F490835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1149 | 410 | 1146 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300047319|Ga0495674_0202516|Ga0495674_0202516_928_1410 |
| Length | 160 |
| Sequence | VSESQAKPAMILSAQALTRIDHEIAKYPSDQKRSAVMAALAIAQDEKGWLSTETMDFVAGATFYEMYNTEPIGRFKLTICTNLPCALQSASEAAEHLKRKLGIGFGETTPDRMFTLKQGECFGACGDAPVVLVNNKRMCSWMRPAELDRLLAELAAEPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 2 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 3 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 240 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 277 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 278 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 279 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 280 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 283 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0 |
| Rhizoplane | 3.57 |
| Rhizosphere | 94.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10025931 | 3300002239 | Bacteria | 939 |
| 2 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 3 | JGI25164J39214_1007850 | 3300002772 | Bacteria | 1075 |
| 4 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 5 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 6 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 7 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 8 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 9 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 10 | Ga0065715_10561781 | 3300005293 | Bacteria | 730 |
| 11 | Ga0070676_10000072 | 3300005328 | Bacteria | 34018 |
| 12 | Ga0070676_10149977 | 3300005328 | Bacteria | 1492 |
| 13 | Ga0070683_100161839 | 3300005329 | Bacteria | 2124 |
| 14 | Ga0070683_101074175 | 3300005329 | Bacteria | 773 |
| 15 | Ga0070690_100002867 | 3300005330 | Bacteria | 9296 |
| 16 | Ga0070690_100074179 | 3300005330 | Bacteria | 2215 |
| 17 | Ga0070690_100315672 | 3300005330 | Bacteria | 1124 |
| 18 | Ga0070690_101056408 | 3300005330 | Bacteria | 642 |
| 19 | Ga0070690_101201813 | 3300005330 | Bacteria | 605 |
| 20 | Ga0070670_100096413 | 3300005331 | Bacteria | 2544 |
| 21 | Ga0070670_100117661 | 3300005331 | Bacteria | 2292 |
| 22 | Ga0070670_100262774 | 3300005331 | Bacteria | 1505 |
| 23 | Ga0070670_101264614 | 3300005331 | Bacteria | 675 |
| 24 | Ga0070670_101885225 | 3300005331 | Bacteria | 550 |
| 25 | Ga0070677_10000170 | 3300005333 | Bacteria | 22499 |
| 26 | Ga0068869_100012083 | 3300005334 | Bacteria | 5692 |
| 27 | Ga0068869_100013977 | 3300005334 | Bacteria | 5354 |
| 28 | Ga0068869_100153654 | 3300005334 | Bacteria | 1787 |
| 29 | Ga0068869_100338471 | 3300005334 | Bacteria | 1224 |
| 30 | Ga0068869_101347236 | 3300005334 | Bacteria | 630 |
| 31 | Ga0068869_101394355 | 3300005334 | Bacteria | 620 |
| 32 | Ga0070666_10006410 | 3300005335 | Bacteria | 7235 |
| 33 | Ga0070666_10007649 | 3300005335 | Bacteria | 6670 |
| 34 | Ga0070666_10647812 | 3300005335 | Bacteria | 773 |
| 35 | Ga0070680_100124951 | 3300005336 | Bacteria | 2149 |
| 36 | Ga0070680_100249515 | 3300005336 | Bacteria | 1500 |
| 37 | Ga0070682_100105552 | 3300005337 | Bacteria | 1868 |
| 38 | Ga0070682_100289267 | 3300005337 | Bacteria | 1198 |
| 39 | Ga0068868_100027054 | 3300005338 | Bacteria | 4374 |
| 40 | Ga0068868_100117644 | 3300005338 | Bacteria | 2165 |
| 41 | Ga0068868_100297177 | 3300005338 | Bacteria | 1371 |
| 42 | Ga0068868_100452445 | 3300005338 | Bacteria | 1117 |
| 43 | Ga0070660_100025820 | 3300005339 | Bacteria | 4369 |
| 44 | Ga0070660_100381078 | 3300005339 | Bacteria | 1164 |
| 45 | Ga0070660_101249062 | 3300005339 | Bacteria | 630 |
| 46 | Ga0070689_100054677 | 3300005340 | Bacteria | 3091 |
| 47 | Ga0070689_100066936 | 3300005340 | Bacteria | 2799 |
| 48 | Ga0070689_101310609 | 3300005340 | Bacteria | 652 |
| 49 | Ga0070691_10207235 | 3300005341 | Bacteria | 1033 |
| 50 | Ga0070687_100021059 | 3300005343 | Bacteria | 3058 |
| 51 | Ga0070687_100241755 | 3300005343 | Bacteria | 1117 |
| 52 | Ga0070661_100219671 | 3300005344 | Bacteria | 1457 |
| 53 | Ga0070661_100707818 | 3300005344 | Bacteria | 821 |
| 54 | Ga0070692_10080451 | 3300005345 | Bacteria | 1754 |
| 55 | Ga0070692_10461690 | 3300005345 | Bacteria | 815 |
| 56 | Ga0070692_10473969 | 3300005345 | Bacteria | 806 |
| 57 | Ga0070668_100035176 | 3300005347 | Bacteria | 3819 |
| 58 | Ga0070668_100404266 | 3300005347 | Bacteria | 1166 |
| 59 | Ga0070668_100795725 | 3300005347 | Bacteria | 840 |
| 60 | Ga0070669_100039846 | 3300005353 | Bacteria | 3414 |
| 61 | Ga0070669_100137721 | 3300005353 | Bacteria | 1879 |
| 62 | Ga0070669_100408258 | 3300005353 | Bacteria | 1113 |
| 63 | Ga0070669_100420649 | 3300005353 | Bacteria | 1097 |
| 64 | Ga0070675_100000543 | 3300005354 | Bacteria | 25849 |
| 65 | Ga0070671_100020291 | 3300005355 | Bacteria | 5419 |
| 66 | Ga0070671_100027112 | 3300005355 | Bacteria | 4713 |
| 67 | Ga0070671_100054157 | 3300005355 | Bacteria | 3335 |
| 68 | Ga0070671_100163977 | 3300005355 | Bacteria | 1879 |
| 69 | Ga0070671_100187344 | 3300005355 | Bacteria | 1753 |
| 70 | Ga0070671_100346000 | 3300005355 | Bacteria | 1269 |
| 71 | Ga0070671_101440471 | 3300005355 | Bacteria | 609 |
| 72 | Ga0070674_100002257 | 3300005356 | Bacteria | 10631 |
| 73 | Ga0070674_100075380 | 3300005356 | Bacteria | 2396 |
| 74 | Ga0070674_100078199 | 3300005356 | Bacteria | 2357 |
| 75 | Ga0070673_100000251 | 3300005364 | Bacteria | 27227 |
| 76 | Ga0070673_100009977 | 3300005364 | Bacteria | 6404 |
| 77 | Ga0070673_100396102 | 3300005364 | Bacteria | 1234 |
| 78 | Ga0070673_100937619 | 3300005364 | Bacteria | 804 |
| 79 | Ga0070673_101253684 | 3300005364 | Bacteria | 695 |
| 80 | Ga0070688_100001386 | 3300005365 | Bacteria | 12053 |
| 81 | Ga0070688_100224327 | 3300005365 | Bacteria | 1326 |
| 82 | Ga0070659_100040641 | 3300005366 | Bacteria | 3635 |
| 83 | Ga0070659_100073192 | 3300005366 | Bacteria | 2727 |
| 84 | Ga0070659_100298389 | 3300005366 | Bacteria | 1343 |
| 85 | Ga0070667_100065246 | 3300005367 | Bacteria | 3091 |
| 86 | Ga0070667_100078305 | 3300005367 | Bacteria | 2824 |
| 87 | Ga0070667_100184789 | 3300005367 | Bacteria | 1845 |
| 88 | Ga0070667_100214808 | 3300005367 | Bacteria | 1710 |
| 89 | Ga0070667_100369281 | 3300005367 | Bacteria | 1301 |
| 90 | Ga0070667_100620974 | 3300005367 | Bacteria | 997 |
| 91 | Ga0070667_101086518 | 3300005367 | Bacteria | 748 |
| 92 | Ga0070667_101163169 | 3300005367 | Bacteria | 722 |
| 93 | Ga0070709_10143754 | 3300005434 | Bacteria | 1641 |
| 94 | Ga0070714_100199160 | 3300005435 | Bacteria | 1831 |
| 95 | Ga0070713_100000033 | 3300005436 | Bacteria | 86758 |
| 96 | Ga0070713_100020841 | 3300005436 | Bacteria | 5032 |
| 97 | Ga0070713_100023278 | 3300005436 | Bacteria | 4803 |
| 98 | Ga0070710_10162844 | 3300005437 | Bacteria | 1385 |
| 99 | Ga0070701_10081040 | 3300005438 | Bacteria | 1757 |
| 100 | Ga0070701_10159993 | 3300005438 | Bacteria | 1304 |
| 101 | Ga0070711_100011100 | 3300005439 | Bacteria | 5590 |
| 102 | Ga0070711_100119878 | 3300005439 | Bacteria | 1944 |
| 103 | Ga0070705_100013604 | 3300005440 | Bacteria | 4166 |
| 104 | Ga0070705_100036353 | 3300005440 | Bacteria | 2768 |
| 105 | Ga0070705_100108366 | 3300005440 | Bacteria | 1769 |
| 106 | Ga0070705_100153212 | 3300005440 | Bacteria | 1532 |
| 107 | Ga0070705_100302450 | 3300005440 | Bacteria | 1147 |
| 108 | Ga0070700_100001013 | 3300005441 | Bacteria | 13883 |
| 109 | Ga0070700_100513667 | 3300005441 | Bacteria | 924 |
| 110 | Ga0070694_100007797 | 3300005444 | Bacteria | 6532 |
| 111 | Ga0070694_100011859 | 3300005444 | Bacteria | 5406 |
| 112 | Ga0070694_100025031 | 3300005444 | Bacteria | 3857 |
| 113 | Ga0070694_100035603 | 3300005444 | Bacteria | 3293 |
| 114 | Ga0070694_100329843 | 3300005444 | Bacteria | 1177 |
| 115 | Ga0070694_100362435 | 3300005444 | Bacteria | 1126 |
| 116 | Ga0070708_100021761 | 3300005445 | Bacteria | 5429 |
| 117 | Ga0070708_100271852 | 3300005445 | Bacteria | 1594 |
| 118 | Ga0070708_100555468 | 3300005445 | Bacteria | 1083 |
| 119 | Ga0070663_100198342 | 3300005455 | Bacteria | 1565 |
| 120 | Ga0070663_100277780 | 3300005455 | Bacteria | 1334 |
| 121 | Ga0070663_100489892 | 3300005455 | Bacteria | 1019 |
| 122 | Ga0070663_100905767 | 3300005455 | Bacteria | 762 |
| 123 | Ga0070663_101637777 | 3300005455 | Bacteria | 574 |
| 124 | Ga0070678_100014041 | 3300005456 | Bacteria | 5039 |
| 125 | Ga0070678_100105868 | 3300005456 | Bacteria | 2190 |
| 126 | Ga0070678_100292288 | 3300005456 | Bacteria | 1382 |
| 127 | Ga0070678_100327823 | 3300005456 | Bacteria | 1309 |
| 128 | Ga0070678_100601781 | 3300005456 | Bacteria | 981 |
| 129 | Ga0070678_101065516 | 3300005456 | Bacteria | 745 |
| 130 | Ga0070662_100045566 | 3300005457 | Bacteria | 3147 |
| 131 | Ga0070662_100073181 | 3300005457 | Bacteria | 2531 |
| 132 | Ga0070662_100077812 | 3300005457 | Bacteria | 2462 |
| 133 | Ga0070662_100099536 | 3300005457 | Bacteria | 2198 |
| 134 | Ga0070662_100428966 | 3300005457 | Bacteria | 1095 |
| 135 | Ga0070681_10013221 | 3300005458 | Bacteria | 8202 |
| 136 | Ga0070681_10014534 | 3300005458 | Bacteria | 7834 |
| 137 | Ga0070681_10178920 | 3300005458 | Bacteria | 2042 |
| 138 | Ga0068867_100087960 | 3300005459 | Bacteria | 2353 |
| 139 | Ga0068867_100168931 | 3300005459 | Bacteria | 1731 |
| 140 | Ga0068867_101001466 | 3300005459 | Bacteria | 758 |
| 141 | Ga0068867_101489589 | 3300005459 | Bacteria | 630 |
| 142 | Ga0070685_10001553 | 3300005466 | Bacteria | 12102 |
| 143 | Ga0070685_10135317 | 3300005466 | Bacteria | 1545 |
| 144 | Ga0070706_100005369 | 3300005467 | Bacteria | 12210 |
| 145 | Ga0070706_100201743 | 3300005467 | Bacteria | 1858 |
| 146 | Ga0070706_100229256 | 3300005467 | Bacteria | 1734 |
| 147 | Ga0070706_100243274 | 3300005467 | Bacteria | 1680 |
| 148 | Ga0070707_100031454 | 3300005468 | Bacteria | 5056 |
| 149 | Ga0070707_100099482 | 3300005468 | Bacteria | 2817 |
| 150 | Ga0070707_100689745 | 3300005468 | Bacteria | 984 |
| 151 | Ga0070698_100111856 | 3300005471 | Bacteria | 2696 |
| 152 | Ga0070698_100118004 | 3300005471 | Bacteria | 2615 |
| 153 | Ga0070698_100344771 | 3300005471 | Bacteria | 1421 |
| 154 | Ga0070699_100009169 | 3300005518 | Bacteria | 8578 |
| 155 | Ga0070699_100191200 | 3300005518 | Bacteria | 1818 |
| 156 | Ga0070699_100530270 | 3300005518 | Bacteria | 1071 |
| 157 | Ga0070699_100618637 | 3300005518 | Bacteria | 988 |
| 158 | Ga0070699_100698845 | 3300005518 | Bacteria | 926 |
| 159 | Ga0070679_100072479 | 3300005530 | Bacteria | 3436 |
| 160 | Ga0070679_100128718 | 3300005530 | Bacteria | 2513 |
| 161 | Ga0070679_100262530 | 3300005530 | Bacteria | 1682 |
| 162 | Ga0070697_100002415 | 3300005536 | Bacteria | 14379 |
| 163 | Ga0070697_100014086 | 3300005536 | Bacteria | 6279 |
| 164 | Ga0070697_100063553 | 3300005536 | Bacteria | 3014 |
| 165 | Ga0070697_100089287 | 3300005536 | Bacteria | 2546 |
| 166 | Ga0070697_100242523 | 3300005536 | Bacteria | 1539 |
| 167 | Ga0070697_100452401 | 3300005536 | Bacteria | 1119 |
| 168 | Ga0070697_101109239 | 3300005536 | Bacteria | 704 |
| 169 | Ga0068853_100004519 | 3300005539 | Bacteria | 10792 |
| 170 | Ga0068853_100047075 | 3300005539 | Bacteria | 3701 |
| 171 | Ga0068853_100082344 | 3300005539 | Bacteria | 2819 |
| 172 | Ga0068853_100436885 | 3300005539 | Bacteria | 1229 |
| 173 | Ga0068853_100811959 | 3300005539 | Bacteria | 896 |
| 174 | Ga0070672_100000757 | 3300005543 | Bacteria | 19233 |
| 175 | Ga0070672_100121871 | 3300005543 | Bacteria | 2135 |
| 176 | Ga0070672_100697281 | 3300005543 | Bacteria | 889 |
| 177 | Ga0070672_101348160 | 3300005543 | Bacteria | 637 |
| 178 | Ga0070686_100095690 | 3300005544 | Bacteria | 1995 |
| 179 | Ga0070686_100461823 | 3300005544 | Bacteria | 978 |
| 180 | Ga0070686_100823400 | 3300005544 | Bacteria | 750 |
| 181 | Ga0070695_100095580 | 3300005545 | Bacteria | 1992 |
| 182 | Ga0070695_101158210 | 3300005545 | Bacteria | 635 |
| 183 | Ga0070695_101396607 | 3300005545 | Bacteria | 581 |
| 184 | Ga0070696_100024455 | 3300005546 | Bacteria | 4105 |
| 185 | Ga0070696_100051826 | 3300005546 | Bacteria | 2854 |
| 186 | Ga0070696_100250352 | 3300005546 | Bacteria | 1340 |
| 187 | Ga0070696_100318204 | 3300005546 | Bacteria | 1197 |
| 188 | Ga0070696_100380670 | 3300005546 | Bacteria | 1100 |
| 189 | Ga0070696_100431838 | 3300005546 | Bacteria | 1036 |
| 190 | Ga0070693_100034357 | 3300005547 | Bacteria | 2805 |
| 191 | Ga0070693_100081645 | 3300005547 | Bacteria | 1929 |
| 192 | Ga0070693_100194827 | 3300005547 | Bacteria | 1313 |
| 193 | Ga0070665_100002227 | 3300005548 | Bacteria | 21612 |
| 194 | Ga0070665_100004533 | 3300005548 | Bacteria | 14554 |
| 195 | Ga0070665_100034082 | 3300005548 | Bacteria | 5120 |
| 196 | Ga0070665_100235316 | 3300005548 | Bacteria | 1832 |
| 197 | Ga0070665_100686800 | 3300005548 | Bacteria | 1037 |
| 198 | Ga0070665_101355487 | 3300005548 | Bacteria | 721 |
| 199 | Ga0070704_100044797 | 3300005549 | Bacteria | 3076 |
| 200 | Ga0070704_100127247 | 3300005549 | Bacteria | 1968 |
| 201 | Ga0070704_100173908 | 3300005549 | Bacteria | 1716 |
| 202 | Ga0070704_100198723 | 3300005549 | Bacteria | 1617 |
| 203 | Ga0070704_100226850 | 3300005549 | Bacteria | 1521 |
| 204 | Ga0070704_101262934 | 3300005549 | Bacteria | 675 |
| 205 | Ga0068855_100439986 | 3300005563 | Bacteria | 1424 |
| 206 | Ga0068855_101143808 | 3300005563 | Bacteria | 812 |
| 207 | Ga0070664_100160350 | 3300005564 | Bacteria | 1990 |
| 208 | Ga0068857_100096584 | 3300005577 | Bacteria | 2648 |
| 209 | Ga0068854_100003089 | 3300005578 | Bacteria | 10367 |
| 210 | Ga0068854_100068470 | 3300005578 | Bacteria | 2588 |
| 211 | Ga0068854_100478558 | 3300005578 | Bacteria | 1045 |
| 212 | Ga0068856_100030254 | 3300005614 | Bacteria | 5293 |
| 213 | Ga0068856_100505285 | 3300005614 | Bacteria | 1230 |
| 214 | Ga0070702_100165943 | 3300005615 | Bacteria | 1432 |
| 215 | Ga0070702_100267918 | 3300005615 | Bacteria | 1166 |
| 216 | Ga0070702_100623315 | 3300005615 | Bacteria | 812 |
| 217 | Ga0070702_100663916 | 3300005615 | Bacteria | 790 |
| 218 | Ga0068852_100009278 | 3300005616 | Bacteria | 7293 |
| 219 | Ga0068852_100060431 | 3300005616 | Bacteria | 3289 |
| 220 | Ga0068852_100160391 | 3300005616 | Bacteria | 2099 |
| 221 | Ga0068852_100197030 | 3300005616 | Bacteria | 1904 |
| 222 | Ga0068852_100741588 | 3300005616 | Bacteria | 994 |
| 223 | Ga0068852_101708142 | 3300005616 | Bacteria | 652 |
| 224 | Ga0068852_101781318 | 3300005616 | Bacteria | 638 |
| 225 | Ga0068859_100001101 | 3300005617 | Bacteria | 27548 |
| 226 | Ga0068859_100004143 | 3300005617 | Bacteria | 14805 |
| 227 | Ga0068859_100118593 | 3300005617 | Bacteria | 2712 |
| 228 | Ga0068859_100344804 | 3300005617 | Bacteria | 1584 |
| 229 | Ga0068859_100421609 | 3300005617 | Bacteria | 1431 |
| 230 | Ga0068859_100564936 | 3300005617 | Bacteria | 1232 |
| 231 | Ga0068864_100001698 | 3300005618 | Bacteria | 18102 |
| 232 | Ga0068864_100015530 | 3300005618 | Bacteria | 6331 |
| 233 | Ga0068864_100018582 | 3300005618 | Bacteria | 5810 |
| 234 | Ga0068864_100075317 | 3300005618 | Bacteria | 2946 |
| 235 | Ga0068864_100085019 | 3300005618 | Bacteria | 2781 |
| 236 | Ga0068864_100089679 | 3300005618 | Bacteria | 2709 |
| 237 | Ga0068864_101208836 | 3300005618 | Bacteria | 754 |
| 238 | Ga0068866_10023568 | 3300005718 | Bacteria | 2866 |
| 239 | Ga0068866_10025262 | 3300005718 | Bacteria | 2791 |
| 240 | Ga0068866_10365037 | 3300005718 | Bacteria | 921 |
| 241 | Ga0068866_10912206 | 3300005718 | Bacteria | 619 |
| 242 | Ga0068861_100022064 | 3300005719 | Bacteria | 4582 |
| 243 | Ga0068861_100111242 | 3300005719 | Bacteria | 2195 |
| 244 | Ga0068861_100150212 | 3300005719 | Bacteria | 1911 |
| 245 | Ga0068861_100813762 | 3300005719 | Bacteria | 878 |
| 246 | Ga0068861_100924498 | 3300005719 | Bacteria | 828 |
| 247 | Ga0068851_10022458 | 3300005834 | Bacteria | 3074 |
| 248 | Ga0068851_10062919 | 3300005834 | Bacteria | 1905 |
| 249 | Ga0068870_10012793 | 3300005840 | Bacteria | 3928 |
| 250 | Ga0068870_10027059 | 3300005840 | Bacteria | 2865 |
| 251 | Ga0068870_10027240 | 3300005840 | Bacteria | 2857 |
| 252 | Ga0068863_100024216 | 3300005841 | Bacteria | 5790 |
| 253 | Ga0068863_100027522 | 3300005841 | Bacteria | 5423 |
| 254 | Ga0068863_100031027 | 3300005841 | Bacteria | 5103 |
| 255 | Ga0068863_100034144 | 3300005841 | Bacteria | 4846 |
| 256 | Ga0068863_100653550 | 3300005841 | Bacteria | 1043 |
| 257 | Ga0068863_101608968 | 3300005841 | Bacteria | 659 |
| 258 | Ga0068858_100001243 | 3300005842 | Bacteria | 26335 |
| 259 | Ga0068858_100001448 | 3300005842 | Bacteria | 24421 |
| 260 | Ga0068858_100125407 | 3300005842 | Bacteria | 2404 |
| 261 | Ga0068858_100126739 | 3300005842 | Bacteria | 2391 |
| 262 | Ga0068858_100195790 | 3300005842 | Bacteria | 1910 |
| 263 | Ga0068858_100759951 | 3300005842 | Bacteria | 945 |
| 264 | Ga0068858_101395383 | 3300005842 | Bacteria | 690 |
| 265 | Ga0068860_100062103 | 3300005843 | Bacteria | 3550 |
| 266 | Ga0068860_100483451 | 3300005843 | Bacteria | 1234 |
| 267 | Ga0068860_100486951 | 3300005843 | Bacteria | 1230 |
| 268 | Ga0068862_100140937 | 3300005844 | Bacteria | 2140 |
| 269 | Ga0068862_101061603 | 3300005844 | Bacteria | 803 |
| 270 | Ga0081539_10000805 | 3300005985 | Bacteria | 61020 |
| 271 | Ga0070717_10187237 | 3300006028 | Bacteria | 1807 |
| 272 | Ga0070715_10107151 | 3300006163 | Bacteria | 1313 |
| 273 | Ga0070715_10260604 | 3300006163 | Bacteria | 910 |
| 274 | Ga0070716_100165349 | 3300006173 | Bacteria | 1438 |
| 275 | Ga0070712_100034746 | 3300006175 | Bacteria | 3418 |
| 276 | Ga0070712_100120470 | 3300006175 | Bacteria | 1973 |
| 277 | Ga0097621_100002521 | 3300006237 | Bacteria | 12549 |
| 278 | Ga0097621_100008534 | 3300006237 | Bacteria | 7379 |
| 279 | Ga0097621_100022358 | 3300006237 | Bacteria | 4908 |
| 280 | Ga0097621_100103464 | 3300006237 | Bacteria | 2398 |
| 281 | Ga0097621_100167357 | 3300006237 | Bacteria | 1893 |
| 282 | Ga0097621_100336484 | 3300006237 | Bacteria | 1340 |
| 283 | Ga0097621_100396827 | 3300006237 | Bacteria | 1234 |
| 284 | Ga0097621_100649972 | 3300006237 | Bacteria | 967 |
| 285 | Ga0097621_101195491 | 3300006237 | Bacteria | 716 |
| 286 | Ga0068871_100004365 | 3300006358 | Bacteria | 9830 |
| 287 | Ga0068871_100041227 | 3300006358 | Bacteria | 3701 |
| 288 | Ga0068871_100076099 | 3300006358 | Bacteria | 2772 |
| 289 | Ga0068871_100261839 | 3300006358 | Bacteria | 1509 |
| 290 | Ga0068871_100551525 | 3300006358 | Bacteria | 1044 |
| 291 | Ga0068871_100666348 | 3300006358 | Bacteria | 951 |
| 292 | Ga0068871_100739535 | 3300006358 | Bacteria | 903 |
| 293 | Ga0075430_100021691 | 3300006846 | Bacteria | 5459 |
| 294 | Ga0075430_100022384 | 3300006846 | Bacteria | 5377 |
| 295 | Ga0075430_100110168 | 3300006846 | Bacteria | 2296 |
| 296 | Ga0075431_100005031 | 3300006847 | Bacteria | 13007 |
| 297 | Ga0075433_10412026 | 3300006852 | Bacteria | 1192 |
| 298 | Ga0075433_10487354 | 3300006852 | Bacteria | 1086 |
| 299 | Ga0075434_100000484 | 3300006871 | Bacteria | 29868 |
| 300 | Ga0075434_100160654 | 3300006871 | Bacteria | 2266 |
| 301 | Ga0075434_100497625 | 3300006871 | Bacteria | 1240 |
| 302 | Ga0075434_101138293 | 3300006871 | Bacteria | 793 |
| 303 | Ga0075434_101340721 | 3300006871 | Bacteria | 726 |
| 304 | Ga0075429_100045494 | 3300006880 | Bacteria | 3819 |
| 305 | Ga0075429_100167210 | 3300006880 | Bacteria | 1926 |
| 306 | Ga0068865_100072899 | 3300006881 | Bacteria | 2440 |
