F490980

General Info

Members Datasets Scaffolds Average Seq Length
1159 478 1098 214

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10745246|Ga0207712_107452461
Length 249
Sequence MKPRYRPARRKRSANACRPFSPAAKYSAVDVFSRIAAIRFLRNSTSSRCSGPEGTYVNLGIGLPTLIGNHLPKDRDIFLHSENGILGLGPAPAKGAEDEDLINAGKQPVTLLTGGAYFHHGDSFAMMRGGHLDICVLGAFQVSAEGDLANWHTGEPDAIPAVGGAMDLAIGARQVFIMMEHVTKAGEPKIVARCTYPLTAMHCVDRIYTDLAVIDVTDRGLKVVEMVDGMQLDELQRLTGAPLALKGER

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
8 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
9 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
12 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
13 2643221546 Microbacterium sp. Root53 Isolate Unclassified
14 2643221569 Achromobacter sp. Root565 Isolate Unclassified
15 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
16 2643221621 Achromobacter sp. Root83 Isolate Unclassified
17 2643221660 Methylibium sp. Root1272 Isolate Unclassified
18 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
19 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
20 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
21 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
22 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
23 2738541280 Massilia sp. GV090 Isolate Unclassified
24 2738541300 Massilia sp. GV016 Isolate Unclassified
25 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
26 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
27 2738543018 Massilia sp. GV045 Isolate Unclassified
28 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
29 2738543030 Massilia sp. GV097 Isolate Unclassified
30 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
31 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
32 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
33 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
34 2842733646 Variovorax sp. R-72446 Isolate Unclassified
35 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
36 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
37 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
38 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
39 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
40 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
41 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
42 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
43 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
44 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
45 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
46 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
47 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
48 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
49 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
50 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
64 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
71 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
76 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
84 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
85 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
94 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
95 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
96 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
97 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
98 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
99 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
100 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
103 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
106 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
143 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
147 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
148 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
149 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
150 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
155 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
169 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
174 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
175 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
176 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
189 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
196 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
197 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
271 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
274 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
278 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
279 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
287 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
288 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
289 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
294 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
295 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
296 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
297 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
308 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
309 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
310 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
311 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
312 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
313 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
314 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
320 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
332 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
368 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
372 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
376 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
395 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
396 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
397 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
398 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
399 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
400 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
434 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
441 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
442 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
456 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
457 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
458 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
463 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
464 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
465 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
466 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
467 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
468 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
469 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
470 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
471 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
477 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
478 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 0.78
Isolates 5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0.35
Rhizoplane 3.97
Rhizosphere 74.46
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1767 2124908027 Bacteria 19337
2 MRS2a_Contig_1768 2124908027 Bacteria 8639
3 MRS2a_Contig_70 2124908027 Bacteria 29249
4 JGI24739J22299_10069019 3300001989 Bacteria 1102
5 JGI24744J21845_10002945 3300002077 Bacteria 3484
6 JGI25156J39149_1009071 3300002705 Bacteria 2446
7 JGI25162J39368_1005763 3300002737 Bacteria 2315
8 JGI25154J39366_1001103 3300002738 Bacteria 10529
9 JGI25154J39366_1001202 3300002738 Bacteria 9805
10 JGI25150J39212_1002842 3300002774 Bacteria 4191
11 JGI25159J45721_1002305 3300002987 Bacteria 7342
12 JGI25151J46595_10004466 3300003187 Bacteria 7396
13 JGI25151J46595_10025792 3300003187 Bacteria 2384
14 rootH1_10018504 3300003316 Bacteria 1863
15 rootH2_10004328 3300003320 Bacteria 6862
16 rootL2_10132830 3300003322 Bacteria 1658
17 rootH1_10048604 3300003323 Bacteria 8499
18 JGI25160J50197_1001072 3300003354 Bacteria 14026
19 JGI25161J50226_1000013 3300003374 Bacteria 199086
20 Ga0055529_1002255 3300003763 Bacteria 3916
21 Ga0055526_1000344 3300003771 Bacteria 38140
22 Ga0055526_1016030 3300003771 Bacteria 2967
23 Ga0055537_1000066 3300003773 Bacteria 76478
24 Ga0055537_1000576 3300003773 Bacteria 20455
25 Ga0055537_1005089 3300003773 Bacteria 3594
26 Ga0055524_1000331 3300003775 Bacteria 43988
27 Ga0055524_1000519 3300003775 Bacteria 29658
28 Ga0055536_1001260 3300003781 Bacteria 15591
29 Ga0055534_1000031 3300003784 Bacteria 120517
30 Ga0055534_1000057 3300003784 Bacteria 85576
31 Ga0055534_1001922 3300003784 Bacteria 7652
32 Ga0055534_1011496 3300003784 Bacteria 1796
33 Ga0055528_1000069 3300003790 Bacteria 83002
34 Ga0055528_1001047 3300003790 Bacteria 18233
35 Ga0055530_10001163 3300003791 Bacteria 20390
36 Ga0055530_10002703 3300003791 Bacteria 11028
37 Ga0055530_10014555 3300003791 Bacteria 2613
38 Ga0055540_1000067 3300003792 Bacteria 122108
39 Ga0055531_10000480 3300003794 Bacteria 36934
40 Ga0058692_1000051 3300003856 Bacteria 107880
41 Ga0055543_1000239 3300004625 Bacteria 42667
42 Ga0065165_1007939 3300005262 Bacteria 5086
43 Ga0065165_1066496 3300005262 Bacteria 970
44 Ga0065165_1069390 3300005262 Bacteria 940
45 Ga0065703_1021859 3300005272 Bacteria 1076
46 Ga0065714_10000917 3300005288 Bacteria 19048
47 Ga0065704_10004515 3300005289 Bacteria 3336
48 Ga0065704_10011001 3300005289 Bacteria 2008
49 Ga0065704_10011853 3300005289 Bacteria 2170
50 Ga0065704_10013108 3300005289 Bacteria 3582
51 Ga0065704_10111899 3300005289 Bacteria 1929
52 Ga0065704_10118072 3300005289 Bacteria 1821
53 Ga0065704_10121111 3300005289 Bacteria 1766
54 Ga0065704_10371111 3300005289 Bacteria 785
55 Ga0065707_10021373 3300005295 Bacteria 1878
56 Ga0070658_10000050 3300005327 Bacteria 119052
57 Ga0070676_10015306 3300005328 Bacteria 4231
58 Ga0070676_10115083 3300005328 Bacteria 1680
59 Ga0070683_100195024 3300005329 Bacteria 1923
60 Ga0070690_100344715 3300005330 Bacteria 1080
61 Ga0070670_100063805 3300005331 Bacteria 3161
62 Ga0070670_100065195 3300005331 Bacteria 3125
63 Ga0070670_100236638 3300005331 Bacteria 1590
64 Ga0070670_100429365 3300005331 Bacteria 1169
65 Ga0068869_100098293 3300005334 Bacteria 2211
66 Ga0070666_10022663 3300005335 Bacteria 4080
67 Ga0070682_100010437 3300005337 Bacteria 5271
68 Ga0068868_100041322 3300005338 Bacteria 3592
69 Ga0068868_100394124 3300005338 Bacteria 1194
70 Ga0070660_100039316 3300005339 Bacteria 3595
71 Ga0070660_100115496 3300005339 Bacteria 2139
72 Ga0070689_100069857 3300005340 Bacteria 2741
73 Ga0070691_10002978 3300005341 Bacteria 7581
74 Ga0070661_100093040 3300005344 Bacteria 2234
75 Ga0070692_10220545 3300005345 Bacteria 1121
76 Ga0070668_100001214 3300005347 Bacteria 18317
77 Ga0070668_100008872 3300005347 Bacteria 7465
78 Ga0070669_100260598 3300005353 Bacteria 1383
79 Ga0070669_100378931 3300005353 Bacteria 1153
80 Ga0070675_100131608 3300005354 Bacteria 2132
81 Ga0070675_100311297 3300005354 Bacteria 1389
82 Ga0070671_100097719 3300005355 Bacteria 2462
83 Ga0070671_100339872 3300005355 Bacteria 1280
84 Ga0070688_100010538 3300005365 Bacteria 5102
85 Ga0070688_100115903 3300005365 Bacteria 1788
86 Ga0070688_100145208 3300005365 Bacteria 1616
87 Ga0070667_100012675 3300005367 Bacteria 6972
88 Ga0070667_100167634 3300005367 Bacteria 1937
89 Ga0070703_10199704 3300005406 Bacteria 784
90 Ga0070709_10430341 3300005434 Bacteria 991
91 Ga0070711_100185451 3300005439 Bacteria 1595
92 Ga0070705_100074739 3300005440 Bacteria 2061
93 Ga0070708_100006204 3300005445 Bacteria 9505
94 Ga0070663_100325544 3300005455 Bacteria 1237
95 Ga0070678_100001422 3300005456 Bacteria 12742
96 Ga0070678_100004688 3300005456 Bacteria 7782
97 Ga0070678_100065700 3300005456 Bacteria 2694
98 Ga0070678_100318857 3300005456 Bacteria 1327
99 Ga0070678_100488510 3300005456 Bacteria 1085
100 Ga0070678_101194587 3300005456 Bacteria 705
101 Ga0070681_10042215 3300005458 Bacteria 4571
102 Ga0068867_100000817 3300005459 Bacteria 21028
103 Ga0070698_100039235 3300005471 Bacteria 4875
104 Ga0070698_100289305 3300005471 Bacteria 1570
105 Ga0070699_100550962 3300005518 Bacteria 1050
106 Ga0070679_100007035 3300005530 Bacteria 10491
107 Ga0068853_100322409 3300005539 Bacteria 1432
108 Ga0068853_100616769 3300005539 Bacteria 1031
109 Ga0070672_100050901 3300005543 Bacteria 3228
110 Ga0070672_100092311 3300005543 Bacteria 2444
111 Ga0070695_100341583 3300005545 Bacteria 1119
112 Ga0070696_100308250 3300005546 Bacteria 1215
113 Ga0070693_100001130 3300005547 Bacteria 11958
114 Ga0070665_100092762 3300005548 Bacteria 3024
115 Ga0070665_100165919 3300005548 Bacteria 2211
116 Ga0070704_100001833 3300005549 Bacteria 11711
117 Ga0070704_100018375 3300005549 Bacteria 4470
118 Ga0070704_100541400 3300005549 Bacteria 1016
119 Ga0068855_100002023 3300005563 Bacteria 25157
120 Ga0068857_100037080 3300005577 Bacteria 4318
121 Ga0068856_100001944 3300005614 Bacteria 21515
122 Ga0068852_100007122 3300005616 Bacteria 8147
123 Ga0068852_100335770 3300005616 Bacteria 1472
124 Ga0068859_100000102 3300005617 Bacteria 79658
125 Ga0068859_100157686 3300005617 Bacteria 2348
126 Ga0068859_100537833 3300005617 Bacteria 1263
127 Ga0068864_100022445 3300005618 Bacteria 5292
128 Ga0068864_100948490 3300005618 Bacteria 851
129 Ga0068861_100002978 3300005719 Bacteria 11173
130 Ga0068861_100049115 3300005719 Bacteria 3193
131 Ga0068861_100187120 3300005719 Bacteria 1728
132 Ga0068851_10003029 3300005834 Bacteria 7426
133 Ga0068851_10107724 3300005834 Bacteria 1485
134 Ga0068870_10004266 3300005840 Bacteria 6145
135 Ga0068870_10368464 3300005840 Bacteria 926
136 Ga0068863_100002676 3300005841 Bacteria 17618
137 Ga0068863_100002708 3300005841 Bacteria 17501
138 Ga0068863_100271929 3300005841 Bacteria 1640
139 Ga0068858_100005282 3300005842 Bacteria 12658
140 Ga0068858_100214049 3300005842 Bacteria 1824
141 Ga0068860_100011245 3300005843 Bacteria 8820
142 Ga0068862_100000273 3300005844 Bacteria 57697
143 Ga0070717_10055546 3300006028 Bacteria 3268
144 Ga0075365_10001342 3300006038 Bacteria 11024
145 Ga0075365_10068681 3300006038 Bacteria 2381
146 Ga0075365_10156649 3300006038 Bacteria 1585
147 Ga0075365_10176804 3300006038 Bacteria 1491
148 Ga0075368_10012672 3300006042 Bacteria 3088
149 Ga0075368_10019966 3300006042 Bacteria 2533
150 Ga0075363_100019977 3300006048 Bacteria 3355
151 Ga0075364_10027807 3300006051 Bacteria 3616
152 Ga0075364_10115864 3300006051 Bacteria 1791
153 Ga0075364_10126914 3300006051 Bacteria 1711
154 Ga0075364_10268827 3300006051 Bacteria 1159
155 Ga0075364_10293033 3300006051 Bacteria 1107
156 Ga0075362_10067403 3300006177 Bacteria 1628
157 Ga0075362_10089313 3300006177 Bacteria 1429
158 Ga0075367_10070788 3300006178 Bacteria 2097
159 Ga0075369_10153111 3300006186 Bacteria 1055
160 Ga0075366_10119074 3300006195 Bacteria 1591
161 Ga0097621_100069994 3300006237 Bacteria 2897
162 Ga0075370_10020335 3300006353 Bacteria 3626
163 Ga0075370_10041784 3300006353 Bacteria 2589
164 Ga0068871_100000429 3300006358 Bacteria 28894
165 Ga0068871_100083858 3300006358 Bacteria 2644
166 Ga0068871_100173275 3300006358 Bacteria 1851
167 Ga0075428_100128714 3300006844 Bacteria 2754
168 Ga0075428_100357960 3300006844 Bacteria 1566
169 Ga0075431_100018399 3300006847 Bacteria 7114
170 Ga0075431_100032618 3300006847 Bacteria 5367
171 Ga0075431_100143311 3300006847 Bacteria 2462
172 Ga0075433_10030675 3300006852 Bacteria 4589
173 Ga0075433_10839414 3300006852 Bacteria 802
174 Ga0075434_100002700 3300006871 Bacteria 15678
175 Ga0075434_100363056 3300006871 Bacteria 1469
176 Ga0075429_100010239 3300006880 Bacteria 8118
177 Ga0068865_100439506 3300006881 Bacteria 1076
178 Ga0075436_100001293 3300006914 Bacteria 17017
179 Ga0097620_100000102 3300006931 Bacteria 79658
180 Ga0097620_100157690 3300006931 Bacteria 2348
181 Ga0097620_100537858 3300006931 Bacteria 1263
182 Ga0075435_100262392 3300007076 Bacteria 1472
183 Ga0105251_10015911 3300009011 Bacteria 4090
184 Ga0105251_10094477 3300009011 Bacteria 1371
185 Ga0105244_10014391 3300009036 Bacteria 4576
186 Ga0105244_10018048 3300009036 Bacteria 3971
187 Ga0105244_10019613 3300009036 Bacteria 3770
188 Ga0105244_10020545 3300009036 Bacteria 3666
189 Ga0105244_10071203 3300009036 Bacteria 1734
190 Ga0105244_10102481 3300009036 Bacteria 1399
191 Ga0105250_10046744 3300009092 Bacteria 1735
192 Ga0105250_10074614 3300009092 Bacteria 1372
193 Ga0105240_10002032 3300009093 Bacteria 33348
194 Ga0105240_10005710 3300009093 Bacteria 18461
