F490835

General Info

Members Datasets Scaffolds Average Seq Length
1149 410 1146 165

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0202516|Ga0495674_0202516_928_1410
Length 160
Sequence VSESQAKPAMILSAQALTRIDHEIAKYPSDQKRSAVMAALAIAQDEKGWLSTETMDFVAGATFYEMYNTEPIGRFKLTICTNLPCALQSASEAAEHLKRKLGIGFGETTPDRMFTLKQGECFGACGDAPVVLVNNKRMCSWMRPAELDRLLAELAAEPAP

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
3 2818991436 Collimonas arenae 515 Isolate Unclassified
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
240 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
280 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
385 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
389 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
390 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
407 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 3.57
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10025931 3300002239 Bacteria 939
2 JGI25162J39368_1000001 3300002737 Bacteria 740113
3 JGI25164J39214_1007850 3300002772 Bacteria 1075
4 JGI25165J46597_1000001 3300003214 Bacteria 1111887
5 Ga0055538_1000001 3300003751 Bacteria 1111887
6 Ga0055539_1000001 3300003752 Bacteria 1111887
7 Ga0055533_1000003 3300003756 Bacteria 1111887
8 Ga0055525_1000003 3300003759 Bacteria 962094
9 Ga0055541_1000001 3300003841 Bacteria 1111887
10 Ga0065715_10561781 3300005293 Bacteria 730
11 Ga0070676_10000072 3300005328 Bacteria 34018
12 Ga0070676_10149977 3300005328 Bacteria 1492
13 Ga0070683_100161839 3300005329 Bacteria 2124
14 Ga0070683_101074175 3300005329 Bacteria 773
15 Ga0070690_100002867 3300005330 Bacteria 9296
16 Ga0070690_100074179 3300005330 Bacteria 2215
17 Ga0070690_100315672 3300005330 Bacteria 1124
18 Ga0070690_101056408 3300005330 Bacteria 642
19 Ga0070690_101201813 3300005330 Bacteria 605
20 Ga0070670_100096413 3300005331 Bacteria 2544
21 Ga0070670_100117661 3300005331 Bacteria 2292
22 Ga0070670_100262774 3300005331 Bacteria 1505
23 Ga0070670_101264614 3300005331 Bacteria 675
24 Ga0070670_101885225 3300005331 Bacteria 550
25 Ga0070677_10000170 3300005333 Bacteria 22499
26 Ga0068869_100012083 3300005334 Bacteria 5692
27 Ga0068869_100013977 3300005334 Bacteria 5354
28 Ga0068869_100153654 3300005334 Bacteria 1787
29 Ga0068869_100338471 3300005334 Bacteria 1224
30 Ga0068869_101347236 3300005334 Bacteria 630
31 Ga0068869_101394355 3300005334 Bacteria 620
32 Ga0070666_10006410 3300005335 Bacteria 7235
33 Ga0070666_10007649 3300005335 Bacteria 6670
34 Ga0070666_10647812 3300005335 Bacteria 773
35 Ga0070680_100124951 3300005336 Bacteria 2149
36 Ga0070680_100249515 3300005336 Bacteria 1500
37 Ga0070682_100105552 3300005337 Bacteria 1868
38 Ga0070682_100289267 3300005337 Bacteria 1198
39 Ga0068868_100027054 3300005338 Bacteria 4374
40 Ga0068868_100117644 3300005338 Bacteria 2165
41 Ga0068868_100297177 3300005338 Bacteria 1371
42 Ga0068868_100452445 3300005338 Bacteria 1117
43 Ga0070660_100025820 3300005339 Bacteria 4369
44 Ga0070660_100381078 3300005339 Bacteria 1164
45 Ga0070660_101249062 3300005339 Bacteria 630
46 Ga0070689_100054677 3300005340 Bacteria 3091
47 Ga0070689_100066936 3300005340 Bacteria 2799
48 Ga0070689_101310609 3300005340 Bacteria 652
49 Ga0070691_10207235 3300005341 Bacteria 1033
50 Ga0070687_100021059 3300005343 Bacteria 3058
51 Ga0070687_100241755 3300005343 Bacteria 1117
52 Ga0070661_100219671 3300005344 Bacteria 1457
53 Ga0070661_100707818 3300005344 Bacteria 821
54 Ga0070692_10080451 3300005345 Bacteria 1754
55 Ga0070692_10461690 3300005345 Bacteria 815
56 Ga0070692_10473969 3300005345 Bacteria 806
57 Ga0070668_100035176 3300005347 Bacteria 3819
58 Ga0070668_100404266 3300005347 Bacteria 1166
59 Ga0070668_100795725 3300005347 Bacteria 840
60 Ga0070669_100039846 3300005353 Bacteria 3414
61 Ga0070669_100137721 3300005353 Bacteria 1879
62 Ga0070669_100408258 3300005353 Bacteria 1113
63 Ga0070669_100420649 3300005353 Bacteria 1097
64 Ga0070675_100000543 3300005354 Bacteria 25849
65 Ga0070671_100020291 3300005355 Bacteria 5419
66 Ga0070671_100027112 3300005355 Bacteria 4713
67 Ga0070671_100054157 3300005355 Bacteria 3335
68 Ga0070671_100163977 3300005355 Bacteria 1879
69 Ga0070671_100187344 3300005355 Bacteria 1753
70 Ga0070671_100346000 3300005355 Bacteria 1269
71 Ga0070671_101440471 3300005355 Bacteria 609
72 Ga0070674_100002257 3300005356 Bacteria 10631
73 Ga0070674_100075380 3300005356 Bacteria 2396
74 Ga0070674_100078199 3300005356 Bacteria 2357
75 Ga0070673_100000251 3300005364 Bacteria 27227
76 Ga0070673_100009977 3300005364 Bacteria 6404
77 Ga0070673_100396102 3300005364 Bacteria 1234
78 Ga0070673_100937619 3300005364 Bacteria 804
79 Ga0070673_101253684 3300005364 Bacteria 695
80 Ga0070688_100001386 3300005365 Bacteria 12053
81 Ga0070688_100224327 3300005365 Bacteria 1326
82 Ga0070659_100040641 3300005366 Bacteria 3635
83 Ga0070659_100073192 3300005366 Bacteria 2727
84 Ga0070659_100298389 3300005366 Bacteria 1343
85 Ga0070667_100065246 3300005367 Bacteria 3091
86 Ga0070667_100078305 3300005367 Bacteria 2824
87 Ga0070667_100184789 3300005367 Bacteria 1845
88 Ga0070667_100214808 3300005367 Bacteria 1710
89 Ga0070667_100369281 3300005367 Bacteria 1301
90 Ga0070667_100620974 3300005367 Bacteria 997
91 Ga0070667_101086518 3300005367 Bacteria 748
92 Ga0070667_101163169 3300005367 Bacteria 722
93 Ga0070709_10143754 3300005434 Bacteria 1641
94 Ga0070714_100199160 3300005435 Bacteria 1831
95 Ga0070713_100000033 3300005436 Bacteria 86758
96 Ga0070713_100020841 3300005436 Bacteria 5032
97 Ga0070713_100023278 3300005436 Bacteria 4803
98 Ga0070710_10162844 3300005437 Bacteria 1385
99 Ga0070701_10081040 3300005438 Bacteria 1757
100 Ga0070701_10159993 3300005438 Bacteria 1304
101 Ga0070711_100011100 3300005439 Bacteria 5590
102 Ga0070711_100119878 3300005439 Bacteria 1944
103 Ga0070705_100013604 3300005440 Bacteria 4166
104 Ga0070705_100036353 3300005440 Bacteria 2768
105 Ga0070705_100108366 3300005440 Bacteria 1769
106 Ga0070705_100153212 3300005440 Bacteria 1532
107 Ga0070705_100302450 3300005440 Bacteria 1147
108 Ga0070700_100001013 3300005441 Bacteria 13883
109 Ga0070700_100513667 3300005441 Bacteria 924
110 Ga0070694_100007797 3300005444 Bacteria 6532
111 Ga0070694_100011859 3300005444 Bacteria 5406
112 Ga0070694_100025031 3300005444 Bacteria 3857
113 Ga0070694_100035603 3300005444 Bacteria 3293
114 Ga0070694_100329843 3300005444 Bacteria 1177
115 Ga0070694_100362435 3300005444 Bacteria 1126
116 Ga0070708_100021761 3300005445 Bacteria 5429
117 Ga0070708_100271852 3300005445 Bacteria 1594
118 Ga0070708_100555468 3300005445 Bacteria 1083
119 Ga0070663_100198342 3300005455 Bacteria 1565
120 Ga0070663_100277780 3300005455 Bacteria 1334
121 Ga0070663_100489892 3300005455 Bacteria 1019
122 Ga0070663_100905767 3300005455 Bacteria 762
123 Ga0070663_101637777 3300005455 Bacteria 574
124 Ga0070678_100014041 3300005456 Bacteria 5039
125 Ga0070678_100105868 3300005456 Bacteria 2190
126 Ga0070678_100292288 3300005456 Bacteria 1382
127 Ga0070678_100327823 3300005456 Bacteria 1309
128 Ga0070678_100601781 3300005456 Bacteria 981
129 Ga0070678_101065516 3300005456 Bacteria 745
130 Ga0070662_100045566 3300005457 Bacteria 3147
131 Ga0070662_100073181 3300005457 Bacteria 2531
132 Ga0070662_100077812 3300005457 Bacteria 2462
133 Ga0070662_100099536 3300005457 Bacteria 2198
134 Ga0070662_100428966 3300005457 Bacteria 1095
135 Ga0070681_10013221 3300005458 Bacteria 8202
136 Ga0070681_10014534 3300005458 Bacteria 7834
137 Ga0070681_10178920 3300005458 Bacteria 2042
138 Ga0068867_100087960 3300005459 Bacteria 2353
139 Ga0068867_100168931 3300005459 Bacteria 1731
140 Ga0068867_101001466 3300005459 Bacteria 758
141 Ga0068867_101489589 3300005459 Bacteria 630
142 Ga0070685_10001553 3300005466 Bacteria 12102
143 Ga0070685_10135317 3300005466 Bacteria 1545
144 Ga0070706_100005369 3300005467 Bacteria 12210
145 Ga0070706_100201743 3300005467 Bacteria 1858
146 Ga0070706_100229256 3300005467 Bacteria 1734
147 Ga0070706_100243274 3300005467 Bacteria 1680
148 Ga0070707_100031454 3300005468 Bacteria 5056
149 Ga0070707_100099482 3300005468 Bacteria 2817
150 Ga0070707_100689745 3300005468 Bacteria 984
151 Ga0070698_100111856 3300005471 Bacteria 2696
152 Ga0070698_100118004 3300005471 Bacteria 2615
153 Ga0070698_100344771 3300005471 Bacteria 1421
154 Ga0070699_100009169 3300005518 Bacteria 8578
155 Ga0070699_100191200 3300005518 Bacteria 1818
156 Ga0070699_100530270 3300005518 Bacteria 1071
157 Ga0070699_100618637 3300005518 Bacteria 988
158 Ga0070699_100698845 3300005518 Bacteria 926
159 Ga0070679_100072479 3300005530 Bacteria 3436
160 Ga0070679_100128718 3300005530 Bacteria 2513
161 Ga0070679_100262530 3300005530 Bacteria 1682
162 Ga0070697_100002415 3300005536 Bacteria 14379
163 Ga0070697_100014086 3300005536 Bacteria 6279
164 Ga0070697_100063553 3300005536 Bacteria 3014
165 Ga0070697_100089287 3300005536 Bacteria 2546
166 Ga0070697_100242523 3300005536 Bacteria 1539
167 Ga0070697_100452401 3300005536 Bacteria 1119
168 Ga0070697_101109239 3300005536 Bacteria 704
169 Ga0068853_100004519 3300005539 Bacteria 10792
170 Ga0068853_100047075 3300005539 Bacteria 3701
171 Ga0068853_100082344 3300005539 Bacteria 2819
172 Ga0068853_100436885 3300005539 Bacteria 1229
173 Ga0068853_100811959 3300005539 Bacteria 896
174 Ga0070672_100000757 3300005543 Bacteria 19233
175 Ga0070672_100121871 3300005543 Bacteria 2135
176 Ga0070672_100697281 3300005543 Bacteria 889
177 Ga0070672_101348160 3300005543 Bacteria 637
178 Ga0070686_100095690 3300005544 Bacteria 1995
179 Ga0070686_100461823 3300005544 Bacteria 978
180 Ga0070686_100823400 3300005544 Bacteria 750
181 Ga0070695_100095580 3300005545 Bacteria 1992
182 Ga0070695_101158210 3300005545 Bacteria 635
183 Ga0070695_101396607 3300005545 Bacteria 581
184 Ga0070696_100024455 3300005546 Bacteria 4105
185 Ga0070696_100051826 3300005546 Bacteria 2854
186 Ga0070696_100250352 3300005546 Bacteria 1340
187 Ga0070696_100318204 3300005546 Bacteria 1197
188 Ga0070696_100380670 3300005546 Bacteria 1100
189 Ga0070696_100431838 3300005546 Bacteria 1036
190 Ga0070693_100034357 3300005547 Bacteria 2805
191 Ga0070693_100081645 3300005547 Bacteria 1929
192 Ga0070693_100194827 3300005547 Bacteria 1313
193 Ga0070665_100002227 3300005548 Bacteria 21612
194 Ga0070665_100004533 3300005548 Bacteria 14554
195 Ga0070665_100034082 3300005548 Bacteria 5120
196 Ga0070665_100235316 3300005548 Bacteria 1832
197 Ga0070665_100686800 3300005548 Bacteria 1037
198 Ga0070665_101355487 3300005548 Bacteria 721
199 Ga0070704_100044797 3300005549 Bacteria 3076
200 Ga0070704_100127247 3300005549 Bacteria 1968
201 Ga0070704_100173908 3300005549 Bacteria 1716
202 Ga0070704_100198723 3300005549 Bacteria 1617
203 Ga0070704_100226850 3300005549 Bacteria 1521
204 Ga0070704_101262934 3300005549 Bacteria 675
205 Ga0068855_100439986 3300005563 Bacteria 1424
206 Ga0068855_101143808 3300005563 Bacteria 812
207 Ga0070664_100160350 3300005564 Bacteria 1990
208 Ga0068857_100096584 3300005577 Bacteria 2648
209 Ga0068854_100003089 3300005578 Bacteria 10367
210 Ga0068854_100068470 3300005578 Bacteria 2588
211 Ga0068854_100478558 3300005578 Bacteria 1045
212 Ga0068856_100030254 3300005614 Bacteria 5293
213 Ga0068856_100505285 3300005614 Bacteria 1230
214 Ga0070702_100165943 3300005615 Bacteria 1432
215 Ga0070702_100267918 3300005615 Bacteria 1166
216 Ga0070702_100623315 3300005615 Bacteria 812
217 Ga0070702_100663916 3300005615 Bacteria 790
218 Ga0068852_100009278 3300005616 Bacteria 7293
219 Ga0068852_100060431 3300005616 Bacteria 3289
220 Ga0068852_100160391 3300005616 Bacteria 2099
221 Ga0068852_100197030 3300005616 Bacteria 1904
222 Ga0068852_100741588 3300005616 Bacteria 994
223 Ga0068852_101708142 3300005616 Bacteria 652
224 Ga0068852_101781318 3300005616 Bacteria 638
225 Ga0068859_100001101 3300005617 Bacteria 27548
226 Ga0068859_100004143 3300005617 Bacteria 14805
227 Ga0068859_100118593 3300005617 Bacteria 2712
228 Ga0068859_100344804 3300005617 Bacteria 1584
229 Ga0068859_100421609 3300005617 Bacteria 1431
230 Ga0068859_100564936 3300005617 Bacteria 1232
231 Ga0068864_100001698 3300005618 Bacteria 18102
232 Ga0068864_100015530 3300005618 Bacteria 6331
233 Ga0068864_100018582 3300005618 Bacteria 5810
234 Ga0068864_100075317 3300005618 Bacteria 2946
235 Ga0068864_100085019 3300005618 Bacteria 2781
236 Ga0068864_100089679 3300005618 Bacteria 2709
237 Ga0068864_101208836 3300005618 Bacteria 754
238 Ga0068866_10023568 3300005718 Bacteria 2866
239 Ga0068866_10025262 3300005718 Bacteria 2791
240 Ga0068866_10365037 3300005718 Bacteria 921
241 Ga0068866_10912206 3300005718 Bacteria 619
242 Ga0068861_100022064 3300005719 Bacteria 4582
243 Ga0068861_100111242 3300005719 Bacteria 2195
244 Ga0068861_100150212 3300005719 Bacteria 1911
245 Ga0068861_100813762 3300005719 Bacteria 878
246 Ga0068861_100924498 3300005719 Bacteria 828
247 Ga0068851_10022458 3300005834 Bacteria 3074
248 Ga0068851_10062919 3300005834 Bacteria 1905
249 Ga0068870_10012793 3300005840 Bacteria 3928
250 Ga0068870_10027059 3300005840 Bacteria 2865
251 Ga0068870_10027240 3300005840 Bacteria 2857
252 Ga0068863_100024216 3300005841 Bacteria 5790
253 Ga0068863_100027522 3300005841 Bacteria 5423
254 Ga0068863_100031027 3300005841 Bacteria 5103
255 Ga0068863_100034144 3300005841 Bacteria 4846
256 Ga0068863_100653550 3300005841 Bacteria 1043
257 Ga0068863_101608968 3300005841 Bacteria 659
258 Ga0068858_100001243 3300005842 Bacteria 26335
259 Ga0068858_100001448 3300005842 Bacteria 24421
260 Ga0068858_100125407 3300005842 Bacteria 2404
261 Ga0068858_100126739 3300005842 Bacteria 2391
262 Ga0068858_100195790 3300005842 Bacteria 1910
263 Ga0068858_100759951 3300005842 Bacteria 945
264 Ga0068858_101395383 3300005842 Bacteria 690
265 Ga0068860_100062103 3300005843 Bacteria 3550
266 Ga0068860_100483451 3300005843 Bacteria 1234
267 Ga0068860_100486951 3300005843 Bacteria 1230
268 Ga0068862_100140937 3300005844 Bacteria 2140
269 Ga0068862_101061603 3300005844 Bacteria 803
270 Ga0081539_10000805 3300005985 Bacteria 61020
271 Ga0070717_10187237 3300006028 Bacteria 1807
272 Ga0070715_10107151 3300006163 Bacteria 1313
273 Ga0070715_10260604 3300006163 Bacteria 910
274 Ga0070716_100165349 3300006173 Bacteria 1438
275 Ga0070712_100034746 3300006175 Bacteria 3418
276 Ga0070712_100120470 3300006175 Bacteria 1973
277 Ga0097621_100002521 3300006237 Bacteria 12549
278 Ga0097621_100008534 3300006237 Bacteria 7379
279 Ga0097621_100022358 3300006237 Bacteria 4908
280 Ga0097621_100103464 3300006237 Bacteria 2398
281 Ga0097621_100167357 3300006237 Bacteria 1893
282 Ga0097621_100336484 3300006237 Bacteria 1340
283 Ga0097621_100396827 3300006237 Bacteria 1234
284 Ga0097621_100649972 3300006237 Bacteria 967
285 Ga0097621_101195491 3300006237 Bacteria 716
286 Ga0068871_100004365 3300006358 Bacteria 9830
287 Ga0068871_100041227 3300006358 Bacteria 3701
288 Ga0068871_100076099 3300006358 Bacteria 2772
289 Ga0068871_100261839 3300006358 Bacteria 1509
290 Ga0068871_100551525 3300006358 Bacteria 1044
291 Ga0068871_100666348 3300006358 Bacteria 951
292 Ga0068871_100739535 3300006358 Bacteria 903
293 Ga0075430_100021691 3300006846 Bacteria 5459
294 Ga0075430_100022384 3300006846 Bacteria 5377
295 Ga0075430_100110168 3300006846 Bacteria 2296
296 Ga0075431_100005031 3300006847 Bacteria 13007
297 Ga0075433_10412026 3300006852 Bacteria 1192
298 Ga0075433_10487354 3300006852 Bacteria 1086
299 Ga0075434_100000484 3300006871 Bacteria 29868
300 Ga0075434_100160654 3300006871 Bacteria 2266
301 Ga0075434_100497625 3300006871 Bacteria 1240
302 Ga0075434_101138293 3300006871 Bacteria 793
303 Ga0075434_101340721 3300006871 Bacteria 726
304 Ga0075429_100045494 3300006880 Bacteria 3819
305 Ga0075429_100167210 3300006880 Bacteria 1926
306 Ga0068865_100072899 3300006881 Bacteria 2440
307 Ga0068865_100082328 3300006881 Bacteria 2313
308 Ga0068865_100118585 3300006881 Bacteria 1964
309 Ga0068865_100342468 3300006881 Bacteria 1209
310 Ga0075436_100000593 3300006914 Bacteria 23748
