209455_1000127 Ga0209455_100012747 269
1053 3300025292 Ga0209676_1000666 Ga0209676_100066612 269
1054 3300025292 Ga0209676_1002188 Ga0209676_10021883 269
1055 3300025294 Ga0209025_1000593 Ga0209025_100059353 269
1056 3300025294 Ga0209025_1005657 Ga0209025_100565712 269
1057 3300025299 Ga0209256_1002209 Ga0209256_10022093 269
1058 3300025904 Ga0207647_10209785 Ga0207647_102097852 269
1059 3300025919 Ga0207657_10133893 Ga0207657_101338932 269
1060 3300026041 Ga0207639_10240659 Ga0207639_102406592 269
1061 3300026116 Ga0207674_10165747 Ga0207674_101657472 269
1062 3300026142 Ga0207698_10174810 Ga0207698_101748102 269
1063 3300027312 Ga0209371_1000009 Ga0209371_1000009212 269
1064 3300027312 Ga0209371_1014017 Ga0209371_10140171 269
1065 3300027666 Ga0209282_1000143 Ga0209282_100014330 269
1066 3300027666 Ga0209282_1089835 Ga0209282_10898351 269
1067 3300027866 Ga0209813_10057344 Ga0209813_100573442 269
1068 3300028379 Ga0268266_10035496 Ga0268266_100354964 269
1069 3300030500 Ga0268256_1000010 Ga0268256_1000010211 269
1070 3300030500 Ga0268256_1014365 Ga0268256_10143652 269
1071 3300031995 Ga0307409_100424024 Ga0307409_1004240242 269
1072 3300046453 Ga0495627_040982 Ga0495627_040982_302_1159 269
1073 3300046558 Ga0495633_0049396 Ga0495633_0049396_38_895 269
1074 3300046660 Ga0495625_0083634 Ga0495625_0083634_853_1704 269
1075 3300046674 Ga0495588_0223814 Ga0495588_0223814_107_964 269
1076 3300048916 Ga0496113_0046156 Ga0496113_0046156_893_1750 269
1077 3300048920 Ga0496117_0000002 Ga0496117_0000002_1744125_1744982 269
1078 3300048921 Ga0496118_0002809 Ga0496118_0002809_2281_3138 269
1079 3300048922 Ga0496119_0016100 Ga0496119_0016100_2673_3530 269
1080 3300048923 Ga0496120_0003418 Ga0496120_0003418_11683_12540 269
1081 3300048923 Ga0496120_0028404 Ga0496120_0028404_817_1668 269
1082 3300048925 Ga0496122_0000001 Ga0496122_0000001_1114915_1115772 269
1083 3300048925 Ga0496122_0013033 Ga0496122_0013033_2202_3059 269
1084 3300048925 Ga0496122_0088340 Ga0496122_0088340_1140_1997 269
1085 3300048926 Ga0496123_0000001 Ga0496123_0000001_1118646_1119503 269
1086 3300048926 Ga0496123_0045179 Ga0496123_0045179_879_1736 269
1087 3300048928 Ga0496125_0033579 Ga0496125_0033579_3175_4032 269
1088 3300049568 Ga0501031_0033507 Ga0501031_0033507_2428_3288 269
1089 3300049569 Ga0501032_0001269 Ga0501032_0001269_12168_13028 269
1090 3300049569 Ga0501032_0086516 Ga0501032_0086516_540_1403 269
1091 3300049570 Ga0501033_0000318 Ga0501033_0000318_22099_22959 269
1092 3300049571 Ga0501034_0081106 Ga0501034_0081106_2118_2981 269
1093 3300049571 Ga0501034_0553025 Ga0501034_0553025_115_975 269
1094 3300049573 Ga0501037_0000136 Ga0501037_0000136_47496_48356 269
1095 3300049574 Ga0501038_0128496 Ga0501038_0128496_445_1308 269
1096 3300049574 Ga0501038_0129095 Ga0501038_0129095_549_1409 269
1097 3300049575 Ga0501039_0009703 Ga0501039_0009703_4149_5012 269
1098 3300049575 Ga0501039_0421288 Ga0501039_0421288_74_934 269
1099 3300049576 Ga0501040_0059833 Ga0501040_0059833_979_1842 269
1100 3300049577 Ga0501041_0106441 Ga0501041_0106441_141_1004 269
1101 3300049578 Ga0501042_0012081 Ga0501042_0012081_4000_4863 269
1102 3300049579 Ga0501043_0000006 Ga0501043_0000006_72052_72912 269
1103 3300049579 Ga0501043_0074808 Ga0501043_0074808_1249_2130 269
1104 3300049580 Ga0501046_0005715 Ga0501046_0005715_2361_3224 269
1105 3300049581 Ga0501047_0006051 Ga0501047_0006051_6304_7164 269
1106 3300049582 Ga0501048_0055868 Ga0501048_0055868_1359_2222 269
1107 3300049582 Ga0501048_0362041 Ga0501048_0362041_69_935 269
1108 3300049584 Ga0501068_0336219 Ga0501068_0336219_36_896 269
1109 3300049585 Ga0501069_0000024 Ga0501069_0000024_46574_47434 269
1110 3300049585 Ga0501069_0007683 Ga0501069_0007683_4178_5038 269
1111 3300049586 Ga0501070_0000093 Ga0501070_0000093_27374_28234 269
1112 3300049586 Ga0501070_0001707 Ga0501070_0001707_12791_13651 269
1113 3300049586 Ga0501070_0046834 Ga0501070_0046834_525_1376 269
1114 3300049587 Ga0501071_0019437 Ga0501071_0019437_3075_3938 269
1115 3300049587 Ga0501071_0161800 Ga0501071_0161800_130_990 269
1116 3300049589 Ga0501073_0046579 Ga0501073_0046579_387_1247 269
1117 3300049589 Ga0501073_0235412 Ga0501073_0235412_127_987 269
1118 3300049590 Ga0501074_0001523 Ga0501074_0001523_13763_14623 269