| 307 | Ga0068865_100082328 | 3300006881 | Bacteria | 2313 |
| 308 | Ga0068865_100118585 | 3300006881 | Bacteria | 1964 |
| 309 | Ga0068865_100342468 | 3300006881 | Bacteria | 1209 |
| 310 | Ga0075436_100000593 | 3300006914 | Bacteria | 23748 |
| 311 | Ga0075436_100030087 | 3300006914 | Bacteria | 3736 |
| 312 | Ga0075436_100046822 | 3300006914 | Bacteria | 2982 |
| 313 | Ga0075436_100148145 | 3300006914 | Bacteria | 1650 |
| 314 | Ga0075436_100292335 | 3300006914 | Bacteria | 1166 |
| 315 | Ga0075436_100340350 | 3300006914 | Bacteria | 1080 |
| 316 | Ga0097620_100001101 | 3300006931 | Bacteria | 27548 |
| 317 | Ga0097620_100004143 | 3300006931 | Bacteria | 14805 |
| 318 | Ga0097620_100118591 | 3300006931 | Bacteria | 2712 |
| 319 | Ga0097620_100344820 | 3300006931 | Bacteria | 1584 |
| 320 | Ga0097620_100421603 | 3300006931 | Bacteria | 1431 |
| 321 | Ga0097620_100564943 | 3300006931 | Bacteria | 1232 |
| 322 | Ga0075435_100130708 | 3300007076 | Bacteria | 2101 |
| 323 | Ga0075435_100177974 | 3300007076 | Bacteria | 1797 |
| 324 | Ga0075435_100213264 | 3300007076 | Bacteria | 1638 |
| 325 | Ga0075435_100234384 | 3300007076 | Bacteria | 1560 |
| 326 | Ga0099794_10038371 | 3300007265 | Bacteria | 2269 |
| 327 | Ga0099794_10043650 | 3300007265 | Bacteria | 2141 |
| 328 | Ga0099794_10090944 | 3300007265 | Bacteria | 1514 |
| 329 | Ga0099794_10100975 | 3300007265 | Bacteria | 1440 |
| 330 | Ga0099794_10189342 | 3300007265 | Bacteria | 1052 |
| 331 | Ga0099795_10039408 | 3300007788 | Bacteria | 1672 |
| 332 | Ga0105251_10242635 | 3300009011 | Bacteria | 812 |
| 333 | Ga0105240_10603196 | 3300009093 | Bacteria | 1208 |
| 334 | Ga0111539_10001053 | 3300009094 | Bacteria | 36307 |
| 335 | Ga0111539_10016781 | 3300009094 | Bacteria | 9072 |
| 336 | Ga0111539_10151848 | 3300009094 | Bacteria | 2711 |
| 337 | Ga0111539_10800328 | 3300009094 | Bacteria | 1097 |
| 338 | Ga0111539_10932848 | 3300009094 | Bacteria | 1009 |
| 339 | Ga0111539_11692320 | 3300009094 | Bacteria | 734 |
| 340 | Ga0111539_12975142 | 3300009094 | Unclassified | 548 |
| 341 | Ga0105245_10000207 | 3300009098 | Bacteria | 55562 |
| 342 | Ga0105245_10123931 | 3300009098 | Bacteria | 2416 |
| 343 | Ga0105245_10209682 | 3300009098 | Bacteria | 1875 |
| 344 | Ga0105245_10383677 | 3300009098 | Bacteria | 1400 |
| 345 | Ga0105245_10410722 | 3300009098 | Bacteria | 1355 |
| 346 | Ga0105245_10451951 | 3300009098 | Bacteria | 1293 |
| 347 | Ga0105245_10460184 | 3300009098 | Bacteria | 1282 |
| 348 | Ga0105245_10817410 | 3300009098 | Bacteria | 971 |
| 349 | Ga0105245_11069593 | 3300009098 | Bacteria | 852 |
| 350 | Ga0105247_10044964 | 3300009101 | Bacteria | 2709 |
| 351 | Ga0105247_10344858 | 3300009101 | Bacteria | 1046 |
| 352 | Ga0114129_10993796 | 3300009147 | Bacteria | 1057 |
| 353 | Ga0105243_10666547 | 3300009148 | Bacteria | 1010 |
| 354 | Ga0105243_11482630 | 3300009148 | Bacteria | 701 |
| 355 | Ga0105241_10167204 | 3300009174 | Bacteria | 1813 |
| 356 | Ga0105241_10217483 | 3300009174 | Bacteria | 1604 |
| 357 | Ga0105241_10934072 | 3300009174 | Bacteria | 808 |
| 358 | Ga0105242_10221835 | 3300009176 | Bacteria | 1690 |
| 359 | Ga0105242_10602608 | 3300009176 | Bacteria | 1061 |
| 360 | Ga0105242_10697852 | 3300009176 | Bacteria | 992 |
| 361 | Ga0105242_11101892 | 3300009176 | Bacteria | 808 |
| 362 | Ga0105242_11881934 | 3300009176 | Bacteria | 638 |
| 363 | Ga0105248_10002218 | 3300009177 | Bacteria | 21485 |
| 364 | Ga0105248_10308283 | 3300009177 | Bacteria | 1783 |
| 365 | Ga0105248_10315991 | 3300009177 | Bacteria | 1759 |
| 366 | Ga0105248_11151747 | 3300009177 | Bacteria | 877 |
| 367 | Ga0105248_11851306 | 3300009177 | Bacteria | 685 |
| 368 | Ga0105237_10265601 | 3300009545 | Bacteria | 1719 |
| 369 | Ga0105237_10527742 | 3300009545 | Bacteria | 1187 |
| 370 | Ga0105237_11090568 | 3300009545 | Bacteria | 805 |
| 371 | Ga0105238_10146803 | 3300009551 | Bacteria | 2335 |
| 372 | Ga0105238_10829145 | 3300009551 | Bacteria | 941 |
| 373 | Ga0105238_11259084 | 3300009551 | Bacteria | 765 |
| 374 | Ga0105249_10821374 | 3300009553 | Bacteria | 994 |
| 375 | Ga0105249_11002136 | 3300009553 | Bacteria | 904 |
| 376 | Ga0105249_11106389 | 3300009553 | Bacteria | 862 |
| 377 | Ga0105249_12432486 | 3300009553 | Bacteria | 596 |
| 378 | Ga0099796_10025359 | 3300010159 | Bacteria | 1871 |
| 379 | Ga0105239_10166516 | 3300010375 | Bacteria | 2465 |
| 380 | Ga0105239_10373346 | 3300010375 | Bacteria | 1612 |
| 381 | Ga0105239_11048648 | 3300010375 | Bacteria | 938 |
| 382 | Ga0105239_11667005 | 3300010375 | Bacteria | 738 |
| 383 | Ga0105246_10062859 | 3300011119 | Bacteria | 2587 |
| 384 | Ga0105246_10189276 | 3300011119 | Bacteria | 1592 |
| 385 | Ga0157373_10311327 | 3300013100 | Bacteria | 1119 |
| 386 | Ga0157373_10358395 | 3300013100 | Bacteria | 1041 |
| 387 | Ga0157371_10250382 | 3300013102 | Bacteria | 1275 |
| 388 | Ga0157371_11066066 | 3300013102 | Bacteria | 619 |
| 389 | Ga0157370_10266430 | 3300013104 | Bacteria | 1583 |
| 390 | Ga0157369_10037398 | 3300013105 | Bacteria | 5313 |
| 391 | Ga0157369_10719551 | 3300013105 | Bacteria | 1028 |
| 392 | Ga0157374_10014294 | 3300013296 | Bacteria | 6945 |
| 393 | Ga0157374_10150237 | 3300013296 | Bacteria | 2264 |
| 394 | Ga0157374_10264089 | 3300013296 | Bacteria | 1696 |
| 395 | Ga0157374_10675431 | 3300013296 | Bacteria | 1045 |
| 396 | Ga0157378_10051663 | 3300013297 | Bacteria | 3657 |
| 397 | Ga0157378_10208931 | 3300013297 | Bacteria | 1850 |
| 398 | Ga0157378_10393456 | 3300013297 | Bacteria | 1364 |
| 399 | Ga0157378_10712517 | 3300013297 | Bacteria | 1024 |
| 400 | Ga0157378_10776966 | 3300013297 | Bacteria | 982 |
| 401 | Ga0157378_10859028 | 3300013297 | Bacteria | 936 |
| 402 | Ga0157378_11137268 | 3300013297 | Bacteria | 819 |
| 403 | Ga0157378_11475590 | 3300013297 | Bacteria | 724 |
| 404 | Ga0163162_10140906 | 3300013306 | Bacteria | 2524 |
| 405 | Ga0163162_10306385 | 3300013306 | Bacteria | 1720 |
| 406 | Ga0163162_10585527 | 3300013306 | Bacteria | 1242 |
| 407 | Ga0163162_10690853 | 3300013306 | Bacteria | 1142 |
| 408 | Ga0157372_10098712 | 3300013307 | Bacteria | 3332 |
| 409 | Ga0157372_10617056 | 3300013307 | Bacteria | 1264 |
| 410 | Ga0157372_10796076 | 3300013307 | Bacteria | 1098 |
| 411 | Ga0157372_11018966 | 3300013307 | Bacteria | 959 |
| 412 | Ga0157375_10011033 | 3300013308 | Bacteria | 7969 |
| 413 | Ga0157375_10016586 | 3300013308 | Bacteria | 6623 |
| 414 | Ga0157375_10042038 | 3300013308 | Bacteria | 4420 |
| 415 | Ga0157375_10374368 | 3300013308 | Bacteria | 1591 |
| 416 | Ga0157375_10436880 | 3300013308 | Bacteria | 1475 |
| 417 | Ga0157375_11503106 | 3300013308 | Bacteria | 795 |
| 418 | Ga0157375_12045523 | 3300013308 | Bacteria | 681 |
| 419 | Ga0163163_10009593 | 3300014325 | Bacteria | 8649 |
| 420 | Ga0163163_10066625 | 3300014325 | Bacteria | 3577 |
| 421 | Ga0157380_10108260 | 3300014326 | Bacteria | 2329 |
| 422 | Ga0157380_10183103 | 3300014326 | Bacteria | 1842 |
| 423 | Ga0157380_10573010 | 3300014326 | Bacteria | 1112 |
| 424 | Ga0157380_11375449 | 3300014326 | Bacteria | 756 |
| 425 | Ga0157380_11920684 | 3300014326 | Bacteria | 653 |
| 426 | Ga0157377_10078631 | 3300014745 | Bacteria | 1923 |
| 427 | Ga0157379_10006994 | 3300014968 | Bacteria | 9753 |
| 428 | Ga0157379_10245270 | 3300014968 | Bacteria | 1625 |
| 429 | Ga0157379_10365806 | 3300014968 | Bacteria | 1322 |
| 430 | Ga0157376_10033466 | 3300014969 | Bacteria | 4138 |
| 431 | Ga0157376_10069688 | 3300014969 | Bacteria | 2982 |
| 432 | Ga0157376_10167905 | 3300014969 | Bacteria | 1995 |
| 433 | Ga0157376_10369635 | 3300014969 | Bacteria | 1378 |
| 434 | Ga0157376_10543339 | 3300014969 | Bacteria | 1149 |
| 435 | Ga0182006_1032825 | 3300015261 | Bacteria | 2084 |
| 436 | Ga0182007_10050203 | 3300015262 | Bacteria | 1377 |
| 437 | Ga0182005_1013443 | 3300015265 | Bacteria | 2302 |
| 438 | Ga0163161_10013389 | 3300017792 | Bacteria | 5707 |
| 439 | Ga0163161_10039723 | 3300017792 | Bacteria | 3379 |
| 440 | Ga0163161_10094176 | 3300017792 | Bacteria | 2220 |
| 441 | Ga0209760_101465 | 3300025207 | Bacteria | 2483 |
| 442 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 443 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 444 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 445 | Ga0207427_100293 | 3300025231 | Bacteria | 35384 |
| 446 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 447 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 448 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 449 | Ga0207656_10001172 | 3300025321 | Bacteria | 8631 |
| 450 | Ga0207656_10118445 | 3300025321 | Bacteria | 1230 |
| 451 | Ga0207682_10024633 | 3300025893 | Bacteria | 2384 |
| 452 | Ga0207682_10035821 | 3300025893 | Bacteria | 2006 |
| 453 | Ga0207682_10040949 | 3300025893 | Bacteria | 1890 |
| 454 | Ga0207682_10233052 | 3300025893 | Bacteria | 854 |
| 455 | Ga0207692_10917195 | 3300025898 | Bacteria | 576 |
| 456 | Ga0207642_10052105 | 3300025899 | Bacteria | 1855 |
| 457 | Ga0207642_10075839 | 3300025899 | Bacteria | 1616 |
| 458 | Ga0207710_10015450 | 3300025900 | Bacteria | 3226 |
| 459 | Ga0207710_10287665 | 3300025900 | Bacteria | 828 |
| 460 | Ga0207688_10172243 | 3300025901 | Bacteria | 1287 |
| 461 | Ga0207688_10183712 | 3300025901 | Bacteria | 1248 |
| 462 | Ga0207680_10007196 | 3300025903 | Bacteria | 5410 |
| 463 | Ga0207680_10246988 | 3300025903 | Bacteria | 1231 |
| 464 | Ga0207685_10002834 | 3300025905 | Bacteria | 4074 |
| 465 | Ga0207699_10070113 | 3300025906 | Bacteria | 2140 |
| 466 | Ga0207645_10000686 | 3300025907 | Bacteria | 28086 |
| 467 | Ga0207645_10229484 | 3300025907 | Bacteria | 1225 |
| 468 | Ga0207645_10602803 | 3300025907 | Bacteria | 746 |
| 469 | Ga0207643_10007629 | 3300025908 | Bacteria | 5814 |
| 470 | Ga0207643_10011915 | 3300025908 | Bacteria | 4694 |
| 471 | Ga0207643_10027879 | 3300025908 | Bacteria | 3134 |
| 472 | Ga0207643_10090879 | 3300025908 | Bacteria | 1780 |
| 473 | Ga0207684_10098891 | 3300025910 | Bacteria | 2492 |
| 474 | Ga0207684_10126212 | 3300025910 | Bacteria | 2196 |
| 475 | Ga0207684_10167442 | 3300025910 | Bacteria | 1894 |
| 476 | Ga0207684_11708245 | 3300025910 | Bacteria | 507 |
| 477 | Ga0207654_10148730 | 3300025911 | Bacteria | 1501 |
| 478 | Ga0207707_10017447 | 3300025912 | Bacteria | 6258 |
| 479 | Ga0207707_10026843 | 3300025912 | Bacteria | 5033 |
| 480 | Ga0207707_10261257 | 3300025912 | Bacteria | 1502 |
| 481 | Ga0207707_10527371 | 3300025912 | Bacteria | 1005 |
| 482 | Ga0207695_10780147 | 3300025913 | Bacteria | 836 |
| 483 | Ga0207671_10013515 | 3300025914 | Bacteria | 6499 |
| 484 | Ga0207671_10040925 | 3300025914 | Bacteria | 3430 |
| 485 | Ga0207693_10025102 | 3300025915 | Bacteria | 4728 |
| 486 | Ga0207693_10046169 | 3300025915 | Bacteria | 3422 |
| 487 | Ga0207693_10076236 | 3300025915 | Bacteria | 2626 |
| 488 | Ga0207663_10104065 | 3300025916 | Bacteria | 1913 |
| 489 | Ga0207660_10654290 | 3300025917 | Bacteria | 857 |
| 490 | Ga0207662_10079839 | 3300025918 | Bacteria | 1994 |
| 491 | Ga0207657_10014919 | 3300025919 | Bacteria | 7555 |
| 492 | Ga0207652_10055337 | 3300025921 | Bacteria | 3411 |
| 493 | Ga0207652_10355688 | 3300025921 | Bacteria | 1322 |
| 494 | Ga0207646_10470666 | 3300025922 | Bacteria | 1133 |
| 495 | Ga0207681_10062298 | 3300025923 | Bacteria | 2568 |
| 496 | Ga0207681_10197824 | 3300025923 | Bacteria | 1542 |
| 497 | Ga0207681_10488648 | 3300025923 | Bacteria | 1006 |
| 498 | Ga0207694_10982735 | 3300025924 | Bacteria | 714 |
| 499 | Ga0207650_10079817 | 3300025925 | Bacteria | 2479 |
| 500 | Ga0207650_10196981 | 3300025925 | Bacteria | 1612 |
| 501 | Ga0207650_10203115 | 3300025925 | Bacteria | 1588 |
| 502 | Ga0207650_10210188 | 3300025925 | Bacteria | 1562 |
| 503 | Ga0207650_11284864 | 3300025925 | Unclassified | 623 |
| 504 | Ga0207650_11516181 | 3300025925 | Bacteria | 570 |
| 505 | Ga0207659_10027966 | 3300025926 | Bacteria | 3825 |
| 506 | Ga0207659_10036324 | 3300025926 | Bacteria | 3412 |
| 507 | Ga0207659_10662271 | 3300025926 | Bacteria | 893 |
| 508 | Ga0207687_10002891 | 3300025927 | Bacteria | 11663 |
| 509 | Ga0207687_10170079 | 3300025927 | Bacteria | 1680 |
| 510 | Ga0207687_10224223 | 3300025927 | Bacteria | 1482 |
| 511 | Ga0207687_10376736 | 3300025927 | Bacteria | 1162 |
| 512 | Ga0207687_10547113 | 3300025927 | Bacteria | 971 |
| 513 | Ga0207700_10000099 | 3300025928 | Bacteria | 53179 |
| 514 | Ga0207700_10031130 | 3300025928 | Bacteria | 3787 |
| 515 | Ga0207700_10051938 | 3300025928 | Bacteria | 3063 |
| 516 | Ga0207664_10002486 | 3300025929 | Bacteria | 12199 |
| 517 | Ga0207644_10004698 | 3300025931 | Bacteria | 8874 |
| 518 | Ga0207644_10009912 | 3300025931 | Bacteria | 6268 |
| 519 | Ga0207644_10049097 | 3300025931 | Bacteria | 3019 |
| 520 | Ga0207644_10166745 | 3300025931 | Bacteria | 1716 |
| 521 | Ga0207690_10131805 | 3300025932 | Bacteria | 1830 |
| 522 | Ga0207690_10406579 | 3300025932 | Bacteria | 1086 |
| 523 | Ga0207690_10474155 | 3300025932 | Bacteria | 1009 |
| 524 | Ga0207706_10029707 | 3300025933 | Bacteria | 4878 |
| 525 | Ga0207706_10040580 | 3300025933 | Bacteria | 4125 |
| 526 | Ga0207706_10098770 | 3300025933 | Bacteria | 2568 |
| 527 | Ga0207706_10145093 | 3300025933 | Bacteria | 2088 |
| 528 | Ga0207706_10326444 | 3300025933 | Bacteria | 1335 |
| 529 | Ga0207706_10564523 | 3300025933 | Bacteria | 979 |
| 530 | Ga0207706_11010902 | 3300025933 | Bacteria | 698 |
| 531 | Ga0207686_10000488 | 3300025934 | Bacteria | 26043 |
| 532 | Ga0207686_10165660 | 3300025934 | Bacteria | 1554 |
| 533 | Ga0207686_10374764 | 3300025934 | Bacteria | 1078 |
| 534 | Ga0207686_10653210 | 3300025934 | Bacteria | 832 |
| 535 | Ga0207709_10003546 | 3300025935 | Bacteria | 9232 |
| 536 | Ga0207670_10037772 | 3300025936 | Bacteria | 3149 |
| 537 | Ga0207670_10195194 | 3300025936 | Bacteria | 1534 |
| 538 | Ga0207670_10256476 | 3300025936 | Bacteria | 1354 |
| 539 | Ga0207670_11144842 | 3300025936 | Bacteria | 658 |
| 540 | Ga0207669_10085486 | 3300025937 | Bacteria | 2036 |
| 541 | Ga0207669_10088399 | 3300025937 | Bacteria | 2009 |
| 542 | Ga0207669_10354658 | 3300025937 | Bacteria | 1134 |
| 543 | Ga0207669_10695343 | 3300025937 | Bacteria | 835 |
| 544 | Ga0207669_11048761 | 3300025937 | Bacteria | 687 |
| 545 | Ga0207704_10407710 | 3300025938 | Bacteria | 1074 |
| 546 | Ga0207704_10656940 | 3300025938 | Bacteria | 864 |
| 547 | Ga0207665_10008468 | 3300025939 | Bacteria | 6776 |
| 548 | Ga0207665_10048319 | 3300025939 | Bacteria | 2856 |
| 549 | Ga0207665_10129285 | 3300025939 | Bacteria | 1791 |
| 550 | Ga0207691_10000367 | 3300025940 | Bacteria | 45445 |
| 551 | Ga0207691_10080128 | 3300025940 | Bacteria | 2937 |
| 552 | Ga0207691_10170606 | 3300025940 | Bacteria | 1905 |
| 553 | Ga0207691_10245380 | 3300025940 | Bacteria | 1547 |
| 554 | Ga0207691_10305182 | 3300025940 | Bacteria | 1367 |
| 555 | Ga0207691_10517493 | 3300025940 | Bacteria | 1013 |
| 556 | Ga0207711_10001033 | 3300025941 | Bacteria | 26678 |
| 557 | Ga0207711_10144793 | 3300025941 | Bacteria | 2140 |
| 558 | Ga0207711_10215806 | 3300025941 | Bacteria | 1753 |
| 559 | Ga0207711_10332300 | 3300025941 | Bacteria | 1406 |
| 560 | Ga0207689_10001526 | 3300025942 | Bacteria | 22022 |
| 561 | Ga0207689_10080987 | 3300025942 | Bacteria | 2669 |
| 562 | Ga0207689_10089949 | 3300025942 | Bacteria | 2522 |
| 563 | Ga0207689_10090458 | 3300025942 | Bacteria | 2515 |
| 564 | Ga0207689_10284134 | 3300025942 | Bacteria | 1370 |
| 565 | Ga0207661_10624998 | 3300025944 | Bacteria | 989 |
| 566 | Ga0207661_10789797 | 3300025944 | Bacteria | 874 |
| 567 | Ga0207661_11387302 | 3300025944 | Bacteria | 645 |
| 568 | Ga0207679_10178247 | 3300025945 | Bacteria | 1756 |
| 569 | Ga0207679_10750990 | 3300025945 | Bacteria | 887 |
| 570 | Ga0207679_11428312 | 3300025945 | Bacteria | 635 |
| 571 | Ga0207667_10243928 | 3300025949 | Bacteria | 1838 |
| 572 | Ga0207651_10001584 | 3300025960 | Bacteria | 10419 |
| 573 | Ga0207651_10003957 | 3300025960 | Bacteria | 7358 |
| 574 | Ga0207651_10629223 | 3300025960 | Bacteria | 940 |
| 575 | Ga0207651_10728505 | 3300025960 | Bacteria | 875 |
| 576 | Ga0207712_10366705 | 3300025961 | Bacteria | 1201 |
| 577 | Ga0207668_10026322 | 3300025972 | Bacteria | 3775 |
| 578 | Ga0207668_10064287 | 3300025972 | Bacteria | 2592 |
| 579 | Ga0207668_10140898 | 3300025972 | Bacteria | 1854 |
| 580 | Ga0207668_10338096 | 3300025972 | Bacteria | 1255 |
| 581 | Ga0207668_10371735 | 3300025972 | Bacteria | 1201 |
| 582 | Ga0207640_10039707 | 3300025981 | Bacteria | 2981 |
| 583 | Ga0207640_10052298 | 3300025981 | Bacteria | 2660 |
| 584 | Ga0207658_10041343 | 3300025986 | Bacteria | 3337 |
| 585 | Ga0207658_10052812 | 3300025986 | Bacteria | 3000 |
| 586 | Ga0207658_10121457 | 3300025986 | Bacteria | 2084 |
| 587 | Ga0207658_10125323 | 3300025986 | Bacteria | 2054 |
| 588 | Ga0207658_10243630 | 3300025986 | Bacteria | 1524 |
| 589 | Ga0207658_10401217 | 3300025986 | Bacteria | 1205 |
| 590 | Ga0207658_10688705 | 3300025986 | Bacteria | 923 |
| 591 | Ga0207677_10002051 | 3300026023 | Bacteria | 10615 |
| 592 | Ga0207677_10045023 | 3300026023 | Bacteria | 2945 |
| 593 | Ga0207677_10062363 | 3300026023 | Bacteria | 2585 |
| 594 | Ga0207677_10097557 | 3300026023 | Bacteria | 2153 |
| 595 | Ga0207677_10231540 | 3300026023 | Bacteria | 1489 |
| 596 | Ga0207677_10296131 | 3300026023 | Bacteria | 1335 |
| 597 | Ga0207677_10449756 | 3300026023 | Bacteria | 1103 |
| 598 | Ga0207677_10640560 | 3300026023 | Bacteria | 937 |
| 599 | Ga0207677_10644287 | 3300026023 | Bacteria | 934 |
| 600 | Ga0207703_10001709 | 3300026035 | Bacteria | 19718 |
| 601 | Ga0207703_10004881 | 3300026035 | Bacteria | 10902 |
| 602 | Ga0207703_10250399 | 3300026035 | Bacteria | 1596 |
| 603 | Ga0207703_10592930 | 3300026035 | Bacteria | 1048 |
| 604 | Ga0207703_10974247 | 3300026035 | Bacteria | 813 |
| 605 | Ga0207703_11160505 | 3300026035 | Bacteria | 742 |
| 606 | Ga0207639_10016008 | 3300026041 | Bacteria | 5296 |
| 607 | Ga0207639_10030737 | 3300026041 | Bacteria | 3941 |
| 608 | Ga0207639_10243640 | 3300026041 | Bacteria | 1564 |
| 609 | Ga0207639_10259421 | 3300026041 | Bacteria | 1519 |
| 610 | Ga0207678_10039057 | 3300026067 | Bacteria | 4121 |
| 611 | Ga0207678_10179040 | 3300026067 | Bacteria | 1810 |
| 612 | Ga0207678_10223448 | 3300026067 | Bacteria | 1612 |
| 613 | Ga0207678_10261753 | 3300026067 | Bacteria | 1482 |
| 614 | Ga0207702_10335483 | 3300026078 | Bacteria | 1443 |
| 615 | Ga0207702_10796015 | 3300026078 | Bacteria | 934 |
| 616 | Ga0207641_10007244 | 3300026088 | Bacteria | 9243 |
| 617 | Ga0207641_10014486 | 3300026088 | Bacteria | 6461 |
| 618 | Ga0207641_10033425 | 3300026088 | Bacteria | 4273 |
| 619 | Ga0207641_10074117 | 3300026088 | Bacteria | 2935 |
| 620 | Ga0207641_10352461 | 3300026088 | Bacteria | 1403 |
| 621 | Ga0207648_10023103 | 3300026089 | Bacteria | 5578 |
| 622 | Ga0207648_10036862 | 3300026089 | Bacteria | 4307 |
| 623 | Ga0207648_10059692 | 3300026089 | Bacteria | 3326 |
| 624 | Ga0207648_10208856 | 3300026089 | Bacteria | 1733 |
| 625 | Ga0207648_10722118 | 3300026089 | Bacteria | 924 |
| 626 | Ga0207676_10000174 | 3300026095 | Bacteria | 56439 |
| 627 | Ga0207676_10000548 | 3300026095 | Bacteria | 31359 |
| 628 | Ga0207676_10014818 | 3300026095 | Bacteria | 5617 |
| 629 | Ga0207676_10050997 | 3300026095 | Bacteria | 3229 |
| 630 | Ga0207676_10162303 | 3300026095 | Bacteria | 1937 |