311 Ga0075436_100030087 3300006914 Bacteria 3736
312 Ga0075436_100046822 3300006914 Bacteria 2982
313 Ga0075436_100148145 3300006914 Bacteria 1650
314 Ga0075436_100292335 3300006914 Bacteria 1166
315 Ga0075436_100340350 3300006914 Bacteria 1080
316 Ga0097620_100001101 3300006931 Bacteria 27548
317 Ga0097620_100004143 3300006931 Bacteria 14805
318 Ga0097620_100118591 3300006931 Bacteria 2712
319 Ga0097620_100344820 3300006931 Bacteria 1584
320 Ga0097620_100421603 3300006931 Bacteria 1431
321 Ga0097620_100564943 3300006931 Bacteria 1232
322 Ga0075435_100130708 3300007076 Bacteria 2101
323 Ga0075435_100177974 3300007076 Bacteria 1797
324 Ga0075435_100213264 3300007076 Bacteria 1638
325 Ga0075435_100234384 3300007076 Bacteria 1560
326 Ga0099794_10038371 3300007265 Bacteria 2269
327 Ga0099794_10043650 3300007265 Bacteria 2141
328 Ga0099794_10090944 3300007265 Bacteria 1514
329 Ga0099794_10100975 3300007265 Bacteria 1440
330 Ga0099794_10189342 3300007265 Bacteria 1052
331 Ga0099795_10039408 3300007788 Bacteria 1672
332 Ga0105251_10242635 3300009011 Bacteria 812
333 Ga0105240_10603196 3300009093 Bacteria 1208
334 Ga0111539_10001053 3300009094 Bacteria 36307
335 Ga0111539_10016781 3300009094 Bacteria 9072
336 Ga0111539_10151848 3300009094 Bacteria 2711
337 Ga0111539_10800328 3300009094 Bacteria 1097
338 Ga0111539_10932848 3300009094 Bacteria 1009
339 Ga0111539_11692320 3300009094 Bacteria 734
340 Ga0111539_12975142 3300009094 Unclassified 548
341 Ga0105245_10000207 3300009098 Bacteria 55562
342 Ga0105245_10123931 3300009098 Bacteria 2416
343 Ga0105245_10209682 3300009098 Bacteria 1875
344 Ga0105245_10383677 3300009098 Bacteria 1400
345 Ga0105245_10410722 3300009098 Bacteria 1355
346 Ga0105245_10451951 3300009098 Bacteria 1293
347 Ga0105245_10460184 3300009098 Bacteria 1282
348 Ga0105245_10817410 3300009098 Bacteria 971
349 Ga0105245_11069593 3300009098 Bacteria 852
350 Ga0105247_10044964 3300009101 Bacteria 2709
351 Ga0105247_10344858 3300009101 Bacteria 1046
352 Ga0114129_10993796 3300009147 Bacteria 1057
353 Ga0105243_10666547 3300009148 Bacteria 1010
354 Ga0105243_11482630 3300009148 Bacteria 701
355 Ga0105241_10167204 3300009174 Bacteria 1813
356 Ga0105241_10217483 3300009174 Bacteria 1604
357 Ga0105241_10934072 3300009174 Bacteria 808
358 Ga0105242_10221835 3300009176 Bacteria 1690
359 Ga0105242_10602608 3300009176 Bacteria 1061
360 Ga0105242_10697852 3300009176 Bacteria 992
361 Ga0105242_11101892 3300009176 Bacteria 808
362 Ga0105242_11881934 3300009176 Bacteria 638
363 Ga0105248_10002218 3300009177 Bacteria 21485
364 Ga0105248_10308283 3300009177 Bacteria 1783
365 Ga0105248_10315991 3300009177 Bacteria 1759
366 Ga0105248_11151747 3300009177 Bacteria 877
367 Ga0105248_11851306 3300009177 Bacteria 685
368 Ga0105237_10265601 3300009545 Bacteria 1719
369 Ga0105237_10527742 3300009545 Bacteria 1187
370 Ga0105237_11090568 3300009545 Bacteria 805
371 Ga0105238_10146803 3300009551 Bacteria 2335
372 Ga0105238_10829145 3300009551 Bacteria 941
373 Ga0105238_11259084 3300009551 Bacteria 765
374 Ga0105249_10821374 3300009553 Bacteria 994
375 Ga0105249_11002136 3300009553 Bacteria 904
376 Ga0105249_11106389 3300009553 Bacteria 862
377 Ga0105249_12432486 3300009553 Bacteria 596
378 Ga0099796_10025359 3300010159 Bacteria 1871
379 Ga0105239_10166516 3300010375 Bacteria 2465
380 Ga0105239_10373346 3300010375 Bacteria 1612
381 Ga0105239_11048648 3300010375 Bacteria 938
382 Ga0105239_11667005 3300010375 Bacteria 738
383 Ga0105246_10062859 3300011119 Bacteria 2587
384 Ga0105246_10189276 3300011119 Bacteria 1592
385 Ga0157373_10311327 3300013100 Bacteria 1119
386 Ga0157373_10358395 3300013100 Bacteria 1041
387 Ga0157371_10250382 3300013102 Bacteria 1275
388 Ga0157371_11066066 3300013102 Bacteria 619
389 Ga0157370_10266430 3300013104 Bacteria 1583
390 Ga0157369_10037398 3300013105 Bacteria 5313
391 Ga0157369_10719551 3300013105 Bacteria 1028
392 Ga0157374_10014294 3300013296 Bacteria 6945
393 Ga0157374_10150237 3300013296 Bacteria 2264
394 Ga0157374_10264089 3300013296 Bacteria 1696
395 Ga0157374_10675431 3300013296 Bacteria 1045
396 Ga0157378_10051663 3300013297 Bacteria 3657
397 Ga0157378_10208931 3300013297 Bacteria 1850
398 Ga0157378_10393456 3300013297 Bacteria 1364
399 Ga0157378_10712517 3300013297 Bacteria 1024
400 Ga0157378_10776966 3300013297 Bacteria 982
401 Ga0157378_10859028 3300013297 Bacteria 936
402 Ga0157378_11137268 3300013297 Bacteria 819
403 Ga0157378_11475590 3300013297 Bacteria 724
404 Ga0163162_10140906 3300013306 Bacteria 2524
405 Ga0163162_10306385 3300013306 Bacteria 1720
406 Ga0163162_10585527 3300013306 Bacteria 1242
407 Ga0163162_10690853 3300013306 Bacteria 1142
408 Ga0157372_10098712 3300013307 Bacteria 3332
409 Ga0157372_10617056 3300013307 Bacteria 1264
410 Ga0157372_10796076 3300013307 Bacteria 1098
411 Ga0157372_11018966 3300013307 Bacteria 959
412 Ga0157375_10011033 3300013308 Bacteria 7969
413 Ga0157375_10016586 3300013308 Bacteria 6623
414 Ga0157375_10042038 3300013308 Bacteria 4420
415 Ga0157375_10374368 3300013308 Bacteria 1591
416 Ga0157375_10436880 3300013308 Bacteria 1475
417 Ga0157375_11503106 3300013308 Bacteria 795
418 Ga0157375_12045523 3300013308 Bacteria 681
419 Ga0163163_10009593 3300014325 Bacteria 8649
420 Ga0163163_10066625 3300014325 Bacteria 3577
421 Ga0157380_10108260 3300014326 Bacteria 2329
422 Ga0157380_10183103 3300014326 Bacteria 1842
423 Ga0157380_10573010 3300014326 Bacteria 1112
424 Ga0157380_11375449 3300014326 Bacteria 756
425 Ga0157380_11920684 3300014326 Bacteria 653
426 Ga0157377_10078631 3300014745 Bacteria 1923
427 Ga0157379_10006994 3300014968 Bacteria 9753
428 Ga0157379_10245270 3300014968 Bacteria 1625
429 Ga0157379_10365806 3300014968 Bacteria 1322
430 Ga0157376_10033466 3300014969 Bacteria 4138
431 Ga0157376_10069688 3300014969 Bacteria 2982
432 Ga0157376_10167905 3300014969 Bacteria 1995
433 Ga0157376_10369635 3300014969 Bacteria 1378
434 Ga0157376_10543339 3300014969 Bacteria 1149
435 Ga0182006_1032825 3300015261 Bacteria 2084
436 Ga0182007_10050203 3300015262 Bacteria 1377
437 Ga0182005_1013443 3300015265 Bacteria 2302
438 Ga0163161_10013389 3300017792 Bacteria 5707
439 Ga0163161_10039723 3300017792 Bacteria 3379
440 Ga0163161_10094176 3300017792 Bacteria 2220
441 Ga0209760_101465 3300025207 Bacteria 2483
442 Ga0209566_100004 3300025225 Bacteria 1531866
443 Ga0209674_100006 3300025226 Bacteria 1531866
444 Ga0209563_100009 3300025230 Bacteria 1378156
445 Ga0207427_100293 3300025231 Bacteria 35384
446 Ga0209437_100004 3300025233 Bacteria 1378156
447 Ga0209677_100005 3300025253 Bacteria 1378156
448 Ga0209233_1000005 3300025261 Bacteria 1531866
449 Ga0207656_10001172 3300025321 Bacteria 8631
450 Ga0207656_10118445 3300025321 Bacteria 1230
451 Ga0207682_10024633 3300025893 Bacteria 2384
452 Ga0207682_10035821 3300025893 Bacteria 2006
453 Ga0207682_10040949 3300025893 Bacteria 1890
454 Ga0207682_10233052 3300025893 Bacteria 854
455 Ga0207692_10917195 3300025898 Bacteria 576
456 Ga0207642_10052105 3300025899 Bacteria 1855
457 Ga0207642_10075839 3300025899 Bacteria 1616
458 Ga0207710_10015450 3300025900 Bacteria 3226
459 Ga0207710_10287665 3300025900 Bacteria 828
460 Ga0207688_10172243 3300025901 Bacteria 1287
461 Ga0207688_10183712 3300025901 Bacteria 1248
462 Ga0207680_10007196 3300025903 Bacteria 5410
463 Ga0207680_10246988 3300025903 Bacteria 1231
464 Ga0207685_10002834 3300025905 Bacteria 4074
465 Ga0207699_10070113 3300025906 Bacteria 2140
466 Ga0207645_10000686 3300025907 Bacteria 28086
467 Ga0207645_10229484 3300025907 Bacteria 1225
468 Ga0207645_10602803 3300025907 Bacteria 746
469 Ga0207643_10007629 3300025908 Bacteria 5814
470 Ga0207643_10011915 3300025908 Bacteria 4694
471 Ga0207643_10027879 3300025908 Bacteria 3134
472 Ga0207643_10090879 3300025908 Bacteria 1780
473 Ga0207684_10098891 3300025910 Bacteria 2492
474 Ga0207684_10126212 3300025910 Bacteria 2196
475 Ga0207684_10167442 3300025910 Bacteria 1894
476 Ga0207684_11708245 3300025910 Bacteria 507
477 Ga0207654_10148730 3300025911 Bacteria 1501
478 Ga0207707_10017447 3300025912 Bacteria 6258
479 Ga0207707_10026843 3300025912 Bacteria 5033
480 Ga0207707_10261257 3300025912 Bacteria 1502
481 Ga0207707_10527371 3300025912 Bacteria 1005
482 Ga0207695_10780147 3300025913 Bacteria 836
483 Ga0207671_10013515 3300025914 Bacteria 6499
484 Ga0207671_10040925 3300025914 Bacteria 3430
485 Ga0207693_10025102 3300025915 Bacteria 4728
486 Ga0207693_10046169 3300025915 Bacteria 3422
487 Ga0207693_10076236 3300025915 Bacteria 2626
488 Ga0207663_10104065 3300025916 Bacteria 1913
489 Ga0207660_10654290 3300025917 Bacteria 857
490 Ga0207662_10079839 3300025918 Bacteria 1994
491 Ga0207657_10014919 3300025919 Bacteria 7555
492 Ga0207652_10055337 3300025921 Bacteria 3411
493 Ga0207652_10355688 3300025921 Bacteria 1322
494 Ga0207646_10470666 3300025922 Bacteria 1133
495 Ga0207681_10062298 3300025923 Bacteria 2568
496 Ga0207681_10197824 3300025923 Bacteria 1542
497 Ga0207681_10488648 3300025923 Bacteria 1006
498 Ga0207694_10982735 3300025924 Bacteria 714
499 Ga0207650_10079817 3300025925 Bacteria 2479
500 Ga0207650_10196981 3300025925 Bacteria 1612
501 Ga0207650_10203115 3300025925 Bacteria 1588
502 Ga0207650_10210188 3300025925 Bacteria 1562
503 Ga0207650_11284864 3300025925 Unclassified 623
504 Ga0207650_11516181 3300025925 Bacteria 570
505 Ga0207659_10027966 3300025926 Bacteria 3825
506 Ga0207659_10036324 3300025926 Bacteria 3412
507 Ga0207659_10662271 3300025926 Bacteria 893
508 Ga0207687_10002891 3300025927 Bacteria 11663
509 Ga0207687_10170079 3300025927 Bacteria 1680
510 Ga0207687_10224223 3300025927 Bacteria 1482
511 Ga0207687_10376736 3300025927 Bacteria 1162
512 Ga0207687_10547113 3300025927 Bacteria 971
513 Ga0207700_10000099 3300025928 Bacteria 53179
514 Ga0207700_10031130 3300025928 Bacteria 3787
515 Ga0207700_10051938 3300025928 Bacteria 3063
516 Ga0207664_10002486 3300025929 Bacteria 12199
517 Ga0207644_10004698 3300025931 Bacteria 8874
518 Ga0207644_10009912 3300025931 Bacteria 6268
519 Ga0207644_10049097 3300025931 Bacteria 3019
520 Ga0207644_10166745 3300025931 Bacteria 1716
521 Ga0207690_10131805 3300025932 Bacteria 1830
522 Ga0207690_10406579 3300025932 Bacteria 1086
523 Ga0207690_10474155 3300025932 Bacteria 1009
524 Ga0207706_10029707 3300025933 Bacteria 4878
525 Ga0207706_10040580 3300025933 Bacteria 4125
526 Ga0207706_10098770 3300025933 Bacteria 2568
527 Ga0207706_10145093 3300025933 Bacteria 2088
528 Ga0207706_10326444 3300025933 Bacteria 1335
529 Ga0207706_10564523 3300025933 Bacteria 979
530 Ga0207706_11010902 3300025933 Bacteria 698
531 Ga0207686_10000488 3300025934 Bacteria 26043
532 Ga0207686_10165660 3300025934 Bacteria 1554
533 Ga0207686_10374764 3300025934 Bacteria 1078
534 Ga0207686_10653210 3300025934 Bacteria 832
535 Ga0207709_10003546 3300025935 Bacteria 9232
536 Ga0207670_10037772 3300025936 Bacteria 3149
537 Ga0207670_10195194 3300025936 Bacteria 1534
538 Ga0207670_10256476 3300025936 Bacteria 1354
539 Ga0207670_11144842 3300025936 Bacteria 658
540 Ga0207669_10085486 3300025937 Bacteria 2036
541 Ga0207669_10088399 3300025937 Bacteria 2009
542 Ga0207669_10354658 3300025937 Bacteria 1134
543 Ga0207669_10695343 3300025937 Bacteria 835
544 Ga0207669_11048761 3300025937 Bacteria 687
545 Ga0207704_10407710 3300025938 Bacteria 1074
546 Ga0207704_10656940 3300025938 Bacteria 864
547 Ga0207665_10008468 3300025939 Bacteria 6776
548 Ga0207665_10048319 3300025939 Bacteria 2856
549 Ga0207665_10129285 3300025939 Bacteria 1791
550 Ga0207691_10000367 3300025940 Bacteria 45445
551 Ga0207691_10080128 3300025940 Bacteria 2937
552 Ga0207691_10170606 3300025940 Bacteria 1905
553 Ga0207691_10245380 3300025940 Bacteria 1547
554 Ga0207691_10305182 3300025940 Bacteria 1367
555 Ga0207691_10517493 3300025940 Bacteria 1013
556 Ga0207711_10001033 3300025941 Bacteria 26678
557 Ga0207711_10144793 3300025941 Bacteria 2140
558 Ga0207711_10215806 3300025941 Bacteria 1753
559 Ga0207711_10332300 3300025941 Bacteria 1406
560 Ga0207689_10001526 3300025942 Bacteria 22022
561 Ga0207689_10080987 3300025942 Bacteria 2669
562 Ga0207689_10089949 3300025942 Bacteria 2522
563 Ga0207689_10090458 3300025942 Bacteria 2515
564 Ga0207689_10284134 3300025942 Bacteria 1370
565 Ga0207661_10624998 3300025944 Bacteria 989
566 Ga0207661_10789797 3300025944 Bacteria 874
567 Ga0207661_11387302 3300025944 Bacteria 645
568 Ga0207679_10178247 3300025945 Bacteria 1756
569 Ga0207679_10750990 3300025945 Bacteria 887
570 Ga0207679_11428312 3300025945 Bacteria 635
571 Ga0207667_10243928 3300025949 Bacteria 1838
572 Ga0207651_10001584 3300025960 Bacteria 10419
573 Ga0207651_10003957 3300025960 Bacteria 7358
574 Ga0207651_10629223 3300025960 Bacteria 940
575 Ga0207651_10728505 3300025960 Bacteria 875
576 Ga0207712_10366705 3300025961 Bacteria 1201
577 Ga0207668_10026322 3300025972 Bacteria 3775
578 Ga0207668_10064287 3300025972 Bacteria 2592
579 Ga0207668_10140898 3300025972 Bacteria 1854
580 Ga0207668_10338096 3300025972 Bacteria 1255
581 Ga0207668_10371735 3300025972 Bacteria 1201
582 Ga0207640_10039707 3300025981 Bacteria 2981
583 Ga0207640_10052298 3300025981 Bacteria 2660
584 Ga0207658_10041343 3300025986 Bacteria 3337
585 Ga0207658_10052812 3300025986 Bacteria 3000
586 Ga0207658_10121457 3300025986 Bacteria 2084
587 Ga0207658_10125323 3300025986 Bacteria 2054
588 Ga0207658_10243630 3300025986 Bacteria 1524
589 Ga0207658_10401217 3300025986 Bacteria 1205
590 Ga0207658_10688705 3300025986 Bacteria 923
591 Ga0207677_10002051 3300026023 Bacteria 10615
592 Ga0207677_10045023 3300026023 Bacteria 2945
593 Ga0207677_10062363 3300026023 Bacteria 2585
594 Ga0207677_10097557 3300026023 Bacteria 2153
595 Ga0207677_10231540 3300026023 Bacteria 1489
596 Ga0207677_10296131 3300026023 Bacteria 1335
597 Ga0207677_10449756 3300026023 Bacteria 1103
598 Ga0207677_10640560 3300026023 Bacteria 937
599 Ga0207677_10644287 3300026023 Bacteria 934
600 Ga0207703_10001709 3300026035 Bacteria 19718
601 Ga0207703_10004881 3300026035 Bacteria 10902
602 Ga0207703_10250399 3300026035 Bacteria 1596
603 Ga0207703_10592930 3300026035 Bacteria 1048
604 Ga0207703_10974247 3300026035 Bacteria 813
605 Ga0207703_11160505 3300026035 Bacteria 742
606 Ga0207639_10016008 3300026041 Bacteria 5296
607 Ga0207639_10030737 3300026041 Bacteria 3941
608 Ga0207639_10243640 3300026041 Bacteria 1564
609 Ga0207639_10259421 3300026041 Bacteria 1519
610 Ga0207678_10039057 3300026067 Bacteria 4121
611 Ga0207678_10179040 3300026067 Bacteria 1810
612 Ga0207678_10223448 3300026067 Bacteria 1612
613 Ga0207678_10261753 3300026067 Bacteria 1482
614 Ga0207702_10335483 3300026078 Bacteria 1443
615 Ga0207702_10796015 3300026078 Bacteria 934
616 Ga0207641_10007244 3300026088 Bacteria 9243
617 Ga0207641_10014486 3300026088 Bacteria 6461
618 Ga0207641_10033425 3300026088 Bacteria 4273
619 Ga0207641_10074117 3300026088 Bacteria 2935
620 Ga0207641_10352461 3300026088 Bacteria 1403
621 Ga0207648_10023103 3300026089 Bacteria 5578
622 Ga0207648_10036862 3300026089 Bacteria 4307
623 Ga0207648_10059692 3300026089 Bacteria 3326
624 Ga0207648_10208856 3300026089 Bacteria 1733
625 Ga0207648_10722118 3300026089 Bacteria 924
626 Ga0207676_10000174 3300026095 Bacteria 56439
627 Ga0207676_10000548 3300026095 Bacteria 31359
628 Ga0207676_10014818 3300026095 Bacteria 5617
629 Ga0207676_10050997 3300026095 Bacteria 3229
630 Ga0207676_10162303 3300026095 Bacteria 1937
631 Ga0207676_10588374 3300026095 Bacteria 1067
632 Ga0207676_11299082 3300026095 Bacteria 722
633 Ga0207674_10018138 3300026116 Bacteria 7657
634 Ga0207674_10065150 3300026116 Bacteria 3674
635 Ga0207674_10551097 3300026116 Bacteria 1114
636 Ga0207675_100001059 3300026118 Bacteria 27297
637 Ga0207675_100028790 3300026118 Bacteria 5175
638 Ga0207675_100029308 3300026118 Bacteria 5129
639 Ga0207675_100274530 3300026118 Bacteria 1637
640 Ga0207683_10000246 3300026121 Bacteria 48193
641 Ga0207683_10017870 3300026121 Bacteria 6048
642 Ga0207683_10023679 3300026121 Bacteria 5282
643 Ga0207683_10051897 3300026121 Bacteria 3593