195 Ga0111539_10000829 3300009094 Bacteria 40191
196 Ga0111539_10073415 3300009094 Bacteria 4034
197 Ga0111539_10078552 3300009094 Bacteria 3882
198 Ga0111539_10316784 3300009094 Bacteria 1815
199 Ga0105247_10013390 3300009101 Bacteria 4920
200 Ga0105247_10085341 3300009101 Bacteria 1996
201 Ga0105247_10086811 3300009101 Bacteria 1980
202 Ga0114129_10024326 3300009147 Bacteria 8582
203 Ga0105243_10000614 3300009148 Bacteria 35544
204 Ga0105243_10000650 3300009148 Bacteria 34412
205 Ga0105243_10036361 3300009148 Bacteria 3823
206 Ga0105241_10002429 3300009174 Bacteria 13980
207 Ga0105248_10000324 3300009177 Bacteria 56570
208 Ga0105248_10000710 3300009177 Bacteria 37689
209 Ga0105248_10054071 3300009177 Bacteria 4503
210 Ga0105248_10116926 3300009177 Bacteria 3007
211 Ga0105237_10028563 3300009545 Bacteria 5680
212 Ga0105237_10052722 3300009545 Bacteria 4082
213 Ga0105237_10054710 3300009545 Bacteria 3999
214 Ga0105238_10044844 3300009551 Bacteria 4469
215 Ga0105238_10113261 3300009551 Bacteria 2692
216 Ga0105249_10000320 3300009553 Bacteria 48700
217 Ga0105249_10014726 3300009553 Bacteria 6913
218 Ga0105249_10251057 3300009553 Bacteria 1754
219 Ga0105249_10347070 3300009553 Bacteria 1503
220 Ga0105239_10005669 3300010375 Bacteria 14587
221 Ga0105239_10057759 3300010375 Bacteria 4257
222 Ga0105246_10006706 3300011119 Bacteria 7038
223 Ga0105246_10086329 3300011119 Bacteria 2249
224 Ga0105246_10107020 3300011119 Bacteria 2047
225 Ga0157373_10143778 3300013100 Bacteria 1677
226 Ga0157373_10144608 3300013100 Bacteria 1672
227 Ga0157371_10000337 3300013102 Bacteria 60433
228 Ga0157371_10002500 3300013102 Bacteria 17479
229 Ga0157371_10293702 3300013102 Bacteria 1175
230 Ga0157371_10506495 3300013102 Bacteria 892
231 Ga0157370_10005499 3300013104 Bacteria 14203
232 Ga0157370_10028779 3300013104 Bacteria 5462
233 Ga0157370_10060408 3300013104 Bacteria 3599
234 Ga0157370_10182582 3300013104 Bacteria 1949
235 Ga0157369_10000342 3300013105 Bacteria 61773
236 Ga0157374_10139663 3300013296 Bacteria 2351
237 Ga0157378_11237764 3300013297 Bacteria 786
238 Ga0163162_10149149 3300013306 Bacteria 2455
239 Ga0157375_10027645 3300013308 Bacteria 5306
240 Ga0157375_10146387 3300013308 Bacteria 2493
241 Ga0163163_10446789 3300014325 Bacteria 1353
242 Ga0157380_10505032 3300014326 Bacteria 1175
243 Ga0157380_10742090 3300014326 Bacteria 992
244 Ga0182008_10000115 3300014497 Bacteria 61294
245 Ga0182008_10000708 3300014497 Bacteria 23865
246 Ga0182008_10130397 3300014497 Bacteria 1253
247 Ga0157379_10004351 3300014968 Bacteria 12112
248 Ga0157379_10009608 3300014968 Bacteria 8424
249 Ga0157376_10278571 3300014969 Bacteria 1574
250 Ga0182007_10000103 3300015262 Bacteria 59975
251 Ga0182007_10120962 3300015262 Bacteria 876
252 Ga0163161_10002266 3300017792 Bacteria 13796
253 Ga0163161_10008437 3300017792 Bacteria 7133
254 Ga0163161_10014688 3300017792 Bacteria 5453
255 Ga0163161_10030084 3300017792 Bacteria 3862
256 Ga0163161_10041540 3300017792 Bacteria 3304
257 Ga0163161_10209787 3300017792 Bacteria 1504
258 Ga0163161_10379015 3300017792 Bacteria 1130
259 Ga0197907_10974739 3300020069 Bacteria 1654
260 Ga0206356_10543351 3300020070 Bacteria 4078
261 Ga0206354_10161263 3300020081 Bacteria 1535
262 Ga0209435_100067 3300025206 Bacteria 66388
263 Ga0209672_103863 3300025228 Bacteria 2955
264 Ga0209437_100566 3300025233 Bacteria 24156
265 Ga0209258_106772 3300025242 Bacteria 1759
266 Ga0207425_1001894 3300025245 Bacteria 7975
267 Ga0209646_1000023 3300025246 Bacteria 441100
268 Ga0209646_1000061 3300025246 Bacteria 255495
269 Ga0209026_1000754 3300025250 Bacteria 18343
270 Ga0209759_1000209 3300025256 Bacteria 90642
271 Ga0209129_1008654 3300025258 Bacteria 2798
272 Ga0209565_1000006 3300025263 Bacteria 897294
273 Ga0209565_1000072 3300025263 Bacteria 164988
274 Ga0209565_1000111 3300025263 Bacteria 117862
275 Ga0209565_1004904 3300025263 Bacteria 3989
276 Ga0209455_1002615 3300025272 Bacteria 6843
277 Ga0209673_1000004 3300025273 Bacteria 896155
278 Ga0209673_1000012 3300025273 Bacteria 579480
279 Ga0209130_1000095 3300025284 Bacteria 145126
280 Ga0209130_1001113 3300025284 Bacteria 19768
281 Ga0209675_1000006 3300025291 Bacteria 732267
282 Ga0209675_1000049 3300025291 Bacteria 215042
283 Ga0209675_1000373 3300025291 Bacteria 38099
284 Ga0209675_1004344 3300025291 Bacteria 6347
285 Ga0209676_1000145 3300025292 Bacteria 174391
286 Ga0209676_1007092 3300025292 Bacteria 5363
287 Ga0209676_1018411 3300025292 Bacteria 2437
288 Ga0209025_1001400 3300025294 Bacteria 32034
289 Ga0209025_1003004 3300025294 Bacteria 16678
290 Ga0209025_1013182 3300025294 Bacteria 5219
291 Ga0209564_1000102 3300025295 Bacteria 222597
292 Ga0209564_1000130 3300025295 Bacteria 194399
293 Ga0209564_1002035 3300025295 Bacteria 17497
294 Ga0209564_1005377 3300025295 Bacteria 7341
295 Ga0209564_1021069 3300025295 Bacteria 2361
296 Ga0209758_1023004 3300025297 Bacteria 2834
297 Ga0209050_1000023 3300025298 Bacteria 537172
298 Ga0209050_1000192 3300025298 Bacteria 138262
299 Ga0209050_1012100 3300025298 Bacteria 4002
300 Ga0209256_1000003 3300025299 Bacteria 1661127
301 Ga0209256_1000037 3300025299 Bacteria 377661
302 Ga0209256_1000126 3300025299 Bacteria 165242
303 Ga0207426_1001496 3300025302 Bacteria 19140
304 Ga0207426_1004536 3300025302 Bacteria 6717
305 Ga0209051_1000017 3300025303 Bacteria 537172
306 Ga0209051_1031038 3300025303 Bacteria 2063
307 Ga0209257_1000041 3300025304 Bacteria 537172
308 Ga0207697_10012975 3300025315 Bacteria 3482
309 Ga0207656_10095323 3300025321 Bacteria 1356
310 Ga0207696_1006016 3300025711 Bacteria 4952
311 Ga0207696_1009865 3300025711 Bacteria 3536
312 Ga0207696_1013069 3300025711 Bacteria 2910
313 Ga0207696_1041747 3300025711 Bacteria 1339
314 Ga0207655_1000575 3300025728 Bacteria 45532
315 Ga0207655_1000626 3300025728 Bacteria 42454
316 Ga0207655_1000627 3300025728 Bacteria 42405
317 Ga0207655_1007194 3300025728 Bacteria 7257
318 Ga0207655_1007198 3300025728 Bacteria 7256
319 Ga0207655_1007651 3300025728 Bacteria 6974
320 Ga0207655_1023080 3300025728 Bacteria 3097
321 Ga0207713_1000501 3300025735 Bacteria 40333
322 Ga0207713_1002798 3300025735 Bacteria 12315
323 Ga0207713_1008316 3300025735 Bacteria 5991
324 Ga0207713_1024683 3300025735 Bacteria 2796
325 Ga0207713_1035512 3300025735 Bacteria 2151
326 Ga0207682_10241509 3300025893 Bacteria 839
327 Ga0207642_10180201 3300025899 Bacteria 1151
328 Ga0207710_10019305 3300025900 Bacteria 2908
329 Ga0207710_10039916 3300025900 Bacteria 2079
330 Ga0207710_10044374 3300025900 Bacteria 1979
331 Ga0207688_10001145 3300025901 Bacteria 13661
332 Ga0207680_10107661 3300025903 Bacteria 1802
333 Ga0207647_10004470 3300025904 Bacteria 10362
334 Ga0207645_10000039 3300025907 Bacteria 88205
335 Ga0207645_10012427 3300025907 Bacteria 5774
336 Ga0207705_10000014 3300025909 Bacteria 434286
337 Ga0207705_10009139 3300025909 Bacteria 7224
338 Ga0207705_10017949 3300025909 Bacteria 5061
339 Ga0207705_10267779 3300025909 Bacteria 1306
340 Ga0207705_10540780 3300025909 Bacteria 906
341 Ga0207707_10346576 3300025912 Bacteria 1280
342 Ga0207707_10680289 3300025912 Bacteria 865
343 Ga0207695_10004527 3300025913 Bacteria 18917
344 Ga0207695_10087242 3300025913 Bacteria 3143
345 Ga0207695_10540200 3300025913 Bacteria 1047
346 Ga0207671_10021108 3300025914 Bacteria 4946
347 Ga0207671_10037527 3300025914 Bacteria 3593
348 Ga0207663_10085290 3300025916 Bacteria 2079
349 Ga0207662_10452809 3300025918 Bacteria 878
350 Ga0207657_10062715 3300025919 Bacteria 3181
351 Ga0207657_10083840 3300025919 Bacteria 2673
352 Ga0207652_10008612 3300025921 Bacteria 8207
353 Ga0207646_10140866 3300025922 Bacteria 2172
354 Ga0207681_10001411 3300025923 Bacteria 15520
355 Ga0207681_10010671 3300025923 Bacteria 5636
356 Ga0207681_10275103 3300025923 Bacteria 1323
357 Ga0207694_10029537 3300025924 Bacteria 4184
358 Ga0207650_10007054 3300025925 Bacteria 7660
359 Ga0207650_10048331 3300025925 Bacteria 3138
360 Ga0207650_10081382 3300025925 Bacteria 2457
361 Ga0207650_10213371 3300025925 Bacteria 1551
362 Ga0207659_10000981 3300025926 Bacteria 17029
363 Ga0207659_10089628 3300025926 Bacteria 2294
364 Ga0207644_10021202 3300025931 Bacteria 4424
365 Ga0207644_10136038 3300025931 Bacteria 1887
366 Ga0207644_10707161 3300025931 Bacteria 840
367 Ga0207690_10026037 3300025932 Bacteria 3682
368 Ga0207706_10047717 3300025933 Bacteria 3789
369 Ga0207709_10000001 3300025935 Bacteria 2228154
370 Ga0207670_10690761 3300025936 Bacteria 844
371 Ga0207691_10000027 3300025940 Bacteria 126502
372 Ga0207691_10212460 3300025940 Bacteria 1680
373 Ga0207711_10000398 3300025941 Bacteria 45914
374 Ga0207711_10001657 3300025941 Bacteria 20542
375 Ga0207711_10138236 3300025941 Bacteria 2190
376 Ga0207689_10005641 3300025942 Bacteria 11151
377 Ga0207661_10586927 3300025944 Bacteria 1022
378 Ga0207667_10000007 3300025949 Bacteria 630590
379 Ga0207667_10049806 3300025949 Bacteria 4422
380 Ga0207712_10000413 3300025961 Bacteria 36586
381 Ga0207712_10007985 3300025961 Bacteria 6690
382 Ga0207712_10312631 3300025961 Bacteria 1293
383 Ga0207712_10392759 3300025961 Bacteria 1164
384 Ga0207712_10745246 3300025961 Bacteria 858
385 Ga0207668_10001633 3300025972 Bacteria 13105
386 Ga0207668_10007857 3300025972 Bacteria 6342
387 Ga0207640_10082887 3300025981 Bacteria 2197
388 Ga0207658_10001299 3300025986 Bacteria 19720
389 Ga0207658_10010287 3300025986 Bacteria 6357
390 Ga0207677_10006642 3300026023 Bacteria 6348
391 Ga0207677_10463230 3300026023 Bacteria 1088
392 Ga0207703_10017904 3300026035 Bacteria 5532
393 Ga0207703_10214743 3300026035 Bacteria 1717
394 Ga0207639_10011964 3300026041 Bacteria 6038
395 Ga0207639_10550354 3300026041 Bacteria 1059
396 Ga0207678_10000720 3300026067 Bacteria 30194
397 Ga0207678_10095314 3300026067 Bacteria 2543
398 Ga0207678_10316580 3300026067 Bacteria 1342
399 Ga0207708_10047203 3300026075 Bacteria 3280
400 Ga0207702_10000147 3300026078 Bacteria 82633
401 Ga0207641_10004970 3300026088 Bacteria 11405
402 Ga0207641_10021577 3300026088 Bacteria 5291
403 Ga0207641_10134324 3300026088 Bacteria 2225
404 Ga0207648_10003178 3300026089 Bacteria 17305
405 Ga0207648_10826775 3300026089 Bacteria 863
406 Ga0207676_10001854 3300026095 Bacteria 15472
407 Ga0207676_10098249 3300026095 Bacteria 2420
408 Ga0207674_10030781 3300026116 Bacteria 5641
409 Ga0207674_10049037 3300026116 Bacteria 4320
410 Ga0207674_10246925 3300026116 Bacteria 1732
411 Ga0207675_100000066 3300026118 Bacteria 78979
412 Ga0207675_100139004 3300026118 Bacteria 2306
413 Ga0207675_100145269 3300026118 Bacteria 2255
414 Ga0207675_100343238 3300026118 Bacteria 1462
415 Ga0207683_10000061 3300026121 Bacteria 81399
416 Ga0207683_10001996 3300026121 Bacteria 18056
417 Ga0207683_10363649 3300026121 Bacteria 1329
418 Ga0207683_10893345 3300026121 Bacteria 825
419 Ga0207698_10701810 3300026142 Bacteria 1007
420 Ga0209371_1000008 3300027312 Bacteria 1024606
421 Ga0209813_10063468 3300027866 Bacteria 1185
422 Ga0207428_10005656 3300027907 Bacteria 11618
423 Ga0207428_10222568 3300027907 Bacteria 1414
424 Ga0268266_10026002 3300028379 Bacteria 4979
425 Ga0268266_10687949 3300028379 Bacteria 985
426 Ga0268265_10000174 3300028380 Bacteria 76817
427 Ga0268265_10353978 3300028380 Bacteria 1342
428 Ga0265318_10113080 3300028577 Bacteria 998
429 Ga0307515_10000921 3300028794 Bacteria 67536
430 Ga0307515_10419150 3300028794 Bacteria 960
431 Ga0268256_1000009 3300030500 Bacteria 1022625
432 Ga0307511_10013789 3300030521 Bacteria 7886
433 Ga0265331_10008658 3300031250 Bacteria 5767
434 Ga0265327_10008996 3300031251 Bacteria 7312
435 Ga0307513_10000113 3300031456 Bacteria 114576
436 Ga0307408_100000301 3300031548 Bacteria 47479
437 Ga0307408_100324555 3300031548 Bacteria 1298
438 Ga0307408_100533180 3300031548 Bacteria 1033
439 Ga0307408_100683939 3300031548 Bacteria 920
440 Ga0307508_10002291 3300031616 Bacteria 20329
441 Ga0265314_10064978 3300031711 Bacteria 2467
442 Ga0265314_10245137 3300031711 Bacteria 1031
443 Ga0307516_10436618 3300031730 Bacteria 966
444 Ga0307405_10376224 3300031731 Bacteria 1104
445 Ga0307410_10702481 3300031852 Bacteria 853
446 Ga0307409_100069488 3300031995 Bacteria 2791
447 Ga0307409_100965372 3300031995 Bacteria 869
448 Ga0307409_101046293 3300031995 Bacteria 836
449 Ga0307416_100181703 3300032002 Bacteria 1972
450 Ga0307416_101329606 3300032002 Bacteria 824
451 Ga0307414_10599218 3300032004 Bacteria 988
452 Ga0307415_100079860 3300032126 Bacteria 2332
453 Ga0373938_0014196 3300034957 Bacteria 1525
454 Ga0373929_0007658 3300035085 Bacteria 1976
455 Ga0373934_0065819 3300035086 Bacteria 1447
456 Ga0373949_0018127 3300035090 Bacteria 1593
457 Ga0373951_0050481 3300035091 Bacteria 1022
458 Ga0373923_0207723 3300035111 Bacteria 907
459 Ga0373932_0004781 3300035112 Bacteria 3193
460 Ga0373939_0086778 3300035114 Bacteria 1050
461 Ga0373953_0100978 3300035117 Bacteria 1214
462 Ga0373942_0089800 3300035207 Bacteria 924
463 Ga0373961_0005960 3300035241 Bacteria 2928
464 Ga0373962_0013966 3300035242 Bacteria 2041
465 Ga0373924_0004330 3300035410 Bacteria 4954
466 Ga0373931_0007152 3300035691 Bacteria 5250
467 Ga0373931_0307168 3300035691 Bacteria 981
468 Ga0373931_0432606 3300035691 Bacteria 838
469 Ga0373937_0222488 3300036401 Bacteria 1777
470 Ga0395899_0000005 3300037312 Bacteria 772966
471 Ga0395900_0000003 3300037418 Bacteria 587648
472 Ga0395900_0250548 3300037418 Bacteria 1772
473 Ga0395900_0846332 3300037418 Bacteria 840
474 Ga0395898_0000003 3300037466 Bacteria 772986
475 Ga0395905_0035594 3300037471 Bacteria 4675
476 Ga0395905_0078520 3300037471 Bacteria 3093
477 Ga0395905_0276889 3300037471 Bacteria 1564
478 Ga0395905_0297864 3300037471 Bacteria 1500
479 Ga0395905_0598951 3300037471 Bacteria 1004
480 Ga0395901_0003694 3300038443 Bacteria 15432
481 Ga0395901_0130167 3300038443 Bacteria 2644
482 Ga0395901_0189780 3300038443 Bacteria 2155
483 Ga0395901_0433511 3300038443 Bacteria 1346
484 Ga0395901_0472872 3300038443 Bacteria 1279
485 Ga0395901_0544468 3300038443 Bacteria 1177
486 Ga0436365_1617569 3300039437 Bacteria 699
487 Ga0436361_0739886 3300039447 Bacteria 1329
488 Ga0439439_0016402 3300041406 Bacteria 1814
489 Ga0439461_0041974 3300041410 Bacteria 991
490 Ga0439466_0028322 3300041411 Bacteria 1934
491 Ga0451793_1256750 3300041452 Bacteria 3375
492 Ga0451804_0767943 3300041463 Bacteria 832
493 Ga0451833_0651743 3300041491 Bacteria 1101
494 Ga0451853_3559394 3300041512 Bacteria 903
495 Ga0439448_0021716 3300042005 Bacteria 1990
496 Ga0466969_0068415 3300044656 Bacteria 1711
497 Ga0466972_0022390 3300044658 Bacteria 3148
498 Ga0466973_0010320 3300044659 Bacteria 8611
499 Ga0466965_0050893 3300044683 Bacteria 2054
500 Ga0466966_0000035 3300044684 Bacteria 98928
501 Ga0466966_0010854 3300044684 Bacteria 6050
502 Ga0466966_0068519 3300044684 Bacteria 2227
503 Ga0466966_0118480 3300044684 Bacteria 1628
504 Ga0466966_0310483 3300044684 Bacteria 948
505 Ga0466961_0000336 3300044693 Bacteria 30807
506 Ga0466961_0002332 3300044693 Bacteria 11791
507 Ga0466961_0009907 3300044693 Bacteria 6073
508 Ga0466963_0004216 3300044694 Bacteria 8337
509 Ga0466963_0006557 3300044694 Bacteria 6894
510 Ga0466963_0089659 3300044694 Bacteria 2092
511 Ga0466964_0086694 3300044706 Bacteria 1355
512 Ga0466971_0009252 3300044719 Bacteria 4305
513 Ga0466968_0037529 3300044735 Bacteria 2033
514 Ga0466968_0060109 3300044735 Bacteria 1638
515 Ga0466970_0050844 3300044765 Bacteria 2211
516 Ga0466970_0054906 3300044765 Bacteria 2127
517 Ga0466970_0117361 3300044765 Bacteria 1456
518 Ga0466957_0000649 3300044842 Bacteria 17672
519 Ga0466957_0011503 3300044842 Bacteria 5108
520 Ga0466957_0130055 3300044842 Bacteria 1612
521 Ga0466957_0302846 3300044842 Bacteria 1074
522 Ga0466959_0005789 3300045049 Bacteria 8513
523 Ga0466959_0019544 3300045049 Bacteria 4981
524 Ga0466959_0184894 3300045049 Bacteria 1456
525 Ga0451576_0134953 3300045051 Bacteria 2573
526 Ga0451576_0156905 3300045051 Bacteria 2374
527 Ga0466958_0020593 3300045836 Bacteria 3848
528 Ga0466958_0025530 3300045836 Bacteria 3484
529 Ga0466958_0039955 3300045836 Bacteria 2819
530 Ga0466958_0125049 3300045836 Bacteria 1612
531 Ga0466967_0054425 3300045976 Bacteria 3521
532 Ga0466967_0128037 3300045976 Bacteria 2354
533 Ga0466967_0588214 3300045976 Bacteria 1098
534 Ga0495617_000150 3300046452 Bacteria 44881
535 Ga0495617_000161 3300046452 Bacteria 42643
536 Ga0495617_000482 3300046452 Bacteria 21208
537 Ga0495617_053734 3300046452 Bacteria 1338
538 Ga0495627_000598 3300046453 Bacteria 28785
539 Ga0495627_006747 3300046453 Bacteria 4468
540 Ga0495627_011318 3300046453 Bacteria 3206