| 631 | Ga0207676_10588374 | 3300026095 | Bacteria | 1067 |
| 632 | Ga0207676_11299082 | 3300026095 | Bacteria | 722 |
| 633 | Ga0207674_10018138 | 3300026116 | Bacteria | 7657 |
| 634 | Ga0207674_10065150 | 3300026116 | Bacteria | 3674 |
| 635 | Ga0207674_10551097 | 3300026116 | Bacteria | 1114 |
| 636 | Ga0207675_100001059 | 3300026118 | Bacteria | 27297 |
| 637 | Ga0207675_100028790 | 3300026118 | Bacteria | 5175 |
| 638 | Ga0207675_100029308 | 3300026118 | Bacteria | 5129 |
| 639 | Ga0207675_100274530 | 3300026118 | Bacteria | 1637 |
| 640 | Ga0207683_10000246 | 3300026121 | Bacteria | 48193 |
| 641 | Ga0207683_10017870 | 3300026121 | Bacteria | 6048 |
| 642 | Ga0207683_10023679 | 3300026121 | Bacteria | 5282 |
| 643 | Ga0207683_10051897 | 3300026121 | Bacteria | 3593 |
| 644 | Ga0207683_10691031 | 3300026121 | Bacteria | 946 |
| 645 | Ga0207683_11262684 | 3300026121 | Bacteria | 684 |
| 646 | Ga0207698_10046357 | 3300026142 | Bacteria | 3282 |
| 647 | Ga0207698_10147975 | 3300026142 | Bacteria | 2034 |
| 648 | Ga0207698_10284124 | 3300026142 | Bacteria | 1532 |
| 649 | Ga0207698_10662793 | 3300026142 | Bacteria | 1035 |
| 650 | Ga0209179_1070318 | 3300027512 | Bacteria | 766 |
| 651 | Ga0209999_1049327 | 3300027543 | Bacteria | 794 |
| 652 | Ga0209588_1003394 | 3300027671 | Bacteria | 4416 |
| 653 | Ga0209588_1065024 | 3300027671 | Bacteria | 1179 |
| 654 | Ga0209588_1096392 | 3300027671 | Bacteria | 953 |
| 655 | Ga0207428_10002514 | 3300027907 | Bacteria | 18299 |
| 656 | Ga0268266_10006669 | 3300028379 | Bacteria | 10534 |
| 657 | Ga0268266_10008065 | 3300028379 | Bacteria | 9410 |
| 658 | Ga0268266_10008592 | 3300028379 | Bacteria | 9072 |
| 659 | Ga0268266_10231835 | 3300028379 | Bacteria | 1701 |
| 660 | Ga0268266_10370436 | 3300028379 | Bacteria | 1349 |
| 661 | Ga0268265_10060666 | 3300028380 | Bacteria | 2899 |
| 662 | Ga0268265_10099483 | 3300028380 | Bacteria | 2345 |
| 663 | Ga0268264_10021756 | 3300028381 | Bacteria | 5234 |
| 664 | Ga0268264_10037732 | 3300028381 | Bacteria | 3985 |
| 665 | Ga0268264_10059516 | 3300028381 | Bacteria | 3200 |
| 666 | Ga0268264_10424362 | 3300028381 | Bacteria | 1283 |
| 667 | Ga0268264_10481944 | 3300028381 | Bacteria | 1207 |
| 668 | Ga0268264_10646841 | 3300028381 | Bacteria | 1046 |
| 669 | Ga0268264_11869806 | 3300028381 | Bacteria | 610 |
| 670 | Ga0265318_10050404 | 3300028577 | Bacteria | 1564 |
| 671 | Ga0265318_10149264 | 3300028577 | Bacteria | 858 |
| 672 | Ga0265332_10000293 | 3300031238 | Bacteria | 39227 |
| 673 | Ga0265332_10133399 | 3300031238 | Bacteria | 1041 |
| 674 | Ga0265328_10003416 | 3300031239 | Bacteria | 7015 |
| 675 | Ga0265320_10021332 | 3300031240 | Bacteria | 3488 |
| 676 | Ga0265325_10011509 | 3300031241 | Bacteria | 5082 |
| 677 | Ga0265329_10015880 | 3300031242 | Bacteria | 2620 |
| 678 | Ga0265329_10019337 | 3300031242 | Bacteria | 2314 |
| 679 | Ga0265339_10034852 | 3300031249 | Bacteria | 2827 |
| 680 | Ga0265339_10080478 | 3300031249 | Bacteria | 1723 |
| 681 | Ga0265331_10000348 | 3300031250 | Bacteria | 49051 |
| 682 | Ga0265331_10004434 | 3300031250 | Bacteria | 8766 |
| 683 | Ga0265327_10128619 | 3300031251 | Bacteria | 1193 |
| 684 | Ga0265316_10018947 | 3300031344 | Bacteria | 5905 |
| 685 | Ga0265316_10041874 | 3300031344 | Bacteria | 3662 |
| 686 | Ga0307408_100017559 | 3300031548 | Bacteria | 4789 |
| 687 | Ga0265313_10044904 | 3300031595 | Bacteria | 2154 |
| 688 | Ga0265314_10000245 | 3300031711 | Bacteria | 79757 |
| 689 | Ga0265314_10028151 | 3300031711 | Bacteria | 4193 |
| 690 | Ga0265342_10007670 | 3300031712 | Bacteria | 7860 |
| 691 | Ga0307405_10069390 | 3300031731 | Bacteria | 2259 |
| 692 | Ga0307413_10036789 | 3300031824 | Bacteria | 2822 |
| 693 | Ga0307413_10087117 | 3300031824 | Bacteria | 2022 |
| 694 | Ga0307410_10002755 | 3300031852 | Bacteria | 8598 |
| 695 | Ga0307406_10013059 | 3300031901 | Bacteria | 4747 |
| 696 | Ga0307407_10068837 | 3300031903 | Bacteria | 2098 |
| 697 | Ga0307409_100243044 | 3300031995 | Bacteria | 1640 |
| 698 | Ga0307409_100274323 | 3300031995 | Bacteria | 1555 |
| 699 | Ga0307416_100014893 | 3300032002 | Bacteria | 5348 |
| 700 | Ga0307416_101158796 | 3300032002 | Bacteria | 878 |
| 701 | Ga0307414_10010426 | 3300032004 | Bacteria | 5391 |
| 702 | Ga0307414_10235708 | 3300032004 | Bacteria | 1512 |
| 703 | Ga0307414_10461762 | 3300032004 | Bacteria | 1116 |
| 704 | Ga0307411_10098093 | 3300032005 | Bacteria | 2064 |
| 705 | Ga0307411_10228757 | 3300032005 | Bacteria | 1448 |
| 706 | Ga0307411_10262761 | 3300032005 | Bacteria | 1364 |
| 707 | Ga0307415_100007490 | 3300032126 | Bacteria | 5974 |
| 708 | Ga0307415_100100576 | 3300032126 | Bacteria | 2119 |
| 709 | Ga0307415_100258270 | 3300032126 | Bacteria | 1420 |
| 710 | Ga0307415_100646664 | 3300032126 | Bacteria | 947 |
| 711 | Ga0316583_10061686 | 3300032133 | Bacteria | 1313 |
| 712 | Ga0307507_10082957 | 3300033179 | Bacteria | 2806 |
| 713 | Ga0307510_10402365 | 3300033180 | Bacteria | 812 |
| 714 | Ga0373928_0037831 | 3300035084 | Bacteria | 1096 |
| 715 | Ga0373934_0019815 | 3300035086 | Bacteria | 2584 |
| 716 | Ga0373934_0022793 | 3300035086 | Bacteria | 2416 |
| 717 | Ga0373951_0160852 | 3300035091 | Bacteria | 635 |
| 718 | Ga0373952_0012716 | 3300035092 | Bacteria | 1660 |
| 719 | Ga0373923_0001906 | 3300035111 | Bacteria | 6228 |
| 720 | Ga0373923_0270828 | 3300035111 | Bacteria | 798 |
| 721 | Ga0373932_0067634 | 3300035112 | Bacteria | 1100 |
| 722 | Ga0373936_0060619 | 3300035113 | Bacteria | 1544 |
| 723 | Ga0373939_0144472 | 3300035114 | Bacteria | 860 |
| 724 | Ga0373941_0039851 | 3300035115 | Bacteria | 1446 |
| 725 | Ga0373945_0152612 | 3300035116 | Bacteria | 937 |
| 726 | Ga0373953_0037940 | 3300035117 | Bacteria | 1904 |
| 727 | Ga0373954_0002636 | 3300035118 | Bacteria | 7548 |
| 728 | Ga0373954_0003489 | 3300035118 | Bacteria | 6675 |
| 729 | Ga0373954_0048171 | 3300035118 | Bacteria | 1996 |
| 730 | Ga0373954_0056289 | 3300035118 | Bacteria | 1850 |
| 731 | Ga0373956_0000615 | 3300035119 | Bacteria | 14591 |
| 732 | Ga0373956_0199774 | 3300035119 | Bacteria | 947 |
| 733 | Ga0373956_0284901 | 3300035119 | Bacteria | 786 |
| 734 | Ga0373956_0454136 | 3300035119 | Bacteria | 611 |
| 735 | Ga0373957_0001592 | 3300035120 | Bacteria | 6205 |
| 736 | Ga0373957_0007229 | 3300035120 | Bacteria | 3545 |
| 737 | Ga0373943_0220334 | 3300035170 | Bacteria | 1056 |
| 738 | Ga0373943_0336008 | 3300035170 | Unclassified | 863 |
| 739 | Ga0373943_0444095 | 3300035170 | Bacteria | 753 |
| 740 | Ga0373946_0009606 | 3300035171 | Bacteria | 3567 |
| 741 | Ga0373946_0282720 | 3300035171 | Bacteria | 817 |
| 742 | Ga0373946_0419147 | 3300035171 | Bacteria | 678 |
| 743 | Ga0373946_0434634 | 3300035171 | Bacteria | 666 |
| 744 | Ga0373955_0055591 | 3300035172 | Bacteria | 2168 |
| 745 | Ga0373955_0250107 | 3300035172 | Bacteria | 1062 |
| 746 | Ga0373942_0105566 | 3300035207 | Bacteria | 865 |
| 747 | Ga0373942_0296105 | 3300035207 | Bacteria | 561 |
| 748 | Ga0373961_0069131 | 3300035241 | Bacteria | 1089 |
| 749 | Ga0373961_0102214 | 3300035241 | Bacteria | 929 |
| 750 | Ga0316574_0000854 | 3300035398 | Bacteria | 13382 |
| 751 | Ga0373924_0032663 | 3300035410 | Bacteria | 2097 |
| 752 | Ga0373924_0195895 | 3300035410 | Bacteria | 890 |
| 753 | Ga0373931_0105884 | 3300035691 | Bacteria | 1589 |
| 754 | Ga0373931_0463267 | 3300035691 | Bacteria | 812 |
| 755 | Ga0373935_0196674 | 3300035692 | Bacteria | 1391 |
| 756 | Ga0373935_0231964 | 3300035692 | Bacteria | 1286 |
| 757 | Ga0373935_0269439 | 3300035692 | Bacteria | 1196 |
| 758 | Ga0373935_0571033 | 3300035692 | Bacteria | 826 |
| 759 | Ga0373927_0032781 | 3300035695 | Bacteria | 3383 |
| 760 | Ga0373927_0035616 | 3300035695 | Bacteria | 3236 |
| 761 | Ga0373927_0217954 | 3300035695 | Bacteria | 1254 |
| 762 | Ga0373927_0343639 | 3300035695 | Bacteria | 983 |
| 763 | Ga0373933_0024477 | 3300035724 | Bacteria | 3456 |
| 764 | Ga0373933_0071872 | 3300035724 | Bacteria | 2107 |
| 765 | Ga0373933_0190804 | 3300035724 | Bacteria | 1309 |
| 766 | Ga0373933_0417170 | 3300035724 | Bacteria | 877 |
| 767 | Ga0373947_0186236 | 3300035725 | Bacteria | 1353 |
| 768 | Ga0373937_0001406 | 3300036401 | Bacteria | 20084 |
| 769 | Ga0373937_0017208 | 3300036401 | Bacteria | 6435 |
| 770 | Ga0373937_0167403 | 3300036401 | Bacteria | 2061 |
| 771 | Ga0373937_0450001 | 3300036401 | Bacteria | 1223 |
| 772 | Ga0373925_0124010 | 3300037068 | Bacteria | 2008 |
| 773 | Ga0373925_0152252 | 3300037068 | Bacteria | 1817 |
| 774 | Ga0373925_0201818 | 3300037068 | Bacteria | 1581 |
| 775 | Ga0373925_0361527 | 3300037068 | Bacteria | 1180 |
| 776 | Ga0395900_0088037 | 3300037418 | Bacteria | 3192 |
| 777 | Ga0395900_0147511 | 3300037418 | Bacteria | 2405 |
| 778 | Ga0395905_1021611 | 3300037471 | Bacteria | 730 |
| 779 | Ga0395901_0180064 | 3300038443 | Bacteria | 2217 |
| 780 | Ga0395901_0449952 | 3300038443 | Bacteria | 1317 |
| 781 | Ga0242420_013094 | 3300038996 | Bacteria | 1410 |
| 782 | Ga0436365_1097290 | 3300039437 | Bacteria | 961 |
| 783 | Ga0436360_1169165 | 3300039438 | Bacteria | 624 |
| 784 | Ga0439436_0128967 | 3300041404 | Bacteria | 709 |
| 785 | Ga0451843_0690997 | 3300041509 | Bacteria | 848 |
| 786 | Ga0439448_0120657 | 3300042005 | Bacteria | 900 |
| 787 | Ga0439432_076975 | 3300042006 | Bacteria | 1013 |
| 788 | Ga0439434_0067858 | 3300042435 | Bacteria | 1120 |
| 789 | Ga0451577_0317631 | 3300042876 | Bacteria | 1412 |
| 790 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 791 | Ga0453683_0125552 | 3300044673 | Bacteria | 1616 |
| 792 | Ga0453683_0497285 | 3300044673 | Bacteria | 791 |
| 793 | Ga0466964_0108427 | 3300044706 | Bacteria | 1235 |
| 794 | Ga0453684_0426012 | 3300044712 | Bacteria | 1481 |
| 795 | Ga0453684_0637922 | 3300044712 | Bacteria | 1164 |
| 796 | Ga0453684_0792130 | 3300044712 | Bacteria | 1023 |
| 797 | Ga0451576_0342806 | 3300045051 | Bacteria | 1564 |
| 798 | Ga0466967_1056839 | 3300045976 | Bacteria | 809 |
| 799 | Ga0495592_0005285 | 3300046454 | Bacteria | 9518 |
| 800 | Ga0495592_0029233 | 3300046454 | Bacteria | 4173 |
| 801 | Ga0495592_0110125 | 3300046454 | Bacteria | 1949 |
| 802 | Ga0495592_0120496 | 3300046454 | Bacteria | 1846 |
| 803 | Ga0495592_0357605 | 3300046454 | Bacteria | 934 |
| 804 | Ga0495603_0232197 | 3300046455 | Bacteria | 1063 |
| 805 | Ga0495629_0096580 | 3300046459 | Bacteria | 2061 |
| 806 | Ga0495641_0015988 | 3300046461 | Bacteria | 3972 |
| 807 | Ga0495651_0002995 | 3300046462 | Bacteria | 13035 |
| 808 | Ga0495651_0010022 | 3300046462 | Bacteria | 7283 |
| 809 | Ga0495651_0070933 | 3300046462 | Bacteria | 2649 |
| 810 | Ga0495651_0092033 | 3300046462 | Bacteria | 2272 |
| 811 | Ga0495653_0006836 | 3300046463 | Bacteria | 9370 |
| 812 | Ga0495653_0259517 | 3300046463 | Bacteria | 1149 |
| 813 | Ga0495653_0427796 | 3300046463 | Bacteria | 837 |
| 814 | Ga0495580_0075522 | 3300046472 | Bacteria | 2351 |
| 815 | Ga0495580_0086177 | 3300046472 | Bacteria | 2187 |
| 816 | Ga0495580_0270829 | 3300046472 | Bacteria | 1160 |
| 817 | Ga0495580_0617171 | 3300046472 | Bacteria | 715 |
| 818 | Ga0495582_0060468 | 3300046473 | Bacteria | 2090 |
| 819 | Ga0495639_0005155 | 3300046475 | Bacteria | 5614 |
| 820 | Ga0495639_0069678 | 3300046475 | Bacteria | 1622 |
| 821 | Ga0495662_0008790 | 3300046476 | Bacteria | 4967 |
| 822 | Ga0495664_0146787 | 3300046477 | Bacteria | 1430 |
| 823 | Ga0495664_0147593 | 3300046477 | Bacteria | 1426 |
| 824 | Ga0495664_0336942 | 3300046477 | Bacteria | 909 |
| 825 | Ga0495594_0060051 | 3300046499 | Bacteria | 2103 |
| 826 | Ga0495607_0049730 | 3300046501 | Bacteria | 2443 |
| 827 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 828 | Ga0495608_0042788 | 3300046511 | Bacteria | 3028 |
| 829 | Ga0495608_0080156 | 3300046511 | Bacteria | 2122 |
| 830 | Ga0495608_0111859 | 3300046511 | Bacteria | 1756 |
| 831 | Ga0495608_0288797 | 3300046511 | Bacteria | 1017 |
| 832 | Ga0495618_0215600 | 3300046514 | Bacteria | 1212 |
| 833 | Ga0495618_0508427 | 3300046514 | Bacteria | 725 |
| 834 | Ga0495628_0002021 | 3300046516 | Bacteria | 18381 |
| 835 | Ga0495628_0004647 | 3300046516 | Bacteria | 12116 |
| 836 | Ga0495628_0020880 | 3300046516 | Bacteria | 5394 |
| 837 | Ga0495628_0117806 | 3300046516 | Bacteria | 2039 |
| 838 | Ga0495628_0120479 | 3300046516 | Bacteria | 2013 |
| 839 | Ga0495628_0432395 | 3300046516 | Bacteria | 958 |
| 840 | Ga0495628_0594943 | 3300046516 | Bacteria | 790 |
| 841 | Ga0495630_0018882 | 3300046517 | Bacteria | 5068 |
| 842 | Ga0495630_0039136 | 3300046517 | Bacteria | 3546 |
| 843 | Ga0495630_0139652 | 3300046517 | Bacteria | 1842 |
| 844 | Ga0495666_0007731 | 3300046526 | Bacteria | 5379 |
| 845 | Ga0495666_0223315 | 3300046526 | Bacteria | 862 |
| 846 | Ga0495652_0021112 | 3300046529 | Bacteria | 5788 |
| 847 | Ga0495652_0035269 | 3300046529 | Bacteria | 4355 |
| 848 | Ga0495652_0065263 | 3300046529 | Bacteria | 3059 |
| 849 | Ga0495652_0069034 | 3300046529 | Bacteria | 2959 |
| 850 | Ga0495652_0139381 | 3300046529 | Bacteria | 1909 |
| 851 | Ga0495652_0260501 | 3300046529 | Bacteria | 1280 |
| 852 | Ga0495652_0325645 | 3300046529 | Bacteria | 1108 |
| 853 | Ga0495652_0346393 | 3300046529 | Bacteria | 1066 |
| 854 | Ga0495665_0022228 | 3300046531 | Bacteria | 3409 |
| 855 | Ga0495665_0143694 | 3300046531 | Bacteria | 1246 |
| 856 | Ga0495640_0025633 | 3300046533 | Bacteria | 4273 |
| 857 | Ga0495640_0068176 | 3300046533 | Bacteria | 2394 |
| 858 | Ga0495586_0027285 | 3300046535 | Bacteria | 3056 |
| 859 | Ga0495586_0583704 | 3300046535 | Bacteria | 645 |
| 860 | Ga0495586_0647300 | 3300046535 | Bacteria | 610 |
| 861 | Ga0495586_0754492 | 3300046535 | Bacteria | 561 |
| 862 | Ga0495587_0050070 | 3300046536 | Bacteria | 2471 |
| 863 | Ga0495587_0338538 | 3300046536 | Bacteria | 839 |
| 864 | Ga0495598_0211432 | 3300046537 | Bacteria | 705 |
| 865 | Ga0495621_0059231 | 3300046539 | Bacteria | 1387 |
| 866 | Ga0495621_0115474 | 3300046539 | Bacteria | 1033 |
| 867 | Ga0495621_0133107 | 3300046539 | Bacteria | 969 |
| 868 | Ga0495621_0174986 | 3300046539 | Bacteria | 854 |
| 869 | Ga0495645_0005439 | 3300046543 | Bacteria | 8741 |
| 870 | Ga0495645_0017006 | 3300046543 | Bacteria | 5206 |
| 871 | Ga0495645_0057856 | 3300046543 | Bacteria | 2813 |
| 872 | Ga0495645_0217465 | 3300046543 | Bacteria | 1287 |
| 873 | Ga0495622_0074613 | 3300046557 | Bacteria | 1564 |
| 874 | Ga0495667_0113960 | 3300046559 | Bacteria | 1747 |
| 875 | Ga0495667_0341704 | 3300046559 | Bacteria | 946 |
| 876 | Ga0495667_0422824 | 3300046559 | Bacteria | 838 |
| 877 | Ga0495634_0068620 | 3300046642 | Bacteria | 2341 |
| 878 | Ga0495634_0076539 | 3300046642 | Bacteria | 2196 |
| 879 | Ga0495634_0460080 | 3300046642 | Bacteria | 749 |
| 880 | Ga0495635_0086714 | 3300046663 | Bacteria | 2142 |
| 881 | Ga0495635_0105657 | 3300046663 | Bacteria | 1923 |
| 882 | Ga0495635_0453472 | 3300046663 | Bacteria | 848 |
| 883 | Ga0495659_0094401 | 3300046664 | Bacteria | 1152 |
| 884 | Ga0495588_0041459 | 3300046674 | Bacteria | 2351 |
| 885 | Ga0495657_0040563 | 3300046675 | Bacteria | 3192 |
| 886 | Ga0495657_0068721 | 3300046675 | Bacteria | 2320 |
| 887 | Ga0495657_0085760 | 3300046675 | Bacteria | 2029 |
| 888 | Ga0495657_0537611 | 3300046675 | Bacteria | 679 |
| 889 | Ga0495657_0558572 | 3300046675 | Bacteria | 664 |
| 890 | Ga0495599_0002888 | 3300046678 | Bacteria | 9995 |
| 891 | Ga0495599_0026654 | 3300046678 | Bacteria | 3623 |
| 892 | Ga0495599_0149340 | 3300046678 | Bacteria | 1448 |
| 893 | Ga0495623_0047566 | 3300046679 | Bacteria | 2723 |
| 894 | Ga0495623_0631191 | 3300046679 | Bacteria | 554 |
| 895 | Ga0495646_0014979 | 3300046680 | Bacteria | 4926 |
| 896 | Ga0495647_0002471 | 3300046681 | Bacteria | 5840 |
| 897 | Ga0495647_0008547 | 3300046681 | Bacteria | 3444 |
| 898 | Ga0495658_0044428 | 3300046683 | Bacteria | 2489 |
| 899 | Ga0495658_0122548 | 3300046683 | Bacteria | 1574 |
| 900 | Ga0495658_0814862 | 3300046683 | Bacteria | 597 |
| 901 | Ga0495669_0205120 | 3300046684 | Bacteria | 943 |
| 902 | Ga0495613_0018189 | 3300046689 | Bacteria | 5239 |
| 903 | Ga0495624_0104714 | 3300046690 | Bacteria | 1741 |
| 904 | Ga0495600_0000916 | 3300046809 | Bacteria | 15803 |
| 905 | Ga0495581_0009710 | 3300047315 | Bacteria | 5570 |
| 906 | Ga0495604_0042840 | 3300047317 | Bacteria | 3545 |
| 907 | Ga0495604_0085018 | 3300047317 | Bacteria | 2361 |
| 908 | Ga0495604_0398243 | 3300047317 | Bacteria | 907 |
| 909 | Ga0495636_0003634 | 3300047318 | Bacteria | 5988 |
| 910 | Ga0495674_0202516 | 3300047319 | Bacteria | 1646 |
| 911 | Ga0495680_0070233 | 3300047322 | Bacteria | 2671 |
| 912 | Ga0495680_0631761 | 3300047322 | Bacteria | 713 |
| 913 | Ga0495680_0631773 | 3300047322 | Bacteria | 713 |
| 914 | Ga0495675_0012907 | 3300047444 | Bacteria | 5264 |
| 915 | Ga0495675_0147540 | 3300047444 | Bacteria | 1455 |
| 916 | Ga0495675_0467693 | 3300047444 | Bacteria | 727 |
| 917 | Ga0495684_0041075 | 3300047471 | Bacteria | 3545 |
| 918 | Ga0495686_0000248 | 3300047472 | Bacteria | 97017 |
| 919 | Ga0495686_0044312 | 3300047472 | Bacteria | 2816 |
| 920 | Ga0495593_0052595 | 3300047673 | Bacteria | 2152 |
| 921 | Ga0495602_0078562 | 3300048088 | Bacteria | 2787 |
| 922 | Ga0495602_0539921 | 3300048088 | Bacteria | 809 |
| 923 | Ga0495602_0788261 | 3300048088 | Bacteria | 639 |
| 924 | Ga0495614_0047249 | 3300048089 | Bacteria | 1846 |
| 925 | Ga0496100_0203137 | 3300048903 | Bacteria | 1445 |
| 926 | Ga0496101_0089547 | 3300048904 | Bacteria | 2287 |
| 927 | Ga0496101_0419498 | 3300048904 | Bacteria | 1055 |
| 928 | Ga0496102_0958535 | 3300048905 | Bacteria | 776 |
| 929 | Ga0496102_1080148 | 3300048905 | Bacteria | 722 |
| 930 | Ga0496102_1575481 | 3300048905 | Bacteria | 575 |
| 931 | Ga0496103_0469964 | 3300048906 | Bacteria | 806 |
| 932 | Ga0496104_0009650 | 3300048907 | Bacteria | 8596 |
| 933 | Ga0496104_0210310 | 3300048907 | Bacteria | 1857 |
| 934 | Ga0496105_0102103 | 3300048908 | Bacteria | 2368 |
| 935 | Ga0496106_0272991 | 3300048909 | Bacteria | 1354 |
| 936 | Ga0496106_0898634 | 3300048909 | Bacteria | 699 |
| 937 | Ga0496107_0155182 | 3300048910 | Bacteria | 1695 |
| 938 | Ga0496107_0349298 | 3300048910 | Bacteria | 1101 |
| 939 | Ga0496107_0501178 | 3300048910 | Bacteria | 901 |
| 940 | Ga0496107_1001937 | 3300048910 | Bacteria | 606 |
| 941 | Ga0496108_0013970 | 3300048911 | Bacteria | 6550 |
| 942 | Ga0496108_0187926 | 3300048911 | Bacteria | 1790 |
| 943 | Ga0496108_0520627 | 3300048911 | Bacteria | 1038 |
| 944 | Ga0496109_0011013 | 3300048912 | Bacteria | 7751 |
| 945 | Ga0496109_0085357 | 3300048912 | Bacteria | 2914 |
| 946 | Ga0496110_0595808 | 3300048913 | Bacteria | 1003 |
| 947 | Ga0496110_0837121 | 3300048913 | Bacteria | 825 |
| 948 | Ga0496110_1292361 | 3300048913 | Bacteria | 639 |
| 949 | Ga0496110_1470886 | 3300048913 | Unclassified | 591 |
| 950 | Ga0496111_0091997 | 3300048914 | Bacteria | 2223 |
| 951 | Ga0496111_0484431 | 3300048914 | Bacteria | 911 |
| 952 | Ga0496112_0005841 | 3300048915 | Bacteria | 10715 |
| 953 | Ga0496112_0014201 | 3300048915 | Bacteria | 7381 |
| 954 | Ga0496112_0234806 | 3300048915 | Bacteria | 1788 |
| 955 | Ga0496112_0394210 | 3300048915 | Bacteria | 1325 |
| 956 | Ga0496113_0298344 | 3300048916 | Bacteria | 1290 |
| 957 | Ga0496113_0401697 | 3300048916 | Bacteria | 1100 |
| 958 | Ga0496114_0012661 | 3300048917 | Bacteria | 6756 |
| 959 | Ga0496114_0022120 | 3300048917 | Bacteria | 5179 |