644 Ga0207683_10691031 3300026121 Bacteria 946
645 Ga0207683_11262684 3300026121 Bacteria 684
646 Ga0207698_10046357 3300026142 Bacteria 3282
647 Ga0207698_10147975 3300026142 Bacteria 2034
648 Ga0207698_10284124 3300026142 Bacteria 1532
649 Ga0207698_10662793 3300026142 Bacteria 1035
650 Ga0209179_1070318 3300027512 Bacteria 766
651 Ga0209999_1049327 3300027543 Bacteria 794
652 Ga0209588_1003394 3300027671 Bacteria 4416
653 Ga0209588_1065024 3300027671 Bacteria 1179
654 Ga0209588_1096392 3300027671 Bacteria 953
655 Ga0207428_10002514 3300027907 Bacteria 18299
656 Ga0268266_10006669 3300028379 Bacteria 10534
657 Ga0268266_10008065 3300028379 Bacteria 9410
658 Ga0268266_10008592 3300028379 Bacteria 9072
659 Ga0268266_10231835 3300028379 Bacteria 1701
660 Ga0268266_10370436 3300028379 Bacteria 1349
661 Ga0268265_10060666 3300028380 Bacteria 2899
662 Ga0268265_10099483 3300028380 Bacteria 2345
663 Ga0268264_10021756 3300028381 Bacteria 5234
664 Ga0268264_10037732 3300028381 Bacteria 3985
665 Ga0268264_10059516 3300028381 Bacteria 3200
666 Ga0268264_10424362 3300028381 Bacteria 1283
667 Ga0268264_10481944 3300028381 Bacteria 1207
668 Ga0268264_10646841 3300028381 Bacteria 1046
669 Ga0268264_11869806 3300028381 Bacteria 610
670 Ga0265318_10050404 3300028577 Bacteria 1564
671 Ga0265318_10149264 3300028577 Bacteria 858
672 Ga0265332_10000293 3300031238 Bacteria 39227
673 Ga0265332_10133399 3300031238 Bacteria 1041
674 Ga0265328_10003416 3300031239 Bacteria 7015
675 Ga0265320_10021332 3300031240 Bacteria 3488
676 Ga0265325_10011509 3300031241 Bacteria 5082
677 Ga0265329_10015880 3300031242 Bacteria 2620
678 Ga0265329_10019337 3300031242 Bacteria 2314
679 Ga0265339_10034852 3300031249 Bacteria 2827
680 Ga0265339_10080478 3300031249 Bacteria 1723
681 Ga0265331_10000348 3300031250 Bacteria 49051
682 Ga0265331_10004434 3300031250 Bacteria 8766
683 Ga0265327_10128619 3300031251 Bacteria 1193
684 Ga0265316_10018947 3300031344 Bacteria 5905
685 Ga0265316_10041874 3300031344 Bacteria 3662
686 Ga0307408_100017559 3300031548 Bacteria 4789
687 Ga0265313_10044904 3300031595 Bacteria 2154
688 Ga0265314_10000245 3300031711 Bacteria 79757
689 Ga0265314_10028151 3300031711 Bacteria 4193
690 Ga0265342_10007670 3300031712 Bacteria 7860
691 Ga0307405_10069390 3300031731 Bacteria 2259
692 Ga0307413_10036789 3300031824 Bacteria 2822
693 Ga0307413_10087117 3300031824 Bacteria 2022
694 Ga0307410_10002755 3300031852 Bacteria 8598
695 Ga0307406_10013059 3300031901 Bacteria 4747
696 Ga0307407_10068837 3300031903 Bacteria 2098
697 Ga0307409_100243044 3300031995 Bacteria 1640
698 Ga0307409_100274323 3300031995 Bacteria 1555
699 Ga0307416_100014893 3300032002 Bacteria 5348
700 Ga0307416_101158796 3300032002 Bacteria 878
701 Ga0307414_10010426 3300032004 Bacteria 5391
702 Ga0307414_10235708 3300032004 Bacteria 1512
703 Ga0307414_10461762 3300032004 Bacteria 1116
704 Ga0307411_10098093 3300032005 Bacteria 2064
705 Ga0307411_10228757 3300032005 Bacteria 1448
706 Ga0307411_10262761 3300032005 Bacteria 1364
707 Ga0307415_100007490 3300032126 Bacteria 5974
708 Ga0307415_100100576 3300032126 Bacteria 2119
709 Ga0307415_100258270 3300032126 Bacteria 1420
710 Ga0307415_100646664 3300032126 Bacteria 947
711 Ga0316583_10061686 3300032133 Bacteria 1313
712 Ga0307507_10082957 3300033179 Bacteria 2806
713 Ga0307510_10402365 3300033180 Bacteria 812
714 Ga0373928_0037831 3300035084 Bacteria 1096
715 Ga0373934_0019815 3300035086 Bacteria 2584
716 Ga0373934_0022793 3300035086 Bacteria 2416
717 Ga0373951_0160852 3300035091 Bacteria 635
718 Ga0373952_0012716 3300035092 Bacteria 1660
719 Ga0373923_0001906 3300035111 Bacteria 6228
720 Ga0373923_0270828 3300035111 Bacteria 798
721 Ga0373932_0067634 3300035112 Bacteria 1100
722 Ga0373936_0060619 3300035113 Bacteria 1544
723 Ga0373939_0144472 3300035114 Bacteria 860
724 Ga0373941_0039851 3300035115 Bacteria 1446
725 Ga0373945_0152612 3300035116 Bacteria 937
726 Ga0373953_0037940 3300035117 Bacteria 1904
727 Ga0373954_0002636 3300035118 Bacteria 7548
728 Ga0373954_0003489 3300035118 Bacteria 6675
729 Ga0373954_0048171 3300035118 Bacteria 1996
730 Ga0373954_0056289 3300035118 Bacteria 1850
731 Ga0373956_0000615 3300035119 Bacteria 14591
732 Ga0373956_0199774 3300035119 Bacteria 947
733 Ga0373956_0284901 3300035119 Bacteria 786
734 Ga0373956_0454136 3300035119 Bacteria 611
735 Ga0373957_0001592 3300035120 Bacteria 6205
736 Ga0373957_0007229 3300035120 Bacteria 3545
737 Ga0373943_0220334 3300035170 Bacteria 1056
738 Ga0373943_0336008 3300035170 Unclassified 863
739 Ga0373943_0444095 3300035170 Bacteria 753
740 Ga0373946_0009606 3300035171 Bacteria 3567
741 Ga0373946_0282720 3300035171 Bacteria 817
742 Ga0373946_0419147 3300035171 Bacteria 678
743 Ga0373946_0434634 3300035171 Bacteria 666
744 Ga0373955_0055591 3300035172 Bacteria 2168
745 Ga0373955_0250107 3300035172 Bacteria 1062
746 Ga0373942_0105566 3300035207 Bacteria 865
747 Ga0373942_0296105 3300035207 Bacteria 561
748 Ga0373961_0069131 3300035241 Bacteria 1089
749 Ga0373961_0102214 3300035241 Bacteria 929
750 Ga0316574_0000854 3300035398 Bacteria 13382
751 Ga0373924_0032663 3300035410 Bacteria 2097
752 Ga0373924_0195895 3300035410 Bacteria 890
753 Ga0373931_0105884 3300035691 Bacteria 1589
754 Ga0373931_0463267 3300035691 Bacteria 812
755 Ga0373935_0196674 3300035692 Bacteria 1391
756 Ga0373935_0231964 3300035692 Bacteria 1286
757 Ga0373935_0269439 3300035692 Bacteria 1196
758 Ga0373935_0571033 3300035692 Bacteria 826
759 Ga0373927_0032781 3300035695 Bacteria 3383
760 Ga0373927_0035616 3300035695 Bacteria 3236
761 Ga0373927_0217954 3300035695 Bacteria 1254
762 Ga0373927_0343639 3300035695 Bacteria 983
763 Ga0373933_0024477 3300035724 Bacteria 3456
764 Ga0373933_0071872 3300035724 Bacteria 2107
765 Ga0373933_0190804 3300035724 Bacteria 1309
766 Ga0373933_0417170 3300035724 Bacteria 877
767 Ga0373947_0186236 3300035725 Bacteria 1353
768 Ga0373937_0001406 3300036401 Bacteria 20084
769 Ga0373937_0017208 3300036401 Bacteria 6435
770 Ga0373937_0167403 3300036401 Bacteria 2061
771 Ga0373937_0450001 3300036401 Bacteria 1223
772 Ga0373925_0124010 3300037068 Bacteria 2008
773 Ga0373925_0152252 3300037068 Bacteria 1817
774 Ga0373925_0201818 3300037068 Bacteria 1581
775 Ga0373925_0361527 3300037068 Bacteria 1180
776 Ga0395900_0088037 3300037418 Bacteria 3192
777 Ga0395900_0147511 3300037418 Bacteria 2405
778 Ga0395905_1021611 3300037471 Bacteria 730
779 Ga0395901_0180064 3300038443 Bacteria 2217
780 Ga0395901_0449952 3300038443 Bacteria 1317
781 Ga0242420_013094 3300038996 Bacteria 1410
782 Ga0436365_1097290 3300039437 Bacteria 961
783 Ga0436360_1169165 3300039438 Bacteria 624
784 Ga0439436_0128967 3300041404 Bacteria 709
785 Ga0451843_0690997 3300041509 Bacteria 848
786 Ga0439448_0120657 3300042005 Bacteria 900
787 Ga0439432_076975 3300042006 Bacteria 1013
788 Ga0439434_0067858 3300042435 Bacteria 1120
789 Ga0451577_0317631 3300042876 Bacteria 1412
790 Ga0466972_0000070 3300044658 Bacteria 100242
791 Ga0453683_0125552 3300044673 Bacteria 1616
792 Ga0453683_0497285 3300044673 Bacteria 791
793 Ga0466964_0108427 3300044706 Bacteria 1235
794 Ga0453684_0426012 3300044712 Bacteria 1481
795 Ga0453684_0637922 3300044712 Bacteria 1164
796 Ga0453684_0792130 3300044712 Bacteria 1023
797 Ga0451576_0342806 3300045051 Bacteria 1564
798 Ga0466967_1056839 3300045976 Bacteria 809
799 Ga0495592_0005285 3300046454 Bacteria 9518
800 Ga0495592_0029233 3300046454 Bacteria 4173
801 Ga0495592_0110125 3300046454 Bacteria 1949
802 Ga0495592_0120496 3300046454 Bacteria 1846
803 Ga0495592_0357605 3300046454 Bacteria 934
804 Ga0495603_0232197 3300046455 Bacteria 1063
805 Ga0495629_0096580 3300046459 Bacteria 2061
806 Ga0495641_0015988 3300046461 Bacteria 3972
807 Ga0495651_0002995 3300046462 Bacteria 13035
808 Ga0495651_0010022 3300046462 Bacteria 7283
809 Ga0495651_0070933 3300046462 Bacteria 2649
810 Ga0495651_0092033 3300046462 Bacteria 2272
811 Ga0495653_0006836 3300046463 Bacteria 9370
812 Ga0495653_0259517 3300046463 Bacteria 1149
813 Ga0495653_0427796 3300046463 Bacteria 837
814 Ga0495580_0075522 3300046472 Bacteria 2351
815 Ga0495580_0086177 3300046472 Bacteria 2187
816 Ga0495580_0270829 3300046472 Bacteria 1160
817 Ga0495580_0617171 3300046472 Bacteria 715
818 Ga0495582_0060468 3300046473 Bacteria 2090
819 Ga0495639_0005155 3300046475 Bacteria 5614
820 Ga0495639_0069678 3300046475 Bacteria 1622
821 Ga0495662_0008790 3300046476 Bacteria 4967
822 Ga0495664_0146787 3300046477 Bacteria 1430
823 Ga0495664_0147593 3300046477 Bacteria 1426
824 Ga0495664_0336942 3300046477 Bacteria 909
825 Ga0495594_0060051 3300046499 Bacteria 2103
826 Ga0495607_0049730 3300046501 Bacteria 2443
827 Ga0495606_0000011 3300046507 Bacteria 296816
828 Ga0495608_0042788 3300046511 Bacteria 3028
829 Ga0495608_0080156 3300046511 Bacteria 2122
830 Ga0495608_0111859 3300046511 Bacteria 1756
831 Ga0495608_0288797 3300046511 Bacteria 1017
832 Ga0495618_0215600 3300046514 Bacteria 1212
833 Ga0495618_0508427 3300046514 Bacteria 725
834 Ga0495628_0002021 3300046516 Bacteria 18381
835 Ga0495628_0004647 3300046516 Bacteria 12116
836 Ga0495628_0020880 3300046516 Bacteria 5394
837 Ga0495628_0117806 3300046516 Bacteria 2039
838 Ga0495628_0120479 3300046516 Bacteria 2013
839 Ga0495628_0432395 3300046516 Bacteria 958
840 Ga0495628_0594943 3300046516 Bacteria 790
841 Ga0495630_0018882 3300046517 Bacteria 5068
842 Ga0495630_0039136 3300046517 Bacteria 3546
843 Ga0495630_0139652 3300046517 Bacteria 1842
844 Ga0495666_0007731 3300046526 Bacteria 5379
845 Ga0495666_0223315 3300046526 Bacteria 862
846 Ga0495652_0021112 3300046529 Bacteria 5788
847 Ga0495652_0035269 3300046529 Bacteria 4355
848 Ga0495652_0065263 3300046529 Bacteria 3059
849 Ga0495652_0069034 3300046529 Bacteria 2959
850 Ga0495652_0139381 3300046529 Bacteria 1909
851 Ga0495652_0260501 3300046529 Bacteria 1280
852 Ga0495652_0325645 3300046529 Bacteria 1108
853 Ga0495652_0346393 3300046529 Bacteria 1066
854 Ga0495665_0022228 3300046531 Bacteria 3409
855 Ga0495665_0143694 3300046531 Bacteria 1246
856 Ga0495640_0025633 3300046533 Bacteria 4273
857 Ga0495640_0068176 3300046533 Bacteria 2394
858 Ga0495586_0027285 3300046535 Bacteria 3056
859 Ga0495586_0583704 3300046535 Bacteria 645
860 Ga0495586_0647300 3300046535 Bacteria 610
861 Ga0495586_0754492 3300046535 Bacteria 561
862 Ga0495587_0050070 3300046536 Bacteria 2471
863 Ga0495587_0338538 3300046536 Bacteria 839
864 Ga0495598_0211432 3300046537 Bacteria 705
865 Ga0495621_0059231 3300046539 Bacteria 1387
866 Ga0495621_0115474 3300046539 Bacteria 1033
867 Ga0495621_0133107 3300046539 Bacteria 969
868 Ga0495621_0174986 3300046539 Bacteria 854
869 Ga0495645_0005439 3300046543 Bacteria 8741
870 Ga0495645_0017006 3300046543 Bacteria 5206
871 Ga0495645_0057856 3300046543 Bacteria 2813
872 Ga0495645_0217465 3300046543 Bacteria 1287
873 Ga0495622_0074613 3300046557 Bacteria 1564
874 Ga0495667_0113960 3300046559 Bacteria 1747
875 Ga0495667_0341704 3300046559 Bacteria 946
876 Ga0495667_0422824 3300046559 Bacteria 838
877 Ga0495634_0068620 3300046642 Bacteria 2341
878 Ga0495634_0076539 3300046642 Bacteria 2196
879 Ga0495634_0460080 3300046642 Bacteria 749
880 Ga0495635_0086714 3300046663 Bacteria 2142
881 Ga0495635_0105657 3300046663 Bacteria 1923
882 Ga0495635_0453472 3300046663 Bacteria 848
883 Ga0495659_0094401 3300046664 Bacteria 1152
884 Ga0495588_0041459 3300046674 Bacteria 2351
885 Ga0495657_0040563 3300046675 Bacteria 3192
886 Ga0495657_0068721 3300046675 Bacteria 2320
887 Ga0495657_0085760 3300046675 Bacteria 2029
888 Ga0495657_0537611 3300046675 Bacteria 679
889 Ga0495657_0558572 3300046675 Bacteria 664
890 Ga0495599_0002888 3300046678 Bacteria 9995
891 Ga0495599_0026654 3300046678 Bacteria 3623
892 Ga0495599_0149340 3300046678 Bacteria 1448
893 Ga0495623_0047566 3300046679 Bacteria 2723
894 Ga0495623_0631191 3300046679 Bacteria 554
895 Ga0495646_0014979 3300046680 Bacteria 4926
896 Ga0495647_0002471 3300046681 Bacteria 5840
897 Ga0495647_0008547 3300046681 Bacteria 3444
898 Ga0495658_0044428 3300046683 Bacteria 2489
899 Ga0495658_0122548 3300046683 Bacteria 1574
900 Ga0495658_0814862 3300046683 Bacteria 597
901 Ga0495669_0205120 3300046684 Bacteria 943
902 Ga0495613_0018189 3300046689 Bacteria 5239
903 Ga0495624_0104714 3300046690 Bacteria 1741
904 Ga0495600_0000916 3300046809 Bacteria 15803
905 Ga0495581_0009710 3300047315 Bacteria 5570
906 Ga0495604_0042840 3300047317 Bacteria 3545
907 Ga0495604_0085018 3300047317 Bacteria 2361
908 Ga0495604_0398243 3300047317 Bacteria 907
909 Ga0495636_0003634 3300047318 Bacteria 5988
910 Ga0495674_0202516 3300047319 Bacteria 1646
911 Ga0495680_0070233 3300047322 Bacteria 2671
912 Ga0495680_0631761 3300047322 Bacteria 713
913 Ga0495680_0631773 3300047322 Bacteria 713
914 Ga0495675_0012907 3300047444 Bacteria 5264
915 Ga0495675_0147540 3300047444 Bacteria 1455
916 Ga0495675_0467693 3300047444 Bacteria 727
917 Ga0495684_0041075 3300047471 Bacteria 3545
918 Ga0495686_0000248 3300047472 Bacteria 97017
919 Ga0495686_0044312 3300047472 Bacteria 2816
920 Ga0495593_0052595 3300047673 Bacteria 2152
921 Ga0495602_0078562 3300048088 Bacteria 2787
922 Ga0495602_0539921 3300048088 Bacteria 809
923 Ga0495602_0788261 3300048088 Bacteria 639
924 Ga0495614_0047249 3300048089 Bacteria 1846
925 Ga0496100_0203137 3300048903 Bacteria 1445
926 Ga0496101_0089547 3300048904 Bacteria 2287
927 Ga0496101_0419498 3300048904 Bacteria 1055
928 Ga0496102_0958535 3300048905 Bacteria 776
929 Ga0496102_1080148 3300048905 Bacteria 722
930 Ga0496102_1575481 3300048905 Bacteria 575
931 Ga0496103_0469964 3300048906 Bacteria 806
932 Ga0496104_0009650 3300048907 Bacteria 8596
933 Ga0496104_0210310 3300048907 Bacteria 1857
934 Ga0496105_0102103 3300048908 Bacteria 2368
935 Ga0496106_0272991 3300048909 Bacteria 1354
936 Ga0496106_0898634 3300048909 Bacteria 699
937 Ga0496107_0155182 3300048910 Bacteria 1695
938 Ga0496107_0349298 3300048910 Bacteria 1101
939 Ga0496107_0501178 3300048910 Bacteria 901
940 Ga0496107_1001937 3300048910 Bacteria 606
941 Ga0496108_0013970 3300048911 Bacteria 6550
942 Ga0496108_0187926 3300048911 Bacteria 1790
943 Ga0496108_0520627 3300048911 Bacteria 1038
944 Ga0496109_0011013 3300048912 Bacteria 7751
945 Ga0496109_0085357 3300048912 Bacteria 2914
946 Ga0496110_0595808 3300048913 Bacteria 1003
947 Ga0496110_0837121 3300048913 Bacteria 825
948 Ga0496110_1292361 3300048913 Bacteria 639
949 Ga0496110_1470886 3300048913 Unclassified 591
950 Ga0496111_0091997 3300048914 Bacteria 2223
951 Ga0496111_0484431 3300048914 Bacteria 911
952 Ga0496112_0005841 3300048915 Bacteria 10715
953 Ga0496112_0014201 3300048915 Bacteria 7381
954 Ga0496112_0234806 3300048915 Bacteria 1788
955 Ga0496112_0394210 3300048915 Bacteria 1325
956 Ga0496113_0298344 3300048916 Bacteria 1290
957 Ga0496113_0401697 3300048916 Bacteria 1100
958 Ga0496114_0012661 3300048917 Bacteria 6756
959 Ga0496114_0022120 3300048917 Bacteria 5179
960 Ga0496114_0022604 3300048917 Bacteria 5126
961 Ga0496114_0659150 3300048917 Bacteria 920
962 Ga0496114_1431973 3300048917 Unclassified 578
963 Ga0496115_0179858 3300048918 Bacteria 1749
964 Ga0496115_0248852 3300048918 Bacteria 1464
965 Ga0496115_0602332 3300048918 Bacteria 873
966 Ga0496124_0485288 3300048927 Bacteria 833
967 Ga0501298_033786 3300049521 Bacteria 1015
968 Ga0501031_0045354 3300049568 Bacteria 2868
969 Ga0501031_0070945 3300049568 Bacteria 2269
970 Ga0501032_0001741 3300049569 Bacteria 17208
971 Ga0501032_0023567 3300049569 Bacteria 4249
972 Ga0501032_0131161 3300049569 Bacteria 1653
973 Ga0501032_0729344 3300049569 Unclassified 627
974 Ga0501033_0000364 3300049570 Bacteria 43293
975 Ga0501033_0005262 3300049570 Bacteria 10267
976 Ga0501033_0010897 3300049570 Bacteria 6970
977 Ga0501033_0211631 3300049570 Bacteria 1382
978 Ga0501033_0775504 3300049570 Bacteria 649
979 Ga0501034_0005376 3300049571 Bacteria 14011
980 Ga0501034_0012071 3300049571 Bacteria 8931
981 Ga0501034_0138359 3300049571 Bacteria 2415