1119 3300049590 Ga0501074_0004462 Ga0501074_0004462_2512_3375 269
1120 3300049591 Ga0501075_0044949 Ga0501075_0044949_1632_2495 269
1121 3300049592 Ga0501076_0060257 Ga0501076_0060257_716_1579 269
1122 3300049593 Ga0501077_0020704 Ga0501077_0020704_2318_3181 269
1123 3300049741 Ga0501079_0003632 Ga0501079_0003632_1224_2087 269
1124 3300049741 Ga0501079_0117239 Ga0501079_0117239_197_1057 269
1125 3300049742 Ga0501080_0005371 Ga0501080_0005371_8221_9081 269
1126 3300049742 Ga0501080_0031943 Ga0501080_0031943_3444_4307 269
1127 3300049742 Ga0501080_0196357 Ga0501080_0196357_63_923 269
1128 3300049743 Ga0501081_0002678 Ga0501081_0002678_10173_11036 269
1129 3300049744 Ga0501083_0000097 Ga0501083_0000097_21100_21960 269
1130 3300049822 Ga0501035_0000068 Ga0501035_0000068_79271_80131 269
1131 3300049822 Ga0501035_0022486 Ga0501035_0022486_1082_1942 269
1132 3300049822 Ga0501035_0107130 Ga0501035_0107130_1211_2071 269
1133 3300049823 Ga0501044_0000096 Ga0501044_0000096_62099_62959 269
1134 3300049823 Ga0501044_0002553 Ga0501044_0002553_13175_14035 269
1135 3300049823 Ga0501044_0019940 Ga0501044_0019940_4487_5368 269
1136 3300049824 Ga0501045_0015524 Ga0501045_0015524_3136_3999 269
1137 3300050491 nmdc:mga00v17_532_c1 nmdc:mga00v17_532_c1_10779_11636 269
1138 3300050491 nmdc:mga00v17_64067_c1 nmdc:mga00v17_64067_c1_892_1749 269
1139 3300050492 nmdc:mga0yw44_5021_c1 nmdc:mga0yw44_5021_c1_909_1766 269
1140 3300050492 nmdc:mga0yw44_5970_c1 nmdc:mga0yw44_5970_c1_2044_2895 269
1141 3300050493 nmdc:mga0k408_158631_c1 nmdc:mga0k408_158631_c1_204_1061 269
1142 3300050493 nmdc:mga0k408_201700_c1 nmdc:mga0k408_201700_c1_109_960 269
1143 3300050494 nmdc:mga06z11_79050_c1 nmdc:mga06z11_79050_c1_284_1135 269
1144 3300050496 nmdc:mga07m45_25346_c1 nmdc:mga07m45_25346_c1_416_1267 269
1145 3300050516 nmdc:mga0sz30_368_c1 nmdc:mga0sz30_368_c1_15237_16094 269
1146 3300053111 Ga0500572_005128 Ga0500572_005128_1103_2014 269
1147 3300053137 Ga0500561_0000035 Ga0500561_0000035_10780_11637 269
1148 3300053151 Ga0500604_0086449 Ga0500604_0086449_145_996 269
1149 3300053157 Ga0500624_001616 Ga0500624_001616_511_1368 269
1150 3300053158 Ga0500627_0084793 Ga0500627_0084793_310_1161 269
1151 3300053177 Ga0500636_0000149 Ga0500636_0000149_12390_13247 269
1152 3300053177 Ga0500636_0005980 Ga0500636_0005980_3953_4810 269
1153 3300053727 Ga0500611_004761 Ga0500611_004761_718_1569 269
1154 3300060353 Ga0501082_0021564 Ga0501082_0021564_2303_3163 269
1155 3300060353 Ga0501082_0058908 Ga0501082_0058908_1128_1991 269
1156 3300061734 Ga0530510_0018557 Ga0530510_0018557_3375_4238 269
1157 iso_pu_bacteria 2503198000 2503200143 269
1158 iso_pu_bacteria 2643221595 2643986457 269
1159 iso_pu_bacteria 2643221627 2644152689 269
1160 iso_pu_bacteria 2738543032 2739354186 269
1161 iso_pu_bacteria 2844002411 2844005008 269
1162 iso_pu_bacteria 2906378014 2906381075 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

127

329

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7858 21 260
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7763 19 261
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.7751 19 260
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7624 21 260
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.7452 19 260
ID Description Score Start End Superfamily
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8467 23 266 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8442 24 264 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8276 24 269 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8101 24 264 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8095 61 264 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2A5K5L0-F1-model_v4 deleted 0.8826 43 269
AF-A0A0A6ZEM7-F1-model_v4 Sulfate transport system permease protein CysT 0.8778 30 266 GO:0005886
GO:0015419
GO:0031969
AF-A0A081GN24-F1-model_v4 Sulfate transport system permease protein CysT 0.8766 27 269 GO:0005886
GO:0015419
AF-A0A0J6LE06-F1-model_v4 Sulfate transport system permease protein CysT 0.875 30 268 GO:0005886
GO:0015419
AF-A0A109K1T2-F1-model_v4 Sulfate transport system permease protein CysT 0.872 26 269 GO:0005886
GO:0015419

Feature Viewer

pLDDT pTM Quality
80.18 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map