| 960 | Ga0496114_0022604 | 3300048917 | Bacteria | 5126 |
| 961 | Ga0496114_0659150 | 3300048917 | Bacteria | 920 |
| 962 | Ga0496114_1431973 | 3300048917 | Unclassified | 578 |
| 963 | Ga0496115_0179858 | 3300048918 | Bacteria | 1749 |
| 964 | Ga0496115_0248852 | 3300048918 | Bacteria | 1464 |
| 965 | Ga0496115_0602332 | 3300048918 | Bacteria | 873 |
| 966 | Ga0496124_0485288 | 3300048927 | Bacteria | 833 |
| 967 | Ga0501298_033786 | 3300049521 | Bacteria | 1015 |
| 968 | Ga0501031_0045354 | 3300049568 | Bacteria | 2868 |
| 969 | Ga0501031_0070945 | 3300049568 | Bacteria | 2269 |
| 970 | Ga0501032_0001741 | 3300049569 | Bacteria | 17208 |
| 971 | Ga0501032_0023567 | 3300049569 | Bacteria | 4249 |
| 972 | Ga0501032_0131161 | 3300049569 | Bacteria | 1653 |
| 973 | Ga0501032_0729344 | 3300049569 | Unclassified | 627 |
| 974 | Ga0501033_0000364 | 3300049570 | Bacteria | 43293 |
| 975 | Ga0501033_0005262 | 3300049570 | Bacteria | 10267 |
| 976 | Ga0501033_0010897 | 3300049570 | Bacteria | 6970 |
| 977 | Ga0501033_0211631 | 3300049570 | Bacteria | 1382 |
| 978 | Ga0501033_0775504 | 3300049570 | Bacteria | 649 |
| 979 | Ga0501034_0005376 | 3300049571 | Bacteria | 14011 |
| 980 | Ga0501034_0012071 | 3300049571 | Bacteria | 8931 |
| 981 | Ga0501034_0138359 | 3300049571 | Bacteria | 2415 |
| 982 | Ga0501036_0004793 | 3300049572 | Bacteria | 10935 |
| 983 | Ga0501036_0006729 | 3300049572 | Bacteria | 9343 |
| 984 | Ga0501036_0044802 | 3300049572 | Bacteria | 3748 |
| 985 | Ga0501036_0117508 | 3300049572 | Bacteria | 2246 |
| 986 | Ga0501036_0139132 | 3300049572 | Bacteria | 2049 |
| 987 | Ga0501036_1081035 | 3300049572 | Bacteria | 655 |
| 988 | Ga0501037_0000162 | 3300049573 | Bacteria | 62629 |
| 989 | Ga0501037_0037962 | 3300049573 | Bacteria | 3551 |
| 990 | Ga0501037_0124832 | 3300049573 | Bacteria | 1849 |
| 991 | Ga0501037_0323169 | 3300049573 | Bacteria | 1068 |
| 992 | Ga0501038_0003864 | 3300049574 | Bacteria | 13921 |
| 993 | Ga0501038_0008423 | 3300049574 | Bacteria | 9485 |
| 994 | Ga0501038_0071876 | 3300049574 | Bacteria | 2933 |
| 995 | Ga0501038_0103831 | 3300049574 | Bacteria | 2363 |
| 996 | Ga0501038_0124809 | 3300049574 | Bacteria | 2120 |
| 997 | Ga0501038_0190761 | 3300049574 | Bacteria | 1649 |
| 998 | Ga0501038_0232637 | 3300049574 | Bacteria | 1466 |
| 999 | Ga0501038_0743440 | 3300049574 | Bacteria | 732 |
| 1000 | Ga0501039_0003351 | 3300049575 | Bacteria | 11972 |
| 1001 | Ga0501039_0008184 | 3300049575 | Bacteria | 7972 |
| 1002 | Ga0501039_0035202 | 3300049575 | Bacteria | 3863 |
| 1003 | Ga0501039_0046891 | 3300049575 | Bacteria | 3339 |
| 1004 | Ga0501039_0199951 | 3300049575 | Bacteria | 1571 |
| 1005 | Ga0501039_0215832 | 3300049575 | Bacteria | 1508 |
| 1006 | Ga0501039_0595776 | 3300049575 | Bacteria | 866 |
| 1007 | Ga0501040_0003740 | 3300049576 | Bacteria | 9860 |
| 1008 | Ga0501040_0009844 | 3300049576 | Bacteria | 6242 |
| 1009 | Ga0501040_0092397 | 3300049576 | Bacteria | 2104 |
| 1010 | Ga0501040_0097200 | 3300049576 | Bacteria | 2051 |
| 1011 | Ga0501041_0222845 | 3300049577 | Bacteria | 1183 |
| 1012 | Ga0501041_0394962 | 3300049577 | Bacteria | 876 |
| 1013 | Ga0501042_0000536 | 3300049578 | Bacteria | 19889 |
| 1014 | Ga0501042_0018299 | 3300049578 | Bacteria | 4849 |
| 1015 | Ga0501042_0196429 | 3300049578 | Bacteria | 1455 |
| 1016 | Ga0501042_0342215 | 3300049578 | Bacteria | 1081 |
| 1017 | Ga0501043_0022331 | 3300049579 | Bacteria | 4964 |
| 1018 | Ga0501043_0060318 | 3300049579 | Bacteria | 2977 |
| 1019 | Ga0501043_0224156 | 3300049579 | Bacteria | 1453 |
| 1020 | Ga0501043_0245920 | 3300049579 | Bacteria | 1379 |
| 1021 | Ga0501043_0304519 | 3300049579 | Bacteria | 1217 |
| 1022 | Ga0501043_0362633 | 3300049579 | Bacteria | 1100 |
| 1023 | Ga0501043_0419990 | 3300049579 | Bacteria | 1008 |
| 1024 | Ga0501046_0026489 | 3300049580 | Bacteria | 4736 |
| 1025 | Ga0501046_0068985 | 3300049580 | Bacteria | 2751 |
| 1026 | Ga0501046_0101642 | 3300049580 | Bacteria | 2205 |
| 1027 | Ga0501048_0008305 | 3300049582 | Bacteria | 7851 |
| 1028 | Ga0501048_0056461 | 3300049582 | Bacteria | 2785 |
| 1029 | Ga0501048_0119705 | 3300049582 | Bacteria | 1860 |
| 1030 | Ga0501067_0213849 | 3300049583 | Bacteria | 1074 |
| 1031 | Ga0501067_0597602 | 3300049583 | Bacteria | 619 |
| 1032 | Ga0501068_0018157 | 3300049584 | Bacteria | 4072 |
| 1033 | Ga0501068_0158079 | 3300049584 | Bacteria | 1428 |
| 1034 | Ga0501068_0275918 | 3300049584 | Bacteria | 1074 |
| 1035 | Ga0501068_0530611 | 3300049584 | Bacteria | 764 |
| 1036 | Ga0501069_0719078 | 3300049585 | Bacteria | 603 |
| 1037 | Ga0501071_0013396 | 3300049587 | Bacteria | 5587 |
| 1038 | Ga0501071_0050832 | 3300049587 | Bacteria | 2986 |
| 1039 | Ga0501071_0435034 | 3300049587 | Bacteria | 1003 |
| 1040 | Ga0501072_0001399 | 3300049588 | Bacteria | 18156 |
| 1041 | Ga0501072_0091526 | 3300049588 | Bacteria | 2415 |
| 1042 | Ga0501072_0179258 | 3300049588 | Bacteria | 1690 |
| 1043 | Ga0501072_0192537 | 3300049588 | Bacteria | 1626 |
| 1044 | Ga0501072_0480728 | 3300049588 | Bacteria | 983 |
| 1045 | Ga0501072_0750219 | 3300049588 | Bacteria | 766 |
| 1046 | Ga0501073_0359056 | 3300049589 | Bacteria | 1006 |
| 1047 | Ga0501074_0214122 | 3300049590 | Bacteria | 1372 |
| 1048 | Ga0501074_0732549 | 3300049590 | Bacteria | 697 |
| 1049 | Ga0501075_0010270 | 3300049591 | Bacteria | 6578 |
| 1050 | Ga0501075_0023115 | 3300049591 | Bacteria | 4549 |
| 1051 | Ga0501075_0239449 | 3300049591 | Bacteria | 1383 |
| 1052 | Ga0501076_0012795 | 3300049592 | Bacteria | 6282 |
| 1053 | Ga0501076_0014474 | 3300049592 | Bacteria | 5943 |
| 1054 | Ga0501076_0019562 | 3300049592 | Bacteria | 5177 |
| 1055 | Ga0501076_0342384 | 3300049592 | Bacteria | 1227 |
| 1056 | Ga0501077_0011579 | 3300049593 | Bacteria | 5511 |
| 1057 | Ga0501077_0108178 | 3300049593 | Bacteria | 1761 |
| 1058 | Ga0501077_0163235 | 3300049593 | Bacteria | 1414 |
| 1059 | Ga0501235_195656 | 3300049669 | Bacteria | 545 |
| 1060 | Ga0501250_071032 | 3300049680 | Bacteria | 575 |
| 1061 | Ga0501079_0004210 | 3300049741 | Bacteria | 10672 |
| 1062 | Ga0501079_0077016 | 3300049741 | Bacteria | 2580 |
| 1063 | Ga0501079_0390417 | 3300049741 | Bacteria | 1091 |
| 1064 | Ga0501079_1381767 | 3300049741 | Bacteria | 554 |
| 1065 | Ga0501080_0006958 | 3300049742 | Bacteria | 10203 |
| 1066 | Ga0501080_0219411 | 3300049742 | Bacteria | 1741 |
| 1067 | Ga0501080_0299631 | 3300049742 | Bacteria | 1458 |
| 1068 | Ga0501081_0000465 | 3300049743 | Bacteria | 22458 |
| 1069 | Ga0501081_0012671 | 3300049743 | Bacteria | 5544 |
| 1070 | Ga0501081_0272525 | 3300049743 | Bacteria | 1238 |
| 1071 | Ga0501081_0396329 | 3300049743 | Bacteria | 1022 |
| 1072 | Ga0501083_0686660 | 3300049744 | Bacteria | 666 |
| 1073 | Ga0501035_0005055 | 3300049822 | Bacteria | 12496 |
| 1074 | Ga0501035_0010038 | 3300049822 | Bacteria | 8787 |
| 1075 | Ga0501035_0025464 | 3300049822 | Bacteria | 5424 |
| 1076 | Ga0501035_0060352 | 3300049822 | Bacteria | 3376 |
| 1077 | Ga0501035_0084580 | 3300049822 | Bacteria | 2797 |
| 1078 | Ga0501035_0093559 | 3300049822 | Bacteria | 2644 |
| 1079 | Ga0501035_0137626 | 3300049822 | Bacteria | 2125 |
| 1080 | Ga0501035_0147964 | 3300049822 | Bacteria | 2039 |
| 1081 | Ga0501035_0161001 | 3300049822 | Bacteria | 1942 |
| 1082 | Ga0501035_0274206 | 3300049822 | Bacteria | 1427 |
| 1083 | Ga0501044_0000076 | 3300049823 | Bacteria | 120755 |
| 1084 | Ga0501044_0001481 | 3300049823 | Bacteria | 27531 |
| 1085 | Ga0501044_0003222 | 3300049823 | Bacteria | 18385 |
| 1086 | Ga0501044_0012028 | 3300049823 | Bacteria | 9376 |
| 1087 | Ga0501044_0043973 | 3300049823 | Bacteria | 4638 |
| 1088 | Ga0501044_0269938 | 3300049823 | Bacteria | 1637 |
| 1089 | Ga0501044_1011639 | 3300049823 | Bacteria | 703 |
| 1090 | Ga0501045_0003218 | 3300049824 | Bacteria | 11170 |
| 1091 | Ga0501045_0041989 | 3300049824 | Bacteria | 3328 |
| 1092 | Ga0501045_0066885 | 3300049824 | Bacteria | 2638 |
| 1093 | Ga0501045_0094485 | 3300049824 | Bacteria | 2211 |
| 1094 | Ga0501045_0259793 | 3300049824 | Bacteria | 1292 |
| 1095 | nmdc:mga05p37_529398_c1 | 3300050507 | Bacteria | 1346 |
| 1096 | nmdc:mga05p37_732932_c1 | 3300050507 | Bacteria | 1092 |
| 1097 | nmdc:mga09592_276772_c1 | 3300050508 | Bacteria | 1456 |
| 1098 | nmdc:mga09592_538283_c1 | 3300050508 | Bacteria | 1004 |
| 1099 | nmdc:mga0qj67_123797_c1 | 3300050509 | Bacteria | 2092 |
| 1100 | nmdc:mga0qj67_549125_c1 | 3300050509 | Bacteria | 927 |
| 1101 | nmdc:mga0qj67_6850_c1 | 3300050509 | Bacteria | 8379 |
| 1102 | nmdc:mga0qj67_983108_c1 | 3300050509 | Bacteria | 663 |
| 1103 | nmdc:mga06r32_1014_c1 | 3300050510 | Bacteria | 25210 |
| 1104 | nmdc:mga06r32_308880_c1 | 3300050510 | Bacteria | 1567 |
| 1105 | nmdc:mga08y16_176151_c1 | 3300050511 | Bacteria | 2221 |
| 1106 | nmdc:mga08y16_19726_c1 | 3300050511 | Bacteria | 7109 |
| 1107 | nmdc:mga08y16_3419_c1 | 3300050511 | Bacteria | 16470 |
| 1108 | nmdc:mga0n895_163087_c1 | 3300050512 | Bacteria | 2260 |
| 1109 | nmdc:mga0n895_367_c1 | 3300050512 | Bacteria | 30485 |
| 1110 | nmdc:mga0n895_438924_c1 | 3300050512 | Bacteria | 1319 |
| 1111 | nmdc:mga0rr50_148782_c1 | 3300050513 | Bacteria | 1890 |
| 1112 | nmdc:mga0rr50_152767_c1 | 3300050513 | Bacteria | 1867 |
| 1113 | nmdc:mga0rr50_158280_c1 | 3300050513 | Bacteria | 1836 |
| 1114 | nmdc:mga0rr50_224730_c1 | 3300050513 | Bacteria | 1551 |
| 1115 | nmdc:mga0rr50_244584_c1 | 3300050513 | Bacteria | 1488 |
| 1116 | nmdc:mga0rr50_97397_c2 | 3300050513 | Bacteria | 1268 |
| 1117 | nmdc:mga08x19_1118_c1 | 3300050514 | Bacteria | 16743 |
| 1118 | nmdc:mga08x19_148673_c1 | 3300050514 | Bacteria | 1585 |
| 1119 | nmdc:mga08x19_221693_c1 | 3300050514 | Bacteria | 1299 |
| 1120 | nmdc:mga08x19_58041_c1 | 3300050514 | Bacteria | 2503 |
| 1121 | nmdc:mga08x19_5900_c1 | 3300050514 | Bacteria | 7244 |
| 1122 | nmdc:mga0a205_132541_c2 | 3300050515 | Bacteria | 777 |
| 1123 | nmdc:mga0a205_363219_c1 | 3300050515 | Bacteria | 1314 |
| 1124 | Ga0495601_0030722 | 3300053077 | Bacteria | 3337 |
| 1125 | Ga0495601_0045721 | 3300053077 | Bacteria | 2754 |
| 1126 | Ga0495601_0167414 | 3300053077 | Bacteria | 1436 |
| 1127 | Ga0495601_0292879 | 3300053077 | Bacteria | 1061 |
| 1128 | Ga0495612_0063075 | 3300053078 | Bacteria | 1537 |
| 1129 | Ga0495612_0073781 | 3300053078 | Bacteria | 1426 |
| 1130 | Ga0495595_0355333 | 3300053084 | Bacteria | 740 |
| 1131 | Ga0495595_0370250 | 3300053084 | Bacteria | 724 |
| 1132 | Ga0495595_0547639 | 3300053084 | Bacteria | 591 |
| 1133 | Ga0495619_0008666 | 3300053085 | Bacteria | 6435 |
| 1134 | Ga0495619_0087963 | 3300053085 | Bacteria | 2101 |
| 1135 | Ga0495619_0267178 | 3300053085 | Bacteria | 1185 |
| 1136 | Ga0500595_012640 | 3300053119 | Bacteria | 3257 |
| 1137 | Ga0500574_009516 | 3300053141 | Bacteria | 2114 |
| 1138 | Ga0501084_0021829 | 3300054114 | Bacteria | 5340 |
| 1139 | Ga0501084_0410960 | 3300054114 | Bacteria | 1144 |
| 1140 | Ga0501084_0599129 | 3300054114 | Bacteria | 931 |
| 1141 | Ga0501082_0004016 | 3300060353 | Bacteria | 12841 |
| 1142 | Ga0501082_0033898 | 3300060353 | Bacteria | 4404 |
| 1143 | Ga0501082_0040072 | 3300060353 | Bacteria | 4041 |
| 1144 | Ga0530510_0000170 | 3300061734 | Bacteria | 39521 |
| 1145 | Ga0530510_0004733 | 3300061734 | Bacteria | 9418 |
| 1146 | Ga0530510_1171410 | 3300061734 | Bacteria | 589 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221603 | 2644028971 | 155 |
| 2 | 3300013297 | Ga0157378_10393456 | Ga0157378_103934563 | 156 |
| 3 | 3300048909 | Ga0496106_0898634 | Ga0496106_0898634_218_688 | 156 |
| 4 | 3300005330 | Ga0070690_100315672 | Ga0070690_1003156721 | 157 |
| 5 | 3300005335 | Ga0070666_10647812 | Ga0070666_106478122 | 157 |
| 6 | 3300005345 | Ga0070692_10080451 | Ga0070692_100804512 | 157 |
| 7 | 3300005440 | Ga0070705_100013604 | Ga0070705_1000136048 | 157 |
| 8 | 3300005444 | Ga0070694_100025031 | Ga0070694_1000250312 | 157 |
| 9 | 3300005444 | Ga0070694_100329843 | Ga0070694_1003298431 | 157 |
| 10 | 3300005458 | Ga0070681_10014534 | Ga0070681_100145342 | 157 |
| 11 | 3300005518 | Ga0070699_100009169 | Ga0070699_1000091692 | 157 |
| 12 | 3300005546 | Ga0070696_100051826 | Ga0070696_1000518263 | 157 |
| 13 | 3300005549 | Ga0070704_100044797 | Ga0070704_1000447973 | 157 |
| 14 | 3300005549 | Ga0070704_100127247 | Ga0070704_1001272472 | 157 |
| 15 | 3300005549 | Ga0070704_100226850 | Ga0070704_1002268502 | 157 |
| 16 | 3300005614 | Ga0068856_100505285 | Ga0068856_1005052852 | 157 |
| 17 | 3300005616 | Ga0068852_101708142 | Ga0068852_1017081421 | 157 |
| 18 | 3300005617 | Ga0068859_100564936 | Ga0068859_1005649362 | 157 |
| 19 | 3300005985 | Ga0081539_10000805 | Ga0081539_1000080556 | 157 |
| 20 | 3300006846 | Ga0075430_100021691 | Ga0075430_1000216915 | 157 |
| 21 | 3300006846 | Ga0075430_100022384 | Ga0075430_1000223848 | 157 |
| 22 | 3300006852 | Ga0075433_10487354 | Ga0075433_104873542 | 157 |
| 23 | 3300006871 | Ga0075434_100000484 | Ga0075434_10000048427 | 157 |
| 24 | 3300006880 | Ga0075429_100167210 | Ga0075429_1001672102 | 157 |
| 25 | 3300006914 | Ga0075436_100000593 | Ga0075436_10000059311 | 157 |
| 26 | 3300006914 | Ga0075436_100030087 | Ga0075436_1000300875 | 157 |
| 27 | 3300006914 | Ga0075436_100046822 | Ga0075436_1000468224 | 157 |
| 28 | 3300006914 | Ga0075436_100148145 | Ga0075436_1001481453 | 157 |
| 29 | 3300006914 | Ga0075436_100292335 | Ga0075436_1002923352 | 157 |
| 30 | 3300006914 | Ga0075436_100340350 | Ga0075436_1003403502 | 157 |
| 31 | 3300006931 | Ga0097620_100564943 | Ga0097620_1005649432 | 157 |
| 32 | 3300007076 | Ga0075435_100177974 | Ga0075435_1001779742 | 157 |
| 33 | 3300007076 | Ga0075435_100213264 | Ga0075435_1002132642 | 157 |
| 34 | 3300007265 | Ga0099794_10038371 | Ga0099794_100383712 | 157 |
| 35 | 3300007265 | Ga0099794_10090944 | Ga0099794_100909442 | 157 |
| 36 | 3300007265 | Ga0099794_10189342 | Ga0099794_101893422 | 157 |
| 37 | 3300007788 | Ga0099795_10039408 | Ga0099795_100394081 | 157 |
| 38 | 3300009147 | Ga0114129_10993796 | Ga0114129_109937962 | 157 |
| 39 | 3300010159 | Ga0099796_10025359 | Ga0099796_100253592 | 157 |
| 40 | 3300013307 | Ga0157372_10617056 | Ga0157372_106170562 | 157 |
| 41 | 3300025898 | Ga0207692_10917195 | Ga0207692_109171951 | 157 |
| 42 | 3300025912 | Ga0207707_10017447 | Ga0207707_100174476 | 157 |
| 43 | 3300025917 | Ga0207660_10654290 | Ga0207660_106542901 | 157 |
| 44 | 3300025939 | Ga0207665_10048319 | Ga0207665_100483192 | 157 |
| 45 | 3300025944 | Ga0207661_11387302 | Ga0207661_113873022 | 157 |
| 46 | 3300026078 | Ga0207702_10796015 | Ga0207702_107960152 | 157 |
| 47 | 3300027543 | Ga0209999_1049327 | Ga0209999_10493271 | 157 |
| 48 | 3300027671 | Ga0209588_1003394 | Ga0209588_10033942 | 157 |
| 49 | 3300027671 | Ga0209588_1096392 | Ga0209588_10963922 | 157 |
| 50 | 3300032002 | Ga0307416_101158796 | Ga0307416_1011587962 | 157 |
| 51 | 3300033179 | Ga0307507_10082957 | Ga0307507_100829571 | 157 |
| 52 | 3300035086 | Ga0373934_0019815 | Ga0373934_0019815_223_696 | 157 |
| 53 | 3300035111 | Ga0373923_0270828 | Ga0373923_0270828_165_638 | 157 |
| 54 | 3300035117 | Ga0373953_0037940 | Ga0373953_0037940_990_1463 | 157 |
| 55 | 3300035118 | Ga0373954_0002636 | Ga0373954_0002636_361_834 | 157 |
| 56 | 3300035118 | Ga0373954_0048171 | Ga0373954_0048171_440_913 | 157 |
| 57 | 3300035118 | Ga0373954_0056289 | Ga0373954_0056289_1214_1687 | 157 |
| 58 | 3300035119 | Ga0373956_0000615 | Ga0373956_0000615_2591_3064 | 157 |
| 59 | 3300035119 | Ga0373956_0199774 | Ga0373956_0199774_227_700 | 157 |
| 60 | 3300035119 | Ga0373956_0454136 | Ga0373956_0454136_121_594 | 157 |
| 61 | 3300035120 | Ga0373957_0001592 | Ga0373957_0001592_5354_5827 | 157 |
| 62 | 3300035172 | Ga0373955_0250107 | Ga0373955_0250107_165_638 | 157 |
| 63 | 3300035410 | Ga0373924_0032663 | Ga0373924_0032663_1338_1811 | 157 |
| 64 | 3300035691 | Ga0373931_0463267 | Ga0373931_0463267_31_504 | 157 |
| 65 | 3300035692 | Ga0373935_0571033 | Ga0373935_0571033_164_637 | 157 |
| 66 | 3300035724 | Ga0373933_0024477 | Ga0373933_0024477_1454_1927 | 157 |
| 67 | 3300036401 | Ga0373937_0001406 | Ga0373937_0001406_1524_1997 | 157 |
| 68 | 3300036401 | Ga0373937_0450001 | Ga0373937_0450001_405_878 | 157 |
| 69 | 3300037068 | Ga0373925_0201818 | Ga0373925_0201818_615_1088 | 157 |
| 70 | 3300038996 | Ga0242420_013094 | Ga0242420_013094_452_925 | 157 |
| 71 | 3300041404 | Ga0439436_0128967 | Ga0439436_0128967_42_515 | 157 |
| 72 | 3300042876 | Ga0451577_0317631 | Ga0451577_0317631_387_860 | 157 |
| 73 | 3300044673 | Ga0453683_0125552 | Ga0453683_0125552_424_897 | 157 |
| 74 | 3300044712 | Ga0453684_0792130 | Ga0453684_0792130_177_650 | 157 |
| 75 | 3300045976 | Ga0466967_1056839 | Ga0466967_1056839_287_760 | 157 |
| 76 | 3300046454 | Ga0495592_0005285 | Ga0495592_0005285_8749_9222 | 157 |
| 77 | 3300046454 | Ga0495592_0110125 | Ga0495592_0110125_865_1338 | 157 |
| 78 | 3300046454 | Ga0495592_0120496 | Ga0495592_0120496_397_870 | 157 |
| 79 | 3300046454 | Ga0495592_0357605 | Ga0495592_0357605_354_827 | 157 |
| 80 | 3300046461 | Ga0495641_0015988 | Ga0495641_0015988_2539_3012 | 157 |
| 81 | 3300046462 | Ga0495651_0002995 | Ga0495651_0002995_7000_7473 | 157 |
| 82 | 3300046463 | Ga0495653_0259517 | Ga0495653_0259517_552_1025 | 157 |
| 83 | 3300046475 | Ga0495639_0069678 | Ga0495639_0069678_132_605 | 157 |
| 84 | 3300046477 | Ga0495664_0146787 | Ga0495664_0146787_779_1252 | 157 |
| 85 | 3300046511 | Ga0495608_0080156 | Ga0495608_0080156_1465_1938 | 157 |
| 86 | 3300046511 | Ga0495608_0288797 | Ga0495608_0288797_223_696 | 157 |
| 87 | 3300046514 | Ga0495618_0508427 | Ga0495618_0508427_44_517 | 157 |
| 88 | 3300046516 | Ga0495628_0004647 | Ga0495628_0004647_4165_4638 | 157 |
| 89 | 3300046516 | Ga0495628_0020880 | Ga0495628_0020880_4182_4655 | 157 |
| 90 | 3300046516 | Ga0495628_0117806 | Ga0495628_0117806_774_1247 | 157 |
| 91 | 3300046516 | Ga0495628_0594943 | Ga0495628_0594943_104_577 | 157 |
| 92 | 3300046517 | Ga0495630_0039136 | Ga0495630_0039136_644_1117 | 157 |
| 93 | 3300046517 | Ga0495630_0139652 | Ga0495630_0139652_526_999 | 157 |
| 94 | 3300046526 | Ga0495666_0007731 | Ga0495666_0007731_105_578 | 157 |
| 95 | 3300046529 | Ga0495652_0035269 | Ga0495652_0035269_1325_1798 | 157 |
| 96 | 3300046529 | Ga0495652_0139381 | Ga0495652_0139381_1302_1775 | 157 |
| 97 | 3300046529 | Ga0495652_0260501 | Ga0495652_0260501_528_1001 | 157 |
| 98 | 3300046529 | Ga0495652_0325645 | Ga0495652_0325645_84_557 | 157 |
| 99 | 3300046531 | Ga0495665_0143694 | Ga0495665_0143694_678_1151 | 157 |
| 100 | 3300046533 | Ga0495640_0068176 | Ga0495640_0068176_1503_1976 | 157 |
| 101 | 3300046535 | Ga0495586_0583704 | Ga0495586_0583704_53_526 | 157 |
| 102 | 3300046535 | Ga0495586_0647300 | Ga0495586_0647300_102_575 | 157 |
| 103 | 3300046535 | Ga0495586_0754492 | Ga0495586_0754492_14_487 | 157 |
| 104 | 3300046536 | Ga0495587_0050070 | Ga0495587_0050070_172_645 | 157 |
| 105 | 3300046536 | Ga0495587_0338538 | Ga0495587_0338538_113_586 | 157 |
| 106 | 3300046543 | Ga0495645_0005439 | Ga0495645_0005439_7366_7839 | 157 |
| 107 | 3300046559 | Ga0495667_0113960 | Ga0495667_0113960_297_770 | 157 |
| 108 | 3300046559 | Ga0495667_0422824 | Ga0495667_0422824_90_563 | 157 |
| 109 | 3300046642 | Ga0495634_0068620 | Ga0495634_0068620_120_593 | 157 |
| 110 | 3300046642 | Ga0495634_0460080 | Ga0495634_0460080_120_593 | 157 |
| 111 | 3300046663 | Ga0495635_0086714 | Ga0495635_0086714_1072_1545 | 157 |