982 Ga0501036_0004793 3300049572 Bacteria 10935
983 Ga0501036_0006729 3300049572 Bacteria 9343
984 Ga0501036_0044802 3300049572 Bacteria 3748
985 Ga0501036_0117508 3300049572 Bacteria 2246
986 Ga0501036_0139132 3300049572 Bacteria 2049
987 Ga0501036_1081035 3300049572 Bacteria 655
988 Ga0501037_0000162 3300049573 Bacteria 62629
989 Ga0501037_0037962 3300049573 Bacteria 3551
990 Ga0501037_0124832 3300049573 Bacteria 1849
991 Ga0501037_0323169 3300049573 Bacteria 1068
992 Ga0501038_0003864 3300049574 Bacteria 13921
993 Ga0501038_0008423 3300049574 Bacteria 9485
994 Ga0501038_0071876 3300049574 Bacteria 2933
995 Ga0501038_0103831 3300049574 Bacteria 2363
996 Ga0501038_0124809 3300049574 Bacteria 2120
997 Ga0501038_0190761 3300049574 Bacteria 1649
998 Ga0501038_0232637 3300049574 Bacteria 1466
999 Ga0501038_0743440 3300049574 Bacteria 732
1000 Ga0501039_0003351 3300049575 Bacteria 11972
1001 Ga0501039_0008184 3300049575 Bacteria 7972
1002 Ga0501039_0035202 3300049575 Bacteria 3863
1003 Ga0501039_0046891 3300049575 Bacteria 3339
1004 Ga0501039_0199951 3300049575 Bacteria 1571
1005 Ga0501039_0215832 3300049575 Bacteria 1508
1006 Ga0501039_0595776 3300049575 Bacteria 866
1007 Ga0501040_0003740 3300049576 Bacteria 9860
1008 Ga0501040_0009844 3300049576 Bacteria 6242
1009 Ga0501040_0092397 3300049576 Bacteria 2104
1010 Ga0501040_0097200 3300049576 Bacteria 2051
1011 Ga0501041_0222845 3300049577 Bacteria 1183
1012 Ga0501041_0394962 3300049577 Bacteria 876
1013 Ga0501042_0000536 3300049578 Bacteria 19889
1014 Ga0501042_0018299 3300049578 Bacteria 4849
1015 Ga0501042_0196429 3300049578 Bacteria 1455
1016 Ga0501042_0342215 3300049578 Bacteria 1081
1017 Ga0501043_0022331 3300049579 Bacteria 4964
1018 Ga0501043_0060318 3300049579 Bacteria 2977
1019 Ga0501043_0224156 3300049579 Bacteria 1453
1020 Ga0501043_0245920 3300049579 Bacteria 1379
1021 Ga0501043_0304519 3300049579 Bacteria 1217
1022 Ga0501043_0362633 3300049579 Bacteria 1100
1023 Ga0501043_0419990 3300049579 Bacteria 1008
1024 Ga0501046_0026489 3300049580 Bacteria 4736
1025 Ga0501046_0068985 3300049580 Bacteria 2751
1026 Ga0501046_0101642 3300049580 Bacteria 2205
1027 Ga0501048_0008305 3300049582 Bacteria 7851
1028 Ga0501048_0056461 3300049582 Bacteria 2785
1029 Ga0501048_0119705 3300049582 Bacteria 1860
1030 Ga0501067_0213849 3300049583 Bacteria 1074
1031 Ga0501067_0597602 3300049583 Bacteria 619
1032 Ga0501068_0018157 3300049584 Bacteria 4072
1033 Ga0501068_0158079 3300049584 Bacteria 1428
1034 Ga0501068_0275918 3300049584 Bacteria 1074
1035 Ga0501068_0530611 3300049584 Bacteria 764
1036 Ga0501069_0719078 3300049585 Bacteria 603
1037 Ga0501071_0013396 3300049587 Bacteria 5587
1038 Ga0501071_0050832 3300049587 Bacteria 2986
1039 Ga0501071_0435034 3300049587 Bacteria 1003
1040 Ga0501072_0001399 3300049588 Bacteria 18156
1041 Ga0501072_0091526 3300049588 Bacteria 2415
1042 Ga0501072_0179258 3300049588 Bacteria 1690
1043 Ga0501072_0192537 3300049588 Bacteria 1626
1044 Ga0501072_0480728 3300049588 Bacteria 983
1045 Ga0501072_0750219 3300049588 Bacteria 766
1046 Ga0501073_0359056 3300049589 Bacteria 1006
1047 Ga0501074_0214122 3300049590 Bacteria 1372
1048 Ga0501074_0732549 3300049590 Bacteria 697
1049 Ga0501075_0010270 3300049591 Bacteria 6578
1050 Ga0501075_0023115 3300049591 Bacteria 4549
1051 Ga0501075_0239449 3300049591 Bacteria 1383
1052 Ga0501076_0012795 3300049592 Bacteria 6282
1053 Ga0501076_0014474 3300049592 Bacteria 5943
1054 Ga0501076_0019562 3300049592 Bacteria 5177
1055 Ga0501076_0342384 3300049592 Bacteria 1227
1056 Ga0501077_0011579 3300049593 Bacteria 5511
1057 Ga0501077_0108178 3300049593 Bacteria 1761
1058 Ga0501077_0163235 3300049593 Bacteria 1414
1059 Ga0501235_195656 3300049669 Bacteria 545
1060 Ga0501250_071032 3300049680 Bacteria 575
1061 Ga0501079_0004210 3300049741 Bacteria 10672
1062 Ga0501079_0077016 3300049741 Bacteria 2580
1063 Ga0501079_0390417 3300049741 Bacteria 1091
1064 Ga0501079_1381767 3300049741 Bacteria 554
1065 Ga0501080_0006958 3300049742 Bacteria 10203
1066 Ga0501080_0219411 3300049742 Bacteria 1741
1067 Ga0501080_0299631 3300049742 Bacteria 1458
1068 Ga0501081_0000465 3300049743 Bacteria 22458
1069 Ga0501081_0012671 3300049743 Bacteria 5544
1070 Ga0501081_0272525 3300049743 Bacteria 1238
1071 Ga0501081_0396329 3300049743 Bacteria 1022
1072 Ga0501083_0686660 3300049744 Bacteria 666
1073 Ga0501035_0005055 3300049822 Bacteria 12496
1074 Ga0501035_0010038 3300049822 Bacteria 8787
1075 Ga0501035_0025464 3300049822 Bacteria 5424
1076 Ga0501035_0060352 3300049822 Bacteria 3376
1077 Ga0501035_0084580 3300049822 Bacteria 2797
1078 Ga0501035_0093559 3300049822 Bacteria 2644
1079 Ga0501035_0137626 3300049822 Bacteria 2125
1080 Ga0501035_0147964 3300049822 Bacteria 2039
1081 Ga0501035_0161001 3300049822 Bacteria 1942
1082 Ga0501035_0274206 3300049822 Bacteria 1427
1083 Ga0501044_0000076 3300049823 Bacteria 120755
1084 Ga0501044_0001481 3300049823 Bacteria 27531
1085 Ga0501044_0003222 3300049823 Bacteria 18385
1086 Ga0501044_0012028 3300049823 Bacteria 9376
1087 Ga0501044_0043973 3300049823 Bacteria 4638
1088 Ga0501044_0269938 3300049823 Bacteria 1637
1089 Ga0501044_1011639 3300049823 Bacteria 703
1090 Ga0501045_0003218 3300049824 Bacteria 11170
1091 Ga0501045_0041989 3300049824 Bacteria 3328
1092 Ga0501045_0066885 3300049824 Bacteria 2638
1093 Ga0501045_0094485 3300049824 Bacteria 2211
1094 Ga0501045_0259793 3300049824 Bacteria 1292
1095 nmdc:mga05p37_529398_c1 3300050507 Bacteria 1346
1096 nmdc:mga05p37_732932_c1 3300050507 Bacteria 1092
1097 nmdc:mga09592_276772_c1 3300050508 Bacteria 1456
1098 nmdc:mga09592_538283_c1 3300050508 Bacteria 1004
1099 nmdc:mga0qj67_123797_c1 3300050509 Bacteria 2092
1100 nmdc:mga0qj67_549125_c1 3300050509 Bacteria 927
1101 nmdc:mga0qj67_6850_c1 3300050509 Bacteria 8379
1102 nmdc:mga0qj67_983108_c1 3300050509 Bacteria 663
1103 nmdc:mga06r32_1014_c1 3300050510 Bacteria 25210
1104 nmdc:mga06r32_308880_c1 3300050510 Bacteria 1567
1105 nmdc:mga08y16_176151_c1 3300050511 Bacteria 2221
1106 nmdc:mga08y16_19726_c1 3300050511 Bacteria 7109
1107 nmdc:mga08y16_3419_c1 3300050511 Bacteria 16470
1108 nmdc:mga0n895_163087_c1 3300050512 Bacteria 2260
1109 nmdc:mga0n895_367_c1 3300050512 Bacteria 30485
1110 nmdc:mga0n895_438924_c1 3300050512 Bacteria 1319
1111 nmdc:mga0rr50_148782_c1 3300050513 Bacteria 1890
1112 nmdc:mga0rr50_152767_c1 3300050513 Bacteria 1867
1113 nmdc:mga0rr50_158280_c1 3300050513 Bacteria 1836
1114 nmdc:mga0rr50_224730_c1 3300050513 Bacteria 1551
1115 nmdc:mga0rr50_244584_c1 3300050513 Bacteria 1488
1116 nmdc:mga0rr50_97397_c2 3300050513 Bacteria 1268
1117 nmdc:mga08x19_1118_c1 3300050514 Bacteria 16743
1118 nmdc:mga08x19_148673_c1 3300050514 Bacteria 1585
1119 nmdc:mga08x19_221693_c1 3300050514 Bacteria 1299
1120 nmdc:mga08x19_58041_c1 3300050514 Bacteria 2503
1121 nmdc:mga08x19_5900_c1 3300050514 Bacteria 7244
1122 nmdc:mga0a205_132541_c2 3300050515 Bacteria 777
1123 nmdc:mga0a205_363219_c1 3300050515 Bacteria 1314
1124 Ga0495601_0030722 3300053077 Bacteria 3337
1125 Ga0495601_0045721 3300053077 Bacteria 2754
1126 Ga0495601_0167414 3300053077 Bacteria 1436
1127 Ga0495601_0292879 3300053077 Bacteria 1061
1128 Ga0495612_0063075 3300053078 Bacteria 1537
1129 Ga0495612_0073781 3300053078 Bacteria 1426
1130 Ga0495595_0355333 3300053084 Bacteria 740
1131 Ga0495595_0370250 3300053084 Bacteria 724
1132 Ga0495595_0547639 3300053084 Bacteria 591
1133 Ga0495619_0008666 3300053085 Bacteria 6435
1134 Ga0495619_0087963 3300053085 Bacteria 2101
1135 Ga0495619_0267178 3300053085 Bacteria 1185
1136 Ga0500595_012640 3300053119 Bacteria 3257
1137 Ga0500574_009516 3300053141 Bacteria 2114
1138 Ga0501084_0021829 3300054114 Bacteria 5340
1139 Ga0501084_0410960 3300054114 Bacteria 1144
1140 Ga0501084_0599129 3300054114 Bacteria 931
1141 Ga0501082_0004016 3300060353 Bacteria 12841
1142 Ga0501082_0033898 3300060353 Bacteria 4404
1143 Ga0501082_0040072 3300060353 Bacteria 4041
1144 Ga0530510_0000170 3300061734 Bacteria 39521
1145 Ga0530510_0004733 3300061734 Bacteria 9418
1146 Ga0530510_1171410 3300061734 Bacteria 589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221603 2644028971 155
2 3300013297 Ga0157378_10393456 Ga0157378_103934563 156
3 3300048909 Ga0496106_0898634 Ga0496106_0898634_218_688 156
4 3300005330 Ga0070690_100315672 Ga0070690_1003156721 157
5 3300005335 Ga0070666_10647812 Ga0070666_106478122 157
6 3300005345 Ga0070692_10080451 Ga0070692_100804512 157
7 3300005440 Ga0070705_100013604 Ga0070705_1000136048 157
8 3300005444 Ga0070694_100025031 Ga0070694_1000250312 157
9 3300005444 Ga0070694_100329843 Ga0070694_1003298431 157
10 3300005458 Ga0070681_10014534 Ga0070681_100145342 157
11 3300005518 Ga0070699_100009169 Ga0070699_1000091692 157
12 3300005546 Ga0070696_100051826 Ga0070696_1000518263 157
13 3300005549 Ga0070704_100044797 Ga0070704_1000447973 157
14 3300005549 Ga0070704_100127247 Ga0070704_1001272472 157
15 3300005549 Ga0070704_100226850 Ga0070704_1002268502 157
16 3300005614 Ga0068856_100505285 Ga0068856_1005052852 157
17 3300005616 Ga0068852_101708142 Ga0068852_1017081421 157
18 3300005617 Ga0068859_100564936 Ga0068859_1005649362 157
19 3300005985 Ga0081539_10000805 Ga0081539_1000080556 157
20 3300006846 Ga0075430_100021691 Ga0075430_1000216915 157
21 3300006846 Ga0075430_100022384 Ga0075430_1000223848 157
22 3300006852 Ga0075433_10487354 Ga0075433_104873542 157
23 3300006871 Ga0075434_100000484 Ga0075434_10000048427 157
24 3300006880 Ga0075429_100167210 Ga0075429_1001672102 157
25 3300006914 Ga0075436_100000593 Ga0075436_10000059311 157
26 3300006914 Ga0075436_100030087 Ga0075436_1000300875 157
27 3300006914 Ga0075436_100046822 Ga0075436_1000468224 157
28 3300006914 Ga0075436_100148145 Ga0075436_1001481453 157
29 3300006914 Ga0075436_100292335 Ga0075436_1002923352 157
30 3300006914 Ga0075436_100340350 Ga0075436_1003403502 157
31 3300006931 Ga0097620_100564943 Ga0097620_1005649432 157
32 3300007076 Ga0075435_100177974 Ga0075435_1001779742 157
33 3300007076 Ga0075435_100213264 Ga0075435_1002132642 157
34 3300007265 Ga0099794_10038371 Ga0099794_100383712 157
35 3300007265 Ga0099794_10090944 Ga0099794_100909442 157
36 3300007265 Ga0099794_10189342 Ga0099794_101893422 157
37 3300007788 Ga0099795_10039408 Ga0099795_100394081 157
38 3300009147 Ga0114129_10993796 Ga0114129_109937962 157
39 3300010159 Ga0099796_10025359 Ga0099796_100253592 157
40 3300013307 Ga0157372_10617056 Ga0157372_106170562 157
41 3300025898 Ga0207692_10917195 Ga0207692_109171951 157
42 3300025912 Ga0207707_10017447 Ga0207707_100174476 157
43 3300025917 Ga0207660_10654290 Ga0207660_106542901 157
44 3300025939 Ga0207665_10048319 Ga0207665_100483192 157
45 3300025944 Ga0207661_11387302 Ga0207661_113873022 157
46 3300026078 Ga0207702_10796015 Ga0207702_107960152 157
47 3300027543 Ga0209999_1049327 Ga0209999_10493271 157
48 3300027671 Ga0209588_1003394 Ga0209588_10033942 157
49 3300027671 Ga0209588_1096392 Ga0209588_10963922 157
50 3300032002 Ga0307416_101158796 Ga0307416_1011587962 157
51 3300033179 Ga0307507_10082957 Ga0307507_100829571 157
52 3300035086 Ga0373934_0019815 Ga0373934_0019815_223_696 157
53 3300035111 Ga0373923_0270828 Ga0373923_0270828_165_638 157
54 3300035117 Ga0373953_0037940 Ga0373953_0037940_990_1463 157
55 3300035118 Ga0373954_0002636 Ga0373954_0002636_361_834 157
56 3300035118 Ga0373954_0048171 Ga0373954_0048171_440_913 157
57 3300035118 Ga0373954_0056289 Ga0373954_0056289_1214_1687 157
58 3300035119 Ga0373956_0000615 Ga0373956_0000615_2591_3064 157
59 3300035119 Ga0373956_0199774 Ga0373956_0199774_227_700 157
60 3300035119 Ga0373956_0454136 Ga0373956_0454136_121_594 157
61 3300035120 Ga0373957_0001592 Ga0373957_0001592_5354_5827 157
62 3300035172 Ga0373955_0250107 Ga0373955_0250107_165_638 157
63 3300035410 Ga0373924_0032663 Ga0373924_0032663_1338_1811 157
64 3300035691 Ga0373931_0463267 Ga0373931_0463267_31_504 157
65 3300035692 Ga0373935_0571033 Ga0373935_0571033_164_637 157
66 3300035724 Ga0373933_0024477 Ga0373933_0024477_1454_1927 157
67 3300036401 Ga0373937_0001406 Ga0373937_0001406_1524_1997 157
68 3300036401 Ga0373937_0450001 Ga0373937_0450001_405_878 157
69 3300037068 Ga0373925_0201818 Ga0373925_0201818_615_1088 157
70 3300038996 Ga0242420_013094 Ga0242420_013094_452_925 157
71 3300041404 Ga0439436_0128967 Ga0439436_0128967_42_515 157
72 3300042876 Ga0451577_0317631 Ga0451577_0317631_387_860 157
73 3300044673 Ga0453683_0125552 Ga0453683_0125552_424_897 157
74 3300044712 Ga0453684_0792130 Ga0453684_0792130_177_650 157
75 3300045976 Ga0466967_1056839 Ga0466967_1056839_287_760 157
76 3300046454 Ga0495592_0005285 Ga0495592_0005285_8749_9222 157
77 3300046454 Ga0495592_0110125 Ga0495592_0110125_865_1338 157
78 3300046454 Ga0495592_0120496 Ga0495592_0120496_397_870 157
79 3300046454 Ga0495592_0357605 Ga0495592_0357605_354_827 157
80 3300046461 Ga0495641_0015988 Ga0495641_0015988_2539_3012 157
81 3300046462 Ga0495651_0002995 Ga0495651_0002995_7000_7473 157
82 3300046463 Ga0495653_0259517 Ga0495653_0259517_552_1025 157
83 3300046475 Ga0495639_0069678 Ga0495639_0069678_132_605 157
84 3300046477 Ga0495664_0146787 Ga0495664_0146787_779_1252 157
85 3300046511 Ga0495608_0080156 Ga0495608_0080156_1465_1938 157
86 3300046511 Ga0495608_0288797 Ga0495608_0288797_223_696 157
87 3300046514 Ga0495618_0508427 Ga0495618_0508427_44_517 157
88 3300046516 Ga0495628_0004647 Ga0495628_0004647_4165_4638 157
89 3300046516 Ga0495628_0020880 Ga0495628_0020880_4182_4655 157
90 3300046516 Ga0495628_0117806 Ga0495628_0117806_774_1247 157
91 3300046516 Ga0495628_0594943 Ga0495628_0594943_104_577 157
92 3300046517 Ga0495630_0039136 Ga0495630_0039136_644_1117 157
93 3300046517 Ga0495630_0139652 Ga0495630_0139652_526_999 157
94 3300046526 Ga0495666_0007731 Ga0495666_0007731_105_578 157
95 3300046529 Ga0495652_0035269 Ga0495652_0035269_1325_1798 157
96 3300046529 Ga0495652_0139381 Ga0495652_0139381_1302_1775 157
97 3300046529 Ga0495652_0260501 Ga0495652_0260501_528_1001 157
98 3300046529 Ga0495652_0325645 Ga0495652_0325645_84_557 157
99 3300046531 Ga0495665_0143694 Ga0495665_0143694_678_1151 157
100 3300046533 Ga0495640_0068176 Ga0495640_0068176_1503_1976 157
101 3300046535 Ga0495586_0583704 Ga0495586_0583704_53_526 157
102 3300046535 Ga0495586_0647300 Ga0495586_0647300_102_575 157
103 3300046535 Ga0495586_0754492 Ga0495586_0754492_14_487 157
104 3300046536 Ga0495587_0050070 Ga0495587_0050070_172_645 157
105 3300046536 Ga0495587_0338538 Ga0495587_0338538_113_586 157
106 3300046543 Ga0495645_0005439 Ga0495645_0005439_7366_7839 157
107 3300046559 Ga0495667_0113960 Ga0495667_0113960_297_770 157
108 3300046559 Ga0495667_0422824 Ga0495667_0422824_90_563 157
109 3300046642 Ga0495634_0068620 Ga0495634_0068620_120_593 157
110 3300046642 Ga0495634_0460080 Ga0495634_0460080_120_593 157
111 3300046663 Ga0495635_0086714 Ga0495635_0086714_1072_1545 157
112 3300046675 Ga0495657_0040563 Ga0495657_0040563_1052_1525 157
113 3300046675 Ga0495657_0085760 Ga0495657_0085760_65_538 157
114 3300046675 Ga0495657_0537611 Ga0495657_0537611_66_539 157
115 3300046678 Ga0495599_0002888 Ga0495599_0002888_5085_5558 157
116 3300046679 Ga0495623_0631191 Ga0495623_0631191_67_540 157
117 3300046681 Ga0495647_0002471 Ga0495647_0002471_119_592 157
118 3300046683 Ga0495658_0814862 Ga0495658_0814862_12_485 157
119 3300047317 Ga0495604_0042840 Ga0495604_0042840_2648_3121 157
120 3300047318 Ga0495636_0003634 Ga0495636_0003634_3777_4250 157
121 3300047322 Ga0495680_0631761 Ga0495680_0631761_218_691 157
122 3300047322 Ga0495680_0631773 Ga0495680_0631773_23_496 157
123 3300047444 Ga0495675_0012907 Ga0495675_0012907_427_900 157
124 3300047444 Ga0495675_0467693 Ga0495675_0467693_147_620 157
125 3300048088 Ga0495602_0788261 Ga0495602_0788261_112_585 157
126 3300049575 Ga0501039_0046891 Ga0501039_0046891_2755_3228 157
127 3300049575 Ga0501039_0595776 Ga0501039_0595776_247_720 157
128 3300049576 Ga0501040_0097200 Ga0501040_0097200_948_1421 157
129 3300049577 Ga0501041_0394962 Ga0501041_0394962_301_774 157