541 Ga0495627_014601 3300046453 Bacteria 2735
542 Ga0495627_016507 3300046453 Bacteria 2525
543 Ga0495627_030390 3300046453 Bacteria 1712
544 Ga0495603_0001565 3300046455 Bacteria 13380
545 Ga0495590_0000005 3300046457 Bacteria 384276
546 Ga0495590_0000013 3300046457 Bacteria 271977
547 Ga0495590_0001057 3300046457 Bacteria 12118
548 Ga0495591_000109 3300046458 Bacteria 94877
549 Ga0495591_062307 3300046458 Bacteria 988
550 Ga0495638_0000027 3300046460 Bacteria 337569
551 Ga0495638_0000034 3300046460 Bacteria 282038
552 Ga0495638_0002984 3300046460 Bacteria 13503
553 Ga0495638_0008497 3300046460 Bacteria 7278
554 Ga0495638_0047171 3300046460 Bacteria 2702
555 Ga0495638_0056554 3300046460 Bacteria 2434
556 Ga0495638_0081076 3300046460 Bacteria 1970
557 Ga0495651_0133033 3300046462 Bacteria 1813
558 Ga0495653_0002434 3300046463 Bacteria 14798
559 Ga0495653_0049957 3300046463 Bacteria 3218
560 Ga0495650_0000322 3300046471 Bacteria 85802
561 Ga0495650_0000653 3300046471 Bacteria 45690
562 Ga0495650_0004075 3300046471 Bacteria 10219
563 Ga0495650_0004125 3300046471 Bacteria 10121
564 Ga0495580_0034724 3300046472 Bacteria 3628
565 Ga0495605_0005435 3300046474 Bacteria 7418
566 Ga0495605_0006402 3300046474 Bacteria 6777
567 Ga0495605_0016476 3300046474 Bacteria 4000
568 Ga0495605_0031057 3300046474 Bacteria 2731
569 Ga0495605_0040684 3300046474 Bacteria 2319
570 Ga0495605_0221990 3300046474 Bacteria 816
571 Ga0495639_0113686 3300046475 Bacteria 1287
572 Ga0495639_0150653 3300046475 Bacteria 1122
573 Ga0495584_0000004 3300046491 Bacteria 314714
574 Ga0495584_0000029 3300046491 Bacteria 105850
575 Ga0495584_0000168 3300046491 Bacteria 46140
576 Ga0495584_0004385 3300046491 Bacteria 7599
577 Ga0495584_0007594 3300046491 Bacteria 5651
578 Ga0495584_0028515 3300046491 Bacteria 2829
579 Ga0495584_0108255 3300046491 Bacteria 1405
580 Ga0495585_0000746 3300046492 Bacteria 28843
581 Ga0495585_0001437 3300046492 Bacteria 18679
582 Ga0495585_0003077 3300046492 Bacteria 11468
583 Ga0495585_0008335 3300046492 Bacteria 6285
584 Ga0495585_0012851 3300046492 Bacteria 4922
585 Ga0495585_0019523 3300046492 Bacteria 3907
586 Ga0495585_0036621 3300046492 Bacteria 2765
587 Ga0495585_0044004 3300046492 Bacteria 2495
588 Ga0495585_0049484 3300046492 Bacteria 2333
589 Ga0495585_0056798 3300046492 Bacteria 2161
590 Ga0495585_0058845 3300046492 Bacteria 2119
591 Ga0495596_0000016 3300046500 Bacteria 117489
592 Ga0495596_0000508 3300046500 Bacteria 24723
593 Ga0495596_0001287 3300046500 Bacteria 14494
594 Ga0495596_0001871 3300046500 Bacteria 11673
595 Ga0495596_0008416 3300046500 Bacteria 4593
596 Ga0495596_0045209 3300046500 Bacteria 1731
597 Ga0495596_0072015 3300046500 Bacteria 1342
598 Ga0495607_0000010 3300046501 Bacteria 206525
599 Ga0495607_0002596 3300046501 Bacteria 14539
600 Ga0495607_0002953 3300046501 Bacteria 13366
601 Ga0495607_0006941 3300046501 Bacteria 7895
602 Ga0495607_0008769 3300046501 Bacteria 6888
603 Ga0495607_0026641 3300046501 Bacteria 3585
604 Ga0495607_0028658 3300046501 Bacteria 3433
605 Ga0495607_0038878 3300046501 Bacteria 2846
606 Ga0495607_0044662 3300046501 Bacteria 2611
607 Ga0495607_0046022 3300046501 Bacteria 2564
608 Ga0495607_0047554 3300046501 Bacteria 2513
609 Ga0495607_0051633 3300046501 Bacteria 2386
610 Ga0495607_0073599 3300046501 Bacteria 1898
611 Ga0495607_0077443 3300046501 Bacteria 1837
612 Ga0495607_0116460 3300046501 Bacteria 1409
613 Ga0495607_0172438 3300046501 Bacteria 1091
614 Ga0495607_0212452 3300046501 Bacteria 951
615 Ga0495583_0000108 3300046506 Bacteria 139791
616 Ga0495583_0000246 3300046506 Bacteria 89354
617 Ga0495583_0000574 3300046506 Bacteria 50599
618 Ga0495583_0001070 3300046506 Bacteria 30573
619 Ga0495583_0002517 3300046506 Bacteria 15512
620 Ga0495583_0005662 3300046506 Bacteria 8406
621 Ga0495583_0017679 3300046506 Bacteria 3779
622 Ga0495583_0021670 3300046506 Bacteria 3300
623 Ga0495583_0027221 3300046506 Bacteria 2824
624 Ga0495583_0029106 3300046506 Bacteria 2706
625 Ga0495583_0034876 3300046506 Bacteria 2406
626 Ga0495606_0007104 3300046507 Bacteria 10123
627 Ga0495606_0007228 3300046507 Bacteria 10009
628 Ga0495606_0015743 3300046507 Bacteria 5807
629 Ga0495606_0063848 3300046507 Bacteria 2345
630 Ga0495606_0076487 3300046507 Bacteria 2092
631 Ga0495606_0116642 3300046507 Bacteria 1603
632 Ga0495606_0206351 3300046507 Bacteria 1116
633 Ga0495606_0220410 3300046507 Bacteria 1069
634 Ga0495610_0000198 3300046512 Bacteria 67337
635 Ga0495610_0003668 3300046512 Bacteria 11807
636 Ga0495610_0005787 3300046512 Bacteria 8700
637 Ga0495610_0006766 3300046512 Bacteria 7780
638 Ga0495610_0017574 3300046512 Bacteria 4074
639 Ga0495610_0060835 3300046512 Bacteria 1796
640 Ga0495610_0077586 3300046512 Bacteria 1534
641 Ga0495616_0001871 3300046513 Bacteria 14224
642 Ga0495616_0003207 3300046513 Bacteria 10544
643 Ga0495616_0003752 3300046513 Bacteria 9693
644 Ga0495616_0010304 3300046513 Bacteria 5416
645 Ga0495616_0027024 3300046513 Bacteria 3048
646 Ga0495616_0027242 3300046513 Bacteria 3034
647 Ga0495616_0032583 3300046513 Bacteria 2720
648 Ga0495616_0042619 3300046513 Bacteria 2310
649 Ga0495616_0086986 3300046513 Bacteria 1485
650 Ga0495620_0004589 3300046515 Bacteria 7769
651 Ga0495620_0021521 3300046515 Bacteria 3130
652 Ga0495628_0000366 3300046516 Bacteria 41368
653 Ga0495628_0422885 3300046516 Bacteria 971
654 Ga0495631_0000063 3300046518 Bacteria 66560
655 Ga0495631_0007886 3300046518 Bacteria 5390
656 Ga0495631_0008421 3300046518 Bacteria 5198
657 Ga0495631_0029987 3300046518 Bacteria 2470
658 Ga0495631_0038814 3300046518 Bacteria 2115
659 Ga0495631_0042417 3300046518 Bacteria 2010
660 Ga0495631_0146325 3300046518 Bacteria 1014
661 Ga0495632_0000118 3300046519 Bacteria 81183
662 Ga0495632_0008663 3300046519 Bacteria 6211
663 Ga0495632_0034637 3300046519 Bacteria 2582
664 Ga0495632_0035531 3300046519 Bacteria 2541
665 Ga0495632_0035944 3300046519 Bacteria 2523
666 Ga0495632_0053177 3300046519 Bacteria 1989
667 Ga0495632_0130380 3300046519 Bacteria 1170
668 Ga0495637_0000008 3300046520 Bacteria 404658
669 Ga0495637_0003117 3300046520 Bacteria 8844
670 Ga0495637_0057625 3300046520 Bacteria 1604
671 Ga0495637_0061927 3300046520 Bacteria 1532
672 Ga0495637_0064385 3300046520 Bacteria 1495
673 Ga0495643_0000028 3300046522 Bacteria 262886
674 Ga0495643_0000167 3300046522 Bacteria 104447
675 Ga0495643_0000398 3300046522 Bacteria 57089
676 Ga0495643_0000806 3300046522 Bacteria 34503
677 Ga0495643_0031419 3300046522 Bacteria 2954
678 Ga0495643_0045741 3300046522 Bacteria 2375
679 Ga0495643_0092380 3300046522 Bacteria 1560
680 Ga0495643_0169218 3300046522 Bacteria 1069
681 Ga0495644_0001842 3300046523 Bacteria 8552
682 Ga0495644_0003267 3300046523 Bacteria 6408
683 Ga0495644_0017201 3300046523 Bacteria 2765
684 Ga0495644_0045134 3300046523 Bacteria 1657
685 Ga0495648_0000002 3300046524 Bacteria 593972
686 Ga0495648_0000127 3300046524 Bacteria 89962
687 Ga0495648_0003027 3300046524 Bacteria 15061
688 Ga0495648_0006784 3300046524 Bacteria 9257
689 Ga0495648_0016213 3300046524 Bacteria 5376
690 Ga0495648_0043266 3300046524 Bacteria 2825
691 Ga0495648_0053579 3300046524 Bacteria 2443
692 Ga0495648_0069857 3300046524 Bacteria 2042
693 Ga0495648_0087131 3300046524 Bacteria 1759
694 Ga0495663_0000430 3300046525 Bacteria 15337
695 Ga0495663_0000667 3300046525 Bacteria 11844
696 Ga0495663_0002025 3300046525 Bacteria 6225
697 Ga0495663_0002087 3300046525 Bacteria 6113
698 Ga0495663_0011033 3300046525 Bacteria 2515
699 Ga0495663_0026855 3300046525 Bacteria 1687
700 Ga0495663_0029574 3300046525 Bacteria 1619
701 Ga0495663_0029935 3300046525 Bacteria 1610
702 Ga0495663_0061670 3300046525 Bacteria 1180
703 Ga0495666_0000042 3300046526 Bacteria 47032
704 Ga0495642_0000713 3300046528 Bacteria 16565
705 Ga0495642_0006913 3300046528 Bacteria 4350
706 Ga0495642_0015223 3300046528 Bacteria 2986
707 Ga0495642_0135830 3300046528 Bacteria 1060
708 Ga0495652_0007817 3300046529 Bacteria 9822
709 Ga0495652_0034272 3300046529 Bacteria 4426
710 Ga0495654_0157555 3300046530 Bacteria 999
711 Ga0495654_0193116 3300046530 Bacteria 875
712 Ga0495586_0187068 3300046535 Bacteria 1172
713 Ga0495586_0257319 3300046535 Bacteria 997
714 Ga0495587_0177490 3300046536 Bacteria 1208
715 Ga0495587_0182111 3300046536 Bacteria 1191
716 Ga0495609_0001891 3300046538 Bacteria 13361
717 Ga0495609_0003441 3300046538 Bacteria 9060
718 Ga0495609_0003916 3300046538 Bacteria 8348
719 Ga0495609_0005560 3300046538 Bacteria 6579
720 Ga0495609_0028674 3300046538 Bacteria 2540
721 Ga0495609_0031199 3300046538 Bacteria 2423
722 Ga0495609_0043209 3300046538 Bacteria 2023
723 Ga0495609_0097429 3300046538 Bacteria 1275
724 Ga0495609_0111753 3300046538 Bacteria 1179
725 Ga0495609_0186241 3300046538 Bacteria 872
726 Ga0495609_0201788 3300046538 Bacteria 831
727 Ga0495621_0092438 3300046539 Bacteria 1142
728 Ga0495597_0000072 3300046542 Bacteria 87914
729 Ga0495597_0000227 3300046542 Bacteria 50869
730 Ga0495597_0000855 3300046542 Bacteria 23940
731 Ga0495597_0008907 3300046542 Bacteria 5003
732 Ga0495597_0015375 3300046542 Bacteria 3625
733 Ga0495597_0060129 3300046542 Bacteria 1657
734 Ga0495597_0061909 3300046542 Bacteria 1629
735 Ga0495645_0320471 3300046543 Bacteria 1007
736 Ga0495622_0000002 3300046557 Bacteria 321742
737 Ga0495622_0000200 3300046557 Bacteria 47745
738 Ga0495622_0126161 3300046557 Bacteria 1167
739 Ga0495633_0000033 3300046558 Bacteria 186714
740 Ga0495633_0000055 3300046558 Bacteria 151013
741 Ga0495633_0000358 3300046558 Bacteria 49277
742 Ga0495633_0003373 3300046558 Bacteria 10698
743 Ga0495633_0005693 3300046558 Bacteria 7541
744 Ga0495633_0027144 3300046558 Bacteria 2801
745 Ga0495633_0031404 3300046558 Bacteria 2575
746 Ga0495633_0034184 3300046558 Bacteria 2446
747 Ga0495633_0157881 3300046558 Bacteria 1046
748 Ga0495633_0232800 3300046558 Bacteria 842
749 Ga0495656_0001583 3300046615 Bacteria 7456
750 Ga0495656_0053816 3300046615 Bacteria 1730
751 Ga0495656_0056704 3300046615 Bacteria 1694
752 Ga0495656_0153134 3300046615 Bacteria 1115
753 Ga0495656_0176141 3300046615 Bacteria 1048
754 Ga0495656_0215911 3300046615 Bacteria 957
755 Ga0495668_0000008 3300046616 Bacteria 498364
756 Ga0495668_0000065 3300046616 Bacteria 178985
757 Ga0495668_0004167 3300046616 Bacteria 10436
758 Ga0495668_0012198 3300046616 Bacteria 5107
759 Ga0495668_0021032 3300046616 Bacteria 3746
760 Ga0495668_0032724 3300046616 Bacteria 2923
761 Ga0495668_0036883 3300046616 Bacteria 2737
762 Ga0495668_0144662 3300046616 Bacteria 1301
763 Ga0495668_0174317 3300046616 Bacteria 1178
764 Ga0495668_0198177 3300046616 Bacteria 1099
765 Ga0495634_0035042 3300046642 Bacteria 3440
766 Ga0495611_0000001 3300046648 Bacteria 2628469
767 Ga0495611_0000410 3300046648 Bacteria 26643
768 Ga0495611_0000965 3300046648 Bacteria 15317
769 Ga0495611_0004192 3300046648 Bacteria 6275
770 Ga0495611_0004303 3300046648 Bacteria 6185
771 Ga0495611_0081476 3300046648 Bacteria 1488
772 Ga0495625_0000001 3300046660 Bacteria 1641829
773 Ga0495625_0000121 3300046660 Bacteria 121186
774 Ga0495625_0000272 3300046660 Bacteria 80655
775 Ga0495625_0001594 3300046660 Bacteria 26845
776 Ga0495625_0003267 3300046660 Bacteria 16384
777 Ga0495625_0036183 3300046660 Bacteria 3631
778 Ga0495625_0071882 3300046660 Bacteria 2427
779 Ga0495625_0090919 3300046660 Bacteria 2110
780 Ga0495625_0092736 3300046660 Bacteria 2086
781 Ga0495625_0095803 3300046660 Bacteria 2045
782 Ga0495625_0252418 3300046660 Bacteria 1144
783 Ga0495635_0059085 3300046663 Bacteria 2637
784 Ga0495635_0260240 3300046663 Bacteria 1168
785 Ga0495659_0000068 3300046664 Bacteria 46175
786 Ga0495659_0000327 3300046664 Bacteria 18786
787 Ga0495661_0000049 3300046665 Bacteria 144060
788 Ga0495661_0000839 3300046665 Bacteria 28706
789 Ga0495661_0011847 3300046665 Bacteria 5905
790 Ga0495661_0014616 3300046665 Bacteria 5257
791 Ga0495661_0033552 3300046665 Bacteria 3237
792 Ga0495661_0045135 3300046665 Bacteria 2696
793 Ga0495661_0068329 3300046665 Bacteria 2084
794 Ga0495661_0068964 3300046665 Bacteria 2073
795 Ga0495661_0077750 3300046665 Bacteria 1921
796 Ga0495661_0080141 3300046665 Bacteria 1885
797 Ga0495661_0135623 3300046665 Bacteria 1344
798 Ga0495661_0145386 3300046665 Bacteria 1285
799 Ga0495661_0332408 3300046665 Bacteria 752
800 Ga0495623_0011973 3300046679 Bacteria 5619
801 Ga0495658_0103700 3300046683 Bacteria 1701
802 Ga0495658_0192797 3300046683 Bacteria 1268
803 Ga0495658_0279392 3300046683 Bacteria 1054
804 Ga0495669_0003845 3300046684 Bacteria 6172
805 Ga0495669_0070249 3300046684 Bacteria 1594
806 Ga0495670_0000676 3300046691 Bacteria 16204
807 Ga0495670_0003614 3300046691 Bacteria 7596
808 Ga0495670_0022234 3300046691 Bacteria 3130
809 Ga0495670_0022929 3300046691 Bacteria 3082
810 Ga0495671_0000129 3300046692 Bacteria 68297
811 Ga0495671_0043038 3300046692 Bacteria 2267
812 Ga0495671_0059437 3300046692 Bacteria 1889
813 Ga0495671_0064592 3300046692 Bacteria 1802
814 Ga0495671_0151025 3300046692 Bacteria 1131
815 Ga0495671_0285830 3300046692 Bacteria 794
816 Ga0495649_0000071 3300046694 Bacteria 89386
817 Ga0495649_0004200 3300046694 Bacteria 9453
818 Ga0495649_0024198 3300046694 Bacteria 3387
819 Ga0495649_0049519 3300046694 Bacteria 2282
820 Ga0495649_0066875 3300046694 Bacteria 1928
821 Ga0495589_0000048 3300046794 Bacteria 117134
822 Ga0495589_0000112 3300046794 Bacteria 77426
823 Ga0495589_0017854 3300046794 Bacteria 3639
824 Ga0495589_0024781 3300046794 Bacteria 3047
825 Ga0495589_0065123 3300046794 Bacteria 1786
826 Ga0495660_0000008 3300046810 Bacteria 435769
827 Ga0495660_0004944 3300046810 Bacteria 8029
828 Ga0495660_0007687 3300046810 Bacteria 6332
829 Ga0495660_0015575 3300046810 Bacteria 4392
830 Ga0495660_0076122 3300046810 Bacteria 1768
831 Ga0495660_0088509 3300046810 Bacteria 1613
832 Ga0495660_0138521 3300046810 Bacteria 1213
833 Ga0495604_0080259 3300047317 Bacteria 2445
834 Ga0495604_0131275 3300047317 Bacteria 1800
835 Ga0495636_0000799 3300047318 Bacteria 11574
836 Ga0495636_0015324 3300047318 Bacteria 3055
837 Ga0495674_0016607 3300047319 Bacteria 6870
838 Ga0495672_0000033 3300047320 Bacteria 291992
839 Ga0495672_0000191 3300047320 Bacteria 88319
840 Ga0495672_0001752 3300047320 Bacteria 20938
841 Ga0495672_0005042 3300047320 Bacteria 10563
842 Ga0495672_0016900 3300047320 Bacteria 4893
843 Ga0495672_0028568 3300047320 Bacteria 3527
844 Ga0495680_0150482 3300047322 Bacteria 1697
845 Ga0495680_0246890 3300047322 Bacteria 1266
846 Ga0495683_0000168 3300047323 Bacteria 63828
847 Ga0495683_0000174 3300047323 Bacteria 63168
848 Ga0495683_0015029 3300047323 Bacteria 4031
849 Ga0495683_0021392 3300047323 Bacteria 3333
850 Ga0495683_0097507 3300047323 Bacteria 1417
851 Ga0495683_0162306 3300047323 Bacteria 1032
852 Ga0495687_000007 3300047443 Bacteria 552679
853 Ga0495687_000015 3300047443 Bacteria 365627
854 Ga0495687_000369 3300047443 Bacteria 56056
855 Ga0495687_000924 3300047443 Bacteria 30497
856 Ga0495687_002679 3300047443 Bacteria 13854
857 Ga0495687_002834 3300047443 Bacteria 13350
858 Ga0495687_052618 3300047443 Bacteria 1720
859 Ga0495687_134554 3300047443 Bacteria 869
860 Ga0495675_0008485 3300047444 Bacteria 6368
861 Ga0495677_0000355 3300047445 Bacteria 19826
862 Ga0495677_0000910 3300047445 Bacteria 11901
863 Ga0495677_0005688 3300047445 Bacteria 4725
864 Ga0495677_0007740 3300047445 Bacteria 4005
865 Ga0495677_0012898 3300047445 Bacteria 3043
866 Ga0495677_0022125 3300047445 Bacteria 2304
867 Ga0495677_0025475 3300047445 Bacteria 2146
868 Ga0495677_0037543 3300047445 Bacteria 1769
869 Ga0495679_000001 3300047446 Bacteria 1607568
870 Ga0495679_001633 3300047446 Bacteria 12492
871 Ga0495679_002909 3300047446 Bacteria 8478
872 Ga0495685_000192 3300047447 Bacteria 20404
873 Ga0495685_012712 3300047447 Bacteria 2851
874 Ga0495685_031041 3300047447 Bacteria 1837
875 Ga0495673_0000003 3300047469 Bacteria 1491337
876 Ga0495673_0000061 3300047469 Bacteria 230647
877 Ga0495673_0000089 3300047469 Bacteria 188744
878 Ga0495681_0000016 3300047470 Bacteria 181322
879 Ga0495681_0000658 3300047470 Bacteria 26270
880 Ga0495681_0001103 3300047470 Bacteria 20503
881 Ga0495681_0004943 3300047470 Bacteria 8996
882 Ga0495681_0006172 3300047470 Bacteria 7913
883 Ga0495681_0009251 3300047470 Bacteria 6091
884 Ga0495681_0011767 3300047470 Bacteria 5181
885 Ga0495681_0019397 3300047470 Bacteria 3714
886 Ga0495681_0022548 3300047470 Bacteria 3366
887 Ga0495681_0040619 3300047470 Bacteria 2264
888 Ga0495681_0090335 3300047470 Bacteria 1353
889 Ga0495681_0179504 3300047470 Bacteria 871
890 Ga0495686_0000146 3300047472 Bacteria 141435