| 112 | 3300046675 | Ga0495657_0040563 | Ga0495657_0040563_1052_1525 | 157 |
| 113 | 3300046675 | Ga0495657_0085760 | Ga0495657_0085760_65_538 | 157 |
| 114 | 3300046675 | Ga0495657_0537611 | Ga0495657_0537611_66_539 | 157 |
| 115 | 3300046678 | Ga0495599_0002888 | Ga0495599_0002888_5085_5558 | 157 |
| 116 | 3300046679 | Ga0495623_0631191 | Ga0495623_0631191_67_540 | 157 |
| 117 | 3300046681 | Ga0495647_0002471 | Ga0495647_0002471_119_592 | 157 |
| 118 | 3300046683 | Ga0495658_0814862 | Ga0495658_0814862_12_485 | 157 |
| 119 | 3300047317 | Ga0495604_0042840 | Ga0495604_0042840_2648_3121 | 157 |
| 120 | 3300047318 | Ga0495636_0003634 | Ga0495636_0003634_3777_4250 | 157 |
| 121 | 3300047322 | Ga0495680_0631761 | Ga0495680_0631761_218_691 | 157 |
| 122 | 3300047322 | Ga0495680_0631773 | Ga0495680_0631773_23_496 | 157 |
| 123 | 3300047444 | Ga0495675_0012907 | Ga0495675_0012907_427_900 | 157 |
| 124 | 3300047444 | Ga0495675_0467693 | Ga0495675_0467693_147_620 | 157 |
| 125 | 3300048088 | Ga0495602_0788261 | Ga0495602_0788261_112_585 | 157 |
| 126 | 3300049575 | Ga0501039_0046891 | Ga0501039_0046891_2755_3228 | 157 |
| 127 | 3300049575 | Ga0501039_0595776 | Ga0501039_0595776_247_720 | 157 |
| 128 | 3300049576 | Ga0501040_0097200 | Ga0501040_0097200_948_1421 | 157 |
| 129 | 3300049577 | Ga0501041_0394962 | Ga0501041_0394962_301_774 | 157 |
| 130 | 3300049578 | Ga0501042_0342215 | Ga0501042_0342215_348_821 | 157 |
| 131 | 3300049582 | Ga0501048_0056461 | Ga0501048_0056461_1933_2406 | 157 |
| 132 | 3300049583 | Ga0501067_0213849 | Ga0501067_0213849_365_838 | 157 |
| 133 | 3300049584 | Ga0501068_0158079 | Ga0501068_0158079_714_1187 | 157 |
| 134 | 3300049587 | Ga0501071_0013396 | Ga0501071_0013396_4931_5404 | 157 |
| 135 | 3300049588 | Ga0501072_0001399 | Ga0501072_0001399_980_1453 | 157 |
| 136 | 3300049588 | Ga0501072_0179258 | Ga0501072_0179258_1175_1648 | 157 |
| 137 | 3300049588 | Ga0501072_0480728 | Ga0501072_0480728_57_530 | 157 |
| 138 | 3300049590 | Ga0501074_0214122 | Ga0501074_0214122_268_741 | 157 |
| 139 | 3300049591 | Ga0501075_0023115 | Ga0501075_0023115_1571_2044 | 157 |
| 140 | 3300049592 | Ga0501076_0012795 | Ga0501076_0012795_4484_4957 | 157 |
| 141 | 3300049593 | Ga0501077_0108178 | Ga0501077_0108178_237_710 | 157 |
| 142 | 3300049741 | Ga0501079_0390417 | Ga0501079_0390417_96_569 | 157 |
| 143 | 3300049742 | Ga0501080_0299631 | Ga0501080_0299631_186_659 | 157 |
| 144 | 3300049743 | Ga0501081_0012671 | Ga0501081_0012671_2088_2561 | 157 |
| 145 | 3300049744 | Ga0501083_0686660 | Ga0501083_0686660_58_531 | 157 |
| 146 | 3300049822 | Ga0501035_0137626 | Ga0501035_0137626_1060_1533 | 157 |
| 147 | 3300049823 | Ga0501044_1011639 | Ga0501044_1011639_177_650 | 157 |
| 148 | 3300049824 | Ga0501045_0066885 | Ga0501045_0066885_1044_1517 | 157 |
| 149 | 3300050508 | nmdc:mga09592_538283_c1 | nmdc:mga09592_538283_c1_494_967 | 157 |
| 150 | 3300050509 | nmdc:mga0qj67_123797_c1 | nmdc:mga0qj67_123797_c1_975_1448 | 157 |
| 151 | 3300050509 | nmdc:mga0qj67_549125_c1 | nmdc:mga0qj67_549125_c1_23_496 | 157 |
| 152 | 3300050509 | nmdc:mga0qj67_6850_c1 | nmdc:mga0qj67_6850_c1_4704_5177 | 157 |
| 153 | 3300050510 | nmdc:mga06r32_308880_c1 | nmdc:mga06r32_308880_c1_842_1315 | 157 |
| 154 | 3300050512 | nmdc:mga0n895_367_c1 | nmdc:mga0n895_367_c1_26205_26678 | 157 |
| 155 | 3300050513 | nmdc:mga0rr50_158280_c1 | nmdc:mga0rr50_158280_c1_433_906 | 157 |
| 156 | 3300050513 | nmdc:mga0rr50_97397_c2 | nmdc:mga0rr50_97397_c2_321_794 | 157 |
| 157 | 3300050514 | nmdc:mga08x19_1118_c1 | nmdc:mga08x19_1118_c1_13571_14044 | 157 |
| 158 | 3300050514 | nmdc:mga08x19_148673_c1 | nmdc:mga08x19_148673_c1_693_1166 | 157 |
| 159 | 3300050514 | nmdc:mga08x19_221693_c1 | nmdc:mga08x19_221693_c1_392_865 | 157 |
| 160 | 3300050514 | nmdc:mga08x19_58041_c1 | nmdc:mga08x19_58041_c1_1333_1806 | 157 |
| 161 | 3300050514 | nmdc:mga08x19_5900_c1 | nmdc:mga08x19_5900_c1_6440_6913 | 157 |
| 162 | 3300053077 | Ga0495601_0030722 | Ga0495601_0030722_2148_2621 | 157 |
| 163 | 3300053077 | Ga0495601_0167414 | Ga0495601_0167414_107_580 | 157 |
| 164 | 3300053085 | Ga0495619_0267178 | Ga0495619_0267178_124_597 | 157 |
| 165 | 3300054114 | Ga0501084_0410960 | Ga0501084_0410960_317_790 | 157 |
| 166 | 3300060353 | Ga0501082_0033898 | Ga0501082_0033898_2844_3317 | 157 |
| 167 | 3300061734 | Ga0530510_0000170 | Ga0530510_0000170_18992_19465 | 157 |
| 168 | 3300061734 | Ga0530510_1171410 | Ga0530510_1171410_81_554 | 157 |
| 169 | 3300005330 | Ga0070690_100074179 | Ga0070690_1000741792 | 158 |
| 170 | 3300005330 | Ga0070690_101056408 | Ga0070690_1010564081 | 158 |
| 171 | 3300005330 | Ga0070690_101201813 | Ga0070690_1012018131 | 158 |
| 172 | 3300005331 | Ga0070670_100117661 | Ga0070670_1001176612 | 158 |
| 173 | 3300005334 | Ga0068869_100012083 | Ga0068869_1000120832 | 158 |
| 174 | 3300005334 | Ga0068869_101394355 | Ga0068869_1013943551 | 158 |
| 175 | 3300005337 | Ga0070682_100105552 | Ga0070682_1001055522 | 158 |
| 176 | 3300005338 | Ga0068868_100452445 | Ga0068868_1004524452 | 158 |
| 177 | 3300005339 | Ga0070660_100381078 | Ga0070660_1003810782 | 158 |
| 178 | 3300005339 | Ga0070660_101249062 | Ga0070660_1012490621 | 158 |
| 179 | 3300005340 | Ga0070689_100066936 | Ga0070689_1000669362 | 158 |
| 180 | 3300005344 | Ga0070661_100707818 | Ga0070661_1007078182 | 158 |
| 181 | 3300005345 | Ga0070692_10473969 | Ga0070692_104739692 | 158 |
| 182 | 3300005347 | Ga0070668_100795725 | Ga0070668_1007957252 | 158 |
| 183 | 3300005353 | Ga0070669_100137721 | Ga0070669_1001377212 | 158 |
| 184 | 3300005356 | Ga0070674_100078199 | Ga0070674_1000781993 | 158 |
| 185 | 3300005366 | Ga0070659_100040641 | Ga0070659_1000406413 | 158 |
| 186 | 3300005366 | Ga0070659_100298389 | Ga0070659_1002983892 | 158 |
| 187 | 3300005367 | Ga0070667_100620974 | Ga0070667_1006209742 | 158 |
| 188 | 3300005367 | Ga0070667_101086518 | Ga0070667_1010865182 | 158 |
| 189 | 3300005438 | Ga0070701_10081040 | Ga0070701_100810402 | 158 |
| 190 | 3300005441 | Ga0070700_100513667 | Ga0070700_1005136671 | 158 |
| 191 | 3300005444 | Ga0070694_100007797 | Ga0070694_1000077974 | 158 |
| 192 | 3300005444 | Ga0070694_100011859 | Ga0070694_1000118594 | 158 |
| 193 | 3300005455 | Ga0070663_100489892 | Ga0070663_1004898922 | 158 |
| 194 | 3300005455 | Ga0070663_101637777 | Ga0070663_1016377771 | 158 |
| 195 | 3300005456 | Ga0070678_100292288 | Ga0070678_1002922882 | 158 |
| 196 | 3300005456 | Ga0070678_101065516 | Ga0070678_1010655161 | 158 |
| 197 | 3300005457 | Ga0070662_100073181 | Ga0070662_1000731812 | 158 |
| 198 | 3300005457 | Ga0070662_100077812 | Ga0070662_1000778122 | 158 |
| 199 | 3300005457 | Ga0070662_100428966 | Ga0070662_1004289661 | 158 |
| 200 | 3300005459 | Ga0068867_101001466 | Ga0068867_1010014662 | 158 |
| 201 | 3300005459 | Ga0068867_101489589 | Ga0068867_1014895891 | 158 |
| 202 | 3300005466 | Ga0070685_10135317 | Ga0070685_101353172 | 158 |
| 203 | 3300005518 | Ga0070699_100530270 | Ga0070699_1005302702 | 158 |
| 204 | 3300005518 | Ga0070699_100618637 | Ga0070699_1006186372 | 158 |
| 205 | 3300005536 | Ga0070697_101109239 | Ga0070697_1011092391 | 158 |
| 206 | 3300005539 | Ga0068853_100811959 | Ga0068853_1008119591 | 158 |
| 207 | 3300005543 | Ga0070672_100697281 | Ga0070672_1006972812 | 158 |
| 208 | 3300005544 | Ga0070686_100095690 | Ga0070686_1000956902 | 158 |
| 209 | 3300005544 | Ga0070686_100461823 | Ga0070686_1004618232 | 158 |
| 210 | 3300005545 | Ga0070695_100095580 | Ga0070695_1000955802 | 158 |
| 211 | 3300005545 | Ga0070695_101396607 | Ga0070695_1013966071 | 158 |
| 212 | 3300005546 | Ga0070696_100250352 | Ga0070696_1002503522 | 158 |
| 213 | 3300005546 | Ga0070696_100318204 | Ga0070696_1003182041 | 158 |
| 214 | 3300005547 | Ga0070693_100194827 | Ga0070693_1001948272 | 158 |
| 215 | 3300005548 | Ga0070665_100235316 | Ga0070665_1002353162 | 158 |
| 216 | 3300005549 | Ga0070704_100173908 | Ga0070704_1001739082 | 158 |
| 217 | 3300005549 | Ga0070704_100198723 | Ga0070704_1001987232 | 158 |
| 218 | 3300005578 | Ga0068854_100478558 | Ga0068854_1004785582 | 158 |
| 219 | 3300005615 | Ga0070702_100165943 | Ga0070702_1001659432 | 158 |
| 220 | 3300005615 | Ga0070702_100663916 | Ga0070702_1006639162 | 158 |
| 221 | 3300005617 | Ga0068859_100004143 | Ga0068859_1000041432 | 158 |
| 222 | 3300005618 | Ga0068864_100075317 | Ga0068864_1000753172 | 158 |
| 223 | 3300005718 | Ga0068866_10025262 | Ga0068866_100252622 | 158 |
| 224 | 3300005718 | Ga0068866_10912206 | Ga0068866_109122061 | 158 |
| 225 | 3300005719 | Ga0068861_100111242 | Ga0068861_1001112422 | 158 |
| 226 | 3300005841 | Ga0068863_100024216 | Ga0068863_1000242168 | 158 |
| 227 | 3300005842 | Ga0068858_100125407 | Ga0068858_1001254073 | 158 |
| 228 | 3300005844 | Ga0068862_100140937 | Ga0068862_1001409372 | 158 |
| 229 | 3300006163 | Ga0070715_10260604 | Ga0070715_102606042 | 158 |
| 230 | 3300006173 | Ga0070716_100165349 | Ga0070716_1001653492 | 158 |
| 231 | 3300006237 | Ga0097621_100008534 | Ga0097621_1000085342 | 158 |
| 232 | 3300006237 | Ga0097621_101195491 | Ga0097621_1011954912 | 158 |
| 233 | 3300006358 | Ga0068871_100076099 | Ga0068871_1000760993 | 158 |
| 234 | 3300006881 | Ga0068865_100082328 | Ga0068865_1000823282 | 158 |
| 235 | 3300006931 | Ga0097620_100004143 | Ga0097620_1000041432 | 158 |
| 236 | 3300009094 | Ga0111539_10016781 | Ga0111539_100167812 | 158 |
| 237 | 3300009094 | Ga0111539_10932848 | Ga0111539_109328482 | 158 |
| 238 | 3300009098 | Ga0105245_10209682 | Ga0105245_102096822 | 158 |
| 239 | 3300009098 | Ga0105245_10451951 | Ga0105245_104519512 | 158 |
| 240 | 3300009101 | Ga0105247_10344858 | Ga0105247_103448582 | 158 |
| 241 | 3300009148 | Ga0105243_10666547 | Ga0105243_106665472 | 158 |
| 242 | 3300009148 | Ga0105243_11482630 | Ga0105243_114826301 | 158 |
| 243 | 3300009176 | Ga0105242_10602608 | Ga0105242_106026082 | 158 |
| 244 | 3300009177 | Ga0105248_10002218 | Ga0105248_100022181 | 158 |
| 245 | 3300009545 | Ga0105237_11090568 | Ga0105237_110905682 | 158 |
| 246 | 3300009551 | Ga0105238_11259084 | Ga0105238_112590841 | 158 |
| 247 | 3300009553 | Ga0105249_10821374 | Ga0105249_108213742 | 158 |
| 248 | 3300010375 | Ga0105239_11048648 | Ga0105239_110486481 | 158 |
| 249 | 3300013100 | Ga0157373_10358395 | Ga0157373_103583952 | 158 |
| 250 | 3300013102 | Ga0157371_11066066 | Ga0157371_110660661 | 158 |
| 251 | 3300013296 | Ga0157374_10150237 | Ga0157374_101502373 | 158 |
| 252 | 3300013296 | Ga0157374_10264089 | Ga0157374_102640892 | 158 |
| 253 | 3300013297 | Ga0157378_10051663 | Ga0157378_100516633 | 158 |
| 254 | 3300013297 | Ga0157378_11137268 | Ga0157378_111372682 | 158 |
| 255 | 3300013306 | Ga0163162_10140906 | Ga0163162_101409062 | 158 |
| 256 | 3300013308 | Ga0157375_10011033 | Ga0157375_100110337 | 158 |
| 257 | 3300013308 | Ga0157375_10374368 | Ga0157375_103743682 | 158 |
| 258 | 3300014326 | Ga0157380_10108260 | Ga0157380_101082602 | 158 |
| 259 | 3300014326 | Ga0157380_10183103 | Ga0157380_101831031 | 158 |
| 260 | 3300014968 | Ga0157379_10245270 | Ga0157379_102452702 | 158 |
| 261 | 3300014969 | Ga0157376_10033466 | Ga0157376_100334663 | 158 |
| 262 | 3300017792 | Ga0163161_10013389 | Ga0163161_100133892 | 158 |
| 263 | 3300025899 | Ga0207642_10052105 | Ga0207642_100521052 | 158 |
| 264 | 3300025900 | Ga0207710_10287665 | Ga0207710_102876652 | 158 |
| 265 | 3300025908 | Ga0207643_10090879 | Ga0207643_100908792 | 158 |
| 266 | 3300025910 | Ga0207684_11708245 | Ga0207684_117082451 | 158 |
| 267 | 3300025925 | Ga0207650_11516181 | Ga0207650_115161811 | 158 |
| 268 | 3300025926 | Ga0207659_10036324 | Ga0207659_100363243 | 158 |
| 269 | 3300025926 | Ga0207659_10662271 | Ga0207659_106622712 | 158 |
| 270 | 3300025927 | Ga0207687_10170079 | Ga0207687_101700792 | 158 |
| 271 | 3300025932 | Ga0207690_10131805 | Ga0207690_101318052 | 158 |
| 272 | 3300025932 | Ga0207690_10406579 | Ga0207690_104065791 | 158 |
| 273 | 3300025933 | Ga0207706_10029707 | Ga0207706_100297074 | 158 |
| 274 | 3300025933 | Ga0207706_10145093 | Ga0207706_101450932 | 158 |
| 275 | 3300025933 | Ga0207706_10326444 | Ga0207706_103264442 | 158 |
| 276 | 3300025933 | Ga0207706_11010902 | Ga0207706_110109021 | 158 |
| 277 | 3300025934 | Ga0207686_10374764 | Ga0207686_103747642 | 158 |
| 278 | 3300025936 | Ga0207670_10195194 | Ga0207670_101951942 | 158 |
| 279 | 3300025936 | Ga0207670_10256476 | Ga0207670_102564762 | 158 |
| 280 | 3300025937 | Ga0207669_10354658 | Ga0207669_103546582 | 158 |
| 281 | 3300025937 | Ga0207669_10695343 | Ga0207669_106953432 | 158 |
| 282 | 3300025940 | Ga0207691_10170606 | Ga0207691_101706062 | 158 |
| 283 | 3300025941 | Ga0207711_10144793 | Ga0207711_101447932 | 158 |
| 284 | 3300025942 | Ga0207689_10001526 | Ga0207689_1000152612 | 158 |
| 285 | 3300025960 | Ga0207651_10728505 | Ga0207651_107285052 | 158 |
| 286 | 3300025972 | Ga0207668_10371735 | Ga0207668_103717352 | 158 |
| 287 | 3300025986 | Ga0207658_10121457 | Ga0207658_101214571 | 158 |
| 288 | 3300025986 | Ga0207658_10688705 | Ga0207658_106887051 | 158 |
| 289 | 3300026023 | Ga0207677_10097557 | Ga0207677_100975572 | 158 |
| 290 | 3300026023 | Ga0207677_10644287 | Ga0207677_106442872 | 158 |
| 291 | 3300026035 | Ga0207703_10974247 | Ga0207703_109742472 | 158 |
| 292 | 3300026067 | Ga0207678_10223448 | Ga0207678_102234481 | 158 |
| 293 | 3300026088 | Ga0207641_10033425 | Ga0207641_100334256 | 158 |
| 294 | 3300026089 | Ga0207648_10023103 | Ga0207648_100231035 | 158 |
| 295 | 3300026089 | Ga0207648_10722118 | Ga0207648_107221182 | 158 |
| 296 | 3300026095 | Ga0207676_10050997 | Ga0207676_100509973 | 158 |
| 297 | 3300026118 | Ga0207675_100028790 | Ga0207675_1000287903 | 158 |
| 298 | 3300026121 | Ga0207683_10051897 | Ga0207683_100518972 | 158 |
| 299 | 3300026142 | Ga0207698_10284124 | Ga0207698_102841242 | 158 |
| 300 | 3300027512 | Ga0209179_1070318 | Ga0209179_10703182 | 158 |
| 301 | 3300028380 | Ga0268265_10099483 | Ga0268265_100994832 | 158 |
| 302 | 3300028381 | Ga0268264_10037732 | Ga0268264_100377325 | 158 |
| 303 | 3300028381 | Ga0268264_10646841 | Ga0268264_106468411 | 158 |
| 304 | 3300032004 | Ga0307414_10235708 | Ga0307414_102357081 | 158 |
| 305 | 3300035113 | Ga0373936_0060619 | Ga0373936_0060619_960_1436 | 158 |
| 306 | 3300035115 | Ga0373941_0039851 | Ga0373941_0039851_911_1396 | 158 |
| 307 | 3300035170 | Ga0373943_0444095 | Ga0373943_0444095_188_664 | 158 |
| 308 | 3300035171 | Ga0373946_0282720 | Ga0373946_0282720_133_609 | 158 |
| 309 | 3300035692 | Ga0373935_0269439 | Ga0373935_0269439_617_1093 | 158 |
| 310 | 3300035695 | Ga0373927_0343639 | Ga0373927_0343639_303_779 | 158 |
| 311 | 3300037068 | Ga0373925_0152252 | Ga0373925_0152252_912_1388 | 158 |
| 312 | 3300037418 | Ga0395900_0088037 | Ga0395900_0088037_168_644 | 158 |
| 313 | 3300038443 | Ga0395901_0449952 | Ga0395901_0449952_674_1150 | 158 |
| 314 | 3300042006 | Ga0439432_076975 | Ga0439432_076975_220_696 | 158 |
| 315 | 3300044712 | Ga0453684_0426012 | Ga0453684_0426012_212_688 | 158 |
| 316 | 3300044712 | Ga0453684_0637922 | Ga0453684_0637922_670_1146 | 158 |
| 317 | 3300045051 | Ga0451576_0342806 | Ga0451576_0342806_727_1203 | 158 |
| 318 | 3300048907 | Ga0496104_0210310 | Ga0496104_0210310_131_607 | 158 |
| 319 | 3300048909 | Ga0496106_0272991 | Ga0496106_0272991_234_710 | 158 |
| 320 | 3300048910 | Ga0496107_0349298 | Ga0496107_0349298_174_650 | 158 |
| 321 | 3300048911 | Ga0496108_0013970 | Ga0496108_0013970_5706_6182 | 158 |
| 322 | 3300048911 | Ga0496108_0187926 | Ga0496108_0187926_1106_1582 | 158 |
| 323 | 3300048912 | Ga0496109_0011013 | Ga0496109_0011013_4146_4622 | 158 |
| 324 | 3300048913 | Ga0496110_0837121 | Ga0496110_0837121_189_665 | 158 |
| 325 | 3300048915 | Ga0496112_0234806 | Ga0496112_0234806_944_1420 | 158 |
| 326 | 3300048917 | Ga0496114_0012661 | Ga0496114_0012661_4996_5472 | 158 |
| 327 | 3300048917 | Ga0496114_0022120 | Ga0496114_0022120_64_540 | 158 |
| 328 | 3300048917 | Ga0496114_0659150 | Ga0496114_0659150_407_883 | 158 |
| 329 | 3300048918 | Ga0496115_0179858 | Ga0496115_0179858_1024_1500 | 158 |
| 330 | 3300049521 | Ga0501298_033786 | Ga0501298_033786_286_762 | 158 |
| 331 | 3300049568 | Ga0501031_0045354 | Ga0501031_0045354_288_764 | 158 |
| 332 | 3300049568 | Ga0501031_0070945 | Ga0501031_0070945_1719_2195 | 158 |
| 333 | 3300049569 | Ga0501032_0001741 | Ga0501032_0001741_7960_8436 | 158 |
| 334 | 3300049569 | Ga0501032_0023567 | Ga0501032_0023567_145_621 | 158 |
| 335 | 3300049569 | Ga0501032_0131161 | Ga0501032_0131161_790_1266 | 158 |
| 336 | 3300049569 | Ga0501032_0729344 | Ga0501032_0729344_135_611 | 158 |
| 337 | 3300049570 | Ga0501033_0000364 | Ga0501033_0000364_7765_8241 | 158 |
| 338 | 3300049570 | Ga0501033_0005262 | Ga0501033_0005262_8953_9429 | 158 |
| 339 | 3300049570 | Ga0501033_0010897 | Ga0501033_0010897_3068_3544 | 158 |
| 340 | 3300049570 | Ga0501033_0211631 | Ga0501033_0211631_842_1318 | 158 |
| 341 | 3300049570 | Ga0501033_0775504 | Ga0501033_0775504_156_632 | 158 |
| 342 | 3300049571 | Ga0501034_0005376 | Ga0501034_0005376_4539_5015 | 158 |
| 343 | 3300049571 | Ga0501034_0012071 | Ga0501034_0012071_7959_8435 | 158 |
| 344 | 3300049571 | Ga0501034_0138359 | Ga0501034_0138359_148_624 | 158 |
| 345 | 3300049572 | Ga0501036_0004793 | Ga0501036_0004793_4329_4805 | 158 |
| 346 | 3300049572 | Ga0501036_0006729 | Ga0501036_0006729_6328_6804 | 158 |
| 347 | 3300049572 | Ga0501036_0044802 | Ga0501036_0044802_1138_1614 | 158 |
| 348 | 3300049572 | Ga0501036_0117508 | Ga0501036_0117508_364_840 | 158 |
| 349 | 3300049572 | Ga0501036_0139132 | Ga0501036_0139132_339_815 | 158 |
| 350 | 3300049572 | Ga0501036_1081035 | Ga0501036_1081035_129_605 | 158 |
| 351 | 3300049573 | Ga0501037_0000162 | Ga0501037_0000162_54195_54671 | 158 |
| 352 | 3300049573 | Ga0501037_0037962 | Ga0501037_0037962_1352_1828 | 158 |
| 353 | 3300049573 | Ga0501037_0124832 | Ga0501037_0124832_1003_1479 | 158 |
| 354 | 3300049573 | Ga0501037_0323169 | Ga0501037_0323169_66_542 | 158 |
| 355 | 3300049574 | Ga0501038_0003864 | Ga0501038_0003864_9006_9482 | 158 |
| 356 | 3300049574 | Ga0501038_0008423 | Ga0501038_0008423_6482_6958 | 158 |
| 357 | 3300049574 | Ga0501038_0071876 | Ga0501038_0071876_1461_1937 | 158 |
| 358 | 3300049574 | Ga0501038_0103831 | Ga0501038_0103831_687_1163 | 158 |
| 359 | 3300049574 | Ga0501038_0190761 | Ga0501038_0190761_627_1103 | 158 |
| 360 | 3300049574 | Ga0501038_0232637 | Ga0501038_0232637_24_500 | 158 |
| 361 | 3300049575 | Ga0501039_0003351 | Ga0501039_0003351_9381_9857 | 158 |
| 362 | 3300049575 | Ga0501039_0035202 | Ga0501039_0035202_3122_3598 | 158 |
| 363 | 3300049575 | Ga0501039_0199951 | Ga0501039_0199951_751_1227 | 158 |
| 364 | 3300049575 | Ga0501039_0215832 | Ga0501039_0215832_581_1057 | 158 |
| 365 | 3300049576 | Ga0501040_0003740 | Ga0501040_0003740_1439_1915 | 158 |
| 366 | 3300049576 | Ga0501040_0009844 | Ga0501040_0009844_150_626 | 158 |
| 367 | 3300049577 | Ga0501041_0222845 | Ga0501041_0222845_467_943 | 158 |
| 368 | 3300049578 | Ga0501042_0000536 | Ga0501042_0000536_5208_5684 | 158 |
| 369 | 3300049578 | Ga0501042_0196429 | Ga0501042_0196429_637_1113 | 158 |
| 370 | 3300049579 | Ga0501043_0022331 | Ga0501043_0022331_1884_2360 | 158 |
| 371 | 3300049579 | Ga0501043_0060318 | Ga0501043_0060318_2005_2481 | 158 |
| 372 | 3300049579 | Ga0501043_0224156 | Ga0501043_0224156_287_763 | 158 |
| 373 | 3300049579 | Ga0501043_0245920 | Ga0501043_0245920_545_1021 | 158 |
| 374 | 3300049579 | Ga0501043_0304519 | Ga0501043_0304519_622_1098 | 158 |