130 3300049578 Ga0501042_0342215 Ga0501042_0342215_348_821 157
131 3300049582 Ga0501048_0056461 Ga0501048_0056461_1933_2406 157
132 3300049583 Ga0501067_0213849 Ga0501067_0213849_365_838 157
133 3300049584 Ga0501068_0158079 Ga0501068_0158079_714_1187 157
134 3300049587 Ga0501071_0013396 Ga0501071_0013396_4931_5404 157
135 3300049588 Ga0501072_0001399 Ga0501072_0001399_980_1453 157
136 3300049588 Ga0501072_0179258 Ga0501072_0179258_1175_1648 157
137 3300049588 Ga0501072_0480728 Ga0501072_0480728_57_530 157
138 3300049590 Ga0501074_0214122 Ga0501074_0214122_268_741 157
139 3300049591 Ga0501075_0023115 Ga0501075_0023115_1571_2044 157
140 3300049592 Ga0501076_0012795 Ga0501076_0012795_4484_4957 157
141 3300049593 Ga0501077_0108178 Ga0501077_0108178_237_710 157
142 3300049741 Ga0501079_0390417 Ga0501079_0390417_96_569 157
143 3300049742 Ga0501080_0299631 Ga0501080_0299631_186_659 157
144 3300049743 Ga0501081_0012671 Ga0501081_0012671_2088_2561 157
145 3300049744 Ga0501083_0686660 Ga0501083_0686660_58_531 157
146 3300049822 Ga0501035_0137626 Ga0501035_0137626_1060_1533 157
147 3300049823 Ga0501044_1011639 Ga0501044_1011639_177_650 157
148 3300049824 Ga0501045_0066885 Ga0501045_0066885_1044_1517 157
149 3300050508 nmdc:mga09592_538283_c1 nmdc:mga09592_538283_c1_494_967 157
150 3300050509 nmdc:mga0qj67_123797_c1 nmdc:mga0qj67_123797_c1_975_1448 157
151 3300050509 nmdc:mga0qj67_549125_c1 nmdc:mga0qj67_549125_c1_23_496 157
152 3300050509 nmdc:mga0qj67_6850_c1 nmdc:mga0qj67_6850_c1_4704_5177 157
153 3300050510 nmdc:mga06r32_308880_c1 nmdc:mga06r32_308880_c1_842_1315 157
154 3300050512 nmdc:mga0n895_367_c1 nmdc:mga0n895_367_c1_26205_26678 157
155 3300050513 nmdc:mga0rr50_158280_c1 nmdc:mga0rr50_158280_c1_433_906 157
156 3300050513 nmdc:mga0rr50_97397_c2 nmdc:mga0rr50_97397_c2_321_794 157
157 3300050514 nmdc:mga08x19_1118_c1 nmdc:mga08x19_1118_c1_13571_14044 157
158 3300050514 nmdc:mga08x19_148673_c1 nmdc:mga08x19_148673_c1_693_1166 157
159 3300050514 nmdc:mga08x19_221693_c1 nmdc:mga08x19_221693_c1_392_865 157
160 3300050514 nmdc:mga08x19_58041_c1 nmdc:mga08x19_58041_c1_1333_1806 157
161 3300050514 nmdc:mga08x19_5900_c1 nmdc:mga08x19_5900_c1_6440_6913 157
162 3300053077 Ga0495601_0030722 Ga0495601_0030722_2148_2621 157
163 3300053077 Ga0495601_0167414 Ga0495601_0167414_107_580 157
164 3300053085 Ga0495619_0267178 Ga0495619_0267178_124_597 157
165 3300054114 Ga0501084_0410960 Ga0501084_0410960_317_790 157
166 3300060353 Ga0501082_0033898 Ga0501082_0033898_2844_3317 157
167 3300061734 Ga0530510_0000170 Ga0530510_0000170_18992_19465 157
168 3300061734 Ga0530510_1171410 Ga0530510_1171410_81_554 157
169 3300005330 Ga0070690_100074179 Ga0070690_1000741792 158
170 3300005330 Ga0070690_101056408 Ga0070690_1010564081 158
171 3300005330 Ga0070690_101201813 Ga0070690_1012018131 158
172 3300005331 Ga0070670_100117661 Ga0070670_1001176612 158
173 3300005334 Ga0068869_100012083 Ga0068869_1000120832 158
174 3300005334 Ga0068869_101394355 Ga0068869_1013943551 158
175 3300005337 Ga0070682_100105552 Ga0070682_1001055522 158
176 3300005338 Ga0068868_100452445 Ga0068868_1004524452 158
177 3300005339 Ga0070660_100381078 Ga0070660_1003810782 158
178 3300005339 Ga0070660_101249062 Ga0070660_1012490621 158
179 3300005340 Ga0070689_100066936 Ga0070689_1000669362 158
180 3300005344 Ga0070661_100707818 Ga0070661_1007078182 158
181 3300005345 Ga0070692_10473969 Ga0070692_104739692 158
182 3300005347 Ga0070668_100795725 Ga0070668_1007957252 158
183 3300005353 Ga0070669_100137721 Ga0070669_1001377212 158
184 3300005356 Ga0070674_100078199 Ga0070674_1000781993 158
185 3300005366 Ga0070659_100040641 Ga0070659_1000406413 158
186 3300005366 Ga0070659_100298389 Ga0070659_1002983892 158
187 3300005367 Ga0070667_100620974 Ga0070667_1006209742 158
188 3300005367 Ga0070667_101086518 Ga0070667_1010865182 158
189 3300005438 Ga0070701_10081040 Ga0070701_100810402 158
190 3300005441 Ga0070700_100513667 Ga0070700_1005136671 158
191 3300005444 Ga0070694_100007797 Ga0070694_1000077974 158
192 3300005444 Ga0070694_100011859 Ga0070694_1000118594 158
193 3300005455 Ga0070663_100489892 Ga0070663_1004898922 158
194 3300005455 Ga0070663_101637777 Ga0070663_1016377771 158
195 3300005456 Ga0070678_100292288 Ga0070678_1002922882 158
196 3300005456 Ga0070678_101065516 Ga0070678_1010655161 158
197 3300005457 Ga0070662_100073181 Ga0070662_1000731812 158
198 3300005457 Ga0070662_100077812 Ga0070662_1000778122 158
199 3300005457 Ga0070662_100428966 Ga0070662_1004289661 158
200 3300005459 Ga0068867_101001466 Ga0068867_1010014662 158
201 3300005459 Ga0068867_101489589 Ga0068867_1014895891 158
202 3300005466 Ga0070685_10135317 Ga0070685_101353172 158
203 3300005518 Ga0070699_100530270 Ga0070699_1005302702 158
204 3300005518 Ga0070699_100618637 Ga0070699_1006186372 158
205 3300005536 Ga0070697_101109239 Ga0070697_1011092391 158
206 3300005539 Ga0068853_100811959 Ga0068853_1008119591 158
207 3300005543 Ga0070672_100697281 Ga0070672_1006972812 158
208 3300005544 Ga0070686_100095690 Ga0070686_1000956902 158
209 3300005544 Ga0070686_100461823 Ga0070686_1004618232 158
210 3300005545 Ga0070695_100095580 Ga0070695_1000955802 158
211 3300005545 Ga0070695_101396607 Ga0070695_1013966071 158
212 3300005546 Ga0070696_100250352 Ga0070696_1002503522 158
213 3300005546 Ga0070696_100318204 Ga0070696_1003182041 158
214 3300005547 Ga0070693_100194827 Ga0070693_1001948272 158
215 3300005548 Ga0070665_100235316 Ga0070665_1002353162 158
216 3300005549 Ga0070704_100173908 Ga0070704_1001739082 158
217 3300005549 Ga0070704_100198723 Ga0070704_1001987232 158
218 3300005578 Ga0068854_100478558 Ga0068854_1004785582 158
219 3300005615 Ga0070702_100165943 Ga0070702_1001659432 158
220 3300005615 Ga0070702_100663916 Ga0070702_1006639162 158
221 3300005617 Ga0068859_100004143 Ga0068859_1000041432 158
222 3300005618 Ga0068864_100075317 Ga0068864_1000753172 158
223 3300005718 Ga0068866_10025262 Ga0068866_100252622 158
224 3300005718 Ga0068866_10912206 Ga0068866_109122061 158
225 3300005719 Ga0068861_100111242 Ga0068861_1001112422 158
226 3300005841 Ga0068863_100024216 Ga0068863_1000242168 158
227 3300005842 Ga0068858_100125407 Ga0068858_1001254073 158
228 3300005844 Ga0068862_100140937 Ga0068862_1001409372 158
229 3300006163 Ga0070715_10260604 Ga0070715_102606042 158
230 3300006173 Ga0070716_100165349 Ga0070716_1001653492 158
231 3300006237 Ga0097621_100008534 Ga0097621_1000085342 158
232 3300006237 Ga0097621_101195491 Ga0097621_1011954912 158
233 3300006358 Ga0068871_100076099 Ga0068871_1000760993 158
234 3300006881 Ga0068865_100082328 Ga0068865_1000823282 158
235 3300006931 Ga0097620_100004143 Ga0097620_1000041432 158
236 3300009094 Ga0111539_10016781 Ga0111539_100167812 158
237 3300009094 Ga0111539_10932848 Ga0111539_109328482 158
238 3300009098 Ga0105245_10209682 Ga0105245_102096822 158
239 3300009098 Ga0105245_10451951 Ga0105245_104519512 158
240 3300009101 Ga0105247_10344858 Ga0105247_103448582 158
241 3300009148 Ga0105243_10666547 Ga0105243_106665472 158
242 3300009148 Ga0105243_11482630 Ga0105243_114826301 158
243 3300009176 Ga0105242_10602608 Ga0105242_106026082 158
244 3300009177 Ga0105248_10002218 Ga0105248_100022181 158
245 3300009545 Ga0105237_11090568 Ga0105237_110905682 158
246 3300009551 Ga0105238_11259084 Ga0105238_112590841 158
247 3300009553 Ga0105249_10821374 Ga0105249_108213742 158
248 3300010375 Ga0105239_11048648 Ga0105239_110486481 158
249 3300013100 Ga0157373_10358395 Ga0157373_103583952 158
250 3300013102 Ga0157371_11066066 Ga0157371_110660661 158
251 3300013296 Ga0157374_10150237 Ga0157374_101502373 158
252 3300013296 Ga0157374_10264089 Ga0157374_102640892 158
253 3300013297 Ga0157378_10051663 Ga0157378_100516633 158
254 3300013297 Ga0157378_11137268 Ga0157378_111372682 158
255 3300013306 Ga0163162_10140906 Ga0163162_101409062 158
256 3300013308 Ga0157375_10011033 Ga0157375_100110337 158
257 3300013308 Ga0157375_10374368 Ga0157375_103743682 158
258 3300014326 Ga0157380_10108260 Ga0157380_101082602 158
259 3300014326 Ga0157380_10183103 Ga0157380_101831031 158
260 3300014968 Ga0157379_10245270 Ga0157379_102452702 158
261 3300014969 Ga0157376_10033466 Ga0157376_100334663 158
262 3300017792 Ga0163161_10013389 Ga0163161_100133892 158
263 3300025899 Ga0207642_10052105 Ga0207642_100521052 158
264 3300025900 Ga0207710_10287665 Ga0207710_102876652 158
265 3300025908 Ga0207643_10090879 Ga0207643_100908792 158
266 3300025910 Ga0207684_11708245 Ga0207684_117082451 158
267 3300025925 Ga0207650_11516181 Ga0207650_115161811 158
268 3300025926 Ga0207659_10036324 Ga0207659_100363243 158
269 3300025926 Ga0207659_10662271 Ga0207659_106622712 158
270 3300025927 Ga0207687_10170079 Ga0207687_101700792 158
271 3300025932 Ga0207690_10131805 Ga0207690_101318052 158
272 3300025932 Ga0207690_10406579 Ga0207690_104065791 158
273 3300025933 Ga0207706_10029707 Ga0207706_100297074 158
274 3300025933 Ga0207706_10145093 Ga0207706_101450932 158
275 3300025933 Ga0207706_10326444 Ga0207706_103264442 158
276 3300025933 Ga0207706_11010902 Ga0207706_110109021 158
277 3300025934 Ga0207686_10374764 Ga0207686_103747642 158
278 3300025936 Ga0207670_10195194 Ga0207670_101951942 158
279 3300025936 Ga0207670_10256476 Ga0207670_102564762 158
280 3300025937 Ga0207669_10354658 Ga0207669_103546582 158
281 3300025937 Ga0207669_10695343 Ga0207669_106953432 158
282 3300025940 Ga0207691_10170606 Ga0207691_101706062 158
283 3300025941 Ga0207711_10144793 Ga0207711_101447932 158
284 3300025942 Ga0207689_10001526 Ga0207689_1000152612 158
285 3300025960 Ga0207651_10728505 Ga0207651_107285052 158
286 3300025972 Ga0207668_10371735 Ga0207668_103717352 158
287 3300025986 Ga0207658_10121457 Ga0207658_101214571 158
288 3300025986 Ga0207658_10688705 Ga0207658_106887051 158
289 3300026023 Ga0207677_10097557 Ga0207677_100975572 158
290 3300026023 Ga0207677_10644287 Ga0207677_106442872 158
291 3300026035 Ga0207703_10974247 Ga0207703_109742472 158
292 3300026067 Ga0207678_10223448 Ga0207678_102234481 158
293 3300026088 Ga0207641_10033425 Ga0207641_100334256 158
294 3300026089 Ga0207648_10023103 Ga0207648_100231035 158
295 3300026089 Ga0207648_10722118 Ga0207648_107221182 158
296 3300026095 Ga0207676_10050997 Ga0207676_100509973 158
297 3300026118 Ga0207675_100028790 Ga0207675_1000287903 158
298 3300026121 Ga0207683_10051897 Ga0207683_100518972 158
299 3300026142 Ga0207698_10284124 Ga0207698_102841242 158
300 3300027512 Ga0209179_1070318 Ga0209179_10703182 158
301 3300028380 Ga0268265_10099483 Ga0268265_100994832 158
302 3300028381 Ga0268264_10037732 Ga0268264_100377325 158
303 3300028381 Ga0268264_10646841 Ga0268264_106468411 158
304 3300032004 Ga0307414_10235708 Ga0307414_102357081 158
305 3300035113 Ga0373936_0060619 Ga0373936_0060619_960_1436 158
306 3300035115 Ga0373941_0039851 Ga0373941_0039851_911_1396 158
307 3300035170 Ga0373943_0444095 Ga0373943_0444095_188_664 158
308 3300035171 Ga0373946_0282720 Ga0373946_0282720_133_609 158
309 3300035692 Ga0373935_0269439 Ga0373935_0269439_617_1093 158
310 3300035695 Ga0373927_0343639 Ga0373927_0343639_303_779 158
311 3300037068 Ga0373925_0152252 Ga0373925_0152252_912_1388 158
312 3300037418 Ga0395900_0088037 Ga0395900_0088037_168_644 158
313 3300038443 Ga0395901_0449952 Ga0395901_0449952_674_1150 158
314 3300042006 Ga0439432_076975 Ga0439432_076975_220_696 158
315 3300044712 Ga0453684_0426012 Ga0453684_0426012_212_688 158
316 3300044712 Ga0453684_0637922 Ga0453684_0637922_670_1146 158
317 3300045051 Ga0451576_0342806 Ga0451576_0342806_727_1203 158
318 3300048907 Ga0496104_0210310 Ga0496104_0210310_131_607 158
319 3300048909 Ga0496106_0272991 Ga0496106_0272991_234_710 158
320 3300048910 Ga0496107_0349298 Ga0496107_0349298_174_650 158
321 3300048911 Ga0496108_0013970 Ga0496108_0013970_5706_6182 158
322 3300048911 Ga0496108_0187926 Ga0496108_0187926_1106_1582 158
323 3300048912 Ga0496109_0011013 Ga0496109_0011013_4146_4622 158
324 3300048913 Ga0496110_0837121 Ga0496110_0837121_189_665 158
325 3300048915 Ga0496112_0234806 Ga0496112_0234806_944_1420 158
326 3300048917 Ga0496114_0012661 Ga0496114_0012661_4996_5472 158
327 3300048917 Ga0496114_0022120 Ga0496114_0022120_64_540 158
328 3300048917 Ga0496114_0659150 Ga0496114_0659150_407_883 158
329 3300048918 Ga0496115_0179858 Ga0496115_0179858_1024_1500 158
330 3300049521 Ga0501298_033786 Ga0501298_033786_286_762 158
331 3300049568 Ga0501031_0045354 Ga0501031_0045354_288_764 158
332 3300049568 Ga0501031_0070945 Ga0501031_0070945_1719_2195 158
333 3300049569 Ga0501032_0001741 Ga0501032_0001741_7960_8436 158
334 3300049569 Ga0501032_0023567 Ga0501032_0023567_145_621 158
335 3300049569 Ga0501032_0131161 Ga0501032_0131161_790_1266 158
336 3300049569 Ga0501032_0729344 Ga0501032_0729344_135_611 158
337 3300049570 Ga0501033_0000364 Ga0501033_0000364_7765_8241 158
338 3300049570 Ga0501033_0005262 Ga0501033_0005262_8953_9429 158
339 3300049570 Ga0501033_0010897 Ga0501033_0010897_3068_3544 158
340 3300049570 Ga0501033_0211631 Ga0501033_0211631_842_1318 158
341 3300049570 Ga0501033_0775504 Ga0501033_0775504_156_632 158
342 3300049571 Ga0501034_0005376 Ga0501034_0005376_4539_5015 158
343 3300049571 Ga0501034_0012071 Ga0501034_0012071_7959_8435 158
344 3300049571 Ga0501034_0138359 Ga0501034_0138359_148_624 158
345 3300049572 Ga0501036_0004793 Ga0501036_0004793_4329_4805 158
346 3300049572 Ga0501036_0006729 Ga0501036_0006729_6328_6804 158
347 3300049572 Ga0501036_0044802 Ga0501036_0044802_1138_1614 158
348 3300049572 Ga0501036_0117508 Ga0501036_0117508_364_840 158
349 3300049572 Ga0501036_0139132 Ga0501036_0139132_339_815 158
350 3300049572 Ga0501036_1081035 Ga0501036_1081035_129_605 158
351 3300049573 Ga0501037_0000162 Ga0501037_0000162_54195_54671 158
352 3300049573 Ga0501037_0037962 Ga0501037_0037962_1352_1828 158
353 3300049573 Ga0501037_0124832 Ga0501037_0124832_1003_1479 158
354 3300049573 Ga0501037_0323169 Ga0501037_0323169_66_542 158
355 3300049574 Ga0501038_0003864 Ga0501038_0003864_9006_9482 158
356 3300049574 Ga0501038_0008423 Ga0501038_0008423_6482_6958 158
357 3300049574 Ga0501038_0071876 Ga0501038_0071876_1461_1937 158
358 3300049574 Ga0501038_0103831 Ga0501038_0103831_687_1163 158
359 3300049574 Ga0501038_0190761 Ga0501038_0190761_627_1103 158
360 3300049574 Ga0501038_0232637 Ga0501038_0232637_24_500 158
361 3300049575 Ga0501039_0003351 Ga0501039_0003351_9381_9857 158
362 3300049575 Ga0501039_0035202 Ga0501039_0035202_3122_3598 158
363 3300049575 Ga0501039_0199951 Ga0501039_0199951_751_1227 158
364 3300049575 Ga0501039_0215832 Ga0501039_0215832_581_1057 158
365 3300049576 Ga0501040_0003740 Ga0501040_0003740_1439_1915 158
366 3300049576 Ga0501040_0009844 Ga0501040_0009844_150_626 158
367 3300049577 Ga0501041_0222845 Ga0501041_0222845_467_943 158
368 3300049578 Ga0501042_0000536 Ga0501042_0000536_5208_5684 158
369 3300049578 Ga0501042_0196429 Ga0501042_0196429_637_1113 158
370 3300049579 Ga0501043_0022331 Ga0501043_0022331_1884_2360 158
371 3300049579 Ga0501043_0060318 Ga0501043_0060318_2005_2481 158
372 3300049579 Ga0501043_0224156 Ga0501043_0224156_287_763 158
373 3300049579 Ga0501043_0245920 Ga0501043_0245920_545_1021 158
374 3300049579 Ga0501043_0304519 Ga0501043_0304519_622_1098 158
375 3300049579 Ga0501043_0362633 Ga0501043_0362633_36_512 158
376 3300049580 Ga0501046_0026489 Ga0501046_0026489_1452_1928 158
377 3300049580 Ga0501046_0068985 Ga0501046_0068985_497_973 158
378 3300049580 Ga0501046_0101642 Ga0501046_0101642_400_876 158
379 3300049582 Ga0501048_0008305 Ga0501048_0008305_1219_1695 158
380 3300049582 Ga0501048_0119705 Ga0501048_0119705_347_823 158
381 3300049584 Ga0501068_0018157 Ga0501068_0018157_1078_1554 158
382 3300049584 Ga0501068_0530611 Ga0501068_0530611_45_521 158
383 3300049587 Ga0501071_0435034 Ga0501071_0435034_278_754 158
384 3300049588 Ga0501072_0091526 Ga0501072_0091526_247_723 158
385 3300049589 Ga0501073_0359056 Ga0501073_0359056_397_873 158
386 3300049591 Ga0501075_0010270 Ga0501075_0010270_1349_1825 158
387 3300049591 Ga0501075_0239449 Ga0501075_0239449_300_776 158
388 3300049592 Ga0501076_0014474 Ga0501076_0014474_5432_5908 158