891 Ga0495686_0003433 3300047472 Bacteria 13745
892 Ga0495686_0017581 3300047472 Bacteria 4811
893 Ga0495686_0057450 3300047472 Bacteria 2428
894 Ga0495686_0118304 3300047472 Bacteria 1582
895 Ga0495602_0026419 3300048088 Bacteria 5599
896 Ga0495615_0000012 3300048090 Bacteria 64858
897 Ga0495615_0036450 3300048090 Bacteria 1207
898 Ga0495615_0042955 3300048090 Bacteria 1136
899 Ga0495626_0006364 3300048091 Bacteria 6731
900 Ga0495626_0021288 3300048091 Bacteria 3218
901 Ga0495626_0067203 3300048091 Bacteria 1619
902 Ga0496100_0013632 3300048903 Bacteria 4695
903 Ga0496100_0190993 3300048903 Bacteria 1487
904 Ga0496101_0003543 3300048904 Bacteria 9740
905 Ga0496101_0201911 3300048904 Bacteria 1537
906 Ga0496101_0264110 3300048904 Bacteria 1343
907 Ga0496102_0000103 3300048905 Bacteria 122239
908 Ga0496102_0114554 3300048905 Bacteria 2515
909 Ga0496102_0206472 3300048905 Bacteria 1852
910 Ga0496103_0000036 3300048906 Bacteria 180019
911 Ga0496103_0005307 3300048906 Bacteria 7731
912 Ga0496103_0243090 3300048906 Bacteria 1158
913 Ga0496104_0002829 3300048907 Bacteria 14970
914 Ga0496104_0013012 3300048907 Bacteria 7492
915 Ga0496104_0085803 3300048907 Bacteria 3005
916 Ga0496104_0321070 3300048907 Bacteria 1461
917 Ga0496105_0001982 3300048908 Bacteria 14740
918 Ga0496105_0030075 3300048908 Bacteria 4449
919 Ga0496105_0061406 3300048908 Bacteria 3101
920 Ga0496105_0069371 3300048908 Bacteria 2913
921 Ga0496106_0010373 3300048909 Bacteria 6883
922 Ga0496107_0143245 3300048910 Bacteria 1767
923 Ga0496107_0274533 3300048910 Bacteria 1255
924 Ga0496107_0446481 3300048910 Bacteria 961
925 Ga0496108_0015009 3300048911 Bacteria 6323
926 Ga0496108_0041368 3300048911 Bacteria 3848
927 Ga0496108_0145189 3300048911 Bacteria 2045
928 Ga0496109_0101361 3300048912 Bacteria 2672
929 Ga0496109_0207592 3300048912 Bacteria 1842
930 Ga0496110_0026193 3300048913 Bacteria 4987
931 Ga0496110_0080787 3300048913 Bacteria 2897
932 Ga0496110_0334973 3300048913 Bacteria 1378
933 Ga0496111_0081081 3300048914 Bacteria 2368
934 Ga0496111_0273641 3300048914 Bacteria 1253
935 Ga0496111_0467944 3300048914 Bacteria 929
936 Ga0496112_0215527 3300048915 Bacteria 1876
937 Ga0496113_0002745 3300048916 Bacteria 10352
938 Ga0496113_0113912 3300048916 Bacteria 2108
939 Ga0496114_0032300 3300048917 Bacteria 4307
940 Ga0496114_0101033 3300048917 Bacteria 2462
941 Ga0496114_0160197 3300048917 Bacteria 1956
942 Ga0496114_0406589 3300048917 Bacteria 1205
943 Ga0496115_0389635 3300048918 Bacteria 1132
944 Ga0496115_0502766 3300048918 Bacteria 974
945 Ga0496116_0000160 3300048919 Bacteria 137507
946 Ga0496116_0001705 3300048919 Bacteria 24088
947 Ga0496116_0007161 3300048919 Bacteria 9973
948 Ga0496116_0174638 3300048919 Bacteria 1159
949 Ga0496117_0000202 3300048920 Bacteria 117638
950 Ga0496117_0000810 3300048920 Bacteria 48467
951 Ga0496117_0001291 3300048920 Bacteria 36931
952 Ga0496117_0003022 3300048920 Bacteria 20187
953 Ga0496117_0226481 3300048920 Bacteria 1036
954 Ga0496118_0000318 3300048921 Bacteria 83296
955 Ga0496118_0000579 3300048921 Bacteria 60445
956 Ga0496118_0003511 3300048921 Bacteria 19659
957 Ga0496118_0005968 3300048921 Bacteria 13587
958 Ga0496118_0017237 3300048921 Bacteria 6585
959 Ga0496119_0000480 3300048922 Bacteria 54616
960 Ga0496119_0004992 3300048922 Bacteria 12953
961 Ga0496119_0042204 3300048922 Bacteria 2896
962 Ga0496119_0044188 3300048922 Bacteria 2807
963 Ga0496120_0000511 3300048923 Bacteria 60526
964 Ga0496120_0031643 3300048923 Bacteria 3200
965 Ga0496121_0002018 3300048924 Bacteria 32204
966 Ga0496121_0003167 3300048924 Bacteria 23721
967 Ga0496121_0009473 3300048924 Bacteria 11188
968 Ga0496121_0012029 3300048924 Bacteria 9509
969 Ga0496121_0015334 3300048924 Bacteria 8040
970 Ga0496121_0017579 3300048924 Bacteria 7291
971 Ga0496121_0092537 3300048924 Bacteria 2357
972 Ga0496122_0000410 3300048925 Bacteria 91128
973 Ga0496122_0000662 3300048925 Bacteria 69323
974 Ga0496122_0001600 3300048925 Bacteria 35421
975 Ga0496122_0001753 3300048925 Bacteria 33345
976 Ga0496122_0003832 3300048925 Bacteria 19331
977 Ga0496122_0005663 3300048925 Bacteria 14748
978 Ga0496122_0006221 3300048925 Bacteria 13828
979 Ga0496122_0008250 3300048925 Bacteria 11301
980 Ga0496122_0019858 3300048925 Bacteria 6114
981 Ga0496122_0130777 3300048925 Bacteria 1595
982 Ga0496123_0000478 3300048926 Bacteria 69650
983 Ga0496123_0000818 3300048926 Bacteria 50079
984 Ga0496123_0001311 3300048926 Bacteria 35270
985 Ga0496123_0002081 3300048926 Bacteria 25765
986 Ga0496123_0003504 3300048926 Bacteria 17485
987 Ga0496123_0003783 3300048926 Bacteria 16574
988 Ga0496123_0004715 3300048926 Bacteria 14107
989 Ga0496123_0006472 3300048926 Bacteria 11333
990 Ga0496123_0095277 3300048926 Bacteria 1751
991 Ga0496123_0120161 3300048926 Bacteria 1480
992 Ga0496124_0003904 3300048927 Bacteria 17822
993 Ga0496124_0004765 3300048927 Bacteria 15616
994 Ga0496124_0005128 3300048927 Bacteria 14910
995 Ga0496124_0007020 3300048927 Bacteria 12067
996 Ga0496124_0007341 3300048927 Bacteria 11740
997 Ga0496124_0008353 3300048927 Bacteria 10841
998 Ga0496124_0010750 3300048927 Bacteria 9227
999 Ga0496124_0155339 3300048927 Bacteria 1790
1000 Ga0496124_0259885 3300048927 Bacteria 1278
1001 Ga0496124_0310325 3300048927 Bacteria 1134
1002 Ga0496125_0000166 3300048928 Bacteria 147432
1003 Ga0496125_0001775 3300048928 Bacteria 29811
1004 Ga0496125_0003280 3300048928 Bacteria 19885
1005 Ga0496125_0003538 3300048928 Bacteria 18831
1006 Ga0496125_0005574 3300048928 Bacteria 13921
1007 Ga0496125_0006247 3300048928 Bacteria 12950
1008 Ga0496125_0018022 3300048928 Bacteria 6712
1009 Ga0496125_0237624 3300048928 Bacteria 1159
1010 Ga0496125_0294352 3300048928 Bacteria 998
1011 Ga0496126_0000116 3300048929 Bacteria 188390
1012 Ga0496126_0036200 3300048929 Bacteria 4617
1013 Ga0496126_0036879 3300048929 Bacteria 4568
1014 Ga0496126_0046931 3300048929 Bacteria 3957
1015 Ga0496126_0095044 3300048929 Bacteria 2615
1016 Ga0496126_0397380 3300048929 Bacteria 1119
1017 Ga0495678_000024 3300049459 Bacteria 229034
1018 Ga0495678_000061 3300049459 Bacteria 142649
1019 Ga0495678_000080 3300049459 Bacteria 120033
1020 Ga0495678_000367 3300049459 Bacteria 46226
1021 Ga0495678_001099 3300049459 Bacteria 22809
1022 Ga0495678_002662 3300049459 Bacteria 11827
1023 Ga0495678_005899 3300049459 Bacteria 6630
1024 Ga0495678_022773 3300049459 Bacteria 2734
1025 Ga0495678_035769 3300049459 Bacteria 2032
1026 Ga0495678_074579 3300049459 Bacteria 1234
1027 Ga0495682_0000284 3300049460 Bacteria 39605
1028 Ga0495682_0000409 3300049460 Bacteria 30562
1029 Ga0495682_0000411 3300049460 Bacteria 30452
1030 Ga0495682_0001519 3300049460 Bacteria 12302
1031 Ga0495682_0013200 3300049460 Bacteria 3150
1032 Ga0495682_0015985 3300049460 Bacteria 2840
1033 Ga0501313_000711 3300049529 Bacteria 2470
1034 Ga0501033_0130265 3300049570 Bacteria 1823
1035 Ga0501034_0056876 3300049571 Bacteria 3934
1036 Ga0501034_0365802 3300049571 Bacteria 1369
1037 Ga0501037_0200556 3300049573 Bacteria 1410
1038 Ga0501038_0198498 3300049574 Bacteria 1611
1039 Ga0501047_0007859 3300049581 Bacteria 10051
1040 Ga0501067_0051471 3300049583 Bacteria 2283
1041 Ga0501073_0000012 3300049589 Bacteria 161319
1042 Ga0501269_000034 3300049766 Bacteria 42532
1043 Ga0501035_0006617 3300049822 Bacteria 10849
1044 Ga0501035_0009730 3300049822 Bacteria 8939
1045 Ga0501035_0022652 3300049822 Bacteria 5770
1046 Ga0501035_0120648 3300049822 Bacteria 2292
1047 Ga0501044_0000236 3300049823 Bacteria 69634
1048 Ga0501044_0044554 3300049823 Bacteria 4603
1049 nmdc:mga03683_277671_c1 3300050489 Bacteria 782
1050 nmdc:mga00v17_41700_c1 3300050491 Bacteria 2758
1051 nmdc:mga00v17_96686_c1 3300050491 Bacteria 1860
1052 nmdc:mga0yw44_1980_c1 3300050492 Bacteria 8494
1053 nmdc:mga0yw44_4987_c1 3300050492 Bacteria 6196
1054 nmdc:mga0yw44_92232_c1 3300050492 Bacteria 1917
1055 nmdc:mga0yw44_96069_c1 3300050492 Bacteria 1881
1056 nmdc:mga0k408_78977_c1 3300050493 Bacteria 1926
1057 nmdc:mga0k408_9809_c1 3300050493 Bacteria 5172
1058 nmdc:mga06z11_28077_c1 3300050494 Bacteria 2697
1059 nmdc:mga07m45_2540_c1 3300050496 Bacteria 8572
1060 nmdc:mga07m45_37452_c1 3300050496 Bacteria 1460
1061 nmdc:mga05p37_209_c1 3300050507 Bacteria 59030
1062 nmdc:mga09592_150_c1 3300050508 Bacteria 47613
1063 nmdc:mga06r32_128933_c1 3300050510 Bacteria 2499
1064 nmdc:mga06r32_148815_c1 3300050510 Bacteria 2319
1065 nmdc:mga06r32_39269_c1 3300050510 Bacteria 4491
1066 nmdc:mga08y16_111071_c1 3300050511 Bacteria 2854
1067 nmdc:mga08y16_261223_c1 3300050511 Bacteria 1788
1068 nmdc:mga08y16_42698_c1 3300050511 Bacteria 4748
1069 nmdc:mga08y16_656469_c1 3300050511 Bacteria 1052
1070 nmdc:mga0rr50_119166_c1 3300050513 Bacteria 2098
1071 nmdc:mga0rr50_229454_c1 3300050513 Bacteria 1536
1072 nmdc:mga08x19_6630_c1 3300050514 Bacteria 6865
1073 nmdc:mga0a205_30059_c1 3300050515 Bacteria 5200
1074 nmdc:mga0a205_648526_c1 3300050515 Bacteria 907
1075 Ga0495595_0165436 3300053084 Bacteria 1093
1076 Ga0500644_0143440 3300053088 Bacteria 951
1077 Ga0500646_0074727 3300053090 Bacteria 1023
1078 Ga0500651_0018685 3300053093 Bacteria 4294
1079 Ga0500651_0065804 3300053093 Bacteria 2257
1080 Ga0500555_000019 3300053103 Bacteria 175470
1081 Ga0500594_0022935 3300053118 Bacteria 1578
1082 Ga0500594_0046611 3300053118 Bacteria 1206
1083 Ga0500652_000792 3300053131 Bacteria 10629
1084 Ga0500559_0003954 3300053136 Bacteria 7141
1085 Ga0500573_0005953 3300053140 Bacteria 6564
1086 Ga0500586_002700 3300053145 Bacteria 4064
1087 Ga0500622_0000146 3300053156 Bacteria 74615
1088 Ga0500634_0175155 3300053161 Bacteria 972
1089 Ga0500645_000242 3300053730 Bacteria 40854
1090 Ga0587070_008462 3300059491 Bacteria 1459
1091 Ga0587080_013453 3300059503 Bacteria 1253
1092 Ga0587083_0009809 3300059505 Bacteria 1535
1093 Ga0587083_0032420 3300059505 Bacteria 1048
1094 Ga0587076_063013 3300059645 Bacteria 752
1095 Ga0466962_0037154 3300061719 Bacteria 2331
1096 Ga0466962_0047494 3300061719 Bacteria 2051
1097 Ga0466962_0068362 3300061719 Bacteria 1696
1098 Ga0530510_0417292 3300061734 Bacteria 1013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100488510 Ga0070678_1004885102 194
2 3300006358 Ga0068871_100083858 Ga0068871_1000838583 194
3 3300026121 Ga0207683_10363649 Ga0207683_103636492 194
4 3300031548 Ga0307408_100324555 Ga0307408_1003245552 197
5 3300032002 Ga0307416_101329606 Ga0307416_1013296062 197
6 3300002705 JGI25156J39149_1009071 JGI25156J39149_10090713 198
7 3300002738 JGI25154J39366_1001103 JGI25154J39366_10011039 198
8 3300025206 Ga0209435_100067 Ga0209435_10006733 198
9 3300025246 Ga0209646_1000061 Ga0209646_100006167 198
10 3300025250 Ga0209026_1000754 Ga0209026_10007547 198
11 3300025256 Ga0209759_1000209 Ga0209759_100020966 198
12 3300044684 Ga0466966_0010854 Ga0466966_0010854_4536_5186 198
13 3300044842 Ga0466957_0000649 Ga0466957_0000649_13725_14375 198
14 3300046520 Ga0495637_0057625 Ga0495637_0057625_259_897 198
15 3300046522 Ga0495643_0000398 Ga0495643_0000398_4351_5001 198
16 3300046615 Ga0495656_0153134 Ga0495656_0153134_399_1037 198
17 3300046665 Ga0495661_0000049 Ga0495661_0000049_49929_50573 198
18 3300046665 Ga0495661_0080141 Ga0495661_0080141_854_1492 198
19 3300047443 Ga0495687_000007 Ga0495687_000007_435797_436447 198
20 3300048912 Ga0496109_0101361 Ga0496109_0101361_1743_2387 198
21 3300048916 Ga0496113_0113912 Ga0496113_0113912_1066_1710 198
22 3300048925 Ga0496122_0001753 Ga0496122_0001753_5150_5794 198
23 3300048926 Ga0496123_0003783 Ga0496123_0003783_6764_7408 198
24 3300048928 Ga0496125_0006247 Ga0496125_0006247_7164_7808 198
25 3300005545 Ga0070695_100341583 Ga0070695_1003415832 199
26 3300031711 Ga0265314_10245137 Ga0265314_102451372 199
27 3300046452 Ga0495617_000482 Ga0495617_000482_16120_16758 199
28 3300046474 Ga0495605_0005435 Ga0495605_0005435_6207_6845 199
29 3300046474 Ga0495605_0006402 Ga0495605_0006402_1442_2110 199
30 3300046492 Ga0495585_0008335 Ga0495585_0008335_85_723 199
31 3300046492 Ga0495585_0019523 Ga0495585_0019523_125_763 199
32 3300046500 Ga0495596_0072015 Ga0495596_0072015_406_1074 199
33 3300046501 Ga0495607_0026641 Ga0495607_0026641_87_725 199
34 3300046501 Ga0495607_0038878 Ga0495607_0038878_1774_2412 199
35 3300046501 Ga0495607_0116460 Ga0495607_0116460_337_975 199
36 3300046506 Ga0495583_0000108 Ga0495583_0000108_1486_2124 199
37 3300046513 Ga0495616_0001871 Ga0495616_0001871_10585_11223 199
38 3300046513 Ga0495616_0027024 Ga0495616_0027024_2144_2812 199
39 3300046520 Ga0495637_0064385 Ga0495637_0064385_801_1469 199
40 3300046522 Ga0495643_0092380 Ga0495643_0092380_508_1176 199
41 3300046523 Ga0495644_0001842 Ga0495644_0001842_5415_6053 199
42 3300046523 Ga0495644_0003267 Ga0495644_0003267_4437_5075 199
43 3300046524 Ga0495648_0043266 Ga0495648_0043266_1611_2279 199
44 3300046530 Ga0495654_0193116 Ga0495654_0193116_118_786 199
45 3300046538 Ga0495609_0003916 Ga0495609_0003916_5159_5797 199
46 3300046557 Ga0495622_0126161 Ga0495622_0126161_364_1002 199
47 3300046558 Ga0495633_0000358 Ga0495633_0000358_27667_28305 199
48 3300046558 Ga0495633_0003373 Ga0495633_0003373_1079_1717 199
49 3300046615 Ga0495656_0053816 Ga0495656_0053816_62_700 199
50 3300046615 Ga0495656_0176141 Ga0495656_0176141_199_837 199
51 3300046616 Ga0495668_0032724 Ga0495668_0032724_1339_2007 199
52 3300046648 Ga0495611_0000965 Ga0495611_0000965_413_1051 199
53 3300046648 Ga0495611_0004303 Ga0495611_0004303_133_771 199
54 3300046660 Ga0495625_0252418 Ga0495625_0252418_87_725 199
55 3300046664 Ga0495659_0000327 Ga0495659_0000327_1450_2088 199
56 3300046665 Ga0495661_0332408 Ga0495661_0332408_31_669 199
57 3300046691 Ga0495670_0000676 Ga0495670_0000676_3348_3986 199
58 3300046692 Ga0495671_0043038 Ga0495671_0043038_103_771 199
59 3300046692 Ga0495671_0064592 Ga0495671_0064592_384_1022 199
60 3300047318 Ga0495636_0000799 Ga0495636_0000799_4903_5541 199
61 3300047320 Ga0495672_0016900 Ga0495672_0016900_4122_4760 199
62 3300047323 Ga0495683_0015029 Ga0495683_0015029_918_1556 199
63 3300047443 Ga0495687_002834 Ga0495687_002834_3174_3812 199
64 3300047445 Ga0495677_0000355 Ga0495677_0000355_5415_6053 199
65 3300047446 Ga0495679_001633 Ga0495679_001633_9184_9852 199
66 3300047447 Ga0495685_000192 Ga0495685_000192_9335_9973 199
67 3300047469 Ga0495673_0000061 Ga0495673_0000061_217738_218376 199
68 3300048091 Ga0495626_0067203 Ga0495626_0067203_413_1081 199
69 3300049459 Ga0495678_000367 Ga0495678_000367_42129_42797 199
70 3300049459 Ga0495678_002662 Ga0495678_002662_11058_11696 199
71 3300049460 Ga0495682_0000409 Ga0495682_0000409_351_989 199
72 3300049460 Ga0495682_0000411 Ga0495682_0000411_11275_11913 199
73 3300059505 Ga0587083_0009809 Ga0587083_0009809_349_996 199
74 3300002738 JGI25154J39366_1001202 JGI25154J39366_10012026 200
75 3300003771 Ga0055526_1000344 Ga0055526_10003442 200
76 3300003773 Ga0055537_1000066 Ga0055537_100006624 200
77 3300003784 Ga0055534_1000057 Ga0055534_100005731 200
78 3300003790 Ga0055528_1000069 Ga0055528_100006962 200
79 3300005616 Ga0068852_100335770 Ga0068852_1003357702 200
80 3300009093 Ga0105240_10002032 Ga0105240_100020327 200
81 3300017792 Ga0163161_10014688 Ga0163161_100146883 200
82 3300025246 Ga0209646_1000023 Ga0209646_100002380 200
83 3300025263 Ga0209565_1000006 Ga0209565_1000006641 200
84 3300025273 Ga0209673_1000004 Ga0209673_1000004188 200
85 3300025291 Ga0209675_1000006 Ga0209675_1000006640 200
86 3300025295 Ga0209564_1000102 Ga0209564_1000102125 200
87 3300025299 Ga0209256_1000037 Ga0209256_100003731 200
88 3300025913 Ga0207695_10087242 Ga0207695_100872423 200
89 3300035086 Ga0373934_0065819 Ga0373934_0065819_285_938 200
90 3300037418 Ga0395900_0250548 Ga0395900_0250548_559_1206 200
91 3300037418 Ga0395900_0846332 Ga0395900_0846332_113_763 200
92 3300037471 Ga0395905_0035594 Ga0395905_0035594_143_793 200
93 3300037471 Ga0395905_0078520 Ga0395905_0078520_235_885 200
94 3300037471 Ga0395905_0598951 Ga0395905_0598951_106_759 200
95 3300038443 Ga0395901_0003694 Ga0395901_0003694_2553_3197 200
96 3300038443 Ga0395901_0130167 Ga0395901_0130167_417_1067 200
97 3300038443 Ga0395901_0433511 Ga0395901_0433511_554_1201 200
98 3300046452 Ga0495617_053734 Ga0495617_053734_151_792 200
99 3300046457 Ga0495590_0000005 Ga0495590_0000005_228007_228651 200
100 3300046457 Ga0495590_0000013 Ga0495590_0000013_197861_198523 200
101 3300046458 Ga0495591_000109 Ga0495591_000109_27278_27940 200
102 3300046460 Ga0495638_0000027 Ga0495638_0000027_100528_101172 200
103 3300046462 Ga0495651_0133033 Ga0495651_0133033_560_1207 200
104 3300046463 Ga0495653_0049957 Ga0495653_0049957_1677_2330 200
105 3300046471 Ga0495650_0000653 Ga0495650_0000653_44068_44709 200