| 375 | 3300049579 | Ga0501043_0362633 | Ga0501043_0362633_36_512 | 158 |
| 376 | 3300049580 | Ga0501046_0026489 | Ga0501046_0026489_1452_1928 | 158 |
| 377 | 3300049580 | Ga0501046_0068985 | Ga0501046_0068985_497_973 | 158 |
| 378 | 3300049580 | Ga0501046_0101642 | Ga0501046_0101642_400_876 | 158 |
| 379 | 3300049582 | Ga0501048_0008305 | Ga0501048_0008305_1219_1695 | 158 |
| 380 | 3300049582 | Ga0501048_0119705 | Ga0501048_0119705_347_823 | 158 |
| 381 | 3300049584 | Ga0501068_0018157 | Ga0501068_0018157_1078_1554 | 158 |
| 382 | 3300049584 | Ga0501068_0530611 | Ga0501068_0530611_45_521 | 158 |
| 383 | 3300049587 | Ga0501071_0435034 | Ga0501071_0435034_278_754 | 158 |
| 384 | 3300049588 | Ga0501072_0091526 | Ga0501072_0091526_247_723 | 158 |
| 385 | 3300049589 | Ga0501073_0359056 | Ga0501073_0359056_397_873 | 158 |
| 386 | 3300049591 | Ga0501075_0010270 | Ga0501075_0010270_1349_1825 | 158 |
| 387 | 3300049591 | Ga0501075_0239449 | Ga0501075_0239449_300_776 | 158 |
| 388 | 3300049592 | Ga0501076_0014474 | Ga0501076_0014474_5432_5908 | 158 |
| 389 | 3300049592 | Ga0501076_0342384 | Ga0501076_0342384_716_1192 | 158 |
| 390 | 3300049593 | Ga0501077_0011579 | Ga0501077_0011579_1989_2465 | 158 |
| 391 | 3300049669 | Ga0501235_195656 | Ga0501235_195656_43_519 | 158 |
| 392 | 3300049680 | Ga0501250_071032 | Ga0501250_071032_39_515 | 158 |
| 393 | 3300049741 | Ga0501079_0077016 | Ga0501079_0077016_1102_1578 | 158 |
| 394 | 3300049741 | Ga0501079_1381767 | Ga0501079_1381767_56_532 | 158 |
| 395 | 3300049742 | Ga0501080_0006958 | Ga0501080_0006958_7522_7998 | 158 |
| 396 | 3300049743 | Ga0501081_0272525 | Ga0501081_0272525_661_1137 | 158 |
| 397 | 3300049743 | Ga0501081_0396329 | Ga0501081_0396329_41_517 | 158 |
| 398 | 3300049822 | Ga0501035_0005055 | Ga0501035_0005055_12009_12485 | 158 |
| 399 | 3300049822 | Ga0501035_0025464 | Ga0501035_0025464_4564_5040 | 158 |
| 400 | 3300049822 | Ga0501035_0060352 | Ga0501035_0060352_403_879 | 158 |
| 401 | 3300049822 | Ga0501035_0084580 | Ga0501035_0084580_317_793 | 158 |
| 402 | 3300049822 | Ga0501035_0093559 | Ga0501035_0093559_659_1135 | 158 |
| 403 | 3300049822 | Ga0501035_0147964 | Ga0501035_0147964_310_786 | 158 |
| 404 | 3300049823 | Ga0501044_0001481 | Ga0501044_0001481_2981_3457 | 158 |
| 405 | 3300049823 | Ga0501044_0003222 | Ga0501044_0003222_3122_3598 | 158 |
| 406 | 3300049823 | Ga0501044_0043973 | Ga0501044_0043973_2989_3465 | 158 |
| 407 | 3300049823 | Ga0501044_0269938 | Ga0501044_0269938_1147_1623 | 158 |
| 408 | 3300049824 | Ga0501045_0003218 | Ga0501045_0003218_2764_3240 | 158 |
| 409 | 3300049824 | Ga0501045_0041989 | Ga0501045_0041989_2481_2957 | 158 |
| 410 | 3300049824 | Ga0501045_0259793 | Ga0501045_0259793_175_651 | 158 |
| 411 | 3300050511 | nmdc:mga08y16_19726_c1 | nmdc:mga08y16_19726_c1_5553_6029 | 158 |
| 412 | 3300050511 | nmdc:mga08y16_3419_c1 | nmdc:mga08y16_3419_c1_3164_3640 | 158 |
| 413 | 3300054114 | Ga0501084_0021829 | Ga0501084_0021829_4430_4906 | 158 |
| 414 | 3300060353 | Ga0501082_0040072 | Ga0501082_0040072_3088_3564 | 158 |
| 415 | 3300061734 | Ga0530510_0004733 | Ga0530510_0004733_5535_6011 | 158 |
| 416 | iso_pu_bacteria | 2721755763 | 2723877061 | 158 |
| 417 | 3300005343 | Ga0070687_100021059 | Ga0070687_1000210592 | 159 |
| 418 | 3300005536 | Ga0070697_100002415 | Ga0070697_10000241512 | 159 |
| 419 | 3300005546 | Ga0070696_100431838 | Ga0070696_1004318382 | 159 |
| 420 | 3300006358 | Ga0068871_100666348 | Ga0068871_1006663482 | 159 |
| 421 | 3300007265 | Ga0099794_10100975 | Ga0099794_101009752 | 159 |
| 422 | 3300009094 | Ga0111539_10151848 | Ga0111539_101518482 | 159 |
| 423 | 3300009553 | Ga0105249_11106389 | Ga0105249_111063892 | 159 |
| 424 | 3300009553 | Ga0105249_12432486 | Ga0105249_124324861 | 159 |
| 425 | 3300025913 | Ga0207695_10780147 | Ga0207695_107801472 | 159 |
| 426 | 3300025940 | Ga0207691_10245380 | Ga0207691_102453802 | 159 |
| 427 | 3300027671 | Ga0209588_1065024 | Ga0209588_10650241 | 159 |
| 428 | 3300028380 | Ga0268265_10060666 | Ga0268265_100606662 | 159 |
| 429 | 3300035084 | Ga0373928_0037831 | Ga0373928_0037831_272_814 | 159 |
| 430 | 3300035091 | Ga0373951_0160852 | Ga0373951_0160852_36_578 | 159 |
| 431 | 3300035724 | Ga0373933_0190804 | Ga0373933_0190804_556_1035 | 159 |
| 432 | 3300037471 | Ga0395905_1021611 | Ga0395905_1021611_33_512 | 159 |
| 433 | 3300039438 | Ga0436360_1169165 | Ga0436360_1169165_87_566 | 159 |
| 434 | 3300042435 | Ga0439434_0067858 | Ga0439434_0067858_567_1046 | 159 |
| 435 | 3300044658 | Ga0466972_0000070 | Ga0466972_0000070_4106_4585 | 159 |
| 436 | 3300044706 | Ga0466964_0108427 | Ga0466964_0108427_345_824 | 159 |
| 437 | 3300046663 | Ga0495635_0453472 | Ga0495635_0453472_345_824 | 159 |
| 438 | 3300048913 | Ga0496110_1292361 | Ga0496110_1292361_119_598 | 159 |
| 439 | 3300048927 | Ga0496124_0485288 | Ga0496124_0485288_70_549 | 159 |
| 440 | 3300049588 | Ga0501072_0750219 | Ga0501072_0750219_214_693 | 159 |
| 441 | 3300050507 | nmdc:mga05p37_732932_c1 | nmdc:mga05p37_732932_c1_561_1070 | 159 |
| 442 | 3300050511 | nmdc:mga08y16_176151_c1 | nmdc:mga08y16_176151_c1_1055_1534 | 159 |
| 443 | iso_pu_bacteria | 2818991436 | 2819540664 | 159 |
| 444 | 3300005616 | Ga0068852_100741588 | Ga0068852_1007415881 | 160 |
| 445 | 3300005841 | Ga0068863_100653550 | Ga0068863_1006535502 | 160 |
| 446 | 3300005842 | Ga0068858_100195790 | Ga0068858_1001957902 | 160 |
| 447 | 3300005843 | Ga0068860_100062103 | Ga0068860_1000621035 | 160 |
| 448 | 3300006237 | Ga0097621_100336484 | Ga0097621_1003364842 | 160 |
| 449 | 3300009177 | Ga0105248_11151747 | Ga0105248_111517472 | 160 |
| 450 | 3300025986 | Ga0207658_10401217 | Ga0207658_104012172 | 160 |
| 451 | 3300026035 | Ga0207703_10592930 | Ga0207703_105929302 | 160 |
| 452 | 3300026088 | Ga0207641_10352461 | Ga0207641_103524612 | 160 |
| 453 | 3300028381 | Ga0268264_10059516 | Ga0268264_100595162 | 160 |
| 454 | 3300032133 | Ga0316583_10061686 | Ga0316583_100616861 | 160 |
| 455 | 3300033180 | Ga0307510_10402365 | Ga0307510_104023652 | 160 |
| 456 | 3300035398 | Ga0316574_0000854 | Ga0316574_0000854_7331_7813 | 160 |
| 457 | 3300041509 | Ga0451843_0690997 | Ga0451843_0690997_114_620 | 160 |
| 458 | 3300047319 | Ga0495674_0202516 | Ga0495674_0202516_928_1410 | 160 |
| 459 | 3300005618 | Ga0068864_101208836 | Ga0068864_1012088362 | 161 |
| 460 | 3300006237 | Ga0097621_100002521 | Ga0097621_1000025216 | 161 |
| 461 | 3300026095 | Ga0207676_11299082 | Ga0207676_112990821 | 161 |
| 462 | 3300035207 | Ga0373942_0296105 | Ga0373942_0296105_48_533 | 161 |
| 463 | 3300035691 | Ga0373931_0105884 | Ga0373931_0105884_471_968 | 161 |
| 464 | 3300046683 | Ga0495658_0122548 | Ga0495658_0122548_1063_1560 | 161 |
| 465 | 3300005329 | Ga0070683_101074175 | Ga0070683_1010741751 | 162 |
| 466 | 3300005331 | Ga0070670_101885225 | Ga0070670_1018852251 | 162 |
| 467 | 3300005340 | Ga0070689_101310609 | Ga0070689_1013106092 | 162 |
| 468 | 3300005347 | Ga0070668_100404266 | Ga0070668_1004042661 | 162 |
| 469 | 3300005353 | Ga0070669_100039846 | Ga0070669_1000398462 | 162 |
| 470 | 3300005353 | Ga0070669_100408258 | Ga0070669_1004082582 | 162 |
| 471 | 3300005355 | Ga0070671_100054157 | Ga0070671_1000541572 | 162 |
| 472 | 3300005364 | Ga0070673_101253684 | Ga0070673_1012536842 | 162 |
| 473 | 3300005439 | Ga0070711_100119878 | Ga0070711_1001198782 | 162 |
| 474 | 3300005440 | Ga0070705_100108366 | Ga0070705_1001083662 | 162 |
| 475 | 3300005440 | Ga0070705_100302450 | Ga0070705_1003024502 | 162 |
| 476 | 3300005444 | Ga0070694_100362435 | Ga0070694_1003624352 | 162 |
| 477 | 3300005445 | Ga0070708_100271852 | Ga0070708_1002718522 | 162 |
| 478 | 3300005445 | Ga0070708_100555468 | Ga0070708_1005554682 | 162 |
| 479 | 3300005455 | Ga0070663_100198342 | Ga0070663_1001983422 | 162 |
| 480 | 3300005456 | Ga0070678_100601781 | Ga0070678_1006017812 | 162 |
| 481 | 3300005458 | Ga0070681_10178920 | Ga0070681_101789202 | 162 |
| 482 | 3300005467 | Ga0070706_100005369 | Ga0070706_10000536914 | 162 |
| 483 | 3300005467 | Ga0070706_100229256 | Ga0070706_1002292562 | 162 |
| 484 | 3300005467 | Ga0070706_100243274 | Ga0070706_1002432742 | 162 |
| 485 | 3300005468 | Ga0070707_100689745 | Ga0070707_1006897451 | 162 |
| 486 | 3300005471 | Ga0070698_100344771 | Ga0070698_1003447712 | 162 |
| 487 | 3300005518 | Ga0070699_100698845 | Ga0070699_1006988451 | 162 |
| 488 | 3300005530 | Ga0070679_100262530 | Ga0070679_1002625302 | 162 |
| 489 | 3300005536 | Ga0070697_100014086 | Ga0070697_1000140863 | 162 |
| 490 | 3300005536 | Ga0070697_100063553 | Ga0070697_1000635533 | 162 |
| 491 | 3300005536 | Ga0070697_100089287 | Ga0070697_1000892874 | 162 |
| 492 | 3300005536 | Ga0070697_100452401 | Ga0070697_1004524011 | 162 |
| 493 | 3300005539 | Ga0068853_100047075 | Ga0068853_1000470753 | 162 |
| 494 | 3300005543 | Ga0070672_100121871 | Ga0070672_1001218711 | 162 |
| 495 | 3300005543 | Ga0070672_101348160 | Ga0070672_1013481602 | 162 |
| 496 | 3300005545 | Ga0070695_101158210 | Ga0070695_1011582101 | 162 |
| 497 | 3300005549 | Ga0070704_101262934 | Ga0070704_1012629341 | 162 |
| 498 | 3300005563 | Ga0068855_100439986 | Ga0068855_1004399862 | 162 |
| 499 | 3300005616 | Ga0068852_101781318 | Ga0068852_1017813181 | 162 |
| 500 | 3300005617 | Ga0068859_100118593 | Ga0068859_1001185934 | 162 |
| 501 | 3300005618 | Ga0068864_100089679 | Ga0068864_1000896793 | 162 |
| 502 | 3300005840 | Ga0068870_10027059 | Ga0068870_100270592 | 162 |
| 503 | 3300005841 | Ga0068863_101608968 | Ga0068863_1016089681 | 162 |
| 504 | 3300005842 | Ga0068858_100126739 | Ga0068858_1001267392 | 162 |
| 505 | 3300005844 | Ga0068862_101061603 | Ga0068862_1010616031 | 162 |
| 506 | 3300006237 | Ga0097621_100103464 | Ga0097621_1001034642 | 162 |
| 507 | 3300006358 | Ga0068871_100041227 | Ga0068871_1000412272 | 162 |
| 508 | 3300006846 | Ga0075430_100110168 | Ga0075430_1001101683 | 162 |
| 509 | 3300006847 | Ga0075431_100005031 | Ga0075431_1000050313 | 162 |
| 510 | 3300006852 | Ga0075433_10412026 | Ga0075433_104120262 | 162 |
| 511 | 3300006871 | Ga0075434_100160654 | Ga0075434_1001606543 | 162 |
| 512 | 3300006871 | Ga0075434_101340721 | Ga0075434_1013407212 | 162 |
| 513 | 3300006880 | Ga0075429_100045494 | Ga0075429_1000454943 | 162 |
| 514 | 3300006881 | Ga0068865_100072899 | Ga0068865_1000728992 | 162 |
| 515 | 3300006931 | Ga0097620_100118591 | Ga0097620_1001185914 | 162 |
| 516 | 3300007076 | Ga0075435_100130708 | Ga0075435_1001307083 | 162 |
| 517 | 3300007076 | Ga0075435_100234384 | Ga0075435_1002343842 | 162 |
| 518 | 3300009094 | Ga0111539_10001053 | Ga0111539_1000105318 | 162 |
| 519 | 3300009094 | Ga0111539_10800328 | Ga0111539_108003282 | 162 |
| 520 | 3300009094 | Ga0111539_11692320 | Ga0111539_116923202 | 162 |
| 521 | 3300009094 | Ga0111539_12975142 | Ga0111539_129751421 | 162 |
| 522 | 3300009098 | Ga0105245_11069593 | Ga0105245_110695932 | 162 |
| 523 | 3300009176 | Ga0105242_10221835 | Ga0105242_102218352 | 162 |
| 524 | 3300009176 | Ga0105242_11101892 | Ga0105242_111018922 | 162 |
| 525 | 3300009176 | Ga0105242_11881934 | Ga0105242_118819341 | 162 |
| 526 | 3300009177 | Ga0105248_10308283 | Ga0105248_103082832 | 162 |
| 527 | 3300013296 | Ga0157374_10675431 | Ga0157374_106754312 | 162 |
| 528 | 3300013297 | Ga0157378_10776966 | Ga0157378_107769662 | 162 |
| 529 | 3300013297 | Ga0157378_11475590 | Ga0157378_114755902 | 162 |
| 530 | 3300013308 | Ga0157375_12045523 | Ga0157375_120455232 | 162 |
| 531 | 3300014326 | Ga0157380_11920684 | Ga0157380_119206841 | 162 |
| 532 | 3300014969 | Ga0157376_10167905 | Ga0157376_101679052 | 162 |
| 533 | 3300025893 | Ga0207682_10024633 | Ga0207682_100246333 | 162 |
| 534 | 3300025901 | Ga0207688_10183712 | Ga0207688_101837122 | 162 |
| 535 | 3300025908 | Ga0207643_10007629 | Ga0207643_100076292 | 162 |
| 536 | 3300025910 | Ga0207684_10098891 | Ga0207684_100988913 | 162 |
| 537 | 3300025910 | Ga0207684_10126212 | Ga0207684_101262124 | 162 |
| 538 | 3300025910 | Ga0207684_10167442 | Ga0207684_101674422 | 162 |
| 539 | 3300025912 | Ga0207707_10261257 | Ga0207707_102612572 | 162 |
| 540 | 3300025921 | Ga0207652_10055337 | Ga0207652_100553372 | 162 |
| 541 | 3300025923 | Ga0207681_10488648 | Ga0207681_104886482 | 162 |
| 542 | 3300025925 | Ga0207650_11284864 | Ga0207650_112848641 | 162 |
| 543 | 3300025931 | Ga0207644_10166745 | Ga0207644_101667452 | 162 |
| 544 | 3300025934 | Ga0207686_10165660 | Ga0207686_101656601 | 162 |
| 545 | 3300025938 | Ga0207704_10407710 | Ga0207704_104077102 | 162 |
| 546 | 3300025940 | Ga0207691_10517493 | Ga0207691_105174932 | 162 |
| 547 | 3300025941 | Ga0207711_10215806 | Ga0207711_102158062 | 162 |
| 548 | 3300025944 | Ga0207661_10789797 | Ga0207661_107897972 | 162 |
| 549 | 3300025960 | Ga0207651_10629223 | Ga0207651_106292232 | 162 |
| 550 | 3300025972 | Ga0207668_10338096 | Ga0207668_103380962 | 162 |
| 551 | 3300026023 | Ga0207677_10231540 | Ga0207677_102315402 | 162 |
| 552 | 3300026035 | Ga0207703_10250399 | Ga0207703_102503992 | 162 |
| 553 | 3300026041 | Ga0207639_10259421 | Ga0207639_102594212 | 162 |
| 554 | 3300026067 | Ga0207678_10179040 | Ga0207678_101790402 | 162 |
| 555 | 3300026095 | Ga0207676_10588374 | Ga0207676_105883742 | 162 |
| 556 | 3300026116 | Ga0207674_10551097 | Ga0207674_105510971 | 162 |
| 557 | 3300026121 | Ga0207683_10691031 | Ga0207683_106910312 | 162 |
| 558 | 3300026142 | Ga0207698_10662793 | Ga0207698_106627932 | 162 |
| 559 | 3300027907 | Ga0207428_10002514 | Ga0207428_1000251413 | 162 |
| 560 | 3300028381 | Ga0268264_10424362 | Ga0268264_104243621 | 162 |
| 561 | 3300028577 | Ga0265318_10050404 | Ga0265318_100504042 | 162 |
| 562 | 3300028577 | Ga0265318_10149264 | Ga0265318_101492642 | 162 |
| 563 | 3300031238 | Ga0265332_10133399 | Ga0265332_101333992 | 162 |
| 564 | 3300031239 | Ga0265328_10003416 | Ga0265328_100034165 | 162 |
| 565 | 3300031240 | Ga0265320_10021332 | Ga0265320_100213325 | 162 |
| 566 | 3300031242 | Ga0265329_10019337 | Ga0265329_100193372 | 162 |
| 567 | 3300031249 | Ga0265339_10034852 | Ga0265339_100348523 | 162 |
| 568 | 3300031250 | Ga0265331_10004434 | Ga0265331_100044349 | 162 |
| 569 | 3300031344 | Ga0265316_10041874 | Ga0265316_100418743 | 162 |
| 570 | 3300031595 | Ga0265313_10044904 | Ga0265313_100449042 | 162 |
| 571 | 3300031711 | Ga0265314_10000245 | Ga0265314_1000024545 | 162 |
| 572 | 3300031712 | Ga0265342_10007670 | Ga0265342_100076704 | 162 |
| 573 | 3300031824 | Ga0307413_10036789 | Ga0307413_100367892 | 162 |
| 574 | 3300031995 | Ga0307409_100243044 | Ga0307409_1002430442 | 162 |
| 575 | 3300031995 | Ga0307409_100274323 | Ga0307409_1002743232 | 162 |
| 576 | 3300032005 | Ga0307411_10228757 | Ga0307411_102287571 | 162 |
| 577 | 3300032005 | Ga0307411_10262761 | Ga0307411_102627612 | 162 |
| 578 | 3300032126 | Ga0307415_100100576 | Ga0307415_1001005762 | 162 |
| 579 | 3300032126 | Ga0307415_100258270 | Ga0307415_1002582702 | 162 |
| 580 | 3300032126 | Ga0307415_100646664 | Ga0307415_1006466641 | 162 |
| 581 | 3300035171 | Ga0373946_0419147 | Ga0373946_0419147_40_528 | 162 |
| 582 | 3300035695 | Ga0373927_0032781 | Ga0373927_0032781_951_1439 | 162 |
| 583 | 3300035724 | Ga0373933_0071872 | Ga0373933_0071872_304_801 | 162 |
| 584 | 3300036401 | Ga0373937_0167403 | Ga0373937_0167403_1284_1781 | 162 |
| 585 | 3300037068 | Ga0373925_0361527 | Ga0373925_0361527_65_553 | 162 |
| 586 | 3300037418 | Ga0395900_0147511 | Ga0395900_0147511_671_1162 | 162 |
| 587 | 3300038443 | Ga0395901_0180064 | Ga0395901_0180064_1037_1528 | 162 |
| 588 | 3300039437 | Ga0436365_1097290 | Ga0436365_1097290_167_655 | 162 |
| 589 | 3300046472 | Ga0495580_0075522 | Ga0495580_0075522_1080_1568 | 162 |
| 590 | 3300046472 | Ga0495580_0270829 | Ga0495580_0270829_575_1063 | 162 |
| 591 | 3300046537 | Ga0495598_0211432 | Ga0495598_0211432_91_579 | 162 |
| 592 | 3300046539 | Ga0495621_0115474 | Ga0495621_0115474_451_951 | 162 |
| 593 | 3300046539 | Ga0495621_0174986 | Ga0495621_0174986_47_535 | 162 |
| 594 | 3300048904 | Ga0496101_0419498 | Ga0496101_0419498_214_702 | 162 |
| 595 | 3300048910 | Ga0496107_1001937 | Ga0496107_1001937_13_501 | 162 |
| 596 | 3300048914 | Ga0496111_0091997 | Ga0496111_0091997_798_1319 | 162 |
| 597 | 3300048915 | Ga0496112_0014201 | Ga0496112_0014201_3996_4517 | 162 |
| 598 | 3300048916 | Ga0496113_0401697 | Ga0496113_0401697_61_582 | 162 |
| 599 | 3300048917 | Ga0496114_1431973 | Ga0496114_1431973_48_536 | 162 |
| 600 | 3300048918 | Ga0496115_0248852 | Ga0496115_0248852_606_1094 | 162 |
| 601 | 3300049574 | Ga0501038_0743440 | Ga0501038_0743440_131_622 | 162 |
| 602 | 3300049575 | Ga0501039_0008184 | Ga0501039_0008184_241_729 | 162 |
| 603 | 3300049576 | Ga0501040_0092397 | Ga0501040_0092397_1278_1766 | 162 |
| 604 | 3300049578 | Ga0501042_0018299 | Ga0501042_0018299_2197_2685 | 162 |
| 605 | 3300049579 | Ga0501043_0419990 | Ga0501043_0419990_252_740 | 162 |
| 606 | 3300049583 | Ga0501067_0597602 | Ga0501067_0597602_55_546 | 162 |
| 607 | 3300049584 | Ga0501068_0275918 | Ga0501068_0275918_296_784 | 162 |
| 608 | 3300049587 | Ga0501071_0050832 | Ga0501071_0050832_1442_1930 | 162 |
| 609 | 3300049588 | Ga0501072_0192537 | Ga0501072_0192537_91_579 | 162 |
| 610 | 3300049592 | Ga0501076_0019562 | Ga0501076_0019562_2186_2674 | 162 |
| 611 | 3300049593 | Ga0501077_0163235 | Ga0501077_0163235_349_837 | 162 |
| 612 | 3300049741 | Ga0501079_0004210 | Ga0501079_0004210_5662_6150 | 162 |
| 613 | 3300049742 | Ga0501080_0219411 | Ga0501080_0219411_364_852 | 162 |
| 614 | 3300049743 | Ga0501081_0000465 | Ga0501081_0000465_19624_20112 | 162 |
| 615 | 3300049822 | Ga0501035_0274206 | Ga0501035_0274206_77_565 | 162 |
| 616 | 3300049824 | Ga0501045_0094485 | Ga0501045_0094485_1503_1991 | 162 |
| 617 | 3300050507 | nmdc:mga05p37_529398_c1 | nmdc:mga05p37_529398_c1_548_1036 | 162 |
| 618 | 3300050508 | nmdc:mga09592_276772_c1 | nmdc:mga09592_276772_c1_52_540 | 162 |
| 619 | 3300050509 | nmdc:mga0qj67_983108_c1 | nmdc:mga0qj67_983108_c1_105_593 | 162 |
| 620 | 3300050510 | nmdc:mga06r32_1014_c1 | nmdc:mga06r32_1014_c1_9512_10000 | 162 |
| 621 | 3300050512 | nmdc:mga0n895_163087_c1 | nmdc:mga0n895_163087_c1_263_751 | 162 |
| 622 | 3300050512 | nmdc:mga0n895_438924_c1 | nmdc:mga0n895_438924_c1_31_519 | 162 |
| 623 | 3300050513 | nmdc:mga0rr50_148782_c1 | nmdc:mga0rr50_148782_c1_1256_1744 | 162 |
| 624 | 3300050513 | nmdc:mga0rr50_152767_c1 | nmdc:mga0rr50_152767_c1_1069_1557 | 162 |
| 625 | 3300050513 | nmdc:mga0rr50_244584_c1 | nmdc:mga0rr50_244584_c1_818_1306 | 162 |
| 626 | 3300050515 | nmdc:mga0a205_132541_c2 | nmdc:mga0a205_132541_c2_143_631 | 162 |
| 627 | 3300050515 | nmdc:mga0a205_363219_c1 | nmdc:mga0a205_363219_c1_25_531 | 162 |
| 628 | 3300053084 | Ga0495595_0370250 | Ga0495595_0370250_213_710 | 162 |
| 629 | 3300053085 | Ga0495619_0087963 | Ga0495619_0087963_87_584 | 162 |
| 630 | 3300060353 | Ga0501082_0004016 | Ga0501082_0004016_1732_2220 | 162 |
| 631 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001655 | 163 |
| 632 | 3300002772 | JGI25164J39214_1007850 | JGI25164J39214_10078502 | 163 |
| 633 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001639 | 163 |
| 634 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001395 | 163 |
| 635 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001395 | 163 |
| 636 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003639 | 163 |
| 637 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003639 | 163 |
| 638 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001639 | 163 |