389 3300049592 Ga0501076_0342384 Ga0501076_0342384_716_1192 158
390 3300049593 Ga0501077_0011579 Ga0501077_0011579_1989_2465 158
391 3300049669 Ga0501235_195656 Ga0501235_195656_43_519 158
392 3300049680 Ga0501250_071032 Ga0501250_071032_39_515 158
393 3300049741 Ga0501079_0077016 Ga0501079_0077016_1102_1578 158
394 3300049741 Ga0501079_1381767 Ga0501079_1381767_56_532 158
395 3300049742 Ga0501080_0006958 Ga0501080_0006958_7522_7998 158
396 3300049743 Ga0501081_0272525 Ga0501081_0272525_661_1137 158
397 3300049743 Ga0501081_0396329 Ga0501081_0396329_41_517 158
398 3300049822 Ga0501035_0005055 Ga0501035_0005055_12009_12485 158
399 3300049822 Ga0501035_0025464 Ga0501035_0025464_4564_5040 158
400 3300049822 Ga0501035_0060352 Ga0501035_0060352_403_879 158
401 3300049822 Ga0501035_0084580 Ga0501035_0084580_317_793 158
402 3300049822 Ga0501035_0093559 Ga0501035_0093559_659_1135 158
403 3300049822 Ga0501035_0147964 Ga0501035_0147964_310_786 158
404 3300049823 Ga0501044_0001481 Ga0501044_0001481_2981_3457 158
405 3300049823 Ga0501044_0003222 Ga0501044_0003222_3122_3598 158
406 3300049823 Ga0501044_0043973 Ga0501044_0043973_2989_3465 158
407 3300049823 Ga0501044_0269938 Ga0501044_0269938_1147_1623 158
408 3300049824 Ga0501045_0003218 Ga0501045_0003218_2764_3240 158
409 3300049824 Ga0501045_0041989 Ga0501045_0041989_2481_2957 158
410 3300049824 Ga0501045_0259793 Ga0501045_0259793_175_651 158
411 3300050511 nmdc:mga08y16_19726_c1 nmdc:mga08y16_19726_c1_5553_6029 158
412 3300050511 nmdc:mga08y16_3419_c1 nmdc:mga08y16_3419_c1_3164_3640 158
413 3300054114 Ga0501084_0021829 Ga0501084_0021829_4430_4906 158
414 3300060353 Ga0501082_0040072 Ga0501082_0040072_3088_3564 158
415 3300061734 Ga0530510_0004733 Ga0530510_0004733_5535_6011 158
416 iso_pu_bacteria 2721755763 2723877061 158
417 3300005343 Ga0070687_100021059 Ga0070687_1000210592 159
418 3300005536 Ga0070697_100002415 Ga0070697_10000241512 159
419 3300005546 Ga0070696_100431838 Ga0070696_1004318382 159
420 3300006358 Ga0068871_100666348 Ga0068871_1006663482 159
421 3300007265 Ga0099794_10100975 Ga0099794_101009752 159
422 3300009094 Ga0111539_10151848 Ga0111539_101518482 159
423 3300009553 Ga0105249_11106389 Ga0105249_111063892 159
424 3300009553 Ga0105249_12432486 Ga0105249_124324861 159
425 3300025913 Ga0207695_10780147 Ga0207695_107801472 159
426 3300025940 Ga0207691_10245380 Ga0207691_102453802 159
427 3300027671 Ga0209588_1065024 Ga0209588_10650241 159
428 3300028380 Ga0268265_10060666 Ga0268265_100606662 159
429 3300035084 Ga0373928_0037831 Ga0373928_0037831_272_814 159
430 3300035091 Ga0373951_0160852 Ga0373951_0160852_36_578 159
431 3300035724 Ga0373933_0190804 Ga0373933_0190804_556_1035 159
432 3300037471 Ga0395905_1021611 Ga0395905_1021611_33_512 159
433 3300039438 Ga0436360_1169165 Ga0436360_1169165_87_566 159
434 3300042435 Ga0439434_0067858 Ga0439434_0067858_567_1046 159
435 3300044658 Ga0466972_0000070 Ga0466972_0000070_4106_4585 159
436 3300044706 Ga0466964_0108427 Ga0466964_0108427_345_824 159
437 3300046663 Ga0495635_0453472 Ga0495635_0453472_345_824 159
438 3300048913 Ga0496110_1292361 Ga0496110_1292361_119_598 159
439 3300048927 Ga0496124_0485288 Ga0496124_0485288_70_549 159
440 3300049588 Ga0501072_0750219 Ga0501072_0750219_214_693 159
441 3300050507 nmdc:mga05p37_732932_c1 nmdc:mga05p37_732932_c1_561_1070 159
442 3300050511 nmdc:mga08y16_176151_c1 nmdc:mga08y16_176151_c1_1055_1534 159
443 iso_pu_bacteria 2818991436 2819540664 159
444 3300005616 Ga0068852_100741588 Ga0068852_1007415881 160
445 3300005841 Ga0068863_100653550 Ga0068863_1006535502 160
446 3300005842 Ga0068858_100195790 Ga0068858_1001957902 160
447 3300005843 Ga0068860_100062103 Ga0068860_1000621035 160
448 3300006237 Ga0097621_100336484 Ga0097621_1003364842 160
449 3300009177 Ga0105248_11151747 Ga0105248_111517472 160
450 3300025986 Ga0207658_10401217 Ga0207658_104012172 160
451 3300026035 Ga0207703_10592930 Ga0207703_105929302 160
452 3300026088 Ga0207641_10352461 Ga0207641_103524612 160
453 3300028381 Ga0268264_10059516 Ga0268264_100595162 160
454 3300032133 Ga0316583_10061686 Ga0316583_100616861 160
455 3300033180 Ga0307510_10402365 Ga0307510_104023652 160
456 3300035398 Ga0316574_0000854 Ga0316574_0000854_7331_7813 160
457 3300041509 Ga0451843_0690997 Ga0451843_0690997_114_620 160
458 3300047319 Ga0495674_0202516 Ga0495674_0202516_928_1410 160
459 3300005618 Ga0068864_101208836 Ga0068864_1012088362 161
460 3300006237 Ga0097621_100002521 Ga0097621_1000025216 161
461 3300026095 Ga0207676_11299082 Ga0207676_112990821 161
462 3300035207 Ga0373942_0296105 Ga0373942_0296105_48_533 161
463 3300035691 Ga0373931_0105884 Ga0373931_0105884_471_968 161
464 3300046683 Ga0495658_0122548 Ga0495658_0122548_1063_1560 161
465 3300005329 Ga0070683_101074175 Ga0070683_1010741751 162
466 3300005331 Ga0070670_101885225 Ga0070670_1018852251 162
467 3300005340 Ga0070689_101310609 Ga0070689_1013106092 162
468 3300005347 Ga0070668_100404266 Ga0070668_1004042661 162
469 3300005353 Ga0070669_100039846 Ga0070669_1000398462 162
470 3300005353 Ga0070669_100408258 Ga0070669_1004082582 162
471 3300005355 Ga0070671_100054157 Ga0070671_1000541572 162
472 3300005364 Ga0070673_101253684 Ga0070673_1012536842 162
473 3300005439 Ga0070711_100119878 Ga0070711_1001198782 162
474 3300005440 Ga0070705_100108366 Ga0070705_1001083662 162
475 3300005440 Ga0070705_100302450 Ga0070705_1003024502 162
476 3300005444 Ga0070694_100362435 Ga0070694_1003624352 162
477 3300005445 Ga0070708_100271852 Ga0070708_1002718522 162
478 3300005445 Ga0070708_100555468 Ga0070708_1005554682 162
479 3300005455 Ga0070663_100198342 Ga0070663_1001983422 162
480 3300005456 Ga0070678_100601781 Ga0070678_1006017812 162
481 3300005458 Ga0070681_10178920 Ga0070681_101789202 162
482 3300005467 Ga0070706_100005369 Ga0070706_10000536914 162
483 3300005467 Ga0070706_100229256 Ga0070706_1002292562 162
484 3300005467 Ga0070706_100243274 Ga0070706_1002432742 162
485 3300005468 Ga0070707_100689745 Ga0070707_1006897451 162
486 3300005471 Ga0070698_100344771 Ga0070698_1003447712 162
487 3300005518 Ga0070699_100698845 Ga0070699_1006988451 162
488 3300005530 Ga0070679_100262530 Ga0070679_1002625302 162
489 3300005536 Ga0070697_100014086 Ga0070697_1000140863 162
490 3300005536 Ga0070697_100063553 Ga0070697_1000635533 162
491 3300005536 Ga0070697_100089287 Ga0070697_1000892874 162
492 3300005536 Ga0070697_100452401 Ga0070697_1004524011 162
493 3300005539 Ga0068853_100047075 Ga0068853_1000470753 162
494 3300005543 Ga0070672_100121871 Ga0070672_1001218711 162
495 3300005543 Ga0070672_101348160 Ga0070672_1013481602 162
496 3300005545 Ga0070695_101158210 Ga0070695_1011582101 162
497 3300005549 Ga0070704_101262934 Ga0070704_1012629341 162
498 3300005563 Ga0068855_100439986 Ga0068855_1004399862 162
499 3300005616 Ga0068852_101781318 Ga0068852_1017813181 162
500 3300005617 Ga0068859_100118593 Ga0068859_1001185934 162
501 3300005618 Ga0068864_100089679 Ga0068864_1000896793 162
502 3300005840 Ga0068870_10027059 Ga0068870_100270592 162
503 3300005841 Ga0068863_101608968 Ga0068863_1016089681 162
504 3300005842 Ga0068858_100126739 Ga0068858_1001267392 162
505 3300005844 Ga0068862_101061603 Ga0068862_1010616031 162
506 3300006237 Ga0097621_100103464 Ga0097621_1001034642 162
507 3300006358 Ga0068871_100041227 Ga0068871_1000412272 162
508 3300006846 Ga0075430_100110168 Ga0075430_1001101683 162
509 3300006847 Ga0075431_100005031 Ga0075431_1000050313 162
510 3300006852 Ga0075433_10412026 Ga0075433_104120262 162
511 3300006871 Ga0075434_100160654 Ga0075434_1001606543 162
512 3300006871 Ga0075434_101340721 Ga0075434_1013407212 162
513 3300006880 Ga0075429_100045494 Ga0075429_1000454943 162
514 3300006881 Ga0068865_100072899 Ga0068865_1000728992 162
515 3300006931 Ga0097620_100118591 Ga0097620_1001185914 162
516 3300007076 Ga0075435_100130708 Ga0075435_1001307083 162
517 3300007076 Ga0075435_100234384 Ga0075435_1002343842 162
518 3300009094 Ga0111539_10001053 Ga0111539_1000105318 162
519 3300009094 Ga0111539_10800328 Ga0111539_108003282 162
520 3300009094 Ga0111539_11692320 Ga0111539_116923202 162
521 3300009094 Ga0111539_12975142 Ga0111539_129751421 162
522 3300009098 Ga0105245_11069593 Ga0105245_110695932 162
523 3300009176 Ga0105242_10221835 Ga0105242_102218352 162
524 3300009176 Ga0105242_11101892 Ga0105242_111018922 162
525 3300009176 Ga0105242_11881934 Ga0105242_118819341 162
526 3300009177 Ga0105248_10308283 Ga0105248_103082832 162
527 3300013296 Ga0157374_10675431 Ga0157374_106754312 162
528 3300013297 Ga0157378_10776966 Ga0157378_107769662 162
529 3300013297 Ga0157378_11475590 Ga0157378_114755902 162
530 3300013308 Ga0157375_12045523 Ga0157375_120455232 162
531 3300014326 Ga0157380_11920684 Ga0157380_119206841 162
532 3300014969 Ga0157376_10167905 Ga0157376_101679052 162
533 3300025893 Ga0207682_10024633 Ga0207682_100246333 162
534 3300025901 Ga0207688_10183712 Ga0207688_101837122 162
535 3300025908 Ga0207643_10007629 Ga0207643_100076292 162
536 3300025910 Ga0207684_10098891 Ga0207684_100988913 162
537 3300025910 Ga0207684_10126212 Ga0207684_101262124 162
538 3300025910 Ga0207684_10167442 Ga0207684_101674422 162
539 3300025912 Ga0207707_10261257 Ga0207707_102612572 162
540 3300025921 Ga0207652_10055337 Ga0207652_100553372 162
541 3300025923 Ga0207681_10488648 Ga0207681_104886482 162
542 3300025925 Ga0207650_11284864 Ga0207650_112848641 162
543 3300025931 Ga0207644_10166745 Ga0207644_101667452 162
544 3300025934 Ga0207686_10165660 Ga0207686_101656601 162
545 3300025938 Ga0207704_10407710 Ga0207704_104077102 162
546 3300025940 Ga0207691_10517493 Ga0207691_105174932 162
547 3300025941 Ga0207711_10215806 Ga0207711_102158062 162
548 3300025944 Ga0207661_10789797 Ga0207661_107897972 162
549 3300025960 Ga0207651_10629223 Ga0207651_106292232 162
550 3300025972 Ga0207668_10338096 Ga0207668_103380962 162
551 3300026023 Ga0207677_10231540 Ga0207677_102315402 162
552 3300026035 Ga0207703_10250399 Ga0207703_102503992 162
553 3300026041 Ga0207639_10259421 Ga0207639_102594212 162
554 3300026067 Ga0207678_10179040 Ga0207678_101790402 162
555 3300026095 Ga0207676_10588374 Ga0207676_105883742 162
556 3300026116 Ga0207674_10551097 Ga0207674_105510971 162
557 3300026121 Ga0207683_10691031 Ga0207683_106910312 162
558 3300026142 Ga0207698_10662793 Ga0207698_106627932 162
559 3300027907 Ga0207428_10002514 Ga0207428_1000251413 162
560 3300028381 Ga0268264_10424362 Ga0268264_104243621 162
561 3300028577 Ga0265318_10050404 Ga0265318_100504042 162
562 3300028577 Ga0265318_10149264 Ga0265318_101492642 162
563 3300031238 Ga0265332_10133399 Ga0265332_101333992 162
564 3300031239 Ga0265328_10003416 Ga0265328_100034165 162
565 3300031240 Ga0265320_10021332 Ga0265320_100213325 162
566 3300031242 Ga0265329_10019337 Ga0265329_100193372 162
567 3300031249 Ga0265339_10034852 Ga0265339_100348523 162
568 3300031250 Ga0265331_10004434 Ga0265331_100044349 162
569 3300031344 Ga0265316_10041874 Ga0265316_100418743 162
570 3300031595 Ga0265313_10044904 Ga0265313_100449042 162
571 3300031711 Ga0265314_10000245 Ga0265314_1000024545 162
572 3300031712 Ga0265342_10007670 Ga0265342_100076704 162
573 3300031824 Ga0307413_10036789 Ga0307413_100367892 162
574 3300031995 Ga0307409_100243044 Ga0307409_1002430442 162
575 3300031995 Ga0307409_100274323 Ga0307409_1002743232 162
576 3300032005 Ga0307411_10228757 Ga0307411_102287571 162
577 3300032005 Ga0307411_10262761 Ga0307411_102627612 162
578 3300032126 Ga0307415_100100576 Ga0307415_1001005762 162
579 3300032126 Ga0307415_100258270 Ga0307415_1002582702 162
580 3300032126 Ga0307415_100646664 Ga0307415_1006466641 162
581 3300035171 Ga0373946_0419147 Ga0373946_0419147_40_528 162
582 3300035695 Ga0373927_0032781 Ga0373927_0032781_951_1439 162
583 3300035724 Ga0373933_0071872 Ga0373933_0071872_304_801 162
584 3300036401 Ga0373937_0167403 Ga0373937_0167403_1284_1781 162
585 3300037068 Ga0373925_0361527 Ga0373925_0361527_65_553 162
586 3300037418 Ga0395900_0147511 Ga0395900_0147511_671_1162 162
587 3300038443 Ga0395901_0180064 Ga0395901_0180064_1037_1528 162
588 3300039437 Ga0436365_1097290 Ga0436365_1097290_167_655 162
589 3300046472 Ga0495580_0075522 Ga0495580_0075522_1080_1568 162
590 3300046472 Ga0495580_0270829 Ga0495580_0270829_575_1063 162
591 3300046537 Ga0495598_0211432 Ga0495598_0211432_91_579 162
592 3300046539 Ga0495621_0115474 Ga0495621_0115474_451_951 162
593 3300046539 Ga0495621_0174986 Ga0495621_0174986_47_535 162
594 3300048904 Ga0496101_0419498 Ga0496101_0419498_214_702 162
595 3300048910 Ga0496107_1001937 Ga0496107_1001937_13_501 162
596 3300048914 Ga0496111_0091997 Ga0496111_0091997_798_1319 162
597 3300048915 Ga0496112_0014201 Ga0496112_0014201_3996_4517 162
598 3300048916 Ga0496113_0401697 Ga0496113_0401697_61_582 162
599 3300048917 Ga0496114_1431973 Ga0496114_1431973_48_536 162
600 3300048918 Ga0496115_0248852 Ga0496115_0248852_606_1094 162
601 3300049574 Ga0501038_0743440 Ga0501038_0743440_131_622 162
602 3300049575 Ga0501039_0008184 Ga0501039_0008184_241_729 162
603 3300049576 Ga0501040_0092397 Ga0501040_0092397_1278_1766 162
604 3300049578 Ga0501042_0018299 Ga0501042_0018299_2197_2685 162
605 3300049579 Ga0501043_0419990 Ga0501043_0419990_252_740 162
606 3300049583 Ga0501067_0597602 Ga0501067_0597602_55_546 162
607 3300049584 Ga0501068_0275918 Ga0501068_0275918_296_784 162
608 3300049587 Ga0501071_0050832 Ga0501071_0050832_1442_1930 162
609 3300049588 Ga0501072_0192537 Ga0501072_0192537_91_579 162
610 3300049592 Ga0501076_0019562 Ga0501076_0019562_2186_2674 162
611 3300049593 Ga0501077_0163235 Ga0501077_0163235_349_837 162
612 3300049741 Ga0501079_0004210 Ga0501079_0004210_5662_6150 162
613 3300049742 Ga0501080_0219411 Ga0501080_0219411_364_852 162
614 3300049743 Ga0501081_0000465 Ga0501081_0000465_19624_20112 162
615 3300049822 Ga0501035_0274206 Ga0501035_0274206_77_565 162
616 3300049824 Ga0501045_0094485 Ga0501045_0094485_1503_1991 162
617 3300050507 nmdc:mga05p37_529398_c1 nmdc:mga05p37_529398_c1_548_1036 162
618 3300050508 nmdc:mga09592_276772_c1 nmdc:mga09592_276772_c1_52_540 162
619 3300050509 nmdc:mga0qj67_983108_c1 nmdc:mga0qj67_983108_c1_105_593 162
620 3300050510 nmdc:mga06r32_1014_c1 nmdc:mga06r32_1014_c1_9512_10000 162
621 3300050512 nmdc:mga0n895_163087_c1 nmdc:mga0n895_163087_c1_263_751 162
622 3300050512 nmdc:mga0n895_438924_c1 nmdc:mga0n895_438924_c1_31_519 162
623 3300050513 nmdc:mga0rr50_148782_c1 nmdc:mga0rr50_148782_c1_1256_1744 162
624 3300050513 nmdc:mga0rr50_152767_c1 nmdc:mga0rr50_152767_c1_1069_1557 162
625 3300050513 nmdc:mga0rr50_244584_c1 nmdc:mga0rr50_244584_c1_818_1306 162
626 3300050515 nmdc:mga0a205_132541_c2 nmdc:mga0a205_132541_c2_143_631 162
627 3300050515 nmdc:mga0a205_363219_c1 nmdc:mga0a205_363219_c1_25_531 162
628 3300053084 Ga0495595_0370250 Ga0495595_0370250_213_710 162
629 3300053085 Ga0495619_0087963 Ga0495619_0087963_87_584 162
630 3300060353 Ga0501082_0004016 Ga0501082_0004016_1732_2220 162
631 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001655 163
632 3300002772 JGI25164J39214_1007850 JGI25164J39214_10078502 163
633 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001639 163
634 3300003751 Ga0055538_1000001 Ga0055538_1000001395 163
635 3300003752 Ga0055539_1000001 Ga0055539_1000001395 163
636 3300003756 Ga0055533_1000003 Ga0055533_1000003639 163
637 3300003759 Ga0055525_1000003 Ga0055525_1000003639 163
638 3300003841 Ga0055541_1000001 Ga0055541_1000001639 163
639 3300005336 Ga0070680_100249515 Ga0070680_1002495152 163
640 3300005355 Ga0070671_100163977 Ga0070671_1001639772 163
641 3300005364 Ga0070673_100396102 Ga0070673_1003961022 163
642 3300005364 Ga0070673_100937619 Ga0070673_1009376192 163
643 3300005367 Ga0070667_100078305 Ga0070667_1000783052 163
644 3300005441 Ga0070700_100001013 Ga0070700_10000101310 163
645 3300005456 Ga0070678_100105868 Ga0070678_1001058682 163
646 3300005548 Ga0070665_100034082 Ga0070665_1000340827 163
647 3300005718 Ga0068866_10365037 Ga0068866_103650371 163