106 3300046471 Ga0495650_0004125 Ga0495650_0004125_5888_6532 200
107 3300046474 Ga0495605_0016476 Ga0495605_0016476_471_1142 200
108 3300046474 Ga0495605_0040684 Ga0495605_0040684_1033_1695 200
109 3300046491 Ga0495584_0000029 Ga0495584_0000029_5348_6010 200
110 3300046491 Ga0495584_0004385 Ga0495584_0004385_3259_3921 200
111 3300046491 Ga0495584_0108255 Ga0495584_0108255_74_727 200
112 3300046492 Ga0495585_0000746 Ga0495585_0000746_2933_3601 200
113 3300046492 Ga0495585_0036621 Ga0495585_0036621_1595_2257 200
114 3300046492 Ga0495585_0049484 Ga0495585_0049484_608_1270 200
115 3300046500 Ga0495596_0008416 Ga0495596_0008416_2312_2974 200
116 3300046501 Ga0495607_0002596 Ga0495607_0002596_13467_14129 200
117 3300046506 Ga0495583_0001070 Ga0495583_0001070_23792_24442 200
118 3300046506 Ga0495583_0002517 Ga0495583_0002517_13442_14086 200
119 3300046506 Ga0495583_0005662 Ga0495583_0005662_2545_3207 200
120 3300046506 Ga0495583_0021670 Ga0495583_0021670_2178_2828 200
121 3300046506 Ga0495583_0027221 Ga0495583_0027221_369_1031 200
122 3300046507 Ga0495606_0063848 Ga0495606_0063848_92_742 200
123 3300046512 Ga0495610_0017574 Ga0495610_0017574_2828_3490 200
124 3300046513 Ga0495616_0003207 Ga0495616_0003207_2849_3499 200
125 3300046513 Ga0495616_0027242 Ga0495616_0027242_1645_2307 200
126 3300046516 Ga0495628_0000366 Ga0495628_0000366_14784_15431 200
127 3300046518 Ga0495631_0007886 Ga0495631_0007886_3327_3989 200
128 3300046518 Ga0495631_0008421 Ga0495631_0008421_2519_3169 200
129 3300046519 Ga0495632_0000118 Ga0495632_0000118_64317_64997 200
130 3300046519 Ga0495632_0008663 Ga0495632_0008663_4528_5190 200
131 3300046519 Ga0495632_0035944 Ga0495632_0035944_352_1002 200
132 3300046519 Ga0495632_0053177 Ga0495632_0053177_909_1571 200
133 3300046520 Ga0495637_0000008 Ga0495637_0000008_73101_73763 200
134 3300046520 Ga0495637_0061927 Ga0495637_0061927_357_1007 200
135 3300046522 Ga0495643_0000167 Ga0495643_0000167_55810_56454 200
136 3300046522 Ga0495643_0031419 Ga0495643_0031419_384_1046 200
137 3300046523 Ga0495644_0045134 Ga0495644_0045134_691_1353 200
138 3300046524 Ga0495648_0000002 Ga0495648_0000002_184143_184787 200
139 3300046524 Ga0495648_0053579 Ga0495648_0053579_1077_1739 200
140 3300046524 Ga0495648_0087131 Ga0495648_0087131_1059_1700 200
141 3300046528 Ga0495642_0135830 Ga0495642_0135830_269_922 200
142 3300046529 Ga0495652_0007817 Ga0495652_0007817_6723_7370 200
143 3300046530 Ga0495654_0157555 Ga0495654_0157555_116_763 200
144 3300046538 Ga0495609_0043209 Ga0495609_0043209_327_989 200
145 3300046538 Ga0495609_0097429 Ga0495609_0097429_212_856 200
146 3300046539 Ga0495621_0092438 Ga0495621_0092438_88_729 200
147 3300046542 Ga0495597_0000855 Ga0495597_0000855_16813_17457 200
148 3300046542 Ga0495597_0061909 Ga0495597_0061909_556_1206 200
149 3300046557 Ga0495622_0000002 Ga0495622_0000002_140116_140760 200
150 3300046557 Ga0495622_0000200 Ga0495622_0000200_37518_38162 200
151 3300046558 Ga0495633_0000033 Ga0495633_0000033_35849_36493 200
152 3300046558 Ga0495633_0157881 Ga0495633_0157881_214_882 200
153 3300046616 Ga0495668_0000008 Ga0495668_0000008_305557_306195 200
154 3300046616 Ga0495668_0000065 Ga0495668_0000065_108181_108825 200
155 3300046616 Ga0495668_0021032 Ga0495668_0021032_2767_3420 200
156 3300046616 Ga0495668_0144662 Ga0495668_0144662_181_843 200
157 3300046616 Ga0495668_0198177 Ga0495668_0198177_102_764 200
158 3300046648 Ga0495611_0000410 Ga0495611_0000410_15093_15755 200
159 3300046648 Ga0495611_0081476 Ga0495611_0081476_136_798 200
160 3300046660 Ga0495625_0000121 Ga0495625_0000121_116943_117587 200
161 3300046660 Ga0495625_0003267 Ga0495625_0003267_14574_15215 200
162 3300046660 Ga0495625_0071882 Ga0495625_0071882_1488_2132 200
163 3300046663 Ga0495635_0059085 Ga0495635_0059085_1238_1891 200
164 3300046665 Ga0495661_0000839 Ga0495661_0000839_2805_3473 200
165 3300046665 Ga0495661_0014616 Ga0495661_0014616_2813_3493 200
166 3300046665 Ga0495661_0033552 Ga0495661_0033552_665_1315 200
167 3300046665 Ga0495661_0045135 Ga0495661_0045135_608_1270 200
168 3300046665 Ga0495661_0077750 Ga0495661_0077750_691_1353 200
169 3300046665 Ga0495661_0135623 Ga0495661_0135623_323_973 200
170 3300046679 Ga0495623_0011973 Ga0495623_0011973_1518_2165 200
171 3300046691 Ga0495670_0022234 Ga0495670_0022234_1654_2322 200
172 3300046692 Ga0495671_0059437 Ga0495671_0059437_267_911 200
173 3300046692 Ga0495671_0151025 Ga0495671_0151025_379_1041 200
174 3300046694 Ga0495649_0000071 Ga0495649_0000071_68537_69199 200
175 3300046694 Ga0495649_0024198 Ga0495649_0024198_2298_2960 200
176 3300046794 Ga0495589_0024781 Ga0495589_0024781_150_812 200
177 3300046794 Ga0495589_0065123 Ga0495589_0065123_399_1061 200
178 3300046810 Ga0495660_0004944 Ga0495660_0004944_1288_1950 200
179 3300046810 Ga0495660_0007687 Ga0495660_0007687_2446_3108 200
180 3300046810 Ga0495660_0088509 Ga0495660_0088509_705_1349 200
181 3300047320 Ga0495672_0000033 Ga0495672_0000033_194321_194983 200
182 3300047320 Ga0495672_0001752 Ga0495672_0001752_7220_7882 200
183 3300047320 Ga0495672_0028568 Ga0495672_0028568_2823_3476 200
184 3300047322 Ga0495680_0150482 Ga0495680_0150482_110_763 200
185 3300047323 Ga0495683_0000168 Ga0495683_0000168_20386_21048 200
186 3300047323 Ga0495683_0097507 Ga0495683_0097507_242_892 200
187 3300047443 Ga0495687_000369 Ga0495687_000369_6450_7094 200
188 3300047443 Ga0495687_000924 Ga0495687_000924_22620_23264 200
189 3300047443 Ga0495687_002679 Ga0495687_002679_8782_9432 200
190 3300047444 Ga0495675_0008485 Ga0495675_0008485_2057_2710 200
191 3300047445 Ga0495677_0000910 Ga0495677_0000910_5144_5806 200
192 3300047445 Ga0495677_0005688 Ga0495677_0005688_1347_2015 200
193 3300047445 Ga0495677_0012898 Ga0495677_0012898_992_1642 200
194 3300047445 Ga0495677_0025475 Ga0495677_0025475_680_1342 200
195 3300047447 Ga0495685_012712 Ga0495685_012712_1065_1727 200
196 3300047470 Ga0495681_0000016 Ga0495681_0000016_116270_116938 200
197 3300047470 Ga0495681_0000658 Ga0495681_0000658_442_1110 200
198 3300047470 Ga0495681_0006172 Ga0495681_0006172_7088_7738 200
199 3300047470 Ga0495681_0019397 Ga0495681_0019397_890_1552 200
200 3300047472 Ga0495686_0000146 Ga0495686_0000146_80547_81209 200
201 3300047472 Ga0495686_0017581 Ga0495686_0017581_2527_3165 200
202 3300047472 Ga0495686_0057450 Ga0495686_0057450_345_1007 200
203 3300048088 Ga0495602_0026419 Ga0495602_0026419_520_1167 200
204 3300048090 Ga0495615_0036450 Ga0495615_0036450_281_925 200
205 3300048091 Ga0495626_0021288 Ga0495626_0021288_745_1407 200
206 3300048903 Ga0496100_0190993 Ga0496100_0190993_294_935 200
207 3300048904 Ga0496101_0201911 Ga0496101_0201911_823_1464 200
208 3300048905 Ga0496102_0206472 Ga0496102_0206472_416_1057 200
209 3300048906 Ga0496103_0243090 Ga0496103_0243090_250_891 200
210 3300048908 Ga0496105_0069371 Ga0496105_0069371_2032_2673 200
211 3300048910 Ga0496107_0274533 Ga0496107_0274533_293_934 200
212 3300048911 Ga0496108_0041368 Ga0496108_0041368_1543_2184 200
213 3300048912 Ga0496109_0207592 Ga0496109_0207592_1094_1735 200
214 3300048913 Ga0496110_0080787 Ga0496110_0080787_2079_2720 200
215 3300048914 Ga0496111_0081081 Ga0496111_0081081_721_1362 200
216 3300048917 Ga0496114_0032300 Ga0496114_0032300_3454_4116 200
217 3300048925 Ga0496122_0019858 Ga0496122_0019858_521_1168 200
218 3300048927 Ga0496124_0155339 Ga0496124_0155339_695_1357 200
219 3300049459 Ga0495678_000024 Ga0495678_000024_136336_136998 200
220 3300049459 Ga0495678_000061 Ga0495678_000061_94130_94780 200
221 3300049459 Ga0495678_005899 Ga0495678_005899_5237_5881 200
222 3300049459 Ga0495678_022773 Ga0495678_022773_1810_2448 200
223 3300049459 Ga0495678_035769 Ga0495678_035769_1083_1727 200
224 3300049460 Ga0495682_0001519 Ga0495682_0001519_5066_5716 200
225 3300049460 Ga0495682_0015985 Ga0495682_0015985_2015_2677 200
226 3300049529 Ga0501313_000711 Ga0501313_000711_1086_1736 200
227 3300053118 Ga0500594_0046611 Ga0500594_0046611_346_987 200
228 3300059491 Ga0587070_008462 Ga0587070_008462_719_1381 200
229 3300059503 Ga0587080_013453 Ga0587080_013453_55_705 200
230 3300059505 Ga0587083_0032420 Ga0587083_0032420_165_815 200
231 3300059645 Ga0587076_063013 Ga0587076_063013_53_715 200
232 3300061719 Ga0466962_0068362 Ga0466962_0068362_786_1442 200
233 3300028794 Ga0307515_10000921 Ga0307515_1000092150 201
234 3300046453 Ga0495627_011318 Ga0495627_011318_1310_1957 201
235 3300046491 Ga0495584_0028515 Ga0495584_0028515_200_847 201
236 3300046492 Ga0495585_0012851 Ga0495585_0012851_1875_2522 201
237 3300046500 Ga0495596_0000508 Ga0495596_0000508_3397_4044 201
238 3300046501 Ga0495607_0212452 Ga0495607_0212452_221_868 201
239 3300046507 Ga0495606_0220410 Ga0495606_0220410_239_886 201
240 3300046518 Ga0495631_0029987 Ga0495631_0029987_358_1005 201
241 3300046518 Ga0495631_0038814 Ga0495631_0038814_104_751 201
242 3300046523 Ga0495644_0017201 Ga0495644_0017201_627_1274 201
243 3300046525 Ga0495663_0061670 Ga0495663_0061670_97_744 201
244 3300046542 Ga0495597_0008907 Ga0495597_0008907_503_1150 201
245 3300046558 Ga0495633_0005693 Ga0495633_0005693_4104_4751 201
246 3300046615 Ga0495656_0001583 Ga0495656_0001583_2324_2971 201
247 3300046616 Ga0495668_0036883 Ga0495668_0036883_218_865 201
248 3300046665 Ga0495661_0068329 Ga0495661_0068329_1265_1912 201
249 3300046665 Ga0495661_0068964 Ga0495661_0068964_339_986 201
250 3300046691 Ga0495670_0003614 Ga0495670_0003614_104_751 201
251 3300046691 Ga0495670_0022929 Ga0495670_0022929_1451_2098 201
252 3300047445 Ga0495677_0037543 Ga0495677_0037543_274_921 201
253 3300047469 Ga0495673_0000003 Ga0495673_0000003_1196560_1197213 201
254 3300047470 Ga0495681_0004943 Ga0495681_0004943_342_989 201
255 3300048090 Ga0495615_0042955 Ga0495615_0042955_100_747 201
256 3300031711 Ga0265314_10064978 Ga0265314_100649782 202
257 3300046501 Ga0495607_0047554 Ga0495607_0047554_404_1072 202
258 3300046526 Ga0495666_0000042 Ga0495666_0000042_44654_45304 202
259 3300046538 Ga0495609_0186241 Ga0495609_0186241_104_772 202
260 3300046665 Ga0495661_0145386 Ga0495661_0145386_99_767 202
261 3300048920 Ga0496117_0001291 Ga0496117_0001291_18318_18965 202
262 3300048921 Ga0496118_0000579 Ga0496118_0000579_23742_24389 202
263 3300048927 Ga0496124_0008353 Ga0496124_0008353_9022_9669 202
264 3300005262 Ga0065165_1007939 Ga0065165_10079395 203
265 3300006028 Ga0070717_10055546 Ga0070717_100555463 203
266 3300010375 Ga0105239_10005669 Ga0105239_100056696 203
267 3300014326 Ga0157380_10742090 Ga0157380_107420902 203
268 3300025909 Ga0207705_10267779 Ga0207705_102677792 203
269 3300028794 Ga0307515_10419150 Ga0307515_104191502 203
270 3300031995 Ga0307409_100965372 Ga0307409_1009653722 203
271 3300035111 Ga0373923_0207723 Ga0373923_0207723_273_884 203
272 3300035117 Ga0373953_0100978 Ga0373953_0100978_291_902 203
273 3300044765 Ga0466970_0117361 Ga0466970_0117361_292_945 203
274 3300046457 Ga0495590_0001057 Ga0495590_0001057_2034_2657 203
275 3300046460 Ga0495638_0056554 Ga0495638_0056554_161_802 203
276 3300046501 Ga0495607_0044662 Ga0495607_0044662_149_808 203
277 3300046507 Ga0495606_0015743 Ga0495606_0015743_3336_3995 203
278 3300046512 Ga0495610_0006766 Ga0495610_0006766_5879_6520 203
279 3300046512 Ga0495610_0060835 Ga0495610_0060835_925_1566 203
280 3300046522 Ga0495643_0000028 Ga0495643_0000028_241627_242268 203
281 3300046524 Ga0495648_0006784 Ga0495648_0006784_5062_5703 203
282 3300046536 Ga0495587_0182111 Ga0495587_0182111_17_628 203
283 3300046542 Ga0495597_0000072 Ga0495597_0000072_18048_18689 203
284 3300046558 Ga0495633_0000055 Ga0495633_0000055_3479_4123 203
285 3300046558 Ga0495633_0031404 Ga0495633_0031404_1656_2297 203
286 3300046660 Ga0495625_0095803 Ga0495625_0095803_291_935 203
287 3300046683 Ga0495658_0103700 Ga0495658_0103700_23_634 203
288 3300046683 Ga0495658_0192797 Ga0495658_0192797_637_1248 203
289 3300046684 Ga0495669_0003845 Ga0495669_0003845_5029_5640 203
290 3300046694 Ga0495649_0049519 Ga0495649_0049519_525_1166 203
291 3300047320 Ga0495672_0005042 Ga0495672_0005042_6384_7025 203
292 3300047322 Ga0495680_0246890 Ga0495680_0246890_490_1110 203
293 3300049459 Ga0495678_001099 Ga0495678_001099_17526_18167 203
294 3300050493 nmdc:mga0k408_78977_c1 nmdc:mga0k408_78977_c1_1199_1810 203
295 3300050496 nmdc:mga07m45_37452_c1 nmdc:mga07m45_37452_c1_351_962 203
296 3300053084 Ga0495595_0165436 Ga0495595_0165436_14_625 203
297 3300053145 Ga0500586_002700 Ga0500586_002700_3222_3863 203
298 3300053161 Ga0500634_0175155 Ga0500634_0175155_28_639 203
299 3300005345 Ga0070692_10220545 Ga0070692_102205452 204
300 3300005456 Ga0070678_100065700 Ga0070678_1000657004 204
301 3300005456 Ga0070678_101194587 Ga0070678_1011945871 204
302 3300013308 Ga0157375_10027645 Ga0157375_100276458 204
303 3300025899 Ga0207642_10180201 Ga0207642_101802011 204
304 3300026067 Ga0207678_10316580 Ga0207678_103165802 204
305 3300026121 Ga0207683_10893345 Ga0207683_108933452 204
306 3300039447 Ga0436361_0739886 Ga0436361_0739886_18_635 204
307 3300044684 Ga0466966_0068519 Ga0466966_0068519_1487_2143 204
308 3300044693 Ga0466961_0009907 Ga0466961_0009907_4315_4971 204
309 3300044735 Ga0466968_0060109 Ga0466968_0060109_892_1506 204
310 3300045049 Ga0466959_0019544 Ga0466959_0019544_3704_4360 204
311 3300045051 Ga0451576_0134953 Ga0451576_0134953_1655_2305 204
312 3300045976 Ga0466967_0588214 Ga0466967_0588214_324_986 204
313 3300050515 nmdc:mga0a205_648526_c1 nmdc:mga0a205_648526_c1_166_816 204
314 3300061734 Ga0530510_0417292 Ga0530510_0417292_359_976 204
315 3300003322 rootL2_10132830 rootL2_101328302 205
316 3300003320 rootH2_10004328 rootH2_1000432810 206
317 3300003323 rootH1_10048604 rootH1_100486047 206
318 3300044694 Ga0466963_0089659 Ga0466963_0089659_1081_1725 206
319 3300044842 Ga0466957_0130055 Ga0466957_0130055_341_985 206
320 3300045836 Ga0466958_0025530 Ga0466958_0025530_83_727 206
321 3300045976 Ga0466967_0128037 Ga0466967_0128037_617_1261 206
322 iso_pu_bacteria 2881927736 2881929484 206
323 3300005262 Ga0065165_1066496 Ga0065165_10664962 207
324 3300037471 Ga0395905_0276889 Ga0395905_0276889_613_1269 207
325 3300046528 Ga0495642_0000713 Ga0495642_0000713_15708_16355 207
326 3300047472 Ga0495686_0003433 Ga0495686_0003433_4704_5360 207
327 iso_pu_bacteria 2576861471 2578458660 207
328 iso_pu_bacteria 2643221577 2643894572 207
329 iso_pu_bacteria 2643221660 2644338882 207
330 iso_pu_bacteria 2643221685 2644476726 207
331 iso_pu_bacteria 2738541275 2738713138 207
332 iso_pu_bacteria 2738541301 2738851561 207
333 iso_pu_bacteria 2738541304 2738867292 207
334 iso_pu_bacteria 2738543022 2739299808 207
335 iso_pu_bacteria 2738543033 2739361488 207
336 iso_pu_bacteria 2747842428 2747948227 207
337 iso_pu_bacteria 2747842428 2747948626 207
338 iso_pu_bacteria 2818991438 2819553710 207
339 iso_pu_bacteria 2857442823 2857446001 207
340 iso_pu_bacteria 2919709256 2919710078 207
341 iso_pu_bacteria 2928100450 2928104676 207
342 iso_pu_bacteria 2939622612 2939622995 207
343 3300025916 Ga0207663_10085290 Ga0207663_100852903 208
344 3300025961 Ga0207712_10312631 Ga0207712_103126312 208
345 3300031852 Ga0307410_10702481 Ga0307410_107024812 208
346 3300038443 Ga0395901_0472872 Ga0395901_0472872_459_1085 208
347 3300046475 Ga0495639_0113686 Ga0495639_0113686_357_1001 208
348 3300049583 Ga0501067_0051471 Ga0501067_0051471_1168_1794 208
349 3300049589 Ga0501073_0000012 Ga0501073_0000012_83179_83805 208
350 3300053140 Ga0500573_0005953 Ga0500573_0005953_1215_1850 208
351 iso_pu_bacteria 2513237150 2513953387 208
352 iso_pu_bacteria 2513237165 2514044665 208
353 iso_pu_bacteria 2885080285 2885084143 208
354 iso_pu_bacteria 2996221748 2996222241 208
355 iso_pu_bacteria 644736347 644750265 208
356 3300005365 Ga0070688_100115903 Ga0070688_1001159031 209
357 3300005617 Ga0068859_100000102 Ga0068859_10000010260 209
358 3300005844 Ga0068862_100000273 Ga0068862_10000027326 209
359 3300006038 Ga0075365_10176804 Ga0075365_101768042 209
360 3300006931 Ga0097620_100000102 Ga0097620_10000010260 209
361 3300009553 Ga0105249_10014726 Ga0105249_100147265 209
362 3300025961 Ga0207712_10007985 Ga0207712_100079854 209
363 3300028380 Ga0268265_10000174 Ga0268265_1000017444 209
364 3300045836 Ga0466958_0125049 Ga0466958_0125049_52_708 209
365 iso_pu_bacteria 2585428057 2587730616 209
366 iso_pu_bacteria 2585428058 2587736839 209
367 iso_pu_bacteria 2588253510 2588294911 209
368 iso_pu_bacteria 2643221546 2643752234 209
369 iso_pu_bacteria 2738541280 2738740503 209
370 iso_pu_bacteria 2738541300 2738843244 209
371 iso_pu_bacteria 2738543018 2739272119 209
372 iso_pu_bacteria 2738543030 2739341163 209
373 iso_pu_bacteria 2842733646 2842737562 209
374 iso_pu_bacteria 2847930680 2847933222 209
375 iso_pu_bacteria 2885270888 2885277564 209
376 3300002987 JGI25159J45721_1002305 JGI25159J45721_10023056 210
377 3300003354 JGI25160J50197_1001072 JGI25160J50197_10010727 210
378 3300003763 Ga0055529_1002255 Ga0055529_10022554 210
379 3300003791 Ga0055530_10014555 Ga0055530_100145553 210
380 3300004625 Ga0055543_1000239 Ga0055543_100023924 210
381 3300005262 Ga0065165_1069390 Ga0065165_10693901 210
382 3300005347 Ga0070668_100001214 Ga0070668_1000012141 210
383 3300005355 Ga0070671_100339872 Ga0070671_1003398722 210
384 3300005367 Ga0070667_100012675 Ga0070667_1000126754 210
385 3300005549 Ga0070704_100541400 Ga0070704_1005414002 210
386 3300005617 Ga0068859_100537833 Ga0068859_1005378332 210
387 3300005841 Ga0068863_100002708 Ga0068863_10000270817 210
388 3300006038 Ga0075365_10001342 Ga0075365_100013427 210
389 3300006051 Ga0075364_10027807 Ga0075364_100278074 210
390 3300006931 Ga0097620_100537858 Ga0097620_1005378582 210
391 3300011119 Ga0105246_10086329 Ga0105246_100863293 210
392 3300011119 Ga0105246_10107020 Ga0105246_101070202 210
393 3300013296 Ga0157374_10139663 Ga0157374_101396633 210
394 3300025228 Ga0209672_103863 Ga0209672_1038633 210
395 3300025242 Ga0209258_106772 Ga0209258_1067723 210
396 3300025272 Ga0209455_1002615 Ga0209455_10026153 210
397 3300025284 Ga0209130_1000095 Ga0209130_100009549 210
398 3300025298 Ga0209050_1012100 Ga0209050_10121002 210
399 3300025302 Ga0207426_1001496 Ga0207426_100149616 210
400 3300025922 Ga0207646_10140866 Ga0207646_101408662 210
401 3300025931 Ga0207644_10136038 Ga0207644_101360382 210
402 3300025941 Ga0207711_10000398 Ga0207711_1000039825 210
403 3300025972 Ga0207668_10001633 Ga0207668_100016331 210
404 3300025986 Ga0207658_10010287 Ga0207658_100102877 210
405 3300026088 Ga0207641_10134324 Ga0207641_101343244 210
406 3300026118 Ga0207675_100145269 Ga0207675_1001452693 210
407 3300028577 Ga0265318_10113080 Ga0265318_101130802 210
408 3300031250 Ga0265331_10008658 Ga0265331_100086583 210
409 3300031616 Ga0307508_10002291 Ga0307508_100022916 210
410 3300031995 Ga0307409_100069488 Ga0307409_1000694883 210
411 3300031995 Ga0307409_101046293 Ga0307409_1010462932 210
412 3300032126 Ga0307415_100079860 Ga0307415_1000798603 210
413 3300044684 Ga0466966_0310483 Ga0466966_0310483_245_919 210
414 3300044693 Ga0466961_0002332 Ga0466961_0002332_4444_5118 210
415 3300044765 Ga0466970_0050844 Ga0466970_0050844_544_1218 210
416 3300045049 Ga0466959_0184894 Ga0466959_0184894_34_708 210
417 3300045836 Ga0466958_0020593 Ga0466958_0020593_1021_1695 210
418 3300045976 Ga0466967_0054425 Ga0466967_0054425_1217_1855 210
419 3300046452 Ga0495617_000150 Ga0495617_000150_12179_12811 210
420 3300046460 Ga0495638_0000034 Ga0495638_0000034_159734_160366 210
421 3300046463 Ga0495653_0002434 Ga0495653_0002434_10045_10695 210
422 3300046501 Ga0495607_0000010 Ga0495607_0000010_190541_191173 210
423 3300046501 Ga0495607_0002953 Ga0495607_0002953_10798_11436 210
424 3300046501 Ga0495607_0008769 Ga0495607_0008769_4132_4773 210
425 3300046501 Ga0495607_0073599 Ga0495607_0073599_131_772 210
426 3300046506 Ga0495583_0000574 Ga0495583_0000574_37700_38332 210
427 3300046506 Ga0495583_0017679 Ga0495583_0017679_1081_1719 210
428 3300046513 Ga0495616_0010304 Ga0495616_0010304_1412_2050 210
429 3300046519 Ga0495632_0034637 Ga0495632_0034637_1444_2085 210
430 3300046520 Ga0495637_0003117 Ga0495637_0003117_3607_4239 210
431 3300046525 Ga0495663_0029574 Ga0495663_0029574_903_1544 210
432 3300046529 Ga0495652_0034272 Ga0495652_0034272_1068_1718 210
433 3300046535 Ga0495586_0187068 Ga0495586_0187068_153_803 210
434 3300046536 Ga0495587_0177490 Ga0495587_0177490_198_848 210
435 3300046538 Ga0495609_0001891 Ga0495609_0001891_8038_8670 210
436 3300046538 Ga0495609_0003441 Ga0495609_0003441_6258_6896 210
437 3300046542 Ga0495597_0000227 Ga0495597_0000227_26968_27618 210
438 3300046616 Ga0495668_0174317 Ga0495668_0174317_229_879 210
439 3300046642 Ga0495634_0035042 Ga0495634_0035042_2575_3225 210
440 3300046648 Ga0495611_0000001 Ga0495611_0000001_1168938_1169570 210
441 3300046660 Ga0495625_0000001 Ga0495625_0000001_746468_747100 210
442 3300046660 Ga0495625_0001594 Ga0495625_0001594_24147_24785 210
443 3300046684 Ga0495669_0070249 Ga0495669_0070249_58_696 210
444 3300046692 Ga0495671_0000129 Ga0495671_0000129_14329_14961 210
445 3300046694 Ga0495649_0004200 Ga0495649_0004200_2006_2644 210
446 3300046794 Ga0495589_0000048 Ga0495589_0000048_93683_94315 210
447 3300046794 Ga0495589_0000112 Ga0495589_0000112_53617_54267 210
448 3300046810 Ga0495660_0000008 Ga0495660_0000008_112340_112972 210
449 3300046810 Ga0495660_0015575 Ga0495660_0015575_3154_3792 210
450 3300047317 Ga0495604_0131275 Ga0495604_0131275_697_1347 210
451 3300047318 Ga0495636_0015324 Ga0495636_0015324_987_1625 210
452 3300047443 Ga0495687_134554 Ga0495687_134554_89_727 210
453 3300047445 Ga0495677_0007740 Ga0495677_0007740_2189_2827 210
454 3300047446 Ga0495679_000001 Ga0495679_000001_417386_418018 210
455 3300047446 Ga0495679_002909 Ga0495679_002909_4433_5071 210
456 3300047469 Ga0495673_0000089 Ga0495673_0000089_16016_16648 210
457 3300047470 Ga0495681_0022548 Ga0495681_0022548_12_650 210
458 3300048903 Ga0496100_0013632 Ga0496100_0013632_2512_3159 210
459 3300048904 Ga0496101_0003543 Ga0496101_0003543_1762_2409 210
460 3300048905 Ga0496102_0000103 Ga0496102_0000103_79813_80460 210
461 3300048906 Ga0496103_0000036 Ga0496103_0000036_85441_86088 210
462 3300048907 Ga0496104_0085803 Ga0496104_0085803_512_1159 210
463 3300048908 Ga0496105_0061406 Ga0496105_0061406_601_1248 210
464 3300048917 Ga0496114_0101033 Ga0496114_0101033_61_708 210
465 3300048919 Ga0496116_0000160 Ga0496116_0000160_41792_42439 210
466 3300048920 Ga0496117_0000202 Ga0496117_0000202_41808_42455 210
467 3300048921 Ga0496118_0000318 Ga0496118_0000318_41808_42455 210
468 3300048922 Ga0496119_0000480 Ga0496119_0000480_16342_16989 210
469 3300048923 Ga0496120_0031643 Ga0496120_0031643_2194_2841 210
470 3300048924 Ga0496121_0012029 Ga0496121_0012029_6164_6811 210
471 3300048929 Ga0496126_0000116 Ga0496126_0000116_41809_42456 210
472 3300049459 Ga0495678_000080 Ga0495678_000080_102653_103285 210
473 3300049460 Ga0495682_0000284 Ga0495682_0000284_23039_23671 210
474 3300049822 Ga0501035_0006617 Ga0501035_0006617_990_1628 210
475 3300049822 Ga0501035_0120648 Ga0501035_0120648_279_917 210
476 3300049823 Ga0501044_0000236 Ga0501044_0000236_68439_69077 210
477 3300050491 nmdc:mga00v17_96686_c1 nmdc:mga00v17_96686_c1_536_1192 210
478 3300050492 nmdc:mga0yw44_1980_c1 nmdc:mga0yw44_1980_c1_1183_1839 210
479 3300050492 nmdc:mga0yw44_4987_c1 nmdc:mga0yw44_4987_c1_817_1449 210
480 3300050492 nmdc:mga0yw44_96069_c1 nmdc:mga0yw44_96069_c1_1086_1718 210
481 3300053103 Ga0500555_000019 Ga0500555_000019_94165_94797 210
482 3300053118 Ga0500594_0022935 Ga0500594_0022935_288_920 210
483 iso_pu_bacteria 2511231002 2511242871 210
484 iso_pu_bacteria 2551306352 2552748891 210
485 iso_pu_bacteria 2551306352 2552748931 210
486 iso_pu_bacteria 2639762793 2640735110 210
487 iso_pu_bacteria 2643221665 2644364146 210
488 iso_pu_bacteria 2675903507 2678231389 210
489 iso_pu_bacteria 2675903507 2678231430 210
490 iso_pu_bacteria 2675903507 2678231991 210
491 iso_pu_bacteria 2773857770 2774437126 210
492 iso_pu_bacteria 2773857770 2774437166 210
493 iso_pu_bacteria 2894023352 2894027253 210
494 iso_pu_bacteria 2919182534 2919182614 210
495 iso_pu_bacteria 2919182534 2919182654 210
496 iso_pu_bacteria 2919506607 2919506797 210
497 iso_pu_bacteria 2928515477 2928515685 210
498 iso_pu_bacteria 2928515477 2928519666 210
499 iso_pu_bacteria 2974320154 2974320572 210
500 iso_pu_bacteria 8033232454 8033234522 210
501 3300002774 JGI25150J39212_1002842 JGI25150J39212_10028426 211
502 3300003187 JGI25151J46595_10025792 JGI25151J46595_100257923 211
503 3300003771 Ga0055526_1016030 Ga0055526_10160302 211
504 3300003773 Ga0055537_1005089 Ga0055537_10050892 211
505 3300003775 Ga0055524_1000331 Ga0055524_100033131 211
506 3300003784 Ga0055534_1000031 Ga0055534_100003132 211
507 3300003784 Ga0055534_1011496 Ga0055534_10114962 211
508 3300003791 Ga0055530_10002703 Ga0055530_100027032 211
509 3300005331 Ga0070670_100065195 Ga0070670_1000651952 211
510 3300005337 Ga0070682_100010437 Ga0070682_1000104373 211
511 3300005341 Ga0070691_10002978 Ga0070691_100029783 211
512 3300005344 Ga0070661_100093040 Ga0070661_1000930402 211
513 3300005354 Ga0070675_100131608 Ga0070675_1001316082 211
514 3300005439 Ga0070711_100185451 Ga0070711_1001854512 211
515 3300005456 Ga0070678_100004688 Ga0070678_1000046883 211
516 3300005539 Ga0068853_100322409 Ga0068853_1003224092 211
517 3300005547 Ga0070693_100001130 Ga0070693_1000011306 211
518 3300005616 Ga0068852_100007122 Ga0068852_1000071226 211
519 3300005617 Ga0068859_100157686 Ga0068859_1001576862 211
520 3300005719 Ga0068861_100187120 Ga0068861_1001871202 211
521 3300005834 Ga0068851_10003029 Ga0068851_100030293 211
522 3300005840 Ga0068870_10004266 Ga0068870_100042665 211
523 3300005841 Ga0068863_100002676 Ga0068863_1000026763 211
524 3300006042 Ga0075368_10012672 Ga0075368_100126723 211
525 3300006051 Ga0075364_10268827 Ga0075364_102688272 211
526 3300006178 Ga0075367_10070788 Ga0075367_100707882 211
527 3300006195 Ga0075366_10119074 Ga0075366_101190742 211
528 3300006353 Ga0075370_10041784 Ga0075370_100417842 211
529 3300006358 Ga0068871_100173275 Ga0068871_1001732752 211
530 3300006844 Ga0075428_100128714 Ga0075428_1001287143 211
531 3300006847 Ga0075431_100143311 Ga0075431_1001433111 211
532 3300006852 Ga0075433_10030675 Ga0075433_100306751 211
533 3300006871 Ga0075434_100002700 Ga0075434_1000027003 211
534 3300006914 Ga0075436_100001293 Ga0075436_10000129314 211
535 3300006931 Ga0097620_100157690 Ga0097620_1001576902 211
536 3300009094 Ga0111539_10000829 Ga0111539_100008296 211
537 3300009094 Ga0111539_10073415 Ga0111539_100734151 211
538 3300009101 Ga0105247_10013390 Ga0105247_100133904 211
539 3300009174 Ga0105241_10002429 Ga0105241_100024293 211
540 3300009177 Ga0105248_10116926 Ga0105248_101169263 211
541 3300009545 Ga0105237_10052722 Ga0105237_100527224 211
542 3300009551 Ga0105238_10044844 Ga0105238_100448442 211
543 3300011119 Ga0105246_10006706 Ga0105246_100067064 211
544 3300013102 Ga0157371_10000337 Ga0157371_1000033719 211
545 3300013102 Ga0157371_10293702 Ga0157371_102937022 211
546 3300013104 Ga0157370_10028779 Ga0157370_100287795 211
547 3300013104 Ga0157370_10060408 Ga0157370_100604082 211
548 3300014497 Ga0182008_10000115 Ga0182008_1000011538 211
549 3300014497 Ga0182008_10130397 Ga0182008_101303972 211
550 3300014968 Ga0157379_10004351 Ga0157379_100043514 211
551 3300015262 Ga0182007_10000103 Ga0182007_1000010319 211
552 3300015262 Ga0182007_10120962 Ga0182007_101209622 211
553 3300017792 Ga0163161_10002266 Ga0163161_100022669 211
554 3300017792 Ga0163161_10008437 Ga0163161_100084373 211
555 3300020069 Ga0197907_10974739 Ga0197907_109747391 211
556 3300020070 Ga0206356_10543351 Ga0206356_105433514 211
557 3300020081 Ga0206354_10161263 Ga0206354_101612632 211
558 3300025245 Ga0207425_1001894 Ga0207425_10018949 211
559 3300025263 Ga0209565_1000072 Ga0209565_100007271 211
560 3300025263 Ga0209565_1004904 Ga0209565_10049044 211
561 3300025291 Ga0209675_1000049 Ga0209675_1000049109 211
562 3300025291 Ga0209675_1004344 Ga0209675_10043444 211
563 3300025292 Ga0209676_1018411 Ga0209676_10184113 211
564 3300025294 Ga0209025_1013182 Ga0209025_10131823 211
565 3300025295 Ga0209564_1000130 Ga0209564_100013070 211
566 3300025297 Ga0209758_1023004 Ga0209758_10230042 211
567 3300025298 Ga0209050_1000192 Ga0209050_100019263 211
568 3300025299 Ga0209256_1000126 Ga0209256_100012670 211
569 3300025303 Ga0209051_1031038 Ga0209051_10310381 211
570 3300025321 Ga0207656_10095323 Ga0207656_100953232 211
571 3300025900 Ga0207710_10019305 Ga0207710_100193053 211
572 3300025901 Ga0207688_10001145 Ga0207688_100011453 211
573 3300025907 Ga0207645_10012427 Ga0207645_100124276 211
574 3300025909 Ga0207705_10540780 Ga0207705_105407802 211
575 3300025912 Ga0207707_10680289 Ga0207707_106802891 211
576 3300025913 Ga0207695_10540200 Ga0207695_105402002 211
577 3300025914 Ga0207671_10021108 Ga0207671_100211083 211
578 3300025924 Ga0207694_10029537 Ga0207694_100295372 211
579 3300025925 Ga0207650_10007054 Ga0207650_100070544 211
580 3300025925 Ga0207650_10048331 Ga0207650_100483312 211
581 3300025931 Ga0207644_10707161 Ga0207644_107071611 211
582 3300025981 Ga0207640_10082887 Ga0207640_100828872 211
583 3300026041 Ga0207639_10550354 Ga0207639_105503542 211
584 3300026067 Ga0207678_10000720 Ga0207678_1000072018 211
585 3300026075 Ga0207708_10047203 Ga0207708_100472032 211
586 3300026088 Ga0207641_10021577 Ga0207641_100215775 211
587 3300026095 Ga0207676_10001854 Ga0207676_100018546 211
588 3300026116 Ga0207674_10246925 Ga0207674_102469252 211
589 3300026118 Ga0207675_100343238 Ga0207675_1003432382 211
590 3300026121 Ga0207683_10001996 Ga0207683_100019965 211
591 3300027866 Ga0209813_10063468 Ga0209813_100634682 211
592 3300027907 Ga0207428_10005656 Ga0207428_1000565613 211
593 3300027907 Ga0207428_10222568 Ga0207428_102225682 211
594 3300028379 Ga0268266_10026002 Ga0268266_100260025 211
595 3300031456 Ga0307513_10000113 Ga0307513_1000011398 211
596 3300031548 Ga0307408_100683939 Ga0307408_1006839392 211
597 3300031730 Ga0307516_10436618 Ga0307516_104366181 211
598 3300031731 Ga0307405_10376224 Ga0307405_103762242 211
599 3300032004 Ga0307414_10599218 Ga0307414_105992182 211
600 3300035691 Ga0373931_0307168 Ga0373931_0307168_186_830 211
601 3300037312 Ga0395899_0000005 Ga0395899_0000005_664674_665312 211
602 3300037418 Ga0395900_0000003 Ga0395900_0000003_107655_108293 211
603 3300037466 Ga0395898_0000003 Ga0395898_0000003_664694_665332 211
604 3300038443 Ga0395901_0189780 Ga0395901_0189780_25_690 211
605 3300038443 Ga0395901_0544468 Ga0395901_0544468_22_687 211
606 3300041406 Ga0439439_0016402 Ga0439439_0016402_337_990 211
607 3300041410 Ga0439461_0041974 Ga0439461_0041974_177_821 211
608 3300041452 Ga0451793_1256750 Ga0451793_1256750_2368_3009 211
609 3300042005 Ga0439448_0021716 Ga0439448_0021716_867_1541 211
610 3300044684 Ga0466966_0000035 Ga0466966_0000035_4393_5031 211
611 3300044693 Ga0466961_0000336 Ga0466961_0000336_26020_26658 211
612 3300044694 Ga0466963_0006557 Ga0466963_0006557_5298_5936 211
613 3300044719 Ga0466971_0009252 Ga0466971_0009252_290_928 211
614 3300044842 Ga0466957_0302846 Ga0466957_0302846_339_977 211
615 3300045049 Ga0466959_0005789 Ga0466959_0005789_950_1588 211
616 3300045836 Ga0466958_0039955 Ga0466958_0039955_885_1523 211
617 3300046453 Ga0495627_000598 Ga0495627_000598_18901_19557 211
618 3300046453 Ga0495627_014601 Ga0495627_014601_1252_1899 211
619 3300046453 Ga0495627_030390 Ga0495627_030390_37_684 211
620 3300046458 Ga0495591_062307 Ga0495591_062307_237_884 211
621 3300046460 Ga0495638_0002984 Ga0495638_0002984_9816_10463 211
622 3300046471 Ga0495650_0004075 Ga0495650_0004075_9229_9885 211
623 3300046491 Ga0495584_0000168 Ga0495584_0000168_40844_41482 211
624 3300046500 Ga0495596_0000016 Ga0495596_0000016_95259_95915 211
625 3300046500 Ga0495596_0001871 Ga0495596_0001871_530_1186 211
626 3300046501 Ga0495607_0006941 Ga0495607_0006941_2709_3365 211
627 3300046512 Ga0495610_0003668 Ga0495610_0003668_8177_8833 211
628 3300046512 Ga0495610_0005787 Ga0495610_0005787_1527_2183 211
629 3300046515 Ga0495620_0004589 Ga0495620_0004589_5944_6600 211
630 3300046522 Ga0495643_0000806 Ga0495643_0000806_23823_24479 211
631 3300046525 Ga0495663_0000430 Ga0495663_0000430_5255_5902 211
632 3300046525 Ga0495663_0000667 Ga0495663_0000667_1383_2030 211
633 3300046538 Ga0495609_0005560 Ga0495609_0005560_64_720 211
634 3300046538 Ga0495609_0028674 Ga0495609_0028674_1486_2133 211
635 3300046558 Ga0495633_0027144 Ga0495633_0027144_288_935 211
636 3300046615 Ga0495656_0215911 Ga0495656_0215911_52_696 211
637 3300047470 Ga0495681_0001103 Ga0495681_0001103_9231_9887 211
638 3300047470 Ga0495681_0090335 Ga0495681_0090335_449_1096 211
639 3300048090 Ga0495615_0000012 Ga0495615_0000012_29741_30397 211
640 3300048907 Ga0496104_0002829 Ga0496104_0002829_5783_6457 211
641 3300048908 Ga0496105_0030075 Ga0496105_0030075_2562_3209 211
642 3300048909 Ga0496106_0010373 Ga0496106_0010373_3556_4230 211
643 3300048911 Ga0496108_0015009 Ga0496108_0015009_521_1195 211
644 3300048913 Ga0496110_0026193 Ga0496110_0026193_4092_4766 211
645 3300048914 Ga0496111_0273641 Ga0496111_0273641_337_984 211
646 3300048915 Ga0496112_0215527 Ga0496112_0215527_375_1049 211
647 3300048916 Ga0496113_0002745 Ga0496113_0002745_8294_8941 211
648 3300048919 Ga0496116_0001705 Ga0496116_0001705_12323_13030 211
649 3300048919 Ga0496116_0007161 Ga0496116_0007161_8794_9441 211
650 3300048919 Ga0496116_0174638 Ga0496116_0174638_278_925 211
651 3300048920 Ga0496117_0000810 Ga0496117_0000810_40249_40896 211
652 3300048920 Ga0496117_0003022 Ga0496117_0003022_11657_12304 211
653 3300048920 Ga0496117_0226481 Ga0496117_0226481_299_997 211
654 3300048921 Ga0496118_0003511 Ga0496118_0003511_8738_9385 211
655 3300048921 Ga0496118_0005968 Ga0496118_0005968_1083_1730 211
656 3300048921 Ga0496118_0017237 Ga0496118_0017237_3815_4513 211
657 3300048922 Ga0496119_0004992 Ga0496119_0004992_290_937 211
658 3300048922 Ga0496119_0044188 Ga0496119_0044188_1239_1937 211
659 3300048923 Ga0496120_0000511 Ga0496120_0000511_23400_24047 211
660 3300048924 Ga0496121_0002018 Ga0496121_0002018_21484_22182 211
661 3300048924 Ga0496121_0003167 Ga0496121_0003167_14143_14790 211
662 3300048924 Ga0496121_0009473 Ga0496121_0009473_7238_7885 211
663 3300048925 Ga0496122_0005663 Ga0496122_0005663_5378_6025 211
664 3300048925 Ga0496122_0006221 Ga0496122_0006221_5993_6640 211
665 3300048925 Ga0496122_0008250 Ga0496122_0008250_1922_2569 211
666 3300048926 Ga0496123_0002081 Ga0496123_0002081_9146_9793 211
667 3300048926 Ga0496123_0004715 Ga0496123_0004715_10862_11509 211
668 3300048926 Ga0496123_0006472 Ga0496123_0006472_2536_3183 211
669 3300048926 Ga0496123_0095277 Ga0496123_0095277_156_854 211
670 3300048927 Ga0496124_0003904 Ga0496124_0003904_6576_7223 211
671 3300048927 Ga0496124_0005128 Ga0496124_0005128_2623_3270 211
672 3300048927 Ga0496124_0007020 Ga0496124_0007020_3795_4442 211
673 3300048927 Ga0496124_0007341 Ga0496124_0007341_2895_3542 211
674 3300048927 Ga0496124_0310325 Ga0496124_0310325_157_855 211
675 3300048928 Ga0496125_0000166 Ga0496125_0000166_101116_101814 211
676 3300048928 Ga0496125_0001775 Ga0496125_0001775_13222_13869 211
677 3300048928 Ga0496125_0005574 Ga0496125_0005574_2731_3378 211
678 3300048928 Ga0496125_0018022 Ga0496125_0018022_5626_6276 211
679 3300048928 Ga0496125_0294352 Ga0496125_0294352_282_923 211
680 3300048929 Ga0496126_0036200 Ga0496126_0036200_1024_1671 211
681 3300048929 Ga0496126_0046931 Ga0496126_0046931_683_1381 211
682 3300049459 Ga0495678_074579 Ga0495678_074579_442_1083 211
683 3300050510 nmdc:mga06r32_148815_c1 nmdc:mga06r32_148815_c1_874_1548 211
684 3300050511 nmdc:mga08y16_111071_c1 nmdc:mga08y16_111071_c1_368_1021 211
685 3300050513 nmdc:mga0rr50_229454_c1 nmdc:mga0rr50_229454_c1_408_1082 211
686 3300050514 nmdc:mga08x19_6630_c1 nmdc:mga08x19_6630_c1_5916_6590 211
687 3300050515 nmdc:mga0a205_30059_c1 nmdc:mga0a205_30059_c1_4332_5006 211
688 3300053088 Ga0500644_0143440 Ga0500644_0143440_229_870 211
689 3300053090 Ga0500646_0074727 Ga0500646_0074727_318_959 211
690 3300053093 Ga0500651_0018685 Ga0500651_0018685_1912_2559 211
691 3300053093 Ga0500651_0065804 Ga0500651_0065804_1524_2165 211
692 3300053131 Ga0500652_000792 Ga0500652_000792_9871_10512 211
693 3300053156 Ga0500622_0000146 Ga0500622_0000146_58457_59098 211
694 3300061719 Ga0466962_0047494 Ga0466962_0047494_32_670 211
695 iso_pu_bacteria 2599185292 2599902574 211
696 iso_pu_bacteria 2643221569 2643861368 211
697 iso_pu_bacteria 2643221621 2644123777 211
698 iso_pu_bacteria 2857537821 2857541740 211
699 3300001989 JGI24739J22299_10069019 JGI24739J22299_100690192 212
700 3300002077 JGI24744J21845_10002945 JGI24744J21845_100029452 212
701 3300002737 JGI25162J39368_1005763 JGI25162J39368_10057632 212
702 3300003187 JGI25151J46595_10004466 JGI25151J46595_100044666 212
703 3300003316 rootH1_10018504 rootH1_100185042 212
704 3300003374 JGI25161J50226_1000013 JGI25161J50226_100001361 212
705 3300003856 Ga0058692_1000051 Ga0058692_1000051101 212
706 3300005272 Ga0065703_1021859 Ga0065703_10218592 212
707 3300005289 Ga0065704_10004515 Ga0065704_100045152 212
708 3300005289 Ga0065704_10011001 Ga0065704_100110012 212
709 3300005289 Ga0065704_10011853 Ga0065704_100118532 212
710 3300005289 Ga0065704_10013108 Ga0065704_100131082 212
711 3300005289 Ga0065704_10111899 Ga0065704_101118992 212
712 3300005289 Ga0065704_10118072 Ga0065704_101180722 212
713 3300005289 Ga0065704_10121111 Ga0065704_101211111 212
714 3300005289 Ga0065704_10371111 Ga0065704_103711111 212
715 3300005295 Ga0065707_10021373 Ga0065707_100213731 212
716 3300005327 Ga0070658_10000050 Ga0070658_10000050119 212
717 3300005328 Ga0070676_10015306 Ga0070676_100153062 212
718 3300005328 Ga0070676_10115083 Ga0070676_101150832 212
719 3300005329 Ga0070683_100195024 Ga0070683_1001950242 212
720 3300005330 Ga0070690_100344715 Ga0070690_1003447151 212
721 3300005331 Ga0070670_100063805 Ga0070670_1000638052 212
722 3300005331 Ga0070670_100236638 Ga0070670_1002366382 212
723 3300005331 Ga0070670_100429365 Ga0070670_1004293651 212
724 3300005334 Ga0068869_100098293 Ga0068869_1000982932 212
725 3300005335 Ga0070666_10022663 Ga0070666_100226634 212
726 3300005338 Ga0068868_100041322 Ga0068868_1000413223 212
727 3300005338 Ga0068868_100394124 Ga0068868_1003941241 212
728 3300005339 Ga0070660_100115496 Ga0070660_1001154962 212
729 3300005340 Ga0070689_100069857 Ga0070689_1000698573 212
730 3300005347 Ga0070668_100008872 Ga0070668_1000088722 212
731 3300005353 Ga0070669_100260598 Ga0070669_1002605982 212
732 3300005353 Ga0070669_100378931 Ga0070669_1003789311 212
733 3300005354 Ga0070675_100311297 Ga0070675_1003112972 212
734 3300005355 Ga0070671_100097719 Ga0070671_1000977193 212
735 3300005365 Ga0070688_100010538 Ga0070688_1000105384 212
736 3300005365 Ga0070688_100145208 Ga0070688_1001452082 212
737 3300005367 Ga0070667_100167634 Ga0070667_1001676343 212
738 3300005406 Ga0070703_10199704 Ga0070703_101997041 212
739 3300005434 Ga0070709_10430341 Ga0070709_104303412 212
740 3300005440 Ga0070705_100074739 Ga0070705_1000747393 212
741 3300005445 Ga0070708_100006204 Ga0070708_1000062047 212
742 3300005455 Ga0070663_100325544 Ga0070663_1003255442 212
743 3300005456 Ga0070678_100001422 Ga0070678_10000142211 212
744 3300005456 Ga0070678_100318857 Ga0070678_1003188572 212
745 3300005458 Ga0070681_10042215 Ga0070681_100422154 212
746 3300005459 Ga0068867_100000817 Ga0068867_10000081720 212
747 3300005471 Ga0070698_100039235 Ga0070698_1000392353 212
748 3300005471 Ga0070698_100289305 Ga0070698_1002893052 212
749 3300005518 Ga0070699_100550962 Ga0070699_1005509622 212
750 3300005539 Ga0068853_100616769 Ga0068853_1006167692 212
751 3300005543 Ga0070672_100050901 Ga0070672_1000509012 212
752 3300005543 Ga0070672_100092311 Ga0070672_1000923112 212
753 3300005546 Ga0070696_100308250 Ga0070696_1003082502 212
754 3300005548 Ga0070665_100092762 Ga0070665_1000927622 212
755 3300005548 Ga0070665_100165919 Ga0070665_1001659192 212
756 3300005549 Ga0070704_100001833 Ga0070704_1000018338 212
757 3300005549 Ga0070704_100018375 Ga0070704_1000183753 212
758 3300005563 Ga0068855_100002023 Ga0068855_10000202316 212
759 3300005577 Ga0068857_100037080 Ga0068857_1000370803 212
760 3300005614 Ga0068856_100001944 Ga0068856_10000194412 212
761 3300005618 Ga0068864_100022445 Ga0068864_1000224452 212
762 3300005618 Ga0068864_100948490 Ga0068864_1009484902 212
763 3300005719 Ga0068861_100002978 Ga0068861_1000029782 212
764 3300005719 Ga0068861_100049115 Ga0068861_1000491153 212
765 3300005834 Ga0068851_10107724 Ga0068851_101077242 212
766 3300005840 Ga0068870_10368464 Ga0068870_103684642 212
767 3300005841 Ga0068863_100271929 Ga0068863_1002719292 212
768 3300005842 Ga0068858_100005282 Ga0068858_1000052824 212
769 3300005842 Ga0068858_100214049 Ga0068858_1002140492 212
770 3300005843 Ga0068860_100011245 Ga0068860_1000112459 212
771 3300006038 Ga0075365_10068681 Ga0075365_100686813 212
772 3300006038 Ga0075365_10156649 Ga0075365_101566492 212
773 3300006042 Ga0075368_10019966 Ga0075368_100199662 212
774 3300006048 Ga0075363_100019977 Ga0075363_1000199772 212
775 3300006051 Ga0075364_10115864 Ga0075364_101158642 212
776 3300006051 Ga0075364_10126914 Ga0075364_101269142 212
777 3300006177 Ga0075362_10067403 Ga0075362_100674032 212
778 3300006177 Ga0075362_10089313 Ga0075362_100893133 212
779 3300006186 Ga0075369_10153111 Ga0075369_101531111 212
780 3300006237 Ga0097621_100069994 Ga0097621_1000699942 212
781 3300006353 Ga0075370_10020335 Ga0075370_100203352 212
782 3300006358 Ga0068871_100000429 Ga0068871_10000042922 212
783 3300006844 Ga0075428_100357960 Ga0075428_1003579602 212
784 3300006847 Ga0075431_100018399 Ga0075431_1000183994 212
785 3300006847 Ga0075431_100032618 Ga0075431_1000326184 212
786 3300006852 Ga0075433_10839414 Ga0075433_108394141 212
787 3300006871 Ga0075434_100363056 Ga0075434_1003630562 212
788 3300006880 Ga0075429_100010239 Ga0075429_1000102396 212
789 3300006881 Ga0068865_100439506 Ga0068865_1004395062 212
790 3300007076 Ga0075435_100262392 Ga0075435_1002623922 212
791 3300009011 Ga0105251_10015911 Ga0105251_100159113 212
792 3300009011 Ga0105251_10094477 Ga0105251_100944772 212
793 3300009036 Ga0105244_10014391 Ga0105244_100143912 212
794 3300009036 Ga0105244_10018048 Ga0105244_100180482 212
795 3300009036 Ga0105244_10019613 Ga0105244_100196133 212
796 3300009036 Ga0105244_10020545 Ga0105244_100205453 212
797 3300009036 Ga0105244_10071203 Ga0105244_100712031 212
798 3300009036 Ga0105244_10102481 Ga0105244_101024812 212
799 3300009092 Ga0105250_10046744 Ga0105250_100467442 212
800 3300009092 Ga0105250_10074614 Ga0105250_100746142 212
801 3300009093 Ga0105240_10005710 Ga0105240_100057107 212
802 3300009094 Ga0111539_10078552 Ga0111539_100785523 212
803 3300009094 Ga0111539_10316784 Ga0111539_103167843 212
804 3300009101 Ga0105247_10085341 Ga0105247_100853412 212
805 3300009101 Ga0105247_10086811 Ga0105247_100868112 212
806 3300009147 Ga0114129_10024326 Ga0114129_100243268 212
807 3300009148 Ga0105243_10000614 Ga0105243_100006142 212
808 3300009148 Ga0105243_10000650 Ga0105243_100006502 212
809 3300009148 Ga0105243_10036361 Ga0105243_100363613 212
810 3300009177 Ga0105248_10000324 Ga0105248_1000032442 212
811 3300009177 Ga0105248_10000710 Ga0105248_1000071027 212
812 3300009177 Ga0105248_10054071 Ga0105248_100540715 212
813 3300009545 Ga0105237_10028563 Ga0105237_100285633 212
814 3300009545 Ga0105237_10054710 Ga0105237_100547102 212
815 3300009551 Ga0105238_10113261 Ga0105238_101132612 212
816 3300009553 Ga0105249_10000320 Ga0105249_1000032031 212
817 3300009553 Ga0105249_10251057 Ga0105249_102510571 212
818 3300009553 Ga0105249_10347070 Ga0105249_103470703 212
819 3300010375 Ga0105239_10057759 Ga0105239_100577593 212
820 3300013100 Ga0157373_10143778 Ga0157373_101437781 212
821 3300013100 Ga0157373_10144608 Ga0157373_101446082 212
822 3300013102 Ga0157371_10002500 Ga0157371_1000250016 212
823 3300013102 Ga0157371_10506495 Ga0157371_105064952 212
824 3300013104 Ga0157370_10005499 Ga0157370_1000549916 212
825 3300013104 Ga0157370_10182582 Ga0157370_101825821 212
826 3300013105 Ga0157369_10000342 Ga0157369_1000034247 212
827 3300013297 Ga0157378_11237764 Ga0157378_112377641 212
828 3300013306 Ga0163162_10149149 Ga0163162_101491492 212
829 3300013308 Ga0157375_10146387 Ga0157375_101463872 212
830 3300014325 Ga0163163_10446789 Ga0163163_104467892 212
831 3300014326 Ga0157380_10505032 Ga0157380_105050322 212
832 3300014968 Ga0157379_10009608 Ga0157379_100096082 212
833 3300014969 Ga0157376_10278571 Ga0157376_102785712 212
834 3300017792 Ga0163161_10030084 Ga0163161_100300843 212
835 3300017792 Ga0163161_10041540 Ga0163161_100415403 212
836 3300017792 Ga0163161_10209787 Ga0163161_102097872 212
837 3300017792 Ga0163161_10379015 Ga0163161_103790152 212
838 3300025233 Ga0209437_100566 Ga0209437_10056610 212
839 3300025292 Ga0209676_1007092 Ga0209676_10070924 212
840 3300025294 Ga0209025_1001400 Ga0209025_100140029 212
841 3300025294 Ga0209025_1003004 Ga0209025_100300415 212
842 3300025295 Ga0209564_1021069 Ga0209564_10210692 212
843 3300025315 Ga0207697_10012975 Ga0207697_100129754 212
844 3300025711 Ga0207696_1006016 Ga0207696_10060162 212
845 3300025711 Ga0207696_1009865 Ga0207696_10098652 212
846 3300025711 Ga0207696_1013069 Ga0207696_10130691 212
847 3300025711 Ga0207696_1041747 Ga0207696_10417472 212
848 3300025728 Ga0207655_1000575 Ga0207655_10005752 212
849 3300025728 Ga0207655_1000626 Ga0207655_100062611 212
850 3300025728 Ga0207655_1000627 Ga0207655_100062711 212
851 3300025728 Ga0207655_1007194 Ga0207655_10071945 212
852 3300025728 Ga0207655_1007198 Ga0207655_10071985 212
853 3300025728 Ga0207655_1007651 Ga0207655_10076517 212
854 3300025728 Ga0207655_1023080 Ga0207655_10230804 212
855 3300025735 Ga0207713_1002798 Ga0207713_10027989 212
856 3300025735 Ga0207713_1008316 Ga0207713_10083164 212
857 3300025735 Ga0207713_1024683 Ga0207713_10246832 212
858 3300025735 Ga0207713_1035512 Ga0207713_10355121 212
859 3300025893 Ga0207682_10241509 Ga0207682_102415092 212
860 3300025900 Ga0207710_10039916 Ga0207710_100399162 212
861 3300025900 Ga0207710_10044374 Ga0207710_100443742 212
862 3300025903 Ga0207680_10107661 Ga0207680_101076612 212
863 3300025904 Ga0207647_10004470 Ga0207647_100044707 212
864 3300025907 Ga0207645_10000039 Ga0207645_1000003932 212
865 3300025909 Ga0207705_10000014 Ga0207705_10000014286 212
866 3300025912 Ga0207707_10346576 Ga0207707_103465762 212
867 3300025913 Ga0207695_10004527 Ga0207695_100045277 212
868 3300025914 Ga0207671_10037527 Ga0207671_100375274 212
869 3300025918 Ga0207662_10452809 Ga0207662_104528092 212
870 3300025919 Ga0207657_10062715 Ga0207657_100627151 212
871 3300025923 Ga0207681_10001411 Ga0207681_100014116 212
872 3300025923 Ga0207681_10275103 Ga0207681_102751032 212
873 3300025925 Ga0207650_10081382 Ga0207650_100813822 212
874 3300025925 Ga0207650_10213371 Ga0207650_102133712 212
875 3300025926 Ga0207659_10000981 Ga0207659_100009816 212
876 3300025926 Ga0207659_10089628 Ga0207659_100896283 212
877 3300025931 Ga0207644_10021202 Ga0207644_100212025 212
878 3300025932 Ga0207690_10026037 Ga0207690_100260372 212
879 3300025933 Ga0207706_10047717 Ga0207706_100477172 212
880 3300025935 Ga0207709_10000001 Ga0207709_10000001807 212
881 3300025935 Ga0207709_10000001 Ga0207709_10000001847 212
882 3300025936 Ga0207670_10690761 Ga0207670_106907611 212
883 3300025940 Ga0207691_10000027 Ga0207691_1000002787 212
884 3300025940 Ga0207691_10212460 Ga0207691_102124602 212
885 3300025941 Ga0207711_10001657 Ga0207711_1000165712 212
886 3300025941 Ga0207711_10138236 Ga0207711_101382362 212
887 3300025942 Ga0207689_10005641 Ga0207689_1000564110 212
888 3300025944 Ga0207661_10586927 Ga0207661_105869271 212
889 3300025949 Ga0207667_10000007 Ga0207667_10000007419 212
890 3300025949 Ga0207667_10049806 Ga0207667_100498063 212
891 3300025961 Ga0207712_10000413 Ga0207712_100004136 212
892 3300025961 Ga0207712_10392759 Ga0207712_103927592 212
893 3300025961 Ga0207712_10745246 Ga0207712_107452461 212
894 3300025972 Ga0207668_10007857 Ga0207668_100078572 212
895 3300025986 Ga0207658_10001299 Ga0207658_100012997 212
896 3300026023 Ga0207677_10006642 Ga0207677_100066426 212
897 3300026023 Ga0207677_10463230 Ga0207677_104632302 212
898 3300026035 Ga0207703_10017904 Ga0207703_100179046 212
899 3300026035 Ga0207703_10214743 Ga0207703_102147432 212
900 3300026041 Ga0207639_10011964 Ga0207639_100119642 212
901 3300026078 Ga0207702_10000147 Ga0207702_1000014710 212
902 3300026088 Ga0207641_10004970 Ga0207641_100049706 212
903 3300026089 Ga0207648_10003178 Ga0207648_1000317816 212
904 3300026089 Ga0207648_10826775 Ga0207648_108267752 212
905 3300026095 Ga0207676_10098249 Ga0207676_100982492 212
906 3300026116 Ga0207674_10030781 Ga0207674_100307814 212
907 3300026116 Ga0207674_10049037 Ga0207674_100490373 212
908 3300026118 Ga0207675_100000066 Ga0207675_10000006664 212
909 3300026118 Ga0207675_100139004 Ga0207675_1001390042 212
910 3300026121 Ga0207683_10000061 Ga0207683_1000006136 212
911 3300027312 Ga0209371_1000008 Ga0209371_1000008140 212
912 3300027312 Ga0209371_1000008 Ga0209371_100000899 212
913 3300028379 Ga0268266_10687949 Ga0268266_106879492 212
914 3300028380 Ga0268265_10353978 Ga0268265_103539782 212
915 3300030500 Ga0268256_1000009 Ga0268256_1000009140 212
916 3300030500 Ga0268256_1000009 Ga0268256_100000999 212
917 3300030521 Ga0307511_10013789 Ga0307511_100137896 212
918 3300031251 Ga0265327_10008996 Ga0265327_100089968 212
919 3300031548 Ga0307408_100000301 Ga0307408_10000030117 212
920 3300031548 Ga0307408_100533180 Ga0307408_1005331801 212
921 3300032002 Ga0307416_100181703 Ga0307416_1001817032 212
922 3300034957 Ga0373938_0014196 Ga0373938_0014196_280_954 212
923 3300035085 Ga0373929_0007658 Ga0373929_0007658_709_1383 212
924 3300035090 Ga0373949_0018127 Ga0373949_0018127_109_783 212
925 3300035091 Ga0373951_0050481 Ga0373951_0050481_150_824 212
926 3300035112 Ga0373932_0004781 Ga0373932_0004781_1769_2443 212
927 3300035114 Ga0373939_0086778 Ga0373939_0086778_258_932 212
928 3300035207 Ga0373942_0089800 Ga0373942_0089800_52_726 212
929 3300035241 Ga0373961_0005960 Ga0373961_0005960_1580_2254 212
930 3300035242 Ga0373962_0013966 Ga0373962_0013966_78_752 212
931 3300035410 Ga0373924_0004330 Ga0373924_0004330_1420_2097 212
932 3300035691 Ga0373931_0007152 Ga0373931_0007152_2280_2954 212
933 3300035691 Ga0373931_0432606 Ga0373931_0432606_85_759 212
934 3300036401 Ga0373937_0222488 Ga0373937_0222488_918_1574 212
935 3300037471 Ga0395905_0297864 Ga0395905_0297864_329_976 212
936 3300039437 Ga0436365_1617569 Ga0436365_1617569_17_664 212
937 3300041411 Ga0439466_0028322 Ga0439466_0028322_933_1583 212
938 3300044656 Ga0466969_0068415 Ga0466969_0068415_816_1466 212
939 3300044658 Ga0466972_0022390 Ga0466972_0022390_1203_1850 212
940 3300044659 Ga0466973_0010320 Ga0466973_0010320_2506_3153 212
941 3300044683 Ga0466965_0050893 Ga0466965_0050893_948_1595 212
942 3300044684 Ga0466966_0118480 Ga0466966_0118480_170_820 212
943 3300044694 Ga0466963_0004216 Ga0466963_0004216_1394_2041 212
944 3300045051 Ga0451576_0156905 Ga0451576_0156905_1253_1900 212
945 3300046453 Ga0495627_006747 Ga0495627_006747_2176_2826 212
946 3300046453 Ga0495627_016507 Ga0495627_016507_1380_2033 212
947 3300046460 Ga0495638_0081076 Ga0495638_0081076_227_880 212
948 3300046471 Ga0495650_0000322 Ga0495650_0000322_4944_5603 212
949 3300046475 Ga0495639_0150653 Ga0495639_0150653_60_713 212
950 3300046491 Ga0495584_0000004 Ga0495584_0000004_265722_266366 212
951 3300046491 Ga0495584_0007594 Ga0495584_0007594_446_1090 212
952 3300046492 Ga0495585_0003077 Ga0495585_0003077_738_1382 212
953 3300046500 Ga0495596_0001287 Ga0495596_0001287_11046_11690 212
954 3300046501 Ga0495607_0028658 Ga0495607_0028658_1547_2200 212
955 3300046501 Ga0495607_0046022 Ga0495607_0046022_148_792 212
956 3300046501 Ga0495607_0051633 Ga0495607_0051633_851_1504 212
957 3300046501 Ga0495607_0077443 Ga0495607_0077443_490_1140 212
958 3300046506 Ga0495583_0000246 Ga0495583_0000246_41241_41885 212
959 3300046507 Ga0495606_0007104 Ga0495606_0007104_4163_4807 212
960 3300046507 Ga0495606_0007228 Ga0495606_0007228_7788_8432 212
961 3300046507 Ga0495606_0076487 Ga0495606_0076487_1244_1888 212
962 3300046507 Ga0495606_0116642 Ga0495606_0116642_731_1375 212
963 3300046512 Ga0495610_0077586 Ga0495610_0077586_519_1163 212
964 3300046513 Ga0495616_0032583 Ga0495616_0032583_1579_2223 212
965 3300046518 Ga0495631_0146325 Ga0495631_0146325_218_892 212
966 3300046519 Ga0495632_0035531 Ga0495632_0035531_1225_1878 212
967 3300046519 Ga0495632_0130380 Ga0495632_0130380_408_1061 212
968 3300046522 Ga0495643_0045741 Ga0495643_0045741_804_1457 212
969 3300046522 Ga0495643_0169218 Ga0495643_0169218_33_686 212
970 3300046524 Ga0495648_0003027 Ga0495648_0003027_4422_5090 212
971 3300046525 Ga0495663_0002025 Ga0495663_0002025_5510_6163 212
972 3300046525 Ga0495663_0002087 Ga0495663_0002087_3770_4420 212
973 3300046525 Ga0495663_0011033 Ga0495663_0011033_1463_2116 212
974 3300046525 Ga0495663_0026855 Ga0495663_0026855_649_1302 212
975 3300046525 Ga0495663_0029935 Ga0495663_0029935_189_842 212
976 3300046535 Ga0495586_0257319 Ga0495586_0257319_136_783 212
977 3300046538 Ga0495609_0111753 Ga0495609_0111753_137_781 212
978 3300046538 Ga0495609_0201788 Ga0495609_0201788_16_660 212
979 3300046542 Ga0495597_0015375 Ga0495597_0015375_1527_2171 212
980 3300046558 Ga0495633_0034184 Ga0495633_0034184_355_999 212
981 3300046558 Ga0495633_0232800 Ga0495633_0232800_172_831 212
982 3300046615 Ga0495656_0056704 Ga0495656_0056704_619_1275 212
983 3300046616 Ga0495668_0004167 Ga0495668_0004167_9396_10040 212
984 3300046660 Ga0495625_0036183 Ga0495625_0036183_1944_2597 212
985 3300046660 Ga0495625_0090919 Ga0495625_0090919_273_917 212
986 3300046663 Ga0495635_0260240 Ga0495635_0260240_285_932 212
987 3300046664 Ga0495659_0000068 Ga0495659_0000068_1245_1889 212
988 3300046665 Ga0495661_0011847 Ga0495661_0011847_238_888 212
989 3300046683 Ga0495658_0279392 Ga0495658_0279392_26_673 212
990 3300046692 Ga0495671_0285830 Ga0495671_0285830_76_729 212
991 3300046694 Ga0495649_0066875 Ga0495649_0066875_779_1429 212
992 3300046810 Ga0495660_0076122 Ga0495660_0076122_1114_1758 212
993 3300047320 Ga0495672_0000191 Ga0495672_0000191_4812_5456 212
994 3300047323 Ga0495683_0000174 Ga0495683_0000174_43941_44585 212
995 3300047443 Ga0495687_000015 Ga0495687_000015_310809_311465 212
996 3300047470 Ga0495681_0009251 Ga0495681_0009251_5068_5721 212
997 3300047470 Ga0495681_0011767 Ga0495681_0011767_2845_3489 212
998 3300047470 Ga0495681_0040619 Ga0495681_0040619_1607_2251 212
999 3300047472 Ga0495686_0118304 Ga0495686_0118304_387_1031 212
1000 3300048905 Ga0496102_0114554 Ga0496102_0114554_712_1359 212
1001 3300048906 Ga0496103_0005307 Ga0496103_0005307_6878_7525 212
1002 3300048907 Ga0496104_0013012 Ga0496104_0013012_124_771 212
1003 3300048907 Ga0496104_0321070 Ga0496104_0321070_284_943 212
1004 3300048908 Ga0496105_0001982 Ga0496105_0001982_2066_2713 212
1005 3300048910 Ga0496107_0143245 Ga0496107_0143245_279_965 212
1006 3300048911 Ga0496108_0145189 Ga0496108_0145189_455_1102 212
1007 3300048913 Ga0496110_0334973 Ga0496110_0334973_170_817 212
1008 3300048914 Ga0496111_0467944 Ga0496111_0467944_163_810 212
1009 3300048917 Ga0496114_0160197 Ga0496114_0160197_425_1099 212
1010 3300048917 Ga0496114_0406589 Ga0496114_0406589_186_833 212
1011 3300048918 Ga0496115_0502766 Ga0496115_0502766_132_806 212
1012 3300048925 Ga0496122_0003832 Ga0496122_0003832_10929_11573 212
1013 3300048925 Ga0496122_0130777 Ga0496122_0130777_772_1437 212
1014 3300048926 Ga0496123_0003504 Ga0496123_0003504_640_1284 212
1015 3300048926 Ga0496123_0120161 Ga0496123_0120161_323_988 212
1016 3300048927 Ga0496124_0004765 Ga0496124_0004765_6020_6667 212
1017 3300048928 Ga0496125_0003280 Ga0496125_0003280_2242_2889 212
1018 3300048928 Ga0496125_0003538 Ga0496125_0003538_14462_15127 212
1019 3300048929 Ga0496126_0036879 Ga0496126_0036879_606_1271 212
1020 3300048929 Ga0496126_0095044 Ga0496126_0095044_847_1503 212
1021 3300049570 Ga0501033_0130265 Ga0501033_0130265_69_707 212
1022 3300049571 Ga0501034_0365802 Ga0501034_0365802_50_760 212
1023 3300049766 Ga0501269_000034 Ga0501269_000034_2351_3013 212
1024 3300049822 Ga0501035_0022652 Ga0501035_0022652_2406_3044 212
1025 3300050491 nmdc:mga00v17_41700_c1 nmdc:mga00v17_41700_c1_429_1115 212
1026 3300050492 nmdc:mga0yw44_92232_c1 nmdc:mga0yw44_92232_c1_495_1181 212
1027 3300050493 nmdc:mga0k408_9809_c1 nmdc:mga0k408_9809_c1_2948_3634 212
1028 3300050494 nmdc:mga06z11_28077_c1 nmdc:mga06z11_28077_c1_1176_1862 212
1029 3300050496 nmdc:mga07m45_2540_c1 nmdc:mga07m45_2540_c1_2292_2978 212
1030 3300050507 nmdc:mga05p37_209_c1 nmdc:mga05p37_209_c1_11008_11658 212
1031 3300050508 nmdc:mga09592_150_c1 nmdc:mga09592_150_c1_11929_12579 212
1032 3300050510 nmdc:mga06r32_128933_c1 nmdc:mga06r32_128933_c1_752_1402 212
1033 3300050510 nmdc:mga06r32_39269_c1 nmdc:mga06r32_39269_c1_1934_2584 212
1034 3300050511 nmdc:mga08y16_42698_c1 nmdc:mga08y16_42698_c1_2560_3207 212
1035 3300050511 nmdc:mga08y16_656469_c1 nmdc:mga08y16_656469_c1_98_748 212
1036 3300050513 nmdc:mga0rr50_119166_c1 nmdc:mga0rr50_119166_c1_1052_1732 212
1037 3300061719 Ga0466962_0037154 Ga0466962_0037154_567_1214 212
1038 iso_pu_bacteria 2562617112 2563060598 212
1039 iso_pu_bacteria 2711768613 2713475775 212
1040 3300003781 Ga0055536_1001260 Ga0055536_10012609 213
1041 3300003791 Ga0055530_10001163 Ga0055530_100011635 213
1042 3300003792 Ga0055540_1000067 Ga0055540_100006717 213
1043 3300003794 Ga0055531_10000480 Ga0055531_1000048032 213
1044 3300006051 Ga0075364_10293033 Ga0075364_102930332 213
1045 3300014497 Ga0182008_10000708 Ga0182008_1000070813 213
1046 3300025258 Ga0209129_1008654 Ga0209129_10086543 213
1047 3300025284 Ga0209130_1001113 Ga0209130_100111317 213
1048 3300025292 Ga0209676_1000145 Ga0209676_1000145161 213
1049 3300025295 Ga0209564_1005377 Ga0209564_10053776 213
1050 3300025298 Ga0209050_1000023 Ga0209050_100002316 213
1051 3300025302 Ga0207426_1004536 Ga0207426_10045365 213
1052 3300025303 Ga0209051_1000017 Ga0209051_100001716 213
1053 3300025304 Ga0209257_1000041 Ga0209257_100004116 213
1054 3300025923 Ga0207681_10010671 Ga0207681_100106712 213
1055 3300041463 Ga0451804_0767943 Ga0451804_0767943_31_678 213
1056 3300041491 Ga0451833_0651743 Ga0451833_0651743_275_922 213
1057 3300041512 Ga0451853_3559394 Ga0451853_3559394_17_664 213
1058 3300046452 Ga0495617_000161 Ga0495617_000161_32296_32943 213
1059 3300046460 Ga0495638_0008497 Ga0495638_0008497_4565_5224 213
1060 3300046460 Ga0495638_0047171 Ga0495638_0047171_1154_1801 213
1061 3300046474 Ga0495605_0221990 Ga0495605_0221990_48_695 213
1062 3300046492 Ga0495585_0001437 Ga0495585_0001437_624_1271 213
1063 3300046492 Ga0495585_0044004 Ga0495585_0044004_1574_2221 213
1064 3300046492 Ga0495585_0056798 Ga0495585_0056798_1070_1717 213
1065 3300046492 Ga0495585_0058845 Ga0495585_0058845_282_929 213
1066 3300046500 Ga0495596_0045209 Ga0495596_0045209_710_1357 213
1067 3300046501 Ga0495607_0172438 Ga0495607_0172438_129_776 213
1068 3300046506 Ga0495583_0029106 Ga0495583_0029106_1901_2548 213
1069 3300046507 Ga0495606_0206351 Ga0495606_0206351_424_1071 213
1070 3300046512 Ga0495610_0000198 Ga0495610_0000198_12264_12923 213
1071 3300046513 Ga0495616_0003752 Ga0495616_0003752_4794_5441 213
1072 3300046513 Ga0495616_0086986 Ga0495616_0086986_503_1150 213
1073 3300046515 Ga0495620_0021521 Ga0495620_0021521_2361_3008 213
1074 3300046516 Ga0495628_0422885 Ga0495628_0422885_62_712 213
1075 3300046518 Ga0495631_0000063 Ga0495631_0000063_53642_54301 213
1076 3300046518 Ga0495631_0042417 Ga0495631_0042417_106_753 213
1077 3300046524 Ga0495648_0000127 Ga0495648_0000127_44659_45306 213
1078 3300046528 Ga0495642_0006913 Ga0495642_0006913_1727_2374 213
1079 3300046528 Ga0495642_0015223 Ga0495642_0015223_1264_1911 213
1080 3300046538 Ga0495609_0031199 Ga0495609_0031199_917_1564 213
1081 3300046542 Ga0495597_0060129 Ga0495597_0060129_79_726 213
1082 3300046543 Ga0495645_0320471 Ga0495645_0320471_219_869 213
1083 3300046616 Ga0495668_0012198 Ga0495668_0012198_4086_4733 213
1084 3300046648 Ga0495611_0004192 Ga0495611_0004192_5350_5997 213
1085 3300046660 Ga0495625_0000272 Ga0495625_0000272_18971_19630 213
1086 3300046660 Ga0495625_0092736 Ga0495625_0092736_727_1374 213
1087 3300046794 Ga0495589_0017854 Ga0495589_0017854_1120_1767 213
1088 3300046810 Ga0495660_0138521 Ga0495660_0138521_434_1081 213
1089 3300047323 Ga0495683_0162306 Ga0495683_0162306_104_751 213
1090 3300047445 Ga0495677_0022125 Ga0495677_0022125_900_1547 213
1091 3300047447 Ga0495685_031041 Ga0495685_031041_516_1163 213
1092 3300047470 Ga0495681_0179504 Ga0495681_0179504_181_834 213
1093 3300048091 Ga0495626_0006364 Ga0495626_0006364_609_1256 213
1094 3300048904 Ga0496101_0264110 Ga0496101_0264110_166_891 213
1095 3300048910 Ga0496107_0446481 Ga0496107_0446481_219_869 213
1096 3300048924 Ga0496121_0017579 Ga0496121_0017579_5422_6147 213
1097 3300048925 Ga0496122_0000410 Ga0496122_0000410_74703_75428 213
1098 3300048925 Ga0496122_0000662 Ga0496122_0000662_12331_12990 213
1099 3300048925 Ga0496122_0001600 Ga0496122_0001600_23782_24429 213
1100 3300048926 Ga0496123_0000478 Ga0496123_0000478_12330_12989 213
1101 3300048926 Ga0496123_0000818 Ga0496123_0000818_36637_37362 213
1102 3300048926 Ga0496123_0001311 Ga0496123_0001311_10887_11534 213
1103 3300048927 Ga0496124_0010750 Ga0496124_0010750_434_1096 213
1104 3300048927 Ga0496124_0259885 Ga0496124_0259885_377_1102 213
1105 3300048928 Ga0496125_0237624 Ga0496125_0237624_349_1074 213
1106 3300048929 Ga0496126_0397380 Ga0496126_0397380_77_739 213
1107 3300049460 Ga0495682_0013200 Ga0495682_0013200_1932_2579 213
1108 3300049571 Ga0501034_0056876 Ga0501034_0056876_1791_2504 213
1109 3300049573 Ga0501037_0200556 Ga0501037_0200556_573_1286 213
1110 3300049574 Ga0501038_0198498 Ga0501038_0198498_205_918 213
1111 3300049581 Ga0501047_0007859 Ga0501047_0007859_1761_2474 213
1112 3300049822 Ga0501035_0009730 Ga0501035_0009730_2025_2738 213
1113 3300049823 Ga0501044_0044554 Ga0501044_0044554_2238_2951 213
1114 3300050489 nmdc:mga03683_277671_c1 nmdc:mga03683_277671_c1_32_682 213
1115 3300053136 Ga0500559_0003954 Ga0500559_0003954_5632_6279 213
1116 3300053730 Ga0500645_000242 Ga0500645_000242_9453_10103 213
1117 iso_pu_bacteria 3000865235 3000865542 213
1118 3300003773 Ga0055537_1000576 Ga0055537_10005769 214
1119 3300003775 Ga0055524_1000519 Ga0055524_100051916 214
1120 3300003784 Ga0055534_1001922 Ga0055534_10019222 214
1121 3300003790 Ga0055528_1001047 Ga0055528_10010474 214
1122 3300005339 Ga0070660_100039316 Ga0070660_1000393163 214
1123 3300005530 Ga0070679_100007035 Ga0070679_1000070358 214
1124 3300025263 Ga0209565_1000111 Ga0209565_100011188 214
1125 3300025273 Ga0209673_1000012 Ga0209673_1000012496 214
1126 3300025291 Ga0209675_1000373 Ga0209675_100037334 214
1127 3300025295 Ga0209564_1002035 Ga0209564_10020356 214
1128 3300025299 Ga0209256_1000003 Ga0209256_1000003750 214
1129 3300025909 Ga0207705_10009139 Ga0207705_100091392 214
1130 3300025909 Ga0207705_10017949 Ga0207705_100179493 214
1131 3300025919 Ga0207657_10083840 Ga0207657_100838402 214
1132 3300025921 Ga0207652_10008612 Ga0207652_100086126 214
1133 3300026067 Ga0207678_10095314 Ga0207678_100953143 214
1134 3300044706 Ga0466964_0086694 Ga0466964_0086694_601_1308 214
1135 3300044735 Ga0466968_0037529 Ga0466968_0037529_1293_2000 214
1136 3300044765 Ga0466970_0054906 Ga0466970_0054906_545_1252 214
1137 3300044842 Ga0466957_0011503 Ga0466957_0011503_2756_3463 214
1138 3300047317 Ga0495604_0080259 Ga0495604_0080259_687_1331 214
1139 3300050511 nmdc:mga08y16_261223_c1 nmdc:mga08y16_261223_c1_583_1248 215
1140 3300026142 Ga0207698_10701810 Ga0207698_107018101 216
1141 3300046455 Ga0495603_0001565 Ga0495603_0001565_9878_10537 216
1142 3300046472 Ga0495580_0034724 Ga0495580_0034724_2435_3094 216
1143 3300046474 Ga0495605_0031057 Ga0495605_0031057_701_1360 216
1144 3300046506 Ga0495583_0034876 Ga0495583_0034876_1213_1872 216
1145 3300046513 Ga0495616_0042619 Ga0495616_0042619_1012_1671 216
1146 3300046524 Ga0495648_0016213 Ga0495648_0016213_1781_2434 216
1147 3300046524 Ga0495648_0069857 Ga0495648_0069857_1353_2012 216
1148 3300047319 Ga0495674_0016607 Ga0495674_0016607_918_1577 216
1149 3300047323 Ga0495683_0021392 Ga0495683_0021392_2140_2799 216
1150 3300047443 Ga0495687_052618 Ga0495687_052618_35_694 216
1151 3300048918 Ga0496115_0389635 Ga0496115_0389635_37_696 216
1152 3300048922 Ga0496119_0042204 Ga0496119_0042204_1102_1761 216
1153 3300048924 Ga0496121_0015334 Ga0496121_0015334_7300_7959 216
1154 3300005288 Ga0065714_10000917 Ga0065714_1000091719 217
1155 3300025735 Ga0207713_1000501 Ga0207713_10005013 217
1156 2124908027 MRS2a_Contig_1767 MRS2a_00624870 219
1157 2124908027 MRS2a_Contig_1768 MRS2a_00625650 219
1158 2124908027 MRS2a_Contig_70 MRS2a_00559350 219
1159 3300048924 Ga0496121_0092537 Ga0496121_0092537_133_792 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

52

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o9l-assembly2.cif.gz_D succinate:coenzyme-a transferase (pig heart) 0.9255 8 207
3cdk-assembly1.cif.gz_D crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.922 8 211
3rrl-assembly1.cif.gz_D complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695 0.9217 11 211
1ooy-assembly1.cif.gz_A succinyl-coa:3-ketoacid coa transferase from pig heart 0.9206 8 207
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9197 8 211
ID Description Score Start End Superfamily
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9185 8 207 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8986 8 219 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8828 8 219 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8765 8 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.85 8 207 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A1F8VZX9-F1-model_v4 3-oxoadipate CoA-transferase 0.9664 1 213 GO:0008410
AF-A0A6H9WP19-F1-model_v4 3-oxoacid CoA-transferase subunit B 0.9652 2 209 GO:0008410
AF-A0A838L7R7-F1-model_v4 3-oxoacid CoA-transferase subunit B 0.9643 3 211 GO:0008410
AF-A0A2M6VCW0-F1-model_v4 3-oxoadipate CoA-transferase 0.9619 1 211 GO:0008410
AF-A0A292PJC2-F1-model_v4 3-oxoacid CoA-transferase (EC 2.8.3.5) 0.9607 11 103 GO:0005739
GO:0008260

Feature Viewer

pLDDT pTM Quality
91.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map