| 639 | 3300005336 | Ga0070680_100249515 | Ga0070680_1002495152 | 163 |
| 640 | 3300005355 | Ga0070671_100163977 | Ga0070671_1001639772 | 163 |
| 641 | 3300005364 | Ga0070673_100396102 | Ga0070673_1003961022 | 163 |
| 642 | 3300005364 | Ga0070673_100937619 | Ga0070673_1009376192 | 163 |
| 643 | 3300005367 | Ga0070667_100078305 | Ga0070667_1000783052 | 163 |
| 644 | 3300005441 | Ga0070700_100001013 | Ga0070700_10000101310 | 163 |
| 645 | 3300005456 | Ga0070678_100105868 | Ga0070678_1001058682 | 163 |
| 646 | 3300005548 | Ga0070665_100034082 | Ga0070665_1000340827 | 163 |
| 647 | 3300005718 | Ga0068866_10365037 | Ga0068866_103650371 | 163 |
| 648 | 3300005719 | Ga0068861_100022064 | Ga0068861_1000220643 | 163 |
| 649 | 3300006028 | Ga0070717_10187237 | Ga0070717_101872372 | 163 |
| 650 | 3300006175 | Ga0070712_100034746 | Ga0070712_1000347464 | 163 |
| 651 | 3300006237 | Ga0097621_100167357 | Ga0097621_1001673573 | 163 |
| 652 | 3300006358 | Ga0068871_100261839 | Ga0068871_1002618392 | 163 |
| 653 | 3300007265 | Ga0099794_10043650 | Ga0099794_100436503 | 163 |
| 654 | 3300009098 | Ga0105245_10000207 | Ga0105245_1000020717 | 163 |
| 655 | 3300009174 | Ga0105241_10934072 | Ga0105241_109340721 | 163 |
| 656 | 3300013105 | Ga0157369_10719551 | Ga0157369_107195512 | 163 |
| 657 | 3300013307 | Ga0157372_11018966 | Ga0157372_110189662 | 163 |
| 658 | 3300014326 | Ga0157380_11375449 | Ga0157380_113754492 | 163 |
| 659 | 3300014969 | Ga0157376_10069688 | Ga0157376_100696883 | 163 |
| 660 | 3300015261 | Ga0182006_1032825 | Ga0182006_10328252 | 163 |
| 661 | 3300015262 | Ga0182007_10050203 | Ga0182007_100502032 | 163 |
| 662 | 3300015265 | Ga0182005_1013443 | Ga0182005_10134432 | 163 |
| 663 | 3300025207 | Ga0209760_101465 | Ga0209760_1014653 | 163 |
| 664 | 3300025907 | Ga0207645_10602803 | Ga0207645_106028032 | 163 |
| 665 | 3300025908 | Ga0207643_10011915 | Ga0207643_100119152 | 163 |
| 666 | 3300025915 | Ga0207693_10046169 | Ga0207693_100461694 | 163 |
| 667 | 3300025935 | Ga0207709_10003546 | Ga0207709_100035469 | 163 |
| 668 | 3300025937 | Ga0207669_11048761 | Ga0207669_110487611 | 163 |
| 669 | 3300025940 | Ga0207691_10080128 | Ga0207691_100801282 | 163 |
| 670 | 3300025972 | Ga0207668_10140898 | Ga0207668_101408982 | 163 |
| 671 | 3300025986 | Ga0207658_10052812 | Ga0207658_100528122 | 163 |
| 672 | 3300026023 | Ga0207677_10045023 | Ga0207677_100450233 | 163 |
| 673 | 3300026118 | Ga0207675_100001059 | Ga0207675_10000105927 | 163 |
| 674 | 3300026121 | Ga0207683_10023679 | Ga0207683_100236797 | 163 |
| 675 | 3300028379 | Ga0268266_10008592 | Ga0268266_100085924 | 163 |
| 676 | 3300032004 | Ga0307414_10461762 | Ga0307414_104617622 | 163 |
| 677 | 3300035170 | Ga0373943_0220334 | Ga0373943_0220334_325_816 | 163 |
| 678 | 3300035692 | Ga0373935_0231964 | Ga0373935_0231964_760_1251 | 163 |
| 679 | 3300046454 | Ga0495592_0029233 | Ga0495592_0029233_2357_2848 | 163 |
| 680 | 3300046462 | Ga0495651_0010022 | Ga0495651_0010022_3902_4393 | 163 |
| 681 | 3300046462 | Ga0495651_0070933 | Ga0495651_0070933_1511_2002 | 163 |
| 682 | 3300046463 | Ga0495653_0006836 | Ga0495653_0006836_1746_2237 | 163 |
| 683 | 3300046501 | Ga0495607_0049730 | Ga0495607_0049730_126_617 | 163 |
| 684 | 3300046507 | Ga0495606_0000011 | Ga0495606_0000011_21331_21822 | 163 |
| 685 | 3300046511 | Ga0495608_0042788 | Ga0495608_0042788_2166_2657 | 163 |
| 686 | 3300046514 | Ga0495618_0215600 | Ga0495618_0215600_168_659 | 163 |
| 687 | 3300046516 | Ga0495628_0002021 | Ga0495628_0002021_14827_15318 | 163 |
| 688 | 3300046516 | Ga0495628_0120479 | Ga0495628_0120479_680_1171 | 163 |
| 689 | 3300046529 | Ga0495652_0021112 | Ga0495652_0021112_1163_1654 | 163 |
| 690 | 3300046529 | Ga0495652_0069034 | Ga0495652_0069034_2361_2852 | 163 |
| 691 | 3300046543 | Ga0495645_0057856 | Ga0495645_0057856_1326_1817 | 163 |
| 692 | 3300046557 | Ga0495622_0074613 | Ga0495622_0074613_725_1216 | 163 |
| 693 | 3300046675 | Ga0495657_0068721 | Ga0495657_0068721_1765_2256 | 163 |
| 694 | 3300046678 | Ga0495599_0026654 | Ga0495599_0026654_769_1260 | 163 |
| 695 | 3300046679 | Ga0495623_0047566 | Ga0495623_0047566_719_1210 | 163 |
| 696 | 3300046809 | Ga0495600_0000916 | Ga0495600_0000916_3693_4184 | 163 |
| 697 | 3300047317 | Ga0495604_0085018 | Ga0495604_0085018_1105_1596 | 163 |
| 698 | 3300047472 | Ga0495686_0000248 | Ga0495686_0000248_16566_17057 | 163 |
| 699 | 3300047472 | Ga0495686_0044312 | Ga0495686_0044312_1820_2311 | 163 |
| 700 | 3300048088 | Ga0495602_0078562 | Ga0495602_0078562_1104_1595 | 163 |
| 701 | 3300048088 | Ga0495602_0539921 | Ga0495602_0539921_245_736 | 163 |
| 702 | 3300048905 | Ga0496102_1575481 | Ga0496102_1575481_18_509 | 163 |
| 703 | 3300049574 | Ga0501038_0124809 | Ga0501038_0124809_1504_1995 | 163 |
| 704 | 3300049822 | Ga0501035_0010038 | Ga0501035_0010038_7062_7553 | 163 |
| 705 | 3300049822 | Ga0501035_0161001 | Ga0501035_0161001_376_867 | 163 |
| 706 | 3300049823 | Ga0501044_0000076 | Ga0501044_0000076_77761_78252 | 163 |
| 707 | 3300049823 | Ga0501044_0012028 | Ga0501044_0012028_1260_1751 | 163 |
| 708 | 3300053077 | Ga0495601_0045721 | Ga0495601_0045721_829_1320 | 163 |
| 709 | 3300053119 | Ga0500595_012640 | Ga0500595_012640_1648_2139 | 163 |
| 710 | 3300053141 | Ga0500574_009516 | Ga0500574_009516_677_1168 | 163 |
| 711 | 3300005334 | Ga0068869_101347236 | Ga0068869_1013472361 | 164 |
| 712 | 3300005367 | Ga0070667_101163169 | Ga0070667_1011631691 | 164 |
| 713 | 3300005467 | Ga0070706_100201743 | Ga0070706_1002017432 | 164 |
| 714 | 3300005548 | Ga0070665_101355487 | Ga0070665_1013554872 | 164 |
| 715 | 3300013297 | Ga0157378_10859028 | Ga0157378_108590281 | 164 |
| 716 | 3300025936 | Ga0207670_11144842 | Ga0207670_111448421 | 164 |
| 717 | 3300035112 | Ga0373932_0067634 | Ga0373932_0067634_371_868 | 164 |
| 718 | 3300035114 | Ga0373939_0144472 | Ga0373939_0144472_96_593 | 164 |
| 719 | 3300035207 | Ga0373942_0105566 | Ga0373942_0105566_250_747 | 164 |
| 720 | 3300035241 | Ga0373961_0102214 | Ga0373961_0102214_102_599 | 164 |
| 721 | 3300042005 | Ga0439448_0120657 | Ga0439448_0120657_396_890 | 164 |
| 722 | 3300046539 | Ga0495621_0133107 | Ga0495621_0133107_153_650 | 164 |
| 723 | 3300049590 | Ga0501074_0732549 | Ga0501074_0732549_151_645 | 164 |
| 724 | 3300054114 | Ga0501084_0599129 | Ga0501084_0599129_387_881 | 164 |
| 725 | 3300006871 | Ga0075434_100497625 | Ga0075434_1004976252 | 165 |
| 726 | 3300009098 | Ga0105245_10410722 | Ga0105245_104107222 | 165 |
| 727 | 3300013308 | Ga0157375_11503106 | Ga0157375_115031061 | 165 |
| 728 | 3300025927 | Ga0207687_10547113 | Ga0207687_105471132 | 165 |
| 729 | 3300031238 | Ga0265332_10000293 | Ga0265332_1000029333 | 165 |
| 730 | 3300031241 | Ga0265325_10011509 | Ga0265325_100115094 | 165 |
| 731 | 3300031242 | Ga0265329_10015880 | Ga0265329_100158803 | 165 |
| 732 | 3300031249 | Ga0265339_10080478 | Ga0265339_100804782 | 165 |
| 733 | 3300031250 | Ga0265331_10000348 | Ga0265331_1000034833 | 165 |
| 734 | 3300031251 | Ga0265327_10128619 | Ga0265327_101286192 | 165 |
| 735 | 3300031344 | Ga0265316_10018947 | Ga0265316_100189474 | 165 |
| 736 | 3300031711 | Ga0265314_10028151 | Ga0265314_100281513 | 165 |
| 737 | 3300035241 | Ga0373961_0069131 | Ga0373961_0069131_336_857 | 165 |
| 738 | 3300049585 | Ga0501069_0719078 | Ga0501069_0719078_35_535 | 165 |
| 739 | 3300035092 | Ga0373952_0012716 | Ga0373952_0012716_159_662 | 166 |
| 740 | 3300053084 | Ga0495595_0547639 | Ga0495595_0547639_56_568 | 166 |
| 741 | 3300005328 | Ga0070676_10000072 | Ga0070676_1000007220 | 167 |
| 742 | 3300005333 | Ga0070677_10000170 | Ga0070677_100001703 | 167 |
| 743 | 3300005334 | Ga0068869_100153654 | Ga0068869_1001536542 | 167 |
| 744 | 3300005335 | Ga0070666_10006410 | Ga0070666_100064103 | 167 |
| 745 | 3300005338 | Ga0068868_100027054 | Ga0068868_1000270544 | 167 |
| 746 | 3300005345 | Ga0070692_10461690 | Ga0070692_104616902 | 167 |
| 747 | 3300005347 | Ga0070668_100035176 | Ga0070668_1000351763 | 167 |
| 748 | 3300005353 | Ga0070669_100420649 | Ga0070669_1004206492 | 167 |
| 749 | 3300005354 | Ga0070675_100000543 | Ga0070675_1000005433 | 167 |
| 750 | 3300005355 | Ga0070671_100020291 | Ga0070671_1000202919 | 167 |
| 751 | 3300005355 | Ga0070671_100027112 | Ga0070671_1000271123 | 167 |
| 752 | 3300005356 | Ga0070674_100002257 | Ga0070674_1000022572 | 167 |
| 753 | 3300005364 | Ga0070673_100000251 | Ga0070673_1000002515 | 167 |
| 754 | 3300005365 | Ga0070688_100224327 | Ga0070688_1002243272 | 167 |
| 755 | 3300005367 | Ga0070667_100065246 | Ga0070667_1000652463 | 167 |
| 756 | 3300005367 | Ga0070667_100184789 | Ga0070667_1001847892 | 167 |
| 757 | 3300005367 | Ga0070667_100214808 | Ga0070667_1002148082 | 167 |
| 758 | 3300005455 | Ga0070663_100277780 | Ga0070663_1002777802 | 167 |
| 759 | 3300005456 | Ga0070678_100014041 | Ga0070678_1000140413 | 167 |
| 760 | 3300005457 | Ga0070662_100099536 | Ga0070662_1000995362 | 167 |
| 761 | 3300005459 | Ga0068867_100168931 | Ga0068867_1001689313 | 167 |
| 762 | 3300005539 | Ga0068853_100082344 | Ga0068853_1000823442 | 167 |
| 763 | 3300005543 | Ga0070672_100000757 | Ga0070672_10000075717 | 167 |
| 764 | 3300005548 | Ga0070665_100002227 | Ga0070665_1000022274 | 167 |
| 765 | 3300005615 | Ga0070702_100623315 | Ga0070702_1006233152 | 167 |
| 766 | 3300005616 | Ga0068852_100009278 | Ga0068852_1000092786 | 167 |
| 767 | 3300005617 | Ga0068859_100421609 | Ga0068859_1004216093 | 167 |
| 768 | 3300005618 | Ga0068864_100018582 | Ga0068864_1000185829 | 167 |
| 769 | 3300005719 | Ga0068861_100150212 | Ga0068861_1001502123 | 167 |
| 770 | 3300005834 | Ga0068851_10022458 | Ga0068851_100224583 | 167 |
| 771 | 3300005840 | Ga0068870_10027240 | Ga0068870_100272403 | 167 |
| 772 | 3300005841 | Ga0068863_100034144 | Ga0068863_1000341443 | 167 |
| 773 | 3300005842 | Ga0068858_100001243 | Ga0068858_10000124322 | 167 |
| 774 | 3300005842 | Ga0068858_100759951 | Ga0068858_1007599512 | 167 |
| 775 | 3300006237 | Ga0097621_100022358 | Ga0097621_1000223583 | 167 |
| 776 | 3300006358 | Ga0068871_100004365 | Ga0068871_10000436513 | 167 |
| 777 | 3300006881 | Ga0068865_100118585 | Ga0068865_1001185852 | 167 |
| 778 | 3300006931 | Ga0097620_100421603 | Ga0097620_1004216032 | 167 |
| 779 | 3300009177 | Ga0105248_10315991 | Ga0105248_103159913 | 167 |
| 780 | 3300013308 | Ga0157375_10042038 | Ga0157375_100420383 | 167 |
| 781 | 3300014968 | Ga0157379_10365806 | Ga0157379_103658062 | 167 |
| 782 | 3300017792 | Ga0163161_10039723 | Ga0163161_100397233 | 167 |
| 783 | 3300025225 | Ga0209566_100004 | Ga0209566_100004791 | 167 |
| 784 | 3300025226 | Ga0209674_100006 | Ga0209674_100006791 | 167 |
| 785 | 3300025230 | Ga0209563_100009 | Ga0209563_100009634 | 167 |
| 786 | 3300025231 | Ga0207427_100293 | Ga0207427_1002936 | 167 |
| 787 | 3300025233 | Ga0209437_100004 | Ga0209437_100004634 | 167 |
| 788 | 3300025253 | Ga0209677_100005 | Ga0209677_100005634 | 167 |
| 789 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005791 | 167 |
| 790 | 3300025321 | Ga0207656_10001172 | Ga0207656_100011722 | 167 |
| 791 | 3300025893 | Ga0207682_10040949 | Ga0207682_100409492 | 167 |
| 792 | 3300025901 | Ga0207688_10172243 | Ga0207688_101722432 | 167 |
| 793 | 3300025903 | Ga0207680_10246988 | Ga0207680_102469882 | 167 |
| 794 | 3300025907 | Ga0207645_10000686 | Ga0207645_1000068620 | 167 |
| 795 | 3300025908 | Ga0207643_10027879 | Ga0207643_100278793 | 167 |
| 796 | 3300025923 | Ga0207681_10062298 | Ga0207681_100622983 | 167 |
| 797 | 3300025924 | Ga0207694_10982735 | Ga0207694_109827352 | 167 |
| 798 | 3300025925 | Ga0207650_10203115 | Ga0207650_102031152 | 167 |
| 799 | 3300025926 | Ga0207659_10027966 | Ga0207659_100279663 | 167 |
| 800 | 3300025931 | Ga0207644_10009912 | Ga0207644_100099123 | 167 |
| 801 | 3300025931 | Ga0207644_10049097 | Ga0207644_100490973 | 167 |
| 802 | 3300025933 | Ga0207706_10098770 | Ga0207706_100987703 | 167 |
| 803 | 3300025937 | Ga0207669_10085486 | Ga0207669_100854862 | 167 |
| 804 | 3300025940 | Ga0207691_10000367 | Ga0207691_1000036721 | 167 |
| 805 | 3300025941 | Ga0207711_10332300 | Ga0207711_103323002 | 167 |
| 806 | 3300025942 | Ga0207689_10090458 | Ga0207689_100904582 | 167 |
| 807 | 3300025960 | Ga0207651_10001584 | Ga0207651_1000158411 | 167 |
| 808 | 3300025972 | Ga0207668_10026322 | Ga0207668_100263223 | 167 |
| 809 | 3300025981 | Ga0207640_10052298 | Ga0207640_100522983 | 167 |
| 810 | 3300025986 | Ga0207658_10041343 | Ga0207658_100413433 | 167 |
| 811 | 3300025986 | Ga0207658_10243630 | Ga0207658_102436303 | 167 |
| 812 | 3300026023 | Ga0207677_10062363 | Ga0207677_100623633 | 167 |
| 813 | 3300026023 | Ga0207677_10640560 | Ga0207677_106405602 | 167 |
| 814 | 3300026035 | Ga0207703_10004881 | Ga0207703_100048814 | 167 |
| 815 | 3300026041 | Ga0207639_10016008 | Ga0207639_100160083 | 167 |
| 816 | 3300026088 | Ga0207641_10074117 | Ga0207641_100741173 | 167 |
| 817 | 3300026089 | Ga0207648_10208856 | Ga0207648_102088563 | 167 |
| 818 | 3300026095 | Ga0207676_10014818 | Ga0207676_100148184 | 167 |
| 819 | 3300026118 | Ga0207675_100029308 | Ga0207675_1000293088 | 167 |
| 820 | 3300026121 | Ga0207683_10000246 | Ga0207683_1000024623 | 167 |
| 821 | 3300026142 | Ga0207698_10046357 | Ga0207698_100463573 | 167 |
| 822 | 3300028379 | Ga0268266_10006669 | Ga0268266_100066694 | 167 |
| 823 | 3300028379 | Ga0268266_10231835 | Ga0268266_102318352 | 167 |
| 824 | 3300046529 | Ga0495652_0065263 | Ga0495652_0065263_1353_1856 | 167 |
| 825 | 3300046680 | Ga0495646_0014979 | Ga0495646_0014979_2930_3433 | 167 |
| 826 | 3300005468 | Ga0070707_100031454 | Ga0070707_1000314548 | 168 |
| 827 | 3300005471 | Ga0070698_100118004 | Ga0070698_1001180042 | 168 |
| 828 | 3300005518 | Ga0070699_100191200 | Ga0070699_1001912002 | 168 |
| 829 | 3300005546 | Ga0070696_100380670 | Ga0070696_1003806702 | 168 |
| 830 | 3300025922 | Ga0207646_10470666 | Ga0207646_104706662 | 168 |
| 831 | 3300044673 | Ga0453683_0497285 | Ga0453683_0497285_115_621 | 168 |
| 832 | 3300005458 | Ga0070681_10013221 | Ga0070681_100132218 | 169 |
| 833 | 3300005530 | Ga0070679_100128718 | Ga0070679_1001287181 | 169 |
| 834 | 3300005539 | Ga0068853_100004519 | Ga0068853_1000045193 | 169 |
| 835 | 3300005547 | Ga0070693_100081645 | Ga0070693_1000816452 | 169 |
| 836 | 3300005548 | Ga0070665_100686800 | Ga0070665_1006868002 | 169 |
| 837 | 3300005563 | Ga0068855_101143808 | Ga0068855_1011438081 | 169 |
| 838 | 3300005564 | Ga0070664_100160350 | Ga0070664_1001603502 | 169 |
| 839 | 3300005577 | Ga0068857_100096584 | Ga0068857_1000965843 | 169 |
| 840 | 3300005616 | Ga0068852_100160391 | Ga0068852_1001603912 | 169 |
| 841 | 3300005719 | Ga0068861_100813762 | Ga0068861_1008137622 | 169 |
| 842 | 3300006358 | Ga0068871_100551525 | Ga0068871_1005515252 | 169 |
| 843 | 3300009174 | Ga0105241_10217483 | Ga0105241_102174832 | 169 |
| 844 | 3300009545 | Ga0105237_10527742 | Ga0105237_105277422 | 169 |
| 845 | 3300010375 | Ga0105239_10373346 | Ga0105239_103733462 | 169 |
| 846 | 3300013308 | Ga0157375_10436880 | Ga0157375_104368802 | 169 |
| 847 | 3300014326 | Ga0157380_10573010 | Ga0157380_105730102 | 169 |
| 848 | 3300025893 | Ga0207682_10233052 | Ga0207682_102330522 | 169 |
| 849 | 3300025911 | Ga0207654_10148730 | Ga0207654_101487302 | 169 |
| 850 | 3300025912 | Ga0207707_10026843 | Ga0207707_100268433 | 169 |
| 851 | 3300025914 | Ga0207671_10013515 | Ga0207671_100135152 | 169 |
| 852 | 3300025921 | Ga0207652_10355688 | Ga0207652_103556882 | 169 |
| 853 | 3300025937 | Ga0207669_10088399 | Ga0207669_100883992 | 169 |
| 854 | 3300025949 | Ga0207667_10243928 | Ga0207667_102439282 | 169 |
| 855 | 3300025972 | Ga0207668_10064287 | Ga0207668_100642872 | 169 |
| 856 | 3300026041 | Ga0207639_10030737 | Ga0207639_100307373 | 169 |
| 857 | 3300026067 | Ga0207678_10261753 | Ga0207678_102617532 | 169 |
| 858 | 3300026089 | Ga0207648_10059692 | Ga0207648_100596922 | 169 |
| 859 | 3300026116 | Ga0207674_10065150 | Ga0207674_100651503 | 169 |
| 860 | 3300026118 | Ga0207675_100274530 | Ga0207675_1002745302 | 169 |
| 861 | 3300028379 | Ga0268266_10370436 | Ga0268266_103704362 | 169 |
| 862 | 3300048905 | Ga0496102_1080148 | Ga0496102_1080148_111_632 | 169 |
| 863 | 3300048913 | Ga0496110_1470886 | Ga0496110_1470886_45_566 | 169 |
| 864 | 3300005355 | Ga0070671_100346000 | Ga0070671_1003460002 | 170 |
| 865 | 3300026121 | Ga0207683_11262684 | Ga0207683_112626841 | 170 |
| 866 | 3300005331 | Ga0070670_100262774 | Ga0070670_1002627741 | 171 |
| 867 | 3300005334 | Ga0068869_100338471 | Ga0068869_1003384712 | 171 |
| 868 | 3300005436 | Ga0070713_100000033 | Ga0070713_10000003343 | 171 |
| 869 | 3300005617 | Ga0068859_100344804 | Ga0068859_1003448042 | 171 |
| 870 | 3300005618 | Ga0068864_100085019 | Ga0068864_1000850194 | 171 |
| 871 | 3300005843 | Ga0068860_100486951 | Ga0068860_1004869512 | 171 |
| 872 | 3300006931 | Ga0097620_100344820 | Ga0097620_1003448202 | 171 |
| 873 | 3300009098 | Ga0105245_10123931 | Ga0105245_101239312 | 171 |
| 874 | 3300009177 | Ga0105248_11851306 | Ga0105248_118513062 | 171 |
| 875 | 3300013306 | Ga0163162_10690853 | Ga0163162_106908532 | 171 |
| 876 | 3300025925 | Ga0207650_10196981 | Ga0207650_101969812 | 171 |
| 877 | 3300025928 | Ga0207700_10000099 | Ga0207700_1000009942 | 171 |
| 878 | 3300025940 | Ga0207691_10305182 | Ga0207691_103051822 | 171 |
| 879 | 3300025942 | Ga0207689_10284134 | Ga0207689_102841342 | 171 |
| 880 | 3300026023 | Ga0207677_10296131 | Ga0207677_102961312 | 171 |
| 881 | 3300026095 | Ga0207676_10162303 | Ga0207676_101623032 | 171 |
| 882 | 3300028381 | Ga0268264_10481944 | Ga0268264_104819442 | 171 |
| 883 | 3300048916 | Ga0496113_0298344 | Ga0496113_0298344_682_1218 | 171 |
| 884 | 3300002239 | JGI24034J26672_10025931 | JGI24034J26672_100259312 | 172 |
| 885 | 3300005293 | Ga0065715_10561781 | Ga0065715_105617812 | 172 |
| 886 | 3300005328 | Ga0070676_10149977 | Ga0070676_101499771 | 172 |
| 887 | 3300005329 | Ga0070683_100161839 | Ga0070683_1001618393 | 172 |
| 888 | 3300005330 | Ga0070690_100002867 | Ga0070690_1000028674 | 172 |
| 889 | 3300005331 | Ga0070670_100096413 | Ga0070670_1000964132 | 172 |
| 890 | 3300005331 | Ga0070670_101264614 | Ga0070670_1012646141 | 172 |
| 891 | 3300005334 | Ga0068869_100013977 | Ga0068869_1000139774 | 172 |
| 892 | 3300005335 | Ga0070666_10007649 | Ga0070666_100076493 | 172 |
| 893 | 3300005336 | Ga0070680_100124951 | Ga0070680_1001249512 | 172 |
| 894 | 3300005337 | Ga0070682_100289267 | Ga0070682_1002892672 | 172 |
| 895 | 3300005338 | Ga0068868_100117644 | Ga0068868_1001176443 | 172 |
| 896 | 3300005338 | Ga0068868_100297177 | Ga0068868_1002971772 | 172 |
| 897 | 3300005339 | Ga0070660_100025820 | Ga0070660_1000258203 | 172 |
| 898 | 3300005340 | Ga0070689_100054677 | Ga0070689_1000546773 | 172 |
| 899 | 3300005341 | Ga0070691_10207235 | Ga0070691_102072352 | 172 |
| 900 | 3300005343 | Ga0070687_100241755 | Ga0070687_1002417552 | 172 |
| 901 | 3300005344 | Ga0070661_100219671 | Ga0070661_1002196712 | 172 |
| 902 | 3300005355 | Ga0070671_100187344 | Ga0070671_1001873442 | 172 |
| 903 | 3300005355 | Ga0070671_101440471 | Ga0070671_1014404711 | 172 |
| 904 | 3300005356 | Ga0070674_100075380 | Ga0070674_1000753803 | 172 |
| 905 | 3300005364 | Ga0070673_100009977 | Ga0070673_1000099776 | 172 |
| 906 | 3300005365 | Ga0070688_100001386 | Ga0070688_10000138610 | 172 |
| 907 | 3300005366 | Ga0070659_100073192 | Ga0070659_1000731922 | 172 |
| 908 | 3300005367 | Ga0070667_100369281 | Ga0070667_1003692813 | 172 |