648 3300005719 Ga0068861_100022064 Ga0068861_1000220643 163
649 3300006028 Ga0070717_10187237 Ga0070717_101872372 163
650 3300006175 Ga0070712_100034746 Ga0070712_1000347464 163
651 3300006237 Ga0097621_100167357 Ga0097621_1001673573 163
652 3300006358 Ga0068871_100261839 Ga0068871_1002618392 163
653 3300007265 Ga0099794_10043650 Ga0099794_100436503 163
654 3300009098 Ga0105245_10000207 Ga0105245_1000020717 163
655 3300009174 Ga0105241_10934072 Ga0105241_109340721 163
656 3300013105 Ga0157369_10719551 Ga0157369_107195512 163
657 3300013307 Ga0157372_11018966 Ga0157372_110189662 163
658 3300014326 Ga0157380_11375449 Ga0157380_113754492 163
659 3300014969 Ga0157376_10069688 Ga0157376_100696883 163
660 3300015261 Ga0182006_1032825 Ga0182006_10328252 163
661 3300015262 Ga0182007_10050203 Ga0182007_100502032 163
662 3300015265 Ga0182005_1013443 Ga0182005_10134432 163
663 3300025207 Ga0209760_101465 Ga0209760_1014653 163
664 3300025907 Ga0207645_10602803 Ga0207645_106028032 163
665 3300025908 Ga0207643_10011915 Ga0207643_100119152 163
666 3300025915 Ga0207693_10046169 Ga0207693_100461694 163
667 3300025935 Ga0207709_10003546 Ga0207709_100035469 163
668 3300025937 Ga0207669_11048761 Ga0207669_110487611 163
669 3300025940 Ga0207691_10080128 Ga0207691_100801282 163
670 3300025972 Ga0207668_10140898 Ga0207668_101408982 163
671 3300025986 Ga0207658_10052812 Ga0207658_100528122 163
672 3300026023 Ga0207677_10045023 Ga0207677_100450233 163
673 3300026118 Ga0207675_100001059 Ga0207675_10000105927 163
674 3300026121 Ga0207683_10023679 Ga0207683_100236797 163
675 3300028379 Ga0268266_10008592 Ga0268266_100085924 163
676 3300032004 Ga0307414_10461762 Ga0307414_104617622 163
677 3300035170 Ga0373943_0220334 Ga0373943_0220334_325_816 163
678 3300035692 Ga0373935_0231964 Ga0373935_0231964_760_1251 163
679 3300046454 Ga0495592_0029233 Ga0495592_0029233_2357_2848 163
680 3300046462 Ga0495651_0010022 Ga0495651_0010022_3902_4393 163
681 3300046462 Ga0495651_0070933 Ga0495651_0070933_1511_2002 163
682 3300046463 Ga0495653_0006836 Ga0495653_0006836_1746_2237 163
683 3300046501 Ga0495607_0049730 Ga0495607_0049730_126_617 163
684 3300046507 Ga0495606_0000011 Ga0495606_0000011_21331_21822 163
685 3300046511 Ga0495608_0042788 Ga0495608_0042788_2166_2657 163
686 3300046514 Ga0495618_0215600 Ga0495618_0215600_168_659 163
687 3300046516 Ga0495628_0002021 Ga0495628_0002021_14827_15318 163
688 3300046516 Ga0495628_0120479 Ga0495628_0120479_680_1171 163
689 3300046529 Ga0495652_0021112 Ga0495652_0021112_1163_1654 163
690 3300046529 Ga0495652_0069034 Ga0495652_0069034_2361_2852 163
691 3300046543 Ga0495645_0057856 Ga0495645_0057856_1326_1817 163
692 3300046557 Ga0495622_0074613 Ga0495622_0074613_725_1216 163
693 3300046675 Ga0495657_0068721 Ga0495657_0068721_1765_2256 163
694 3300046678 Ga0495599_0026654 Ga0495599_0026654_769_1260 163
695 3300046679 Ga0495623_0047566 Ga0495623_0047566_719_1210 163
696 3300046809 Ga0495600_0000916 Ga0495600_0000916_3693_4184 163
697 3300047317 Ga0495604_0085018 Ga0495604_0085018_1105_1596 163
698 3300047472 Ga0495686_0000248 Ga0495686_0000248_16566_17057 163
699 3300047472 Ga0495686_0044312 Ga0495686_0044312_1820_2311 163
700 3300048088 Ga0495602_0078562 Ga0495602_0078562_1104_1595 163
701 3300048088 Ga0495602_0539921 Ga0495602_0539921_245_736 163
702 3300048905 Ga0496102_1575481 Ga0496102_1575481_18_509 163
703 3300049574 Ga0501038_0124809 Ga0501038_0124809_1504_1995 163
704 3300049822 Ga0501035_0010038 Ga0501035_0010038_7062_7553 163
705 3300049822 Ga0501035_0161001 Ga0501035_0161001_376_867 163
706 3300049823 Ga0501044_0000076 Ga0501044_0000076_77761_78252 163
707 3300049823 Ga0501044_0012028 Ga0501044_0012028_1260_1751 163
708 3300053077 Ga0495601_0045721 Ga0495601_0045721_829_1320 163
709 3300053119 Ga0500595_012640 Ga0500595_012640_1648_2139 163
710 3300053141 Ga0500574_009516 Ga0500574_009516_677_1168 163
711 3300005334 Ga0068869_101347236 Ga0068869_1013472361 164
712 3300005367 Ga0070667_101163169 Ga0070667_1011631691 164
713 3300005467 Ga0070706_100201743 Ga0070706_1002017432 164
714 3300005548 Ga0070665_101355487 Ga0070665_1013554872 164
715 3300013297 Ga0157378_10859028 Ga0157378_108590281 164
716 3300025936 Ga0207670_11144842 Ga0207670_111448421 164
717 3300035112 Ga0373932_0067634 Ga0373932_0067634_371_868 164
718 3300035114 Ga0373939_0144472 Ga0373939_0144472_96_593 164
719 3300035207 Ga0373942_0105566 Ga0373942_0105566_250_747 164
720 3300035241 Ga0373961_0102214 Ga0373961_0102214_102_599 164
721 3300042005 Ga0439448_0120657 Ga0439448_0120657_396_890 164
722 3300046539 Ga0495621_0133107 Ga0495621_0133107_153_650 164
723 3300049590 Ga0501074_0732549 Ga0501074_0732549_151_645 164
724 3300054114 Ga0501084_0599129 Ga0501084_0599129_387_881 164
725 3300006871 Ga0075434_100497625 Ga0075434_1004976252 165
726 3300009098 Ga0105245_10410722 Ga0105245_104107222 165
727 3300013308 Ga0157375_11503106 Ga0157375_115031061 165
728 3300025927 Ga0207687_10547113 Ga0207687_105471132 165
729 3300031238 Ga0265332_10000293 Ga0265332_1000029333 165
730 3300031241 Ga0265325_10011509 Ga0265325_100115094 165
731 3300031242 Ga0265329_10015880 Ga0265329_100158803 165
732 3300031249 Ga0265339_10080478 Ga0265339_100804782 165
733 3300031250 Ga0265331_10000348 Ga0265331_1000034833 165
734 3300031251 Ga0265327_10128619 Ga0265327_101286192 165
735 3300031344 Ga0265316_10018947 Ga0265316_100189474 165
736 3300031711 Ga0265314_10028151 Ga0265314_100281513 165
737 3300035241 Ga0373961_0069131 Ga0373961_0069131_336_857 165
738 3300049585 Ga0501069_0719078 Ga0501069_0719078_35_535 165
739 3300035092 Ga0373952_0012716 Ga0373952_0012716_159_662 166
740 3300053084 Ga0495595_0547639 Ga0495595_0547639_56_568 166
741 3300005328 Ga0070676_10000072 Ga0070676_1000007220 167
742 3300005333 Ga0070677_10000170 Ga0070677_100001703 167
743 3300005334 Ga0068869_100153654 Ga0068869_1001536542 167
744 3300005335 Ga0070666_10006410 Ga0070666_100064103 167
745 3300005338 Ga0068868_100027054 Ga0068868_1000270544 167
746 3300005345 Ga0070692_10461690 Ga0070692_104616902 167
747 3300005347 Ga0070668_100035176 Ga0070668_1000351763 167
748 3300005353 Ga0070669_100420649 Ga0070669_1004206492 167
749 3300005354 Ga0070675_100000543 Ga0070675_1000005433 167
750 3300005355 Ga0070671_100020291 Ga0070671_1000202919 167
751 3300005355 Ga0070671_100027112 Ga0070671_1000271123 167
752 3300005356 Ga0070674_100002257 Ga0070674_1000022572 167
753 3300005364 Ga0070673_100000251 Ga0070673_1000002515 167
754 3300005365 Ga0070688_100224327 Ga0070688_1002243272 167
755 3300005367 Ga0070667_100065246 Ga0070667_1000652463 167
756 3300005367 Ga0070667_100184789 Ga0070667_1001847892 167
757 3300005367 Ga0070667_100214808 Ga0070667_1002148082 167
758 3300005455 Ga0070663_100277780 Ga0070663_1002777802 167
759 3300005456 Ga0070678_100014041 Ga0070678_1000140413 167
760 3300005457 Ga0070662_100099536 Ga0070662_1000995362 167
761 3300005459 Ga0068867_100168931 Ga0068867_1001689313 167
762 3300005539 Ga0068853_100082344 Ga0068853_1000823442 167
763 3300005543 Ga0070672_100000757 Ga0070672_10000075717 167
764 3300005548 Ga0070665_100002227 Ga0070665_1000022274 167
765 3300005615 Ga0070702_100623315 Ga0070702_1006233152 167
766 3300005616 Ga0068852_100009278 Ga0068852_1000092786 167
767 3300005617 Ga0068859_100421609 Ga0068859_1004216093 167
768 3300005618 Ga0068864_100018582 Ga0068864_1000185829 167
769 3300005719 Ga0068861_100150212 Ga0068861_1001502123 167
770 3300005834 Ga0068851_10022458 Ga0068851_100224583 167
771 3300005840 Ga0068870_10027240 Ga0068870_100272403 167
772 3300005841 Ga0068863_100034144 Ga0068863_1000341443 167
773 3300005842 Ga0068858_100001243 Ga0068858_10000124322 167
774 3300005842 Ga0068858_100759951 Ga0068858_1007599512 167
775 3300006237 Ga0097621_100022358 Ga0097621_1000223583 167
776 3300006358 Ga0068871_100004365 Ga0068871_10000436513 167
777 3300006881 Ga0068865_100118585 Ga0068865_1001185852 167
778 3300006931 Ga0097620_100421603 Ga0097620_1004216032 167
779 3300009177 Ga0105248_10315991 Ga0105248_103159913 167
780 3300013308 Ga0157375_10042038 Ga0157375_100420383 167
781 3300014968 Ga0157379_10365806 Ga0157379_103658062 167
782 3300017792 Ga0163161_10039723 Ga0163161_100397233 167
783 3300025225 Ga0209566_100004 Ga0209566_100004791 167
784 3300025226 Ga0209674_100006 Ga0209674_100006791 167
785 3300025230 Ga0209563_100009 Ga0209563_100009634 167
786 3300025231 Ga0207427_100293 Ga0207427_1002936 167
787 3300025233 Ga0209437_100004 Ga0209437_100004634 167
788 3300025253 Ga0209677_100005 Ga0209677_100005634 167
789 3300025261 Ga0209233_1000005 Ga0209233_1000005791 167
790 3300025321 Ga0207656_10001172 Ga0207656_100011722 167
791 3300025893 Ga0207682_10040949 Ga0207682_100409492 167
792 3300025901 Ga0207688_10172243 Ga0207688_101722432 167
793 3300025903 Ga0207680_10246988 Ga0207680_102469882 167
794 3300025907 Ga0207645_10000686 Ga0207645_1000068620 167
795 3300025908 Ga0207643_10027879 Ga0207643_100278793 167
796 3300025923 Ga0207681_10062298 Ga0207681_100622983 167
797 3300025924 Ga0207694_10982735 Ga0207694_109827352 167
798 3300025925 Ga0207650_10203115 Ga0207650_102031152 167
799 3300025926 Ga0207659_10027966 Ga0207659_100279663 167
800 3300025931 Ga0207644_10009912 Ga0207644_100099123 167
801 3300025931 Ga0207644_10049097 Ga0207644_100490973 167
802 3300025933 Ga0207706_10098770 Ga0207706_100987703 167
803 3300025937 Ga0207669_10085486 Ga0207669_100854862 167
804 3300025940 Ga0207691_10000367 Ga0207691_1000036721 167
805 3300025941 Ga0207711_10332300 Ga0207711_103323002 167
806 3300025942 Ga0207689_10090458 Ga0207689_100904582 167
807 3300025960 Ga0207651_10001584 Ga0207651_1000158411 167
808 3300025972 Ga0207668_10026322 Ga0207668_100263223 167
809 3300025981 Ga0207640_10052298 Ga0207640_100522983 167
810 3300025986 Ga0207658_10041343 Ga0207658_100413433 167
811 3300025986 Ga0207658_10243630 Ga0207658_102436303 167
812 3300026023 Ga0207677_10062363 Ga0207677_100623633 167
813 3300026023 Ga0207677_10640560 Ga0207677_106405602 167
814 3300026035 Ga0207703_10004881 Ga0207703_100048814 167
815 3300026041 Ga0207639_10016008 Ga0207639_100160083 167
816 3300026088 Ga0207641_10074117 Ga0207641_100741173 167
817 3300026089 Ga0207648_10208856 Ga0207648_102088563 167
818 3300026095 Ga0207676_10014818 Ga0207676_100148184 167
819 3300026118 Ga0207675_100029308 Ga0207675_1000293088 167
820 3300026121 Ga0207683_10000246 Ga0207683_1000024623 167
821 3300026142 Ga0207698_10046357 Ga0207698_100463573 167
822 3300028379 Ga0268266_10006669 Ga0268266_100066694 167
823 3300028379 Ga0268266_10231835 Ga0268266_102318352 167
824 3300046529 Ga0495652_0065263 Ga0495652_0065263_1353_1856 167
825 3300046680 Ga0495646_0014979 Ga0495646_0014979_2930_3433 167
826 3300005468 Ga0070707_100031454 Ga0070707_1000314548 168
827 3300005471 Ga0070698_100118004 Ga0070698_1001180042 168
828 3300005518 Ga0070699_100191200 Ga0070699_1001912002 168
829 3300005546 Ga0070696_100380670 Ga0070696_1003806702 168
830 3300025922 Ga0207646_10470666 Ga0207646_104706662 168
831 3300044673 Ga0453683_0497285 Ga0453683_0497285_115_621 168
832 3300005458 Ga0070681_10013221 Ga0070681_100132218 169
833 3300005530 Ga0070679_100128718 Ga0070679_1001287181 169
834 3300005539 Ga0068853_100004519 Ga0068853_1000045193 169
835 3300005547 Ga0070693_100081645 Ga0070693_1000816452 169
836 3300005548 Ga0070665_100686800 Ga0070665_1006868002 169
837 3300005563 Ga0068855_101143808 Ga0068855_1011438081 169
838 3300005564 Ga0070664_100160350 Ga0070664_1001603502 169
839 3300005577 Ga0068857_100096584 Ga0068857_1000965843 169
840 3300005616 Ga0068852_100160391 Ga0068852_1001603912 169
841 3300005719 Ga0068861_100813762 Ga0068861_1008137622 169
842 3300006358 Ga0068871_100551525 Ga0068871_1005515252 169
843 3300009174 Ga0105241_10217483 Ga0105241_102174832 169
844 3300009545 Ga0105237_10527742 Ga0105237_105277422 169
845 3300010375 Ga0105239_10373346 Ga0105239_103733462 169
846 3300013308 Ga0157375_10436880 Ga0157375_104368802 169
847 3300014326 Ga0157380_10573010 Ga0157380_105730102 169
848 3300025893 Ga0207682_10233052 Ga0207682_102330522 169
849 3300025911 Ga0207654_10148730 Ga0207654_101487302 169
850 3300025912 Ga0207707_10026843 Ga0207707_100268433 169
851 3300025914 Ga0207671_10013515 Ga0207671_100135152 169
852 3300025921 Ga0207652_10355688 Ga0207652_103556882 169
853 3300025937 Ga0207669_10088399 Ga0207669_100883992 169
854 3300025949 Ga0207667_10243928 Ga0207667_102439282 169
855 3300025972 Ga0207668_10064287 Ga0207668_100642872 169
856 3300026041 Ga0207639_10030737 Ga0207639_100307373 169
857 3300026067 Ga0207678_10261753 Ga0207678_102617532 169
858 3300026089 Ga0207648_10059692 Ga0207648_100596922 169
859 3300026116 Ga0207674_10065150 Ga0207674_100651503 169
860 3300026118 Ga0207675_100274530 Ga0207675_1002745302 169
861 3300028379 Ga0268266_10370436 Ga0268266_103704362 169
862 3300048905 Ga0496102_1080148 Ga0496102_1080148_111_632 169
863 3300048913 Ga0496110_1470886 Ga0496110_1470886_45_566 169
864 3300005355 Ga0070671_100346000 Ga0070671_1003460002 170
865 3300026121 Ga0207683_11262684 Ga0207683_112626841 170
866 3300005331 Ga0070670_100262774 Ga0070670_1002627741 171
867 3300005334 Ga0068869_100338471 Ga0068869_1003384712 171
868 3300005436 Ga0070713_100000033 Ga0070713_10000003343 171
869 3300005617 Ga0068859_100344804 Ga0068859_1003448042 171
870 3300005618 Ga0068864_100085019 Ga0068864_1000850194 171
871 3300005843 Ga0068860_100486951 Ga0068860_1004869512 171
872 3300006931 Ga0097620_100344820 Ga0097620_1003448202 171
873 3300009098 Ga0105245_10123931 Ga0105245_101239312 171
874 3300009177 Ga0105248_11851306 Ga0105248_118513062 171
875 3300013306 Ga0163162_10690853 Ga0163162_106908532 171
876 3300025925 Ga0207650_10196981 Ga0207650_101969812 171
877 3300025928 Ga0207700_10000099 Ga0207700_1000009942 171
878 3300025940 Ga0207691_10305182 Ga0207691_103051822 171
879 3300025942 Ga0207689_10284134 Ga0207689_102841342 171
880 3300026023 Ga0207677_10296131 Ga0207677_102961312 171
881 3300026095 Ga0207676_10162303 Ga0207676_101623032 171
882 3300028381 Ga0268264_10481944 Ga0268264_104819442 171
883 3300048916 Ga0496113_0298344 Ga0496113_0298344_682_1218 171
884 3300002239 JGI24034J26672_10025931 JGI24034J26672_100259312 172
885 3300005293 Ga0065715_10561781 Ga0065715_105617812 172
886 3300005328 Ga0070676_10149977 Ga0070676_101499771 172
887 3300005329 Ga0070683_100161839 Ga0070683_1001618393 172
888 3300005330 Ga0070690_100002867 Ga0070690_1000028674 172
889 3300005331 Ga0070670_100096413 Ga0070670_1000964132 172
890 3300005331 Ga0070670_101264614 Ga0070670_1012646141 172
891 3300005334 Ga0068869_100013977 Ga0068869_1000139774 172
892 3300005335 Ga0070666_10007649 Ga0070666_100076493 172
893 3300005336 Ga0070680_100124951 Ga0070680_1001249512 172
894 3300005337 Ga0070682_100289267 Ga0070682_1002892672 172
895 3300005338 Ga0068868_100117644 Ga0068868_1001176443 172
896 3300005338 Ga0068868_100297177 Ga0068868_1002971772 172
897 3300005339 Ga0070660_100025820 Ga0070660_1000258203 172
898 3300005340 Ga0070689_100054677 Ga0070689_1000546773 172
899 3300005341 Ga0070691_10207235 Ga0070691_102072352 172
900 3300005343 Ga0070687_100241755 Ga0070687_1002417552 172
901 3300005344 Ga0070661_100219671 Ga0070661_1002196712 172
902 3300005355 Ga0070671_100187344 Ga0070671_1001873442 172
903 3300005355 Ga0070671_101440471 Ga0070671_1014404711 172
904 3300005356 Ga0070674_100075380 Ga0070674_1000753803 172
905 3300005364 Ga0070673_100009977 Ga0070673_1000099776 172
906 3300005365 Ga0070688_100001386 Ga0070688_10000138610 172
907 3300005366 Ga0070659_100073192 Ga0070659_1000731922 172
908 3300005367 Ga0070667_100369281 Ga0070667_1003692813 172
909 3300005434 Ga0070709_10143754 Ga0070709_101437542 172
910 3300005435 Ga0070714_100199160 Ga0070714_1001991602 172
911 3300005436 Ga0070713_100020841 Ga0070713_1000208414 172
912 3300005436 Ga0070713_100023278 Ga0070713_1000232783 172
913 3300005437 Ga0070710_10162844 Ga0070710_101628442 172
914 3300005438 Ga0070701_10159993 Ga0070701_101599933 172
915 3300005439 Ga0070711_100011100 Ga0070711_1000111002 172
916 3300005440 Ga0070705_100036353 Ga0070705_1000363532 172
917 3300005440 Ga0070705_100153212 Ga0070705_1001532123 172
918 3300005444 Ga0070694_100035603 Ga0070694_1000356033 172
919 3300005445 Ga0070708_100021761 Ga0070708_1000217613 172
920 3300005455 Ga0070663_100905767 Ga0070663_1009057671 172
921 3300005456 Ga0070678_100327823 Ga0070678_1003278232 172
922 3300005457 Ga0070662_100045566 Ga0070662_1000455663 172
923 3300005459 Ga0068867_100087960 Ga0068867_1000879602 172
924 3300005466 Ga0070685_10001553 Ga0070685_1000155312 172
925 3300005468 Ga0070707_100099482 Ga0070707_1000994822 172
926 3300005471 Ga0070698_100111856 Ga0070698_1001118563 172
927 3300005530 Ga0070679_100072479 Ga0070679_1000724791 172
928 3300005536 Ga0070697_100242523 Ga0070697_1002425232 172
929 3300005539 Ga0068853_100436885 Ga0068853_1004368852 172
930 3300005544 Ga0070686_100823400 Ga0070686_1008234002 172
931 3300005546 Ga0070696_100024455 Ga0070696_1000244553 172
932 3300005547 Ga0070693_100034357 Ga0070693_1000343572 172
933 3300005548 Ga0070665_100004533 Ga0070665_1000045339 172
934 3300005578 Ga0068854_100003089 Ga0068854_1000030893 172
935 3300005578 Ga0068854_100068470 Ga0068854_1000684703 172
936 3300005614 Ga0068856_100030254 Ga0068856_1000302544 172
937 3300005615 Ga0070702_100267918 Ga0070702_1002679182 172
938 3300005616 Ga0068852_100060431 Ga0068852_1000604313 172
939 3300005616 Ga0068852_100197030 Ga0068852_1001970303 172
940 3300005617 Ga0068859_100001101 Ga0068859_10000110113 172
941 3300005618 Ga0068864_100001698 Ga0068864_10000169816 172
942 3300005618 Ga0068864_100015530 Ga0068864_1000155303 172
943 3300005718 Ga0068866_10023568 Ga0068866_100235683 172
944 3300005719 Ga0068861_100924498 Ga0068861_1009244982 172
945 3300005834 Ga0068851_10062919 Ga0068851_100629192 172
946 3300005840 Ga0068870_10012793 Ga0068870_100127933 172
947 3300005841 Ga0068863_100027522 Ga0068863_1000275229 172
948 3300005841 Ga0068863_100031027 Ga0068863_1000310272 172
949 3300005842 Ga0068858_100001448 Ga0068858_10000144820 172
950 3300005842 Ga0068858_101395383 Ga0068858_1013953832 172
951 3300005843 Ga0068860_100483451 Ga0068860_1004834512 172
952 3300006163 Ga0070715_10107151 Ga0070715_101071512 172
953 3300006175 Ga0070712_100120470 Ga0070712_1001204702 172
954 3300006237 Ga0097621_100396827 Ga0097621_1003968272 172
955 3300006237 Ga0097621_100649972 Ga0097621_1006499722 172
956 3300006358 Ga0068871_100739535 Ga0068871_1007395352 172
957 3300006871 Ga0075434_101138293 Ga0075434_1011382932 172
958 3300006881 Ga0068865_100342468 Ga0068865_1003424682 172
959 3300006931 Ga0097620_100001101 Ga0097620_10000110117 172
960 3300009011 Ga0105251_10242635 Ga0105251_102426351 172
961 3300009093 Ga0105240_10603196 Ga0105240_106031962 172
962 3300009098 Ga0105245_10383677 Ga0105245_103836772 172
963 3300009098 Ga0105245_10460184 Ga0105245_104601842 172
964 3300009098 Ga0105245_10817410 Ga0105245_108174101 172
965 3300009101 Ga0105247_10044964 Ga0105247_100449642 172
966 3300009174 Ga0105241_10167204 Ga0105241_101672041 172
967 3300009176 Ga0105242_10697852 Ga0105242_106978521 172
968 3300009545 Ga0105237_10265601 Ga0105237_102656013 172
969 3300009551 Ga0105238_10146803 Ga0105238_101468033 172
970 3300009551 Ga0105238_10829145 Ga0105238_108291452 172
971 3300009553 Ga0105249_11002136 Ga0105249_110021362 172
972 3300010375 Ga0105239_10166516 Ga0105239_101665162 172
973 3300010375 Ga0105239_11667005 Ga0105239_116670052 172
974 3300011119 Ga0105246_10062859 Ga0105246_100628592 172
975 3300011119 Ga0105246_10189276 Ga0105246_101892763 172
976 3300013100 Ga0157373_10311327 Ga0157373_103113272 172
977 3300013102 Ga0157371_10250382 Ga0157371_102503822 172
978 3300013104 Ga0157370_10266430 Ga0157370_102664302 172
979 3300013105 Ga0157369_10037398 Ga0157369_100373984 172
980 3300013296 Ga0157374_10014294 Ga0157374_100142947 172
981 3300013297 Ga0157378_10208931 Ga0157378_102089312 172
982 3300013297 Ga0157378_10712517 Ga0157378_107125172 172
983 3300013306 Ga0163162_10306385 Ga0163162_103063852 172
984 3300013306 Ga0163162_10585527 Ga0163162_105855272 172
985 3300013307 Ga0157372_10098712 Ga0157372_100987123 172
986 3300013307 Ga0157372_10796076 Ga0157372_107960762 172
987 3300013308 Ga0157375_10016586 Ga0157375_100165866 172
988 3300014325 Ga0163163_10009593 Ga0163163_100095938 172
989 3300014325 Ga0163163_10066625 Ga0163163_100666252 172
990 3300014745 Ga0157377_10078631 Ga0157377_100786312 172
991 3300014968 Ga0157379_10006994 Ga0157379_100069945 172
992 3300014969 Ga0157376_10369635 Ga0157376_103696352 172
993 3300014969 Ga0157376_10543339 Ga0157376_105433392 172
994 3300017792 Ga0163161_10094176 Ga0163161_100941762 172
995 3300025321 Ga0207656_10118445 Ga0207656_101184452 172
996 3300025893 Ga0207682_10035821 Ga0207682_100358213 172
997 3300025899 Ga0207642_10075839 Ga0207642_100758392 172
998 3300025900 Ga0207710_10015450 Ga0207710_100154503 172
999 3300025903 Ga0207680_10007196 Ga0207680_100071962 172
1000 3300025905 Ga0207685_10002834 Ga0207685_100028343 172
1001 3300025906 Ga0207699_10070113 Ga0207699_100701133 172
1002 3300025907 Ga0207645_10229484 Ga0207645_102294842 172
1003 3300025912 Ga0207707_10527371 Ga0207707_105273711 172
1004 3300025914 Ga0207671_10040925 Ga0207671_100409252 172
1005 3300025915 Ga0207693_10025102 Ga0207693_100251023 172
1006 3300025915 Ga0207693_10076236 Ga0207693_100762363 172
1007 3300025916 Ga0207663_10104065 Ga0207663_101040652 172
1008 3300025918 Ga0207662_10079839 Ga0207662_100798392 172
1009 3300025919 Ga0207657_10014919 Ga0207657_100149193 172
1010 3300025923 Ga0207681_10197824 Ga0207681_101978242 172
1011 3300025925 Ga0207650_10079817 Ga0207650_100798172 172
1012 3300025925 Ga0207650_10210188 Ga0207650_102101882 172
1013 3300025927 Ga0207687_10002891 Ga0207687_1000289110 172
1014 3300025927 Ga0207687_10224223 Ga0207687_102242232 172
1015 3300025927 Ga0207687_10376736 Ga0207687_103767362 172
1016 3300025928 Ga0207700_10031130 Ga0207700_100311302 172
1017 3300025928 Ga0207700_10051938 Ga0207700_100519383 172
1018 3300025929 Ga0207664_10002486 Ga0207664_1000248612 172
1019 3300025931 Ga0207644_10004698 Ga0207644_100046988 172
1020 3300025932 Ga0207690_10474155 Ga0207690_104741552 172
1021 3300025933 Ga0207706_10040580 Ga0207706_100405802 172
1022 3300025933 Ga0207706_10564523 Ga0207706_105645232 172
1023 3300025934 Ga0207686_10000488 Ga0207686_100004884 172
1024 3300025934 Ga0207686_10653210 Ga0207686_106532102 172
1025 3300025936 Ga0207670_10037772 Ga0207670_100377723 172
1026 3300025938 Ga0207704_10656940 Ga0207704_106569402 172
1027 3300025939 Ga0207665_10008468 Ga0207665_100084683 172
1028 3300025939 Ga0207665_10129285 Ga0207665_101292852 172
1029 3300025941 Ga0207711_10001033 Ga0207711_1000103320 172
1030 3300025942 Ga0207689_10080987 Ga0207689_100809872 172
1031 3300025942 Ga0207689_10089949 Ga0207689_100899493 172
1032 3300025944 Ga0207661_10624998 Ga0207661_106249982 172
1033 3300025945 Ga0207679_10178247 Ga0207679_101782472 172
1034 3300025945 Ga0207679_10750990 Ga0207679_107509902 172
1035 3300025945 Ga0207679_11428312 Ga0207679_114283121 172
1036 3300025960 Ga0207651_10003957 Ga0207651_100039573 172
1037 3300025961 Ga0207712_10366705 Ga0207712_103667052 172
1038 3300025981 Ga0207640_10039707 Ga0207640_100397074 172
1039 3300025986 Ga0207658_10125323 Ga0207658_101253233 172
1040 3300026023 Ga0207677_10002051 Ga0207677_100020514 172
1041 3300026023 Ga0207677_10449756 Ga0207677_104497562 172
1042 3300026035 Ga0207703_10001709 Ga0207703_1000170914 172
1043 3300026035 Ga0207703_11160505 Ga0207703_111605052 172
1044 3300026041 Ga0207639_10243640 Ga0207639_102436402 172
1045 3300026067 Ga0207678_10039057 Ga0207678_100390571 172
1046 3300026078 Ga0207702_10335483 Ga0207702_103354832 172
1047 3300026088 Ga0207641_10007244 Ga0207641_100072447 172
1048 3300026088 Ga0207641_10014486 Ga0207641_100144862 172
1049 3300026089 Ga0207648_10036862 Ga0207648_100368623 172
1050 3300026095 Ga0207676_10000174 Ga0207676_1000017423 172
1051 3300026095 Ga0207676_10000548 Ga0207676_1000054814 172
1052 3300026116 Ga0207674_10018138 Ga0207674_100181382 172
1053 3300026121 Ga0207683_10017870 Ga0207683_100178702 172
1054 3300026142 Ga0207698_10147975 Ga0207698_101479752 172
1055 3300028379 Ga0268266_10008065 Ga0268266_100080653 172
1056 3300028381 Ga0268264_10021756 Ga0268264_100217564 172
1057 3300028381 Ga0268264_11869806 Ga0268264_118698061 172
1058 3300031548 Ga0307408_100017559 Ga0307408_1000175592 172
1059 3300031731 Ga0307405_10069390 Ga0307405_100693902 172
1060 3300031824 Ga0307413_10087117 Ga0307413_100871172 172
1061 3300031852 Ga0307410_10002755 Ga0307410_100027558 172
1062 3300031901 Ga0307406_10013059 Ga0307406_100130593 172
1063 3300031903 Ga0307407_10068837 Ga0307407_100688372 172
1064 3300032002 Ga0307416_100014893 Ga0307416_1000148933 172
1065 3300032004 Ga0307414_10010426 Ga0307414_100104263 172
1066 3300032005 Ga0307411_10098093 Ga0307411_100980932 172
1067 3300032126 Ga0307415_100007490 Ga0307415_1000074902 172
1068 3300035086 Ga0373934_0022793 Ga0373934_0022793_755_1273 172
1069 3300035111 Ga0373923_0001906 Ga0373923_0001906_869_1387 172
1070 3300035116 Ga0373945_0152612 Ga0373945_0152612_288_806 172
1071 3300035118 Ga0373954_0003489 Ga0373954_0003489_6059_6577 172
1072 3300035119 Ga0373956_0284901 Ga0373956_0284901_133_651 172
1073 3300035120 Ga0373957_0007229 Ga0373957_0007229_149_667 172
1074 3300035170 Ga0373943_0336008 Ga0373943_0336008_258_776 172
1075 3300035171 Ga0373946_0009606 Ga0373946_0009606_1174_1692 172
1076 3300035171 Ga0373946_0434634 Ga0373946_0434634_136_654 172
1077 3300035172 Ga0373955_0055591 Ga0373955_0055591_512_1030 172
1078 3300035410 Ga0373924_0195895 Ga0373924_0195895_239_757 172
1079 3300035692 Ga0373935_0196674 Ga0373935_0196674_576_1094 172
1080 3300035695 Ga0373927_0035616 Ga0373927_0035616_1418_1936 172
1081 3300035695 Ga0373927_0217954 Ga0373927_0217954_421_939 172
1082 3300035724 Ga0373933_0417170 Ga0373933_0417170_43_561 172
1083 3300035725 Ga0373947_0186236 Ga0373947_0186236_707_1225 172
1084 3300036401 Ga0373937_0017208 Ga0373937_0017208_1141_1659 172
1085 3300037068 Ga0373925_0124010 Ga0373925_0124010_1184_1702 172
1086 3300046455 Ga0495603_0232197 Ga0495603_0232197_465_983 172
1087 3300046459 Ga0495629_0096580 Ga0495629_0096580_1460_1978 172
1088 3300046462 Ga0495651_0092033 Ga0495651_0092033_906_1424 172
1089 3300046463 Ga0495653_0427796 Ga0495653_0427796_160_678 172
1090 3300046472 Ga0495580_0086177 Ga0495580_0086177_256_774 172
1091 3300046472 Ga0495580_0617171 Ga0495580_0617171_112_630 172
1092 3300046473 Ga0495582_0060468 Ga0495582_0060468_1066_1584 172
1093 3300046475 Ga0495639_0005155 Ga0495639_0005155_1589_2107 172
1094 3300046476 Ga0495662_0008790 Ga0495662_0008790_1516_2034 172
1095 3300046477 Ga0495664_0147593 Ga0495664_0147593_216_734 172
1096 3300046477 Ga0495664_0336942 Ga0495664_0336942_368_886 172
1097 3300046499 Ga0495594_0060051 Ga0495594_0060051_491_1009 172
1098 3300046511 Ga0495608_0111859 Ga0495608_0111859_136_654 172
1099 3300046516 Ga0495628_0432395 Ga0495628_0432395_25_543 172
1100 3300046517 Ga0495630_0018882 Ga0495630_0018882_1762_2280 172
1101 3300046526 Ga0495666_0223315 Ga0495666_0223315_255_773 172
1102 3300046529 Ga0495652_0346393 Ga0495652_0346393_318_836 172
1103 3300046531 Ga0495665_0022228 Ga0495665_0022228_2773_3291 172
1104 3300046533 Ga0495640_0025633 Ga0495640_0025633_918_1436 172
1105 3300046535 Ga0495586_0027285 Ga0495586_0027285_2160_2678 172
1106 3300046539 Ga0495621_0059231 Ga0495621_0059231_583_1101 172
1107 3300046543 Ga0495645_0017006 Ga0495645_0017006_3184_3702 172
1108 3300046543 Ga0495645_0217465 Ga0495645_0217465_755_1273 172
1109 3300046559 Ga0495667_0341704 Ga0495667_0341704_252_770 172
1110 3300046642 Ga0495634_0076539 Ga0495634_0076539_629_1147 172
1111 3300046663 Ga0495635_0105657 Ga0495635_0105657_340_858 172
1112 3300046664 Ga0495659_0094401 Ga0495659_0094401_410_928 172
1113 3300046674 Ga0495588_0041459 Ga0495588_0041459_1181_1699 172
1114 3300046675 Ga0495657_0558572 Ga0495657_0558572_135_653 172
1115 3300046678 Ga0495599_0149340 Ga0495599_0149340_171_689 172
1116 3300046681 Ga0495647_0008547 Ga0495647_0008547_1409_1927 172
1117 3300046683 Ga0495658_0044428 Ga0495658_0044428_1066_1584 172
1118 3300046684 Ga0495669_0205120 Ga0495669_0205120_301_819 172
1119 3300046689 Ga0495613_0018189 Ga0495613_0018189_1946_2464 172
1120 3300046690 Ga0495624_0104714 Ga0495624_0104714_252_770 172
1121 3300047315 Ga0495581_0009710 Ga0495581_0009710_1414_1932 172
1122 3300047317 Ga0495604_0398243 Ga0495604_0398243_378_896 172
1123 3300047322 Ga0495680_0070233 Ga0495680_0070233_1065_1583 172
1124 3300047444 Ga0495675_0147540 Ga0495675_0147540_590_1108 172
1125 3300047471 Ga0495684_0041075 Ga0495684_0041075_1895_2413 172
1126 3300047673 Ga0495593_0052595 Ga0495593_0052595_1134_1652 172
1127 3300048089 Ga0495614_0047249 Ga0495614_0047249_939_1457 172
1128 3300048903 Ga0496100_0203137 Ga0496100_0203137_167_685 172
1129 3300048904 Ga0496101_0089547 Ga0496101_0089547_123_641 172
1130 3300048905 Ga0496102_0958535 Ga0496102_0958535_130_648 172
1131 3300048906 Ga0496103_0469964 Ga0496103_0469964_133_651 172
1132 3300048907 Ga0496104_0009650 Ga0496104_0009650_3118_3636 172
1133 3300048908 Ga0496105_0102103 Ga0496105_0102103_575_1093 172
1134 3300048910 Ga0496107_0155182 Ga0496107_0155182_245_763 172
1135 3300048910 Ga0496107_0501178 Ga0496107_0501178_92_610 172
1136 3300048911 Ga0496108_0520627 Ga0496108_0520627_319_843 172
1137 3300048912 Ga0496109_0085357 Ga0496109_0085357_1653_2171 172
1138 3300048913 Ga0496110_0595808 Ga0496110_0595808_368_886 172
1139 3300048914 Ga0496111_0484431 Ga0496111_0484431_231_749 172
1140 3300048915 Ga0496112_0005841 Ga0496112_0005841_7387_7905 172
1141 3300048915 Ga0496112_0394210 Ga0496112_0394210_702_1220 172
1142 3300048917 Ga0496114_0022604 Ga0496114_0022604_4443_4961 172
1143 3300048918 Ga0496115_0602332 Ga0496115_0602332_192_710 172
1144 3300050513 nmdc:mga0rr50_224730_c1 nmdc:mga0rr50_224730_c1_1020_1538 172
1145 3300053077 Ga0495601_0292879 Ga0495601_0292879_503_1021 172
1146 3300053078 Ga0495612_0063075 Ga0495612_0063075_398_916 172
1147 3300053078 Ga0495612_0073781 Ga0495612_0073781_578_1096 172
1148 3300053084 Ga0495595_0355333 Ga0495595_0355333_210_728 172
1149 3300053085 Ga0495619_0008666 Ga0495619_0008666_3111_3629 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

20

155

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8993 12 165
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8835 15 168
3iam-assembly1.cif.gz_2 crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh 0.8829 17 171
7a24-assembly1.cif.gz_B assembly intermediate of the plant mitochondrial complex i 0.8682 12 172
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8675 12 165
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.936 83 165 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9294 84 172 3.40.30.10
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9282 12 83 1.10.10.1590
2fug202 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 85 171 3.40.30.10
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9159 12 82 1.10.10.1590
ID Description Score Start End GO Terms
AF-A0A534WXL5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9192 40 169 GO:0003954
GO:0046872
GO:0051537
AF-A0A5E4JMT3-F1-model_v4 Thioredoxin-like [2Fe-2S] ferredoxin 0.9157 36 166 GO:0016491
GO:0046872
GO:0051537
AF-A0A016QR90-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.9151 40 172 GO:0003954
GO:0046872
GO:0051537
AF-A0A1G0H2P2-F1-model_v4 NADH-quinone oxidoreductase subunit E (NADH dehydrogenase I subunit E) (NDH-1 subunit E) 0.9097 12 168 GO:0003954
GO:0046872
GO:0051537
AF-A0A3A0FDS5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.9071 12 168 GO:0003954
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
92.03 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map