| 909 | 3300005434 | Ga0070709_10143754 | Ga0070709_101437542 | 172 |
| 910 | 3300005435 | Ga0070714_100199160 | Ga0070714_1001991602 | 172 |
| 911 | 3300005436 | Ga0070713_100020841 | Ga0070713_1000208414 | 172 |
| 912 | 3300005436 | Ga0070713_100023278 | Ga0070713_1000232783 | 172 |
| 913 | 3300005437 | Ga0070710_10162844 | Ga0070710_101628442 | 172 |
| 914 | 3300005438 | Ga0070701_10159993 | Ga0070701_101599933 | 172 |
| 915 | 3300005439 | Ga0070711_100011100 | Ga0070711_1000111002 | 172 |
| 916 | 3300005440 | Ga0070705_100036353 | Ga0070705_1000363532 | 172 |
| 917 | 3300005440 | Ga0070705_100153212 | Ga0070705_1001532123 | 172 |
| 918 | 3300005444 | Ga0070694_100035603 | Ga0070694_1000356033 | 172 |
| 919 | 3300005445 | Ga0070708_100021761 | Ga0070708_1000217613 | 172 |
| 920 | 3300005455 | Ga0070663_100905767 | Ga0070663_1009057671 | 172 |
| 921 | 3300005456 | Ga0070678_100327823 | Ga0070678_1003278232 | 172 |
| 922 | 3300005457 | Ga0070662_100045566 | Ga0070662_1000455663 | 172 |
| 923 | 3300005459 | Ga0068867_100087960 | Ga0068867_1000879602 | 172 |
| 924 | 3300005466 | Ga0070685_10001553 | Ga0070685_1000155312 | 172 |
| 925 | 3300005468 | Ga0070707_100099482 | Ga0070707_1000994822 | 172 |
| 926 | 3300005471 | Ga0070698_100111856 | Ga0070698_1001118563 | 172 |
| 927 | 3300005530 | Ga0070679_100072479 | Ga0070679_1000724791 | 172 |
| 928 | 3300005536 | Ga0070697_100242523 | Ga0070697_1002425232 | 172 |
| 929 | 3300005539 | Ga0068853_100436885 | Ga0068853_1004368852 | 172 |
| 930 | 3300005544 | Ga0070686_100823400 | Ga0070686_1008234002 | 172 |
| 931 | 3300005546 | Ga0070696_100024455 | Ga0070696_1000244553 | 172 |
| 932 | 3300005547 | Ga0070693_100034357 | Ga0070693_1000343572 | 172 |
| 933 | 3300005548 | Ga0070665_100004533 | Ga0070665_1000045339 | 172 |
| 934 | 3300005578 | Ga0068854_100003089 | Ga0068854_1000030893 | 172 |
| 935 | 3300005578 | Ga0068854_100068470 | Ga0068854_1000684703 | 172 |
| 936 | 3300005614 | Ga0068856_100030254 | Ga0068856_1000302544 | 172 |
| 937 | 3300005615 | Ga0070702_100267918 | Ga0070702_1002679182 | 172 |
| 938 | 3300005616 | Ga0068852_100060431 | Ga0068852_1000604313 | 172 |
| 939 | 3300005616 | Ga0068852_100197030 | Ga0068852_1001970303 | 172 |
| 940 | 3300005617 | Ga0068859_100001101 | Ga0068859_10000110113 | 172 |
| 941 | 3300005618 | Ga0068864_100001698 | Ga0068864_10000169816 | 172 |
| 942 | 3300005618 | Ga0068864_100015530 | Ga0068864_1000155303 | 172 |
| 943 | 3300005718 | Ga0068866_10023568 | Ga0068866_100235683 | 172 |
| 944 | 3300005719 | Ga0068861_100924498 | Ga0068861_1009244982 | 172 |
| 945 | 3300005834 | Ga0068851_10062919 | Ga0068851_100629192 | 172 |
| 946 | 3300005840 | Ga0068870_10012793 | Ga0068870_100127933 | 172 |
| 947 | 3300005841 | Ga0068863_100027522 | Ga0068863_1000275229 | 172 |
| 948 | 3300005841 | Ga0068863_100031027 | Ga0068863_1000310272 | 172 |
| 949 | 3300005842 | Ga0068858_100001448 | Ga0068858_10000144820 | 172 |
| 950 | 3300005842 | Ga0068858_101395383 | Ga0068858_1013953832 | 172 |
| 951 | 3300005843 | Ga0068860_100483451 | Ga0068860_1004834512 | 172 |
| 952 | 3300006163 | Ga0070715_10107151 | Ga0070715_101071512 | 172 |
| 953 | 3300006175 | Ga0070712_100120470 | Ga0070712_1001204702 | 172 |
| 954 | 3300006237 | Ga0097621_100396827 | Ga0097621_1003968272 | 172 |
| 955 | 3300006237 | Ga0097621_100649972 | Ga0097621_1006499722 | 172 |
| 956 | 3300006358 | Ga0068871_100739535 | Ga0068871_1007395352 | 172 |
| 957 | 3300006871 | Ga0075434_101138293 | Ga0075434_1011382932 | 172 |
| 958 | 3300006881 | Ga0068865_100342468 | Ga0068865_1003424682 | 172 |
| 959 | 3300006931 | Ga0097620_100001101 | Ga0097620_10000110117 | 172 |
| 960 | 3300009011 | Ga0105251_10242635 | Ga0105251_102426351 | 172 |
| 961 | 3300009093 | Ga0105240_10603196 | Ga0105240_106031962 | 172 |
| 962 | 3300009098 | Ga0105245_10383677 | Ga0105245_103836772 | 172 |
| 963 | 3300009098 | Ga0105245_10460184 | Ga0105245_104601842 | 172 |
| 964 | 3300009098 | Ga0105245_10817410 | Ga0105245_108174101 | 172 |
| 965 | 3300009101 | Ga0105247_10044964 | Ga0105247_100449642 | 172 |
| 966 | 3300009174 | Ga0105241_10167204 | Ga0105241_101672041 | 172 |
| 967 | 3300009176 | Ga0105242_10697852 | Ga0105242_106978521 | 172 |
| 968 | 3300009545 | Ga0105237_10265601 | Ga0105237_102656013 | 172 |
| 969 | 3300009551 | Ga0105238_10146803 | Ga0105238_101468033 | 172 |
| 970 | 3300009551 | Ga0105238_10829145 | Ga0105238_108291452 | 172 |
| 971 | 3300009553 | Ga0105249_11002136 | Ga0105249_110021362 | 172 |
| 972 | 3300010375 | Ga0105239_10166516 | Ga0105239_101665162 | 172 |
| 973 | 3300010375 | Ga0105239_11667005 | Ga0105239_116670052 | 172 |
| 974 | 3300011119 | Ga0105246_10062859 | Ga0105246_100628592 | 172 |
| 975 | 3300011119 | Ga0105246_10189276 | Ga0105246_101892763 | 172 |
| 976 | 3300013100 | Ga0157373_10311327 | Ga0157373_103113272 | 172 |
| 977 | 3300013102 | Ga0157371_10250382 | Ga0157371_102503822 | 172 |
| 978 | 3300013104 | Ga0157370_10266430 | Ga0157370_102664302 | 172 |
| 979 | 3300013105 | Ga0157369_10037398 | Ga0157369_100373984 | 172 |
| 980 | 3300013296 | Ga0157374_10014294 | Ga0157374_100142947 | 172 |
| 981 | 3300013297 | Ga0157378_10208931 | Ga0157378_102089312 | 172 |
| 982 | 3300013297 | Ga0157378_10712517 | Ga0157378_107125172 | 172 |
| 983 | 3300013306 | Ga0163162_10306385 | Ga0163162_103063852 | 172 |
| 984 | 3300013306 | Ga0163162_10585527 | Ga0163162_105855272 | 172 |
| 985 | 3300013307 | Ga0157372_10098712 | Ga0157372_100987123 | 172 |
| 986 | 3300013307 | Ga0157372_10796076 | Ga0157372_107960762 | 172 |
| 987 | 3300013308 | Ga0157375_10016586 | Ga0157375_100165866 | 172 |
| 988 | 3300014325 | Ga0163163_10009593 | Ga0163163_100095938 | 172 |
| 989 | 3300014325 | Ga0163163_10066625 | Ga0163163_100666252 | 172 |
| 990 | 3300014745 | Ga0157377_10078631 | Ga0157377_100786312 | 172 |
| 991 | 3300014968 | Ga0157379_10006994 | Ga0157379_100069945 | 172 |
| 992 | 3300014969 | Ga0157376_10369635 | Ga0157376_103696352 | 172 |
| 993 | 3300014969 | Ga0157376_10543339 | Ga0157376_105433392 | 172 |
| 994 | 3300017792 | Ga0163161_10094176 | Ga0163161_100941762 | 172 |
| 995 | 3300025321 | Ga0207656_10118445 | Ga0207656_101184452 | 172 |
| 996 | 3300025893 | Ga0207682_10035821 | Ga0207682_100358213 | 172 |
| 997 | 3300025899 | Ga0207642_10075839 | Ga0207642_100758392 | 172 |
| 998 | 3300025900 | Ga0207710_10015450 | Ga0207710_100154503 | 172 |
| 999 | 3300025903 | Ga0207680_10007196 | Ga0207680_100071962 | 172 |
| 1000 | 3300025905 | Ga0207685_10002834 | Ga0207685_100028343 | 172 |
| 1001 | 3300025906 | Ga0207699_10070113 | Ga0207699_100701133 | 172 |
| 1002 | 3300025907 | Ga0207645_10229484 | Ga0207645_102294842 | 172 |
| 1003 | 3300025912 | Ga0207707_10527371 | Ga0207707_105273711 | 172 |
| 1004 | 3300025914 | Ga0207671_10040925 | Ga0207671_100409252 | 172 |
| 1005 | 3300025915 | Ga0207693_10025102 | Ga0207693_100251023 | 172 |
| 1006 | 3300025915 | Ga0207693_10076236 | Ga0207693_100762363 | 172 |
| 1007 | 3300025916 | Ga0207663_10104065 | Ga0207663_101040652 | 172 |
| 1008 | 3300025918 | Ga0207662_10079839 | Ga0207662_100798392 | 172 |
| 1009 | 3300025919 | Ga0207657_10014919 | Ga0207657_100149193 | 172 |
| 1010 | 3300025923 | Ga0207681_10197824 | Ga0207681_101978242 | 172 |
| 1011 | 3300025925 | Ga0207650_10079817 | Ga0207650_100798172 | 172 |
| 1012 | 3300025925 | Ga0207650_10210188 | Ga0207650_102101882 | 172 |
| 1013 | 3300025927 | Ga0207687_10002891 | Ga0207687_1000289110 | 172 |
| 1014 | 3300025927 | Ga0207687_10224223 | Ga0207687_102242232 | 172 |
| 1015 | 3300025927 | Ga0207687_10376736 | Ga0207687_103767362 | 172 |
| 1016 | 3300025928 | Ga0207700_10031130 | Ga0207700_100311302 | 172 |
| 1017 | 3300025928 | Ga0207700_10051938 | Ga0207700_100519383 | 172 |
| 1018 | 3300025929 | Ga0207664_10002486 | Ga0207664_1000248612 | 172 |
| 1019 | 3300025931 | Ga0207644_10004698 | Ga0207644_100046988 | 172 |
| 1020 | 3300025932 | Ga0207690_10474155 | Ga0207690_104741552 | 172 |
| 1021 | 3300025933 | Ga0207706_10040580 | Ga0207706_100405802 | 172 |
| 1022 | 3300025933 | Ga0207706_10564523 | Ga0207706_105645232 | 172 |
| 1023 | 3300025934 | Ga0207686_10000488 | Ga0207686_100004884 | 172 |
| 1024 | 3300025934 | Ga0207686_10653210 | Ga0207686_106532102 | 172 |
| 1025 | 3300025936 | Ga0207670_10037772 | Ga0207670_100377723 | 172 |
| 1026 | 3300025938 | Ga0207704_10656940 | Ga0207704_106569402 | 172 |
| 1027 | 3300025939 | Ga0207665_10008468 | Ga0207665_100084683 | 172 |
| 1028 | 3300025939 | Ga0207665_10129285 | Ga0207665_101292852 | 172 |
| 1029 | 3300025941 | Ga0207711_10001033 | Ga0207711_1000103320 | 172 |
| 1030 | 3300025942 | Ga0207689_10080987 | Ga0207689_100809872 | 172 |
| 1031 | 3300025942 | Ga0207689_10089949 | Ga0207689_100899493 | 172 |
| 1032 | 3300025944 | Ga0207661_10624998 | Ga0207661_106249982 | 172 |
| 1033 | 3300025945 | Ga0207679_10178247 | Ga0207679_101782472 | 172 |
| 1034 | 3300025945 | Ga0207679_10750990 | Ga0207679_107509902 | 172 |
| 1035 | 3300025945 | Ga0207679_11428312 | Ga0207679_114283121 | 172 |
| 1036 | 3300025960 | Ga0207651_10003957 | Ga0207651_100039573 | 172 |
| 1037 | 3300025961 | Ga0207712_10366705 | Ga0207712_103667052 | 172 |
| 1038 | 3300025981 | Ga0207640_10039707 | Ga0207640_100397074 | 172 |
| 1039 | 3300025986 | Ga0207658_10125323 | Ga0207658_101253233 | 172 |
| 1040 | 3300026023 | Ga0207677_10002051 | Ga0207677_100020514 | 172 |
| 1041 | 3300026023 | Ga0207677_10449756 | Ga0207677_104497562 | 172 |
| 1042 | 3300026035 | Ga0207703_10001709 | Ga0207703_1000170914 | 172 |
| 1043 | 3300026035 | Ga0207703_11160505 | Ga0207703_111605052 | 172 |
| 1044 | 3300026041 | Ga0207639_10243640 | Ga0207639_102436402 | 172 |
| 1045 | 3300026067 | Ga0207678_10039057 | Ga0207678_100390571 | 172 |
| 1046 | 3300026078 | Ga0207702_10335483 | Ga0207702_103354832 | 172 |
| 1047 | 3300026088 | Ga0207641_10007244 | Ga0207641_100072447 | 172 |
| 1048 | 3300026088 | Ga0207641_10014486 | Ga0207641_100144862 | 172 |
| 1049 | 3300026089 | Ga0207648_10036862 | Ga0207648_100368623 | 172 |
| 1050 | 3300026095 | Ga0207676_10000174 | Ga0207676_1000017423 | 172 |
| 1051 | 3300026095 | Ga0207676_10000548 | Ga0207676_1000054814 | 172 |
| 1052 | 3300026116 | Ga0207674_10018138 | Ga0207674_100181382 | 172 |
| 1053 | 3300026121 | Ga0207683_10017870 | Ga0207683_100178702 | 172 |
| 1054 | 3300026142 | Ga0207698_10147975 | Ga0207698_101479752 | 172 |
| 1055 | 3300028379 | Ga0268266_10008065 | Ga0268266_100080653 | 172 |
| 1056 | 3300028381 | Ga0268264_10021756 | Ga0268264_100217564 | 172 |
| 1057 | 3300028381 | Ga0268264_11869806 | Ga0268264_118698061 | 172 |
| 1058 | 3300031548 | Ga0307408_100017559 | Ga0307408_1000175592 | 172 |
| 1059 | 3300031731 | Ga0307405_10069390 | Ga0307405_100693902 | 172 |
| 1060 | 3300031824 | Ga0307413_10087117 | Ga0307413_100871172 | 172 |
| 1061 | 3300031852 | Ga0307410_10002755 | Ga0307410_100027558 | 172 |
| 1062 | 3300031901 | Ga0307406_10013059 | Ga0307406_100130593 | 172 |
| 1063 | 3300031903 | Ga0307407_10068837 | Ga0307407_100688372 | 172 |
| 1064 | 3300032002 | Ga0307416_100014893 | Ga0307416_1000148933 | 172 |
| 1065 | 3300032004 | Ga0307414_10010426 | Ga0307414_100104263 | 172 |
| 1066 | 3300032005 | Ga0307411_10098093 | Ga0307411_100980932 | 172 |
| 1067 | 3300032126 | Ga0307415_100007490 | Ga0307415_1000074902 | 172 |
| 1068 | 3300035086 | Ga0373934_0022793 | Ga0373934_0022793_755_1273 | 172 |
| 1069 | 3300035111 | Ga0373923_0001906 | Ga0373923_0001906_869_1387 | 172 |
| 1070 | 3300035116 | Ga0373945_0152612 | Ga0373945_0152612_288_806 | 172 |
| 1071 | 3300035118 | Ga0373954_0003489 | Ga0373954_0003489_6059_6577 | 172 |
| 1072 | 3300035119 | Ga0373956_0284901 | Ga0373956_0284901_133_651 | 172 |
| 1073 | 3300035120 | Ga0373957_0007229 | Ga0373957_0007229_149_667 | 172 |
| 1074 | 3300035170 | Ga0373943_0336008 | Ga0373943_0336008_258_776 | 172 |
| 1075 | 3300035171 | Ga0373946_0009606 | Ga0373946_0009606_1174_1692 | 172 |
| 1076 | 3300035171 | Ga0373946_0434634 | Ga0373946_0434634_136_654 | 172 |
| 1077 | 3300035172 | Ga0373955_0055591 | Ga0373955_0055591_512_1030 | 172 |
| 1078 | 3300035410 | Ga0373924_0195895 | Ga0373924_0195895_239_757 | 172 |
| 1079 | 3300035692 | Ga0373935_0196674 | Ga0373935_0196674_576_1094 | 172 |
| 1080 | 3300035695 | Ga0373927_0035616 | Ga0373927_0035616_1418_1936 | 172 |
| 1081 | 3300035695 | Ga0373927_0217954 | Ga0373927_0217954_421_939 | 172 |
| 1082 | 3300035724 | Ga0373933_0417170 | Ga0373933_0417170_43_561 | 172 |
| 1083 | 3300035725 | Ga0373947_0186236 | Ga0373947_0186236_707_1225 | 172 |
| 1084 | 3300036401 | Ga0373937_0017208 | Ga0373937_0017208_1141_1659 | 172 |
| 1085 | 3300037068 | Ga0373925_0124010 | Ga0373925_0124010_1184_1702 | 172 |
| 1086 | 3300046455 | Ga0495603_0232197 | Ga0495603_0232197_465_983 | 172 |
| 1087 | 3300046459 | Ga0495629_0096580 | Ga0495629_0096580_1460_1978 | 172 |
| 1088 | 3300046462 | Ga0495651_0092033 | Ga0495651_0092033_906_1424 | 172 |
| 1089 | 3300046463 | Ga0495653_0427796 | Ga0495653_0427796_160_678 | 172 |
| 1090 | 3300046472 | Ga0495580_0086177 | Ga0495580_0086177_256_774 | 172 |
| 1091 | 3300046472 | Ga0495580_0617171 | Ga0495580_0617171_112_630 | 172 |
| 1092 | 3300046473 | Ga0495582_0060468 | Ga0495582_0060468_1066_1584 | 172 |
| 1093 | 3300046475 | Ga0495639_0005155 | Ga0495639_0005155_1589_2107 | 172 |
| 1094 | 3300046476 | Ga0495662_0008790 | Ga0495662_0008790_1516_2034 | 172 |
| 1095 | 3300046477 | Ga0495664_0147593 | Ga0495664_0147593_216_734 | 172 |
| 1096 | 3300046477 | Ga0495664_0336942 | Ga0495664_0336942_368_886 | 172 |
| 1097 | 3300046499 | Ga0495594_0060051 | Ga0495594_0060051_491_1009 | 172 |
| 1098 | 3300046511 | Ga0495608_0111859 | Ga0495608_0111859_136_654 | 172 |
| 1099 | 3300046516 | Ga0495628_0432395 | Ga0495628_0432395_25_543 | 172 |
| 1100 | 3300046517 | Ga0495630_0018882 | Ga0495630_0018882_1762_2280 | 172 |
| 1101 | 3300046526 | Ga0495666_0223315 | Ga0495666_0223315_255_773 | 172 |
| 1102 | 3300046529 | Ga0495652_0346393 | Ga0495652_0346393_318_836 | 172 |
| 1103 | 3300046531 | Ga0495665_0022228 | Ga0495665_0022228_2773_3291 | 172 |
| 1104 | 3300046533 | Ga0495640_0025633 | Ga0495640_0025633_918_1436 | 172 |
| 1105 | 3300046535 | Ga0495586_0027285 | Ga0495586_0027285_2160_2678 | 172 |
| 1106 | 3300046539 | Ga0495621_0059231 | Ga0495621_0059231_583_1101 | 172 |
| 1107 | 3300046543 | Ga0495645_0017006 | Ga0495645_0017006_3184_3702 | 172 |
| 1108 | 3300046543 | Ga0495645_0217465 | Ga0495645_0217465_755_1273 | 172 |
| 1109 | 3300046559 | Ga0495667_0341704 | Ga0495667_0341704_252_770 | 172 |
| 1110 | 3300046642 | Ga0495634_0076539 | Ga0495634_0076539_629_1147 | 172 |
| 1111 | 3300046663 | Ga0495635_0105657 | Ga0495635_0105657_340_858 | 172 |
| 1112 | 3300046664 | Ga0495659_0094401 | Ga0495659_0094401_410_928 | 172 |
| 1113 | 3300046674 | Ga0495588_0041459 | Ga0495588_0041459_1181_1699 | 172 |
| 1114 | 3300046675 | Ga0495657_0558572 | Ga0495657_0558572_135_653 | 172 |
| 1115 | 3300046678 | Ga0495599_0149340 | Ga0495599_0149340_171_689 | 172 |
| 1116 | 3300046681 | Ga0495647_0008547 | Ga0495647_0008547_1409_1927 | 172 |
| 1117 | 3300046683 | Ga0495658_0044428 | Ga0495658_0044428_1066_1584 | 172 |
| 1118 | 3300046684 | Ga0495669_0205120 | Ga0495669_0205120_301_819 | 172 |
| 1119 | 3300046689 | Ga0495613_0018189 | Ga0495613_0018189_1946_2464 | 172 |
| 1120 | 3300046690 | Ga0495624_0104714 | Ga0495624_0104714_252_770 | 172 |
| 1121 | 3300047315 | Ga0495581_0009710 | Ga0495581_0009710_1414_1932 | 172 |
| 1122 | 3300047317 | Ga0495604_0398243 | Ga0495604_0398243_378_896 | 172 |
| 1123 | 3300047322 | Ga0495680_0070233 | Ga0495680_0070233_1065_1583 | 172 |
| 1124 | 3300047444 | Ga0495675_0147540 | Ga0495675_0147540_590_1108 | 172 |
| 1125 | 3300047471 | Ga0495684_0041075 | Ga0495684_0041075_1895_2413 | 172 |
| 1126 | 3300047673 | Ga0495593_0052595 | Ga0495593_0052595_1134_1652 | 172 |
| 1127 | 3300048089 | Ga0495614_0047249 | Ga0495614_0047249_939_1457 | 172 |
| 1128 | 3300048903 | Ga0496100_0203137 | Ga0496100_0203137_167_685 | 172 |
| 1129 | 3300048904 | Ga0496101_0089547 | Ga0496101_0089547_123_641 | 172 |
| 1130 | 3300048905 | Ga0496102_0958535 | Ga0496102_0958535_130_648 | 172 |
| 1131 | 3300048906 | Ga0496103_0469964 | Ga0496103_0469964_133_651 | 172 |
| 1132 | 3300048907 | Ga0496104_0009650 | Ga0496104_0009650_3118_3636 | 172 |
| 1133 | 3300048908 | Ga0496105_0102103 | Ga0496105_0102103_575_1093 | 172 |
| 1134 | 3300048910 | Ga0496107_0155182 | Ga0496107_0155182_245_763 | 172 |
| 1135 | 3300048910 | Ga0496107_0501178 | Ga0496107_0501178_92_610 | 172 |
| 1136 | 3300048911 | Ga0496108_0520627 | Ga0496108_0520627_319_843 | 172 |
| 1137 | 3300048912 | Ga0496109_0085357 | Ga0496109_0085357_1653_2171 | 172 |
| 1138 | 3300048913 | Ga0496110_0595808 | Ga0496110_0595808_368_886 | 172 |
| 1139 | 3300048914 | Ga0496111_0484431 | Ga0496111_0484431_231_749 | 172 |
| 1140 | 3300048915 | Ga0496112_0005841 | Ga0496112_0005841_7387_7905 | 172 |
| 1141 | 3300048915 | Ga0496112_0394210 | Ga0496112_0394210_702_1220 | 172 |
| 1142 | 3300048917 | Ga0496114_0022604 | Ga0496114_0022604_4443_4961 | 172 |
| 1143 | 3300048918 | Ga0496115_0602332 | Ga0496115_0602332_192_710 | 172 |
| 1144 | 3300050513 | nmdc:mga0rr50_224730_c1 | nmdc:mga0rr50_224730_c1_1020_1538 | 172 |
| 1145 | 3300053077 | Ga0495601_0292879 | Ga0495601_0292879_503_1021 | 172 |
| 1146 | 3300053078 | Ga0495612_0063075 | Ga0495612_0063075_398_916 | 172 |
| 1147 | 3300053078 | Ga0495612_0073781 | Ga0495612_0073781_578_1096 | 172 |
| 1148 | 3300053084 | Ga0495595_0355333 | Ga0495595_0355333_210_728 | 172 |
| 1149 | 3300053085 | Ga0495619_0008666 | Ga0495619_0008666_3111_3629 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p7c-assembly1.cif.gz_E | complex i from e. coli, ddm/lmng-purified, apo, open state | 0.8993 | 12 | 165 |
| 6zjy-assembly1.cif.gz_2 | respiratory complex i from thermus thermophilus, nad+ dataset, minor state | 0.8835 | 15 | 168 |
| 3iam-assembly1.cif.gz_2 | crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh | 0.8829 | 17 | 171 |
| 7a24-assembly1.cif.gz_B | assembly intermediate of the plant mitochondrial complex i | 0.8682 | 12 | 172 |
| 7p7c-assembly1.cif.gz_E | complex i from e. coli, ddm/lmng-purified, apo, open state | 0.8675 | 12 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.936 | 83 | 165 | 3.40.30.10 |
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9294 | 84 | 172 | 3.40.30.10 |
| af_Q6PBX8_48_121_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9282 | 12 | 83 | 1.10.10.1590 |
| 2fug202 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9193 | 85 | 171 | 3.40.30.10 |
| af_P0AFD1_13_82_1.10.10.1590 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E | 0.9159 | 12 | 82 | 1.10.10.1590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534WXL5-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9192 | 40 | 169 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A5E4JMT3-F1-model_v4 | Thioredoxin-like [2Fe-2S] ferredoxin | 0.9157 | 36 | 166 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A016QR90-F1-model_v4 | NADH-quinone oxidoreductase subunit E | 0.9151 | 40 | 172 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1G0H2P2-F1-model_v4 | NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) | 0.9097 | 12 | 168 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A3A0FDS5-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE | 0.9071 | 12 | 168 |
GO:0003954
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar