F490710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1141 | 389 | 2282 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100436913|Ga0070689_1004369131 |
| Length | 289 |
| Sequence | LPLVGLLRRPNPSNPAIISVYLGCSVALWLTVLSVSSADTMLRGLWKLTWLEIKIFLREPLGVVGTVGLPVLVYVGLGRLLGPRVGRASPDVPRAVSVDLPILSVLLIVASAVLSLVAIIAIYREGGILRRLRATPLRPHTILTAHVLAKLLFTLVTLAVMVLAGRRYFPIPAAVPMVSFTVALLFTTVSLLSLGFLIASVVPTARFAQPIGTLVLYPMVGLSGLFVPIESLPPLLRALARVLPLTYAVSLLKGIWRGEGWSAHLGDVAVLTATFLVLMAASSRVFRWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 251 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 252 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 253 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 254 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 255 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 256 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 257 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 258 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 259 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 343 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 344 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 345 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 349 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 351 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 354 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 355 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 356 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 360 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 362 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 363 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.37 |
| Nodule | 0 |
| Rhizoplane | 3.94 |
| Rhizosphere | 93.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070689_100436913 | 3300005340 | Bacteria | 1112 |
| 2 | MBSR1b_contig_8694521 | 2162886012 | Bacteria | 1460 |
| 3 | JGI25406J46586_10004594 | 3300003203 | Bacteria | 6428 |
| 4 | Ga0065704_10230603 | 3300005289 | Bacteria | 1044 |
| 5 | Ga0065712_10003012 | 3300005290 | Bacteria | 6886 |
| 6 | Ga0065712_10067827 | 3300005290 | Bacteria | 27716 |
| 7 | Ga0065712_10088488 | 3300005290 | Bacteria | 2517 |
| 8 | Ga0065715_10089309 | 3300005293 | Bacteria | 11310 |
| 9 | Ga0065715_10187852 | 3300005293 | Bacteria | 1433 |
| 10 | Ga0065715_10223470 | 3300005293 | Unclassified | 1262 |
| 11 | Ga0065715_10342083 | 3300005293 | Unclassified | 965 |
| 12 | Ga0065707_10093908 | 3300005295 | Bacteria | 3564 |
| 13 | Ga0065707_10115964 | 3300005295 | Bacteria | 2252 |
| 14 | Ga0065707_10297546 | 3300005295 | Bacteria | 1011 |
| 15 | Ga0070658_10019311 | 3300005327 | Bacteria | 5458 |
| 16 | Ga0070658_10048484 | 3300005327 | Bacteria | 3440 |
| 17 | Ga0070658_10711479 | 3300005327 | Unclassified | 872 |
| 18 | Ga0070676_10117171 | 3300005328 | Bacteria | 1667 |
| 19 | Ga0070683_100175745 | 3300005329 | Bacteria | 2032 |
| 20 | Ga0070683_100397046 | 3300005329 | Bacteria | 1315 |
| 21 | Ga0070670_100024330 | 3300005331 | Bacteria | 5208 |
| 22 | Ga0070670_100026632 | 3300005331 | Bacteria | 4974 |
| 23 | Ga0070670_100149548 | 3300005331 | Bacteria | 2021 |
| 24 | Ga0070670_100168545 | 3300005331 | Bacteria | 1899 |
| 25 | Ga0070670_100325136 | 3300005331 | Bacteria | 1348 |
| 26 | Ga0070677_10108876 | 3300005333 | Bacteria | 1234 |
| 27 | Ga0068869_100027625 | 3300005334 | Bacteria | 3959 |
| 28 | Ga0068869_100112833 | 3300005334 | Bacteria | 2070 |
| 29 | Ga0070666_10060814 | 3300005335 | Bacteria | 2557 |
| 30 | Ga0070680_100007823 | 3300005336 | Bacteria | 8146 |
| 31 | Ga0070680_100396055 | 3300005336 | Unclassified | 1177 |
| 32 | Ga0070682_100016079 | 3300005337 | Bacteria | 4346 |
| 33 | Ga0070682_100196860 | 3300005337 | Bacteria | 1419 |
| 34 | Ga0068868_100064218 | 3300005338 | Bacteria | 2914 |
| 35 | Ga0068868_100101581 | 3300005338 | Bacteria | 2327 |
| 36 | Ga0068868_100151438 | 3300005338 | Bacteria | 1910 |
| 37 | Ga0068868_100226456 | 3300005338 | Bacteria | 1567 |
| 38 | Ga0068868_100481958 | 3300005338 | Bacteria | 1084 |
| 39 | Ga0070689_100062062 | 3300005340 | Bacteria | 2907 |
| 40 | Ga0070689_100076859 | 3300005340 | Bacteria | 2616 |
| 41 | Ga0070689_100409004 | 3300005340 | Bacteria | 1148 |
| 42 | Ga0070691_10000314 | 3300005341 | Bacteria | 17078 |
| 43 | Ga0070691_10139060 | 3300005341 | Bacteria | 1236 |
| 44 | Ga0070661_100031365 | 3300005344 | Bacteria | 3843 |
| 45 | Ga0070668_100600673 | 3300005347 | Bacteria | 963 |
| 46 | Ga0070668_100660054 | 3300005347 | Bacteria | 919 |
| 47 | Ga0070669_100000727 | 3300005353 | Bacteria | 24018 |
| 48 | Ga0070669_100001162 | 3300005353 | Bacteria | 19218 |
| 49 | Ga0070669_100057118 | 3300005353 | Bacteria | 2863 |
| 50 | Ga0070669_100100205 | 3300005353 | Bacteria | 2184 |
| 51 | Ga0070675_100000381 | 3300005354 | Bacteria | 30031 |
| 52 | Ga0070675_100044978 | 3300005354 | Bacteria | 3612 |
| 53 | Ga0070675_100194844 | 3300005354 | Unclassified | 1757 |
| 54 | Ga0070675_100249057 | 3300005354 | Bacteria | 1554 |
| 55 | Ga0070675_100532026 | 3300005354 | Unclassified | 1061 |
| 56 | Ga0070671_100022701 | 3300005355 | Bacteria | 5127 |
| 57 | Ga0070671_100051343 | 3300005355 | Bacteria | 3429 |
| 58 | Ga0070671_100175466 | 3300005355 | Bacteria | 1813 |
| 59 | Ga0070671_100280947 | 3300005355 | Bacteria | 1416 |
| 60 | Ga0070674_100027520 | 3300005356 | Bacteria | 3727 |
| 61 | Ga0070674_100032698 | 3300005356 | Bacteria | 3455 |
| 62 | Ga0070674_100044535 | 3300005356 | Bacteria | 3026 |
| 63 | Ga0070674_100083525 | 3300005356 | Bacteria | 2288 |
| 64 | Ga0070674_100223752 | 3300005356 | Bacteria | 1465 |
| 65 | Ga0070674_100319267 | 3300005356 | Bacteria | 1245 |
| 66 | Ga0070674_100676614 | 3300005356 | Bacteria | 880 |
| 67 | Ga0070673_100014110 | 3300005364 | Bacteria | 5552 |
| 68 | Ga0070688_100016092 | 3300005365 | Bacteria | 4269 |
| 69 | Ga0070688_100220527 | 3300005365 | Bacteria | 1336 |
| 70 | Ga0070659_100009356 | 3300005366 | Bacteria | 7196 |
| 71 | Ga0070659_100046618 | 3300005366 | Bacteria | 3398 |
| 72 | Ga0070659_100161894 | 3300005366 | Bacteria | 1830 |
| 73 | Ga0070709_10001985 | 3300005434 | Bacteria | 11148 |
| 74 | Ga0070709_10127207 | 3300005434 | Bacteria | 1735 |
| 75 | Ga0070709_10133103 | 3300005434 | Bacteria | 1700 |
| 76 | Ga0070709_10319980 | 3300005434 | Bacteria | 1138 |
| 77 | Ga0070714_100067256 | 3300005435 | Unclassified | 3089 |
| 78 | Ga0070714_100069188 | 3300005435 | Bacteria | 3048 |
| 79 | Ga0070714_100075091 | 3300005435 | Bacteria | 2932 |
| 80 | Ga0070714_100300709 | 3300005435 | Unclassified | 1496 |
| 81 | Ga0070713_100000180 | 3300005436 | Bacteria | 41991 |
| 82 | Ga0070713_100001143 | 3300005436 | Bacteria | 17000 |
| 83 | Ga0070713_100016132 | 3300005436 | Bacteria | 5611 |
| 84 | Ga0070713_100032958 | 3300005436 | Bacteria | 4145 |
| 85 | Ga0070713_100039295 | 3300005436 | Bacteria | 3840 |
| 86 | Ga0070713_100082524 | 3300005436 | Unclassified | 2745 |
| 87 | Ga0070713_100087678 | 3300005436 | Bacteria | 2670 |
| 88 | Ga0070710_10020002 | 3300005437 | Unclassified | 3468 |
| 89 | Ga0070710_10061563 | 3300005437 | Unclassified | 2138 |
| 90 | Ga0070710_10126371 | 3300005437 | Bacteria | 1554 |
| 91 | Ga0070701_10164448 | 3300005438 | Bacteria | 1288 |
| 92 | Ga0070701_10270448 | 3300005438 | Bacteria | 1034 |
| 93 | Ga0070711_100000441 | 3300005439 | Bacteria | 21555 |
| 94 | Ga0070711_100000766 | 3300005439 | Bacteria | 16740 |
| 95 | Ga0070711_100014055 | 3300005439 | Bacteria | 5037 |
| 96 | Ga0070711_100015453 | 3300005439 | Bacteria | 4832 |
| 97 | Ga0070711_100060355 | 3300005439 | Bacteria | 2636 |
| 98 | Ga0070711_100109236 | 3300005439 | Bacteria | 2027 |
| 99 | Ga0070711_100118775 | 3300005439 | Bacteria | 1952 |
| 100 | Ga0070711_100355555 | 3300005439 | Bacteria | 1179 |
| 101 | Ga0070711_100481411 | 3300005439 | Unclassified | 1020 |
| 102 | Ga0070705_100288519 | 3300005440 | Bacteria | 1170 |
| 103 | Ga0070700_100054072 | 3300005441 | Bacteria | 2508 |
| 104 | Ga0070700_100173514 | 3300005441 | Bacteria | 1495 |
| 105 | Ga0070694_100005219 | 3300005444 | Bacteria | 7849 |
| 106 | Ga0070694_100006820 | 3300005444 | Bacteria | 6936 |
| 107 | Ga0070708_100000081 | 3300005445 | Bacteria | 61675 |
| 108 | Ga0070708_100018220 | 3300005445 | Bacteria | 5876 |
| 109 | Ga0070708_100079703 | 3300005445 | Bacteria | 2962 |
| 110 | Ga0070663_100024099 | 3300005455 | Bacteria | 4090 |
| 111 | Ga0070663_100089958 | 3300005455 | Bacteria | 2272 |
| 112 | Ga0070663_100102817 | 3300005455 | Bacteria | 2135 |
| 113 | Ga0070663_100156217 | 3300005455 | Bacteria | 1753 |
| 114 | Ga0070678_100020086 | 3300005456 | Unclassified | 4375 |
| 115 | Ga0070678_100086375 | 3300005456 | Bacteria | 2393 |
| 116 | Ga0070678_100176553 | 3300005456 | Bacteria | 1745 |
| 117 | Ga0070678_100447338 | 3300005456 | Unclassified | 1131 |
| 118 | Ga0070662_100016492 | 3300005457 | Bacteria | 4962 |
| 119 | Ga0070662_100093100 | 3300005457 | Bacteria | 2267 |
| 120 | Ga0070662_100272021 | 3300005457 | Bacteria | 1368 |
| 121 | Ga0070662_100651408 | 3300005457 | Unclassified | 888 |
| 122 | Ga0070681_10002730 | 3300005458 | Bacteria | 16264 |
| 123 | Ga0070681_10063440 | 3300005458 | Bacteria | 3667 |
| 124 | Ga0070681_10130184 | 3300005458 | Bacteria | 2448 |
| 125 | Ga0068867_100042111 | 3300005459 | Bacteria | 3339 |
| 126 | Ga0068867_100048895 | 3300005459 | Bacteria | 3112 |
| 127 | Ga0068867_100098897 | 3300005459 | Bacteria | 2225 |
| 128 | Ga0068867_100142008 | 3300005459 | Bacteria | 1878 |
| 129 | Ga0068867_100339577 | 3300005459 | Bacteria | 1250 |
| 130 | Ga0070685_10000943 | 3300005466 | Bacteria | 15645 |
| 131 | Ga0070685_10032234 | 3300005466 | Bacteria | 2934 |
| 132 | Ga0070706_100007119 | 3300005467 | Bacteria | 10520 |
| 133 | Ga0070706_100012916 | 3300005467 | Bacteria | 7730 |
| 134 | Ga0070706_100268267 | 3300005467 | Viruses | 1593 |
| 135 | Ga0070706_100338038 | 3300005467 | Bacteria | 1404 |
| 136 | Ga0070707_100001950 | 3300005468 | Bacteria | 19793 |
| 137 | Ga0070707_100003644 | 3300005468 | Bacteria | 14526 |
| 138 | Ga0070707_100177898 | 3300005468 | Bacteria | 2074 |
| 139 | Ga0070707_100461679 | 3300005468 | Bacteria | 1231 |
| 140 | Ga0070707_100579024 | 3300005468 | Unclassified | 1085 |
| 141 | Ga0070698_100004310 | 3300005471 | Bacteria | 15649 |
| 142 | Ga0070698_100115650 | 3300005471 | Bacteria | 2646 |
| 143 | Ga0070698_100290800 | 3300005471 | Bacteria | 1565 |
| 144 | Ga0070698_100416343 | 3300005471 | Bacteria | 1278 |
| 145 | Ga0070698_100430025 | 3300005471 | Unclassified | 1255 |
| 146 | Ga0070699_100010867 | 3300005518 | Bacteria | 7876 |
| 147 | Ga0070699_100037867 | 3300005518 | Bacteria | 4175 |
| 148 | Ga0070699_100060876 | 3300005518 | Bacteria | 3272 |
| 149 | Ga0070699_100064883 | 3300005518 | Bacteria | 3167 |
| 150 | Ga0070699_100159681 | 3300005518 | Bacteria | 1995 |
| 151 | Ga0070699_100240453 | 3300005518 | Bacteria | 1616 |
| 152 | Ga0070699_100486601 | 3300005518 | Unclassified | 1120 |
| 153 | Ga0070699_100664849 | 3300005518 | Unclassified | 951 |
| 154 | Ga0070699_100700912 | 3300005518 | Bacteria | 925 |
| 155 | Ga0070679_100013189 | 3300005530 | Bacteria | 7912 |
| 156 | Ga0070679_100023599 | 3300005530 | Bacteria | 6024 |
| 157 | Ga0070679_100305928 | 3300005530 | Bacteria | 1540 |
| 158 | Ga0070679_100398568 | 3300005530 | Bacteria | 1322 |
| 159 | Ga0070684_100013274 | 3300005535 | Bacteria | 6638 |
| 160 | Ga0070684_100241251 | 3300005535 | Bacteria | 1651 |
| 161 | Ga0070684_100369140 | 3300005535 | Bacteria | 1321 |
| 162 | Ga0070684_100439350 | 3300005535 | Bacteria | 1205 |
| 163 | Ga0070684_100479562 | 3300005535 | Bacteria | 1151 |
| 164 | Ga0070697_100001931 | 3300005536 | Bacteria | 15867 |
| 165 | Ga0070697_100013572 | 3300005536 | Bacteria | 6391 |
| 166 | Ga0070697_100143416 | 3300005536 | Bacteria | 2009 |
| 167 | Ga0070697_100274591 | 3300005536 | Bacteria | 1445 |
| 168 | Ga0070672_100057939 | 3300005543 | Bacteria | 3043 |
| 169 | Ga0070672_100147881 | 3300005543 | Bacteria | 1942 |
| 170 | Ga0070672_100369218 | 3300005543 | Bacteria | 1226 |
| 171 | Ga0070686_100074218 | 3300005544 | Bacteria | 2235 |
| 172 | Ga0070686_100094646 | 3300005544 | Bacteria | 2005 |
| 173 | Ga0070686_100300668 | 3300005544 | Bacteria | 1190 |
| 174 | Ga0070686_100345106 | 3300005544 | Bacteria | 1117 |
| 175 | Ga0070686_100366287 | 3300005544 | Unclassified | 1087 |
| 176 | Ga0070695_100000829 | 3300005545 | Bacteria | 16689 |
| 177 | Ga0070695_100003902 | 3300005545 | Bacteria | 8706 |
| 178 | Ga0070695_100152238 | 3300005545 | Unclassified | 1615 |
| 179 | Ga0070695_100211902 | 3300005545 | Unclassified | 1391 |
| 180 | Ga0070696_100002254 | 3300005546 | Bacteria | 12712 |
| 181 | Ga0070696_100048110 | 3300005546 | Bacteria | 2959 |
| 182 | Ga0070693_100000200 | 3300005547 | Bacteria | 28231 |
| 183 | Ga0070693_100009327 | 3300005547 | Bacteria | 4877 |
| 184 | Ga0070693_100051779 | 3300005547 | Bacteria | 2352 |
| 185 | Ga0070665_100006550 | 3300005548 | Bacteria | 11834 |
| 186 | Ga0070665_100010091 | 3300005548 | Bacteria | 9555 |
| 187 | Ga0070665_100014615 | 3300005548 | Bacteria | 7878 |
| 188 | Ga0070665_100077027 | 3300005548 | Bacteria | 3341 |
| 189 | Ga0070665_100114428 | 3300005548 | Bacteria | 2700 |
| 190 | Ga0070704_100001732 | 3300005549 | Bacteria | 11908 |
| 191 | Ga0070704_100004385 | 3300005549 | Bacteria | 8147 |
| 192 | Ga0070704_100334734 | 3300005549 | Bacteria | 1273 |
| 193 | Ga0068855_100721648 | 3300005563 | Bacteria | 1065 |
| 194 | Ga0070664_100003507 | 3300005564 | Bacteria | 12666 |
| 195 | Ga0070664_100224856 | 3300005564 | Bacteria | 1680 |
| 196 | Ga0070664_100287836 | 3300005564 | Unclassified | 1483 |
| 197 | Ga0070664_100305136 | 3300005564 | Unclassified | 1439 |
| 198 | Ga0070664_100369119 | 3300005564 | Bacteria | 1308 |
| 199 | Ga0068857_100007741 | 3300005577 | Bacteria | 9254 |
| 200 | Ga0068857_100041896 | 3300005577 | Bacteria | 4060 |
| 201 | Ga0068857_100084299 | 3300005577 | Bacteria | 2840 |
| 202 | Ga0068854_100240233 | 3300005578 | Unclassified | 1442 |
| 203 | Ga0068856_100230003 | 3300005614 | Bacteria | 1869 |
| 204 | Ga0070702_100063187 | 3300005615 | Bacteria | 2161 |
| 205 | Ga0070702_100075026 | 3300005615 | Bacteria | 2008 |
| 206 | Ga0068852_100024949 | 3300005616 | Bacteria | 4838 |
| 207 | Ga0068852_100139429 | 3300005616 | Bacteria | 2242 |
| 208 | Ga0068852_100205857 | 3300005616 | Bacteria | 1864 |
| 209 | Ga0068859_100028342 | 3300005617 | Bacteria | 5614 |
| 210 | Ga0068859_100077070 | 3300005617 | Bacteria | 3375 |
| 211 | Ga0068859_100180594 | 3300005617 | Bacteria | 2193 |
| 212 | Ga0068859_100388543 | 3300005617 | Unclassified | 1491 |
| 213 | Ga0068859_100466009 | 3300005617 | Unclassified | 1359 |
| 214 | Ga0068859_100543900 | 3300005617 | Bacteria | 1256 |
| 215 | Ga0068859_100631281 | 3300005617 | Bacteria | 1164 |
| 216 | Ga0068864_100001175 | 3300005618 | Bacteria | 21803 |
| 217 | Ga0068864_100059408 | 3300005618 | Bacteria | 3308 |
| 218 | Ga0068864_100147229 | 3300005618 | Bacteria | 2130 |
| 219 | Ga0068864_100264731 | 3300005618 | Bacteria | 1600 |
| 220 | Ga0068864_100286781 | 3300005618 | Bacteria | 1538 |
| 221 | Ga0068866_10035405 | 3300005718 | Unclassified | 2438 |
| 222 | Ga0068866_10058280 | 3300005718 | Bacteria | 1994 |
| 223 | Ga0068866_10089494 | 3300005718 | Bacteria | 1673 |
| 224 | Ga0068861_100208762 | 3300005719 | Unclassified | 1644 |
| 225 | Ga0068861_100228329 | 3300005719 | Unclassified | 1577 |
| 226 | Ga0068861_100492057 | 3300005719 | Bacteria | 1107 |
| 227 | Ga0068851_10099905 | 3300005834 | Bacteria | 1538 |
| 228 | Ga0068851_10191177 | 3300005834 | Bacteria | 1138 |
| 229 | Ga0068863_100000704 | 3300005841 | Bacteria | 33679 |
| 230 | Ga0068863_100012167 | 3300005841 | Bacteria | 8311 |
| 231 | Ga0068863_100081146 | 3300005841 | Bacteria | 3072 |
| 232 | Ga0068863_100421734 | 3300005841 | Bacteria | 1307 |
| 233 | Ga0068863_100966734 | 3300005841 | Unclassified | 853 |
| 234 | Ga0068858_100003039 | 3300005842 | Bacteria | 16816 |
| 235 | Ga0068858_100027377 | 3300005842 | Bacteria | 5296 |
| 236 | Ga0068858_100562186 | 3300005842 | Unclassified | 1105 |
| 237 | Ga0068858_100583817 | 3300005842 | Bacteria | 1083 |
| 238 | Ga0068858_100623729 | 3300005842 | Bacteria | 1047 |
| 239 | Ga0068860_100064452 | 3300005843 | Unclassified | 3480 |
| 240 | Ga0068860_100150761 | 3300005843 | Bacteria | 2239 |
| 241 | Ga0068860_100155296 | 3300005843 | Bacteria | 2205 |
| 242 | Ga0068860_100343566 | 3300005843 | Bacteria | 1468 |
| 243 | Ga0068860_100679963 | 3300005843 | Bacteria | 1038 |
| 244 | Ga0068862_100013068 | 3300005844 | Bacteria | 6867 |
| 245 | Ga0068862_100201634 | 3300005844 | Bacteria | 1794 |
| 246 | Ga0068862_100211572 | 3300005844 | Unclassified | 1752 |
| 247 | Ga0068862_100301715 | 3300005844 | Bacteria | 1474 |
| 248 | Ga0068862_100764520 | 3300005844 | Unclassified | 941 |
| 249 | Ga0068862_100813603 | 3300005844 | Bacteria | 913 |
| 250 | Ga0068862_100995715 | 3300005844 | Bacteria | 829 |
| 251 | Ga0081455_10039113 | 3300005937 | Bacteria | 4195 |
| 252 | Ga0081455_10369777 | 3300005937 | Bacteria | 1005 |
| 253 | Ga0081539_10001216 | 3300005985 | Bacteria | 46061 |
| 254 | Ga0070717_10000390 | 3300006028 | Bacteria | 28003 |
| 255 | Ga0070717_10015105 | 3300006028 | Bacteria | 5954 |
| 256 | Ga0075365_10012336 | 3300006038 | Bacteria | 5071 |
| 257 | Ga0075368_10019197 | 3300006042 | Bacteria | 2579 |
| 258 | Ga0075368_10029364 | 3300006042 | Bacteria | 2126 |
| 259 | Ga0075364_10111183 | 3300006051 | Bacteria | 1828 |
| 260 | Ga0075432_10081893 | 3300006058 | Bacteria | 1171 |
| 261 | Ga0070715_10005229 | 3300006163 | Unclassified | 4312 |
| 262 | Ga0070715_10033098 | 3300006163 | Bacteria | 2110 |
| 263 | Ga0070716_100008491 | 3300006173 | Bacteria | 5097 |
| 264 | Ga0070716_100076673 | 3300006173 | Bacteria | 1982 |
| 265 | Ga0070716_100099815 | 3300006173 | Bacteria | 1777 |
| 266 | Ga0070716_100149312 | 3300006173 | Bacteria | 1501 |
| 267 | Ga0070716_100343200 | 3300006173 | Bacteria | 1054 |
| 268 | Ga0070712_100000424 | 3300006175 | Bacteria | 24251 |
| 269 | Ga0070712_100000774 | 3300006175 | Bacteria | 18882 |
| 270 | Ga0075367_10019708 | 3300006178 | Bacteria | 3744 |
| 271 | Ga0075367_10150968 | 3300006178 | Unclassified | 1442 |
| 272 | Ga0075367_10229048 | 3300006178 | Unclassified | 1164 |
| 273 | Ga0075366_10037914 | 3300006195 | Bacteria | 2847 |
| 274 | Ga0075366_10041787 | 3300006195 | Bacteria | 2715 |
| 275 | Ga0075366_10143594 | 3300006195 | Bacteria | 1444 |
| 276 | Ga0097621_100051496 | 3300006237 | Bacteria | 3351 |
| 277 | Ga0097621_100090730 | 3300006237 | Bacteria | 2557 |
| 278 | Ga0097621_100115283 | 3300006237 | Bacteria | 2274 |
| 279 | Ga0097621_100152891 | 3300006237 | Bacteria | 1979 |
| 280 | Ga0097621_100207508 | 3300006237 | Bacteria | 1703 |
| 281 | Ga0097621_100274545 | 3300006237 | Unclassified | 1482 |
| 282 | Ga0097621_100359368 | 3300006237 | Unclassified | 1297 |
| 283 | Ga0097621_100484628 | 3300006237 | Unclassified | 1118 |
| 284 | Ga0097621_100841627 | 3300006237 | Unclassified | 852 |
| 285 | Ga0075370_10042865 | 3300006353 | Bacteria | 2557 |
| 286 | Ga0068871_100023117 | 3300006358 | Bacteria | 4802 |
| 287 | Ga0068871_100047401 | 3300006358 | Bacteria | 3466 |
| 288 | Ga0068871_100064046 | 3300006358 | Bacteria | 3008 |
| 289 | Ga0068871_100262882 | 3300006358 | Unclassified | 1506 |
| 290 | Ga0068871_100271419 | 3300006358 | Bacteria | 1482 |
| 291 | Ga0068871_100896367 | 3300006358 | Unclassified | 822 |
| 292 | Ga0075428_100012869 | 3300006844 | Bacteria | 9310 |
| 293 | Ga0075428_100020050 | 3300006844 | Bacteria | 7404 |
| 294 | Ga0075428_100026426 | 3300006844 | Bacteria | 6426 |
| 295 | Ga0075428_100192939 | 3300006844 | Bacteria | 2203 |
| 296 | Ga0075428_100207079 | 3300006844 | Bacteria | 2120 |
| 297 | Ga0075428_100390752 | 3300006844 | Bacteria | 1491 |
| 298 | Ga0075428_101030199 | 3300006844 | Bacteria | 871 |
| 299 | Ga0075430_100035079 | 3300006846 | Bacteria | 4258 |
| 300 | Ga0075430_100099702 | 3300006846 | Bacteria | 2426 |
| 301 | Ga0075430_100224238 | 3300006846 | Bacteria | 1559 |
| 302 | Ga0075430_100238233 | 3300006846 | Bacteria | 1508 |
| 303 | Ga0075430_100247581 | 3300006846 | Bacteria | 1477 |
| 304 | Ga0075430_100400093 | 3300006846 | Bacteria | 1133 |
| 305 | Ga0075431_100028762 | 3300006847 | Bacteria | 5714 |
| 306 | Ga0075431_100030652 | 3300006847 | Bacteria | 5541 |
| 307 | Ga0075431_100053177 | 3300006847 | Bacteria | 4175 |
| 308 | Ga0075431_100094974 | 3300006847 | Bacteria | 3078 |
| 309 | Ga0075431_100166805 | 3300006847 | Unclassified | 2263 |
| 310 | Ga0075431_100225150 | 3300006847 | Bacteria | 1912 |
| 311 | Ga0075433_10011743 | 3300006852 | Bacteria | 7053 |
| 312 | Ga0075433_10074249 | 3300006852 | Bacteria | 2992 |
| 313 | Ga0075433_10107478 | 3300006852 | Bacteria | 2474 |
| 314 | Ga0075433_10122773 | 3300006852 | Bacteria | 2307 |
| 315 | Ga0075433_10198946 | 3300006852 | Bacteria | 1782 |
| 316 | Ga0075433_10199807 | 3300006852 | Bacteria | 1777 |
| 317 | Ga0075433_10554907 | 3300006852 | Unclassified | 1010 |
| 318 | Ga0075434_100000098 | 3300006871 | Bacteria | 48574 |
| 319 | Ga0075434_100011671 | 3300006871 | Bacteria | 8297 |
| 320 | Ga0075434_100027710 | 3300006871 | Bacteria | 5563 |
| 321 | Ga0075434_100081905 | 3300006871 | Bacteria | 3224 |
| 322 | Ga0075434_100145485 | 3300006871 | Bacteria | 2390 |
| 323 | Ga0075434_100222295 | 3300006871 | Bacteria | 1908 |
| 324 | Ga0075434_100649152 | 3300006871 | Unclassified | 1073 |
| 325 | Ga0075429_100053555 | 3300006880 | Bacteria | 3511 |
| 326 | Ga0075429_100086373 | 3300006880 | Bacteria | 2734 |
| 327 | Ga0075429_100108416 | 3300006880 | Bacteria | 2427 |
| 328 | Ga0075429_100171615 | 3300006880 | Bacteria | 1899 |
| 329 | Ga0075429_100560626 | 3300006880 | Bacteria | 1001 |
| 330 | Ga0068865_100002032 | 3300006881 | Bacteria | 11941 |
| 331 | Ga0068865_100009144 | 3300006881 | Bacteria | 6132 |
| 332 | Ga0068865_100094661 | 3300006881 | Bacteria | 2174 |
| 333 | Ga0068865_100291421 | 3300006881 | Bacteria | 1303 |
| 334 | Ga0068865_100531964 | 3300006881 | Unclassified | 984 |
| 335 | Ga0075436_100000037 | 3300006914 | Bacteria | 83376 |
| 336 | Ga0075436_100005387 | 3300006914 | Bacteria | 8807 |
| 337 | Ga0075436_100006638 | 3300006914 | Bacteria | 7926 |
| 338 | Ga0075436_100006643 | 3300006914 | Bacteria | 7922 |
| 339 | Ga0075436_100045018 | 3300006914 | Bacteria | 3044 |
| 340 | Ga0075436_100045696 | 3300006914 | Bacteria | 3021 |
| 341 | Ga0075436_100295354 | 3300006914 | Bacteria | 1160 |
| 342 | Ga0097620_100028342 | 3300006931 | Bacteria | 5614 |
| 343 | Ga0097620_100077072 | 3300006931 | Bacteria | 3375 |
| 344 | Ga0097620_100180599 | 3300006931 | Bacteria | 2193 |
| 345 | Ga0097620_100388540 | 3300006931 | Unclassified | 1491 |
| 346 | Ga0097620_100466114 | 3300006931 | Unclassified | 1359 |
| 347 | Ga0097620_100543864 | 3300006931 | Bacteria | 1256 |
| 348 | Ga0097620_100631254 | 3300006931 | Bacteria | 1164 |
| 349 | Ga0075435_100000020 | 3300007076 | Bacteria | 91240 |
| 350 | Ga0075435_100004674 | 3300007076 | Bacteria | 9441 |
| 351 | Ga0075435_100009374 | 3300007076 | Bacteria | 7083 |
| 352 | Ga0075435_100080339 | 3300007076 | Unclassified | 2677 |
| 353 | Ga0075435_100165792 | 3300007076 | Unclassified | 1863 |
| 354 | Ga0075435_100586085 | 3300007076 | Unclassified | 967 |
| 355 | Ga0105240_10024898 | 3300009093 | Bacteria | 7878 |
| 356 | Ga0105240_10057307 | 3300009093 | Bacteria | 4868 |
| 357 | Ga0105240_10123688 | 3300009093 | Bacteria | 3112 |
| 358 | Ga0111539_10002591 | 3300009094 | Bacteria | 23946 |
| 359 | Ga0111539_10002914 | 3300009094 | Bacteria | 22702 |
| 360 | Ga0111539_10003917 | 3300009094 | Bacteria | 19571 |
| 361 | Ga0111539_10035761 | 3300009094 | Bacteria | 6012 |
| 362 | Ga0111539_10041050 | 3300009094 | Bacteria | 5565 |
| 363 | Ga0111539_10070775 | 3300009094 | Bacteria | 4117 |
| 364 | Ga0111539_10097410 | 3300009094 | Unclassified | 3455 |
| 365 | Ga0111539_10270335 | 3300009094 | Bacteria | 1979 |
| 366 | Ga0111539_10534548 | 3300009094 | Unclassified | 1366 |
| 367 | Ga0111539_10729611 | 3300009094 | Bacteria | 1153 |
| 368 | Ga0111539_10876032 | 3300009094 | Unclassified | 1044 |
| 369 | Ga0111539_10911847 | 3300009094 | Bacteria | 1022 |
| 370 | Ga0105245_10038798 | 3300009098 | Bacteria | 4238 |
| 371 | Ga0105245_10231365 | 3300009098 | Bacteria | 1788 |
| 372 | Ga0105245_10265833 | 3300009098 | Bacteria | 1671 |
| 373 | Ga0105247_10038134 | 3300009101 | Bacteria | 2932 |
| 374 | Ga0105247_10038653 | 3300009101 | Bacteria | 2914 |
| 375 | Ga0105247_10137752 | 3300009101 | Unclassified | 1596 |
| 376 | Ga0114129_10000174 | 3300009147 | Bacteria | 70648 |
| 377 | Ga0114129_10000192 | 3300009147 | Bacteria | 68551 |
| 378 | Ga0114129_10000275 | 3300009147 | Bacteria | 58684 |
| 379 | Ga0114129_10005113 | 3300009147 | Bacteria | 18461 |
| 380 | Ga0114129_10008970 | 3300009147 | Bacteria | 14259 |
| 381 | Ga0114129_10022135 | 3300009147 | Bacteria | 9021 |
| 382 | Ga0114129_10048805 | 3300009147 | Bacteria | 5950 |
| 383 | Ga0114129_10061464 | 3300009147 | Bacteria | 5249 |
| 384 | Ga0114129_10099321 | 3300009147 | Bacteria | 4029 |
| 385 | Ga0114129_10153629 | 3300009147 | Bacteria | 3149 |
| 386 | Ga0114129_10165848 | 3300009147 | Bacteria | 3014 |
| 387 | Ga0114129_10253945 | 3300009147 | Bacteria | 2359 |
| 388 | Ga0114129_10579457 | 3300009147 | Bacteria | 1456 |
| 389 | Ga0114129_10588951 | 3300009147 | Bacteria | 1442 |
| 390 | Ga0114129_10766159 | 3300009147 | Bacteria | 1234 |
| 391 | Ga0114129_11135104 | 3300009147 | Unclassified | 977 |
| 392 | Ga0105243_10033909 | 3300009148 | Bacteria | 3949 |
| 393 | Ga0105243_10123793 | 3300009148 | Bacteria | 2184 |
| 394 | Ga0105243_10405874 | 3300009148 | Unclassified | 1267 |
| 395 | Ga0105243_10535370 | 3300009148 | Unclassified | 1116 |
| 396 | Ga0105241_10087351 | 3300009174 | Bacteria | 2454 |
| 397 | Ga0105242_10026761 | 3300009176 | Bacteria | 4573 |
| 398 | Ga0105242_10068681 | 3300009176 | Bacteria | 2933 |
| 399 | Ga0105248_10002305 | 3300009177 | Bacteria | 21144 |
| 400 | Ga0105248_10008586 | 3300009177 | Bacteria | 11220 |
| 401 | Ga0105248_10026590 | 3300009177 | Bacteria | 6436 |
| 402 | Ga0105248_10048444 | 3300009177 | Bacteria | 4767 |
| 403 | Ga0105248_10131427 | 3300009177 | Bacteria | 2824 |
| 404 | Ga0105248_10185846 | 3300009177 | Bacteria | 2342 |
| 405 | Ga0105248_10233198 | 3300009177 | Bacteria | 2072 |
| 406 | Ga0105248_10306691 | 3300009177 | Bacteria | 1788 |
| 407 | Ga0105248_10582472 | 3300009177 | Unclassified | 1262 |
| 408 | Ga0105248_11135072 | 3300009177 | Bacteria | 883 |
| 409 | Ga0105237_10031580 | 3300009545 | Bacteria | 5366 |
| 410 | Ga0105237_10279603 | 3300009545 | Bacteria | 1672 |
| 411 | Ga0105237_10366173 | 3300009545 | Bacteria | 1446 |
| 412 | Ga0105238_10063520 | 3300009551 | Bacteria | 3693 |
| 413 | Ga0105238_10099977 | 3300009551 | Bacteria | 2883 |
| 414 | Ga0105238_10178492 | 3300009551 | Bacteria | 2100 |
| 415 | Ga0105249_10000517 | 3300009553 | Bacteria | 35617 |
| 416 | Ga0105249_10006590 | 3300009553 | Bacteria | 10104 |
| 417 | Ga0105249_10055970 | 3300009553 | Bacteria | 3611 |
| 418 | Ga0105249_10154988 | 3300009553 | Unclassified | 2208 |
| 419 | Ga0105249_10649785 | 3300009553 | Bacteria | 1112 |
| 420 | Ga0105249_10831416 | 3300009553 | Bacteria | 988 |
| 421 | Ga0105239_10394456 | 3300010375 | Bacteria | 1566 |
| 422 | Ga0105239_10625030 | 3300010375 | Unclassified | 1229 |
| 423 | Ga0105246_10206590 | 3300011119 | Bacteria | 1530 |
| 424 | Ga0157373_10137237 | 3300013100 | Bacteria | 1720 |
| 425 | Ga0157370_10603578 | 3300013104 | Bacteria | 1005 |
| 426 | Ga0157369_10104725 | 3300013105 | Bacteria | 3012 |
| 427 | Ga0157369_10331994 | 3300013105 | Bacteria | 1580 |
| 428 | Ga0157374_10137113 | 3300013296 | Bacteria | 2373 |
| 429 | Ga0157378_10001096 | 3300013297 | Bacteria | 24704 |
| 430 | Ga0157378_10033718 | 3300013297 | Bacteria | 4527 |
| 431 | Ga0157378_10046860 | 3300013297 | Unclassified | 3842 |
| 432 | Ga0157378_10105791 | 3300013297 | Bacteria | 2573 |
| 433 | Ga0157378_10198639 | 3300013297 | Unclassified | 1896 |
| 434 | Ga0157378_10261550 | 3300013297 | Bacteria | 1660 |
| 435 | Ga0157378_10279585 | 3300013297 | Unclassified | 1608 |
| 436 | Ga0163162_10000370 | 3300013306 | Bacteria | 40835 |
| 437 | Ga0163162_10129753 | 3300013306 | Bacteria | 2629 |
| 438 | Ga0163162_10169437 | 3300013306 | Bacteria | 2308 |
| 439 | Ga0163162_10216115 | 3300013306 | Bacteria | 2047 |
| 440 | Ga0157372_10030751 | 3300013307 | Bacteria | 5875 |
| 441 | Ga0157372_10036897 | 3300013307 | Bacteria | 5390 |
| 442 | Ga0157372_10070222 | 3300013307 | Bacteria | 3940 |
| 443 | Ga0157372_10691920 | 3300013307 | Bacteria | 1187 |
| 444 | Ga0157372_10821614 | 3300013307 | Bacteria | 1079 |
| 445 | Ga0157375_10063743 | 3300013308 | Bacteria | 3668 |
| 446 | Ga0157375_10691508 | 3300013308 | Bacteria | 1174 |
| 447 | Ga0157375_11018630 | 3300013308 | Unclassified | 967 |
| 448 | Ga0163163_10010921 | 3300014325 | Bacteria | 8203 |
| 449 | Ga0163163_10115060 | 3300014325 | Bacteria | 2721 |
| 450 | Ga0163163_10123563 | 3300014325 | Unclassified | 2624 |
| 451 | Ga0163163_10256300 | 3300014325 | Bacteria | 1800 |
| 452 | Ga0163163_10305448 | 3300014325 | Bacteria | 1643 |
| 453 | Ga0157380_10048552 | 3300014326 | Bacteria | 3343 |
| 454 | Ga0157380_10060343 | 3300014326 | Bacteria | 3030 |
| 455 | Ga0157380_10071651 | 3300014326 | Unclassified | 2804 |
| 456 | Ga0157380_10086528 | 3300014326 | Bacteria | 2575 |
| 457 | Ga0157380_10090930 | 3300014326 | Bacteria | 2519 |
| 458 | Ga0157380_10128178 | 3300014326 | Bacteria | 2160 |
| 459 | Ga0157380_10666729 | 3300014326 | Unclassified | 1040 |
| 460 | Ga0157377_10025904 | 3300014745 | Bacteria | 3132 |
| 461 | Ga0157377_10067967 | 3300014745 | Unclassified | 2052 |
| 462 | Ga0157377_10165134 | 3300014745 | Bacteria | 1380 |
| 463 | Ga0157377_10354231 | 3300014745 | Bacteria | 986 |
| 464 | Ga0157379_10025716 | 3300014968 | Bacteria | 5232 |
| 465 | Ga0157379_10053135 | 3300014968 | Bacteria | 3619 |
| 466 | Ga0157379_10177184 | 3300014968 | Bacteria | 1925 |
| 467 | Ga0157379_10186808 | 3300014968 | Bacteria | 1873 |
| 468 | Ga0157379_10299618 | 3300014968 | Unclassified | 1465 |
| 469 | Ga0157379_10668075 | 3300014968 | Unclassified | 974 |
| 470 | Ga0157379_10696431 | 3300014968 | Bacteria | 953 |
| 471 | Ga0157376_10003558 | 3300014969 | Bacteria | 10744 |
| 472 | Ga0157376_10009627 | 3300014969 | Bacteria | 7030 |
| 473 | Ga0157376_10027273 | 3300014969 | Bacteria | 4525 |
| 474 | Ga0157376_10141167 | 3300014969 | Bacteria | 2161 |
| 475 | Ga0157376_10545064 | 3300014969 | Unclassified | 1147 |
| 476 | Ga0157376_10587519 | 3300014969 | Bacteria | 1107 |
| 477 | Ga0157376_10653701 | 3300014969 | Bacteria | 1052 |
| 478 | Ga0163161_10331170 | 3300017792 | Bacteria | 1206 |
| 479 | Ga0163161_10463331 | 3300017792 | Bacteria | 1026 |
| 480 | Ga0163161_10504719 | 3300017792 | Bacteria | 985 |
| 481 | Ga0224572_1046239 | 3300024225 | Unclassified | 815 |
| 482 | Ga0228598_1001375 | 3300024227 | Bacteria | 5346 |
| 483 | Ga0207697_10000143 | 3300025315 | Bacteria | 34721 |
| 484 | Ga0207697_10019067 | 3300025315 | Bacteria | 2809 |
| 485 | Ga0207697_10039033 | 3300025315 | Unclassified | 1948 |
| 486 | Ga0207682_10184740 | 3300025893 | Bacteria | 953 |
| 487 | Ga0207692_10006630 | 3300025898 | Bacteria | 4706 |
| 488 | Ga0207692_10028479 | 3300025898 | Unclassified | 2643 |
| 489 | Ga0207692_10045854 | 3300025898 | Unclassified | 2189 |
| 490 | Ga0207692_10189142 | 3300025898 | Bacteria | 1204 |
| 491 | Ga0207642_10062595 | 3300025899 | Bacteria | 1736 |
| 492 | Ga0207642_10096895 | 3300025899 | Bacteria | 1471 |
| 493 | Ga0207710_10098964 | 3300025900 | Unclassified | 1373 |
| 494 | Ga0207710_10168468 | 3300025900 | Unclassified | 1070 |
| 495 | Ga0207688_10002686 | 3300025901 | Bacteria | 9626 |
| 496 | Ga0207680_10031017 | 3300025903 | Bacteria | 3024 |
| 497 | Ga0207680_10547803 | 3300025903 | Bacteria | 826 |
| 498 | Ga0207647_10031204 | 3300025904 | Bacteria | 3430 |
| 499 | Ga0207685_10016219 | 3300025905 | Bacteria | 2380 |
| 500 | Ga0207685_10043484 | 3300025905 | Bacteria | 1693 |
| 501 | Ga0207685_10049662 | 3300025905 | Bacteria | 1612 |
| 502 | Ga0207685_10214862 | 3300025905 | Bacteria | 911 |
| 503 | Ga0207699_10004012 | 3300025906 | Bacteria | 7044 |
| 504 | Ga0207699_10006533 | 3300025906 | Bacteria | 5654 |
| 505 | Ga0207699_10031968 | 3300025906 | Bacteria | 2961 |
| 506 | Ga0207645_10081854 | 3300025907 | Bacteria | 2069 |
| 507 | Ga0207645_10266798 | 3300025907 | Bacteria | 1135 |
| 508 | Ga0207643_10004131 | 3300025908 | Bacteria | 7821 |
| 509 | Ga0207684_10038320 | 3300025910 | Bacteria | 4067 |
| 510 | Ga0207684_10083434 | 3300025910 | Bacteria | 2721 |
| 511 | Ga0207654_10210395 | 3300025911 | Unclassified | 1285 |
| 512 | Ga0207707_10170658 | 3300025912 | Bacteria | 1901 |
| 513 | Ga0207695_10068686 | 3300025913 | Bacteria | 3630 |
| 514 | Ga0207695_10072281 | 3300025913 | Bacteria | 3520 |
| 515 | Ga0207695_10153992 | 3300025913 | Unclassified | 2235 |
| 516 | Ga0207671_10189948 | 3300025914 | Bacteria | 1601 |
| 517 | Ga0207693_10000777 | 3300025915 | Bacteria | 28620 |
| 518 | Ga0207693_10001047 | 3300025915 | Bacteria | 24726 |
| 519 | Ga0207693_10002215 | 3300025915 | Bacteria | 16946 |
| 520 | Ga0207693_10083296 | 3300025915 | Bacteria | 2505 |
| 521 | Ga0207663_10001539 | 3300025916 | Bacteria | 10795 |
| 522 | Ga0207663_10019520 | 3300025916 | Bacteria | 3821 |
| 523 | Ga0207663_10023854 | 3300025916 | Unclassified | 3518 |
| 524 | Ga0207663_10031948 | 3300025916 | Bacteria | 3121 |
| 525 | Ga0207663_10070153 | 3300025916 | Bacteria | 2257 |
| 526 | Ga0207663_10075561 | 3300025916 | Bacteria | 2187 |
| 527 | Ga0207663_10209827 | 3300025916 | Bacteria | 1411 |
| 528 | Ga0207663_10392933 | 3300025916 | Bacteria | 1059 |
| 529 | Ga0207660_10016841 | 3300025917 | Bacteria | 4846 |
| 530 | Ga0207660_10124929 | 3300025917 | Bacteria | 1953 |
| 531 | Ga0207657_10337769 | 3300025919 | Unclassified | 1189 |
| 532 | Ga0207649_10007720 | 3300025920 | Bacteria | 5851 |
| 533 | Ga0207649_10512717 | 3300025920 | Unclassified | 913 |
| 534 | Ga0207652_10004402 | 3300025921 | Bacteria | 11475 |
| 535 | Ga0207652_10016347 | 3300025921 | Bacteria | 6057 |
| 536 | Ga0207652_10192956 | 3300025921 | Unclassified | 1832 |
| 537 | Ga0207652_10329028 | 3300025921 | Bacteria | 1380 |
| 538 | Ga0207646_10001929 | 3300025922 | Bacteria | 24924 |
| 539 | Ga0207646_10003702 | 3300025922 | Bacteria | 17067 |
| 540 | Ga0207646_10043474 | 3300025922 | Bacteria | 4034 |
| 541 | Ga0207646_10500073 | 3300025922 | Bacteria | 1095 |
| 542 | Ga0207646_10589136 | 3300025922 | Unclassified | 999 |
| 543 | Ga0207681_10007137 | 3300025923 | Bacteria | 6851 |
| 544 | Ga0207681_10014326 | 3300025923 | Bacteria | 4925 |
| 545 | Ga0207681_10042100 | 3300025923 | Bacteria | 3048 |
| 546 | Ga0207681_10054804 | 3300025923 | Bacteria | 2713 |
| 547 | Ga0207650_10048321 | 3300025925 | Bacteria | 3138 |
| 548 | Ga0207650_10079065 | 3300025925 | Bacteria | 2490 |
| 549 | Ga0207650_10106585 | 3300025925 | Bacteria | 2164 |
| 550 | Ga0207650_10174640 | 3300025925 | Bacteria | 1709 |
| 551 | Ga0207650_10181421 | 3300025925 | Bacteria | 1678 |
| 552 | Ga0207650_10441673 | 3300025925 | Unclassified | 1082 |
| 553 | Ga0207659_10004795 | 3300025926 | Bacteria | 8201 |
| 554 | Ga0207659_10057577 | 3300025926 | Bacteria | 2787 |
| 555 | Ga0207659_10716376 | 3300025926 | Bacteria | 857 |
| 556 | Ga0207687_10022662 | 3300025927 | Bacteria | 4182 |
| 557 | Ga0207687_10028103 | 3300025927 | Bacteria | 3778 |
| 558 | Ga0207687_10455461 | 3300025927 | Unclassified | 1062 |
| 559 | Ga0207700_10000198 | 3300025928 | Bacteria | 35892 |
| 560 | Ga0207700_10005511 | 3300025928 | Bacteria | 7590 |
| 561 | Ga0207700_10008571 | 3300025928 | Bacteria | 6344 |
| 562 | Ga0207700_10012349 | 3300025928 | Bacteria | 5503 |
| 563 | Ga0207700_10025819 | 3300025928 | Bacteria | 4087 |
| 564 | Ga0207700_10136987 | 3300025928 | Unclassified | 2007 |
| 565 | Ga0207664_10060517 | 3300025929 | Bacteria | 3018 |
| 566 | Ga0207664_10165331 | 3300025929 | Unclassified | 1890 |
| 567 | Ga0207644_10019983 | 3300025931 | Bacteria | 4549 |
| 568 | Ga0207644_10155052 | 3300025931 | Bacteria | 1775 |
| 569 | Ga0207644_10158149 | 3300025931 | Bacteria | 1759 |
| 570 | Ga0207644_10196790 | 3300025931 | Unclassified | 1588 |
| 571 | Ga0207690_10060792 | 3300025932 | Bacteria | 2566 |
| 572 | Ga0207690_10061061 | 3300025932 | Bacteria | 2561 |
| 573 | Ga0207706_10001040 | 3300025933 | Bacteria | 28167 |
| 574 | Ga0207706_10032441 | 3300025933 | Bacteria | 4651 |
| 575 | Ga0207706_10108239 | 3300025933 | Bacteria | 2446 |
| 576 | Ga0207686_10015467 | 3300025934 | Bacteria | 4266 |
| 577 | Ga0207686_10070869 | 3300025934 | Bacteria | 2241 |
| 578 | Ga0207686_10088992 | 3300025934 | Bacteria | 2034 |
| 579 | Ga0207686_10103537 | 3300025934 | Bacteria | 1905 |
| 580 | Ga0207709_10102484 | 3300025935 | Bacteria | 1895 |
| 581 | Ga0207709_10330029 | 3300025935 | Bacteria | 1145 |
| 582 | Ga0207670_10041666 | 3300025936 | Bacteria | 3021 |
| 583 | Ga0207670_10261625 | 3300025936 | Bacteria | 1341 |
| 584 | Ga0207670_10301876 | 3300025936 | Bacteria | 1254 |
| 585 | Ga0207670_10338749 | 3300025936 | Unclassified | 1188 |
| 586 | Ga0207669_10002051 | 3300025937 | Bacteria | 8527 |
| 587 | Ga0207669_10043725 | 3300025937 | Bacteria | 2626 |
| 588 | Ga0207669_10051604 | 3300025937 | Unclassified | 2465 |
| 589 | Ga0207669_10068597 | 3300025937 | Bacteria | 2216 |
| 590 | Ga0207669_10083401 | 3300025937 | Bacteria | 2055 |
| 591 | Ga0207669_10228453 | 3300025937 | Bacteria | 1371 |
| 592 | Ga0207669_10457950 | 3300025937 | Bacteria | 1012 |
| 593 | Ga0207669_10594096 | 3300025937 | Archaea | 899 |
| 594 | Ga0207704_10002974 | 3300025938 | Bacteria | 7660 |
| 595 | Ga0207704_10076603 | 3300025938 | Bacteria | 2143 |
| 596 | Ga0207704_10121676 | 3300025938 | Bacteria | 1788 |
| 597 | Ga0207704_10122989 | 3300025938 | Bacteria | 1780 |
| 598 | Ga0207665_10011723 | 3300025939 | Bacteria | 5759 |
| 599 | Ga0207665_10041165 | 3300025939 | Bacteria | 3084 |
| 600 | Ga0207665_10103546 | 3300025939 | Bacteria | 1991 |
| 601 | Ga0207665_10223987 | 3300025939 | Unclassified | 1379 |
| 602 | Ga0207691_10001772 | 3300025940 | Bacteria | 21258 |
| 603 | Ga0207691_10002031 | 3300025940 | Bacteria | 19804 |
| 604 | Ga0207691_10005687 | 3300025940 | Bacteria | 12050 |
| 605 | Ga0207691_10015894 | 3300025940 | Bacteria | 7151 |
| 606 | Ga0207691_10219525 | 3300025940 | Bacteria | 1649 |
| 607 | Ga0207691_10390815 | 3300025940 | Unclassified | 1187 |
| 608 | Ga0207711_10055231 | 3300025941 | Bacteria | 3410 |
| 609 | Ga0207711_10100293 | 3300025941 | Bacteria | 2561 |
| 610 | Ga0207711_10106747 | 3300025941 | Bacteria | 2485 |
| 611 | Ga0207689_10035057 | 3300025942 | Bacteria | 4168 |
| 612 | Ga0207689_10058008 | 3300025942 | Bacteria | 3184 |
| 613 | Ga0207689_10060049 | 3300025942 | Bacteria | 3127 |
| 614 | Ga0207689_10067178 | 3300025942 | Unclassified | 2947 |
| 615 | Ga0207661_10002181 | 3300025944 | Bacteria | 13503 |
| 616 | Ga0207661_10122440 | 3300025944 | Bacteria | 2216 |
| 617 | Ga0207679_10009204 | 3300025945 | Bacteria | 6315 |
| 618 | Ga0207679_10078085 | 3300025945 | Bacteria | 2521 |
| 619 | Ga0207679_10099555 | 3300025945 | Bacteria | 2270 |
| 620 | Ga0207667_10088075 | 3300025949 | Bacteria | 3211 |
| 621 | Ga0207667_10463330 | 3300025949 | Bacteria | 1287 |
| 622 | Ga0207667_10522288 | 3300025949 | Bacteria | 1203 |
| 623 | Ga0207651_10009512 | 3300025960 | Bacteria | 5330 |
| 624 | Ga0207651_10051872 | 3300025960 | Bacteria | 2794 |
| 625 | Ga0207651_10159240 | 3300025960 | Bacteria | 1768 |
| 626 | Ga0207651_10540568 | 3300025960 | Unclassified | 1012 |
| 627 | Ga0207651_10629556 | 3300025960 | Bacteria | 940 |
| 628 | Ga0207712_10005715 | 3300025961 | Bacteria | 7839 |
| 629 | Ga0207712_10018718 | 3300025961 | Bacteria | 4514 |
| 630 | Ga0207712_10031016 | 3300025961 | Bacteria | 3598 |
| 631 | Ga0207668_10197776 | 3300025972 | Bacteria | 1598 |
| 632 | Ga0207640_10231360 | 3300025981 | Unclassified | 1422 |
| 633 | Ga0207658_10207493 | 3300025986 | Bacteria | 1640 |
| 634 | Ga0207658_10458895 | 3300025986 | Bacteria | 1129 |
| 635 | Ga0207658_10622705 | 3300025986 | Bacteria | 971 |
| 636 | Ga0207677_10018985 | 3300026023 | Bacteria | 4141 |
| 637 | Ga0207677_10122991 | 3300026023 | Bacteria | 1956 |
| 638 | Ga0207677_10502626 | 3300026023 | Unclassified | 1048 |
| 639 | Ga0207703_10022356 | 3300026035 | Bacteria | 4960 |
| 640 | Ga0207703_10206038 | 3300026035 | Bacteria | 1750 |
| 641 | Ga0207639_10057652 | 3300026041 | Bacteria | 2983 |
| 642 | Ga0207639_10090509 | 3300026041 | Bacteria | 2447 |
| 643 | Ga0207678_10022795 | 3300026067 | Bacteria | 5483 |
| 644 | Ga0207678_10116577 | 3300026067 | Bacteria | 2279 |
| 645 | Ga0207678_10249368 | 3300026067 | Bacteria | 1520 |
| 646 | Ga0207708_10040016 | 3300026075 | Bacteria | 3573 |
| 647 | Ga0207708_10111785 | 3300026075 | Bacteria | 2121 |
| 648 | Ga0207708_10470049 | 3300026075 | Unclassified | 1050 |
| 649 | Ga0207702_10148735 | 3300026078 | Bacteria | 2128 |
| 650 | Ga0207641_10002046 | 3300026088 | Bacteria | 19179 |
| 651 | Ga0207641_10062188 | 3300026088 | Bacteria | 3185 |
| 652 | Ga0207641_10142883 | 3300026088 | Bacteria | 2162 |
| 653 | Ga0207641_10395844 | 3300026088 | Unclassified | 1325 |
| 654 | Ga0207641_10454030 | 3300026088 | Bacteria | 1239 |
| 655 | Ga0207648_10025474 | 3300026089 | Bacteria | 5268 |
| 656 | Ga0207648_10079346 | 3300026089 | Unclassified | 2863 |
| 657 | Ga0207648_10882872 | 3300026089 | Bacteria | 835 |
| 658 | Ga0207676_10014980 | 3300026095 | Bacteria | 5587 |
| 659 | Ga0207676_10141259 | 3300026095 | Bacteria | 2062 |
| 660 | Ga0207676_10319130 | 3300026095 | Bacteria | 1425 |
| 661 | Ga0207676_10507766 | 3300026095 | Bacteria | 1146 |
| 662 | Ga0207676_10570234 | 3300026095 | Bacteria | 1084 |
| 663 | Ga0207674_10000575 | 3300026116 | Bacteria | 48309 |
| 664 | Ga0207674_10050804 | 3300026116 | Bacteria | 4234 |
| 665 | Ga0207674_10060999 | 3300026116 | Bacteria | 3811 |
| 666 | Ga0207675_100015566 | 3300026118 | Bacteria | 7094 |
| 667 | Ga0207675_100050343 | 3300026118 | Bacteria | 3887 |
| 668 | Ga0207675_100071374 | 3300026118 | Bacteria | 3247 |
| 669 | Ga0207675_100090262 | 3300026118 | Bacteria | 2881 |
| 670 | Ga0207675_100188437 | 3300026118 | Bacteria | 1978 |
| 671 | Ga0207675_100324138 | 3300026118 | Bacteria | 1505 |
| 672 | Ga0207683_10004709 | 3300026121 | Bacteria | 11761 |
| 673 | Ga0207683_10029677 | 3300026121 | Bacteria | 4736 |
| 674 | Ga0207683_10030498 | 3300026121 | Bacteria | 4672 |
| 675 | Ga0207683_10180490 | 3300026121 | Bacteria | 1914 |
| 676 | Ga0207683_10248801 | 3300026121 | Bacteria | 1622 |
| 677 | Ga0207683_10419621 | 3300026121 | Bacteria | 1232 |
| 678 | Ga0207698_10034543 | 3300026142 | Bacteria | 3687 |
| 679 | Ga0207698_10039495 | 3300026142 | Bacteria | 3497 |
| 680 | Ga0207698_10170029 | 3300026142 | Bacteria | 1918 |
| 681 | Ga0207698_10244188 | 3300026142 | Bacteria | 1638 |
| 682 | Ga0209969_1007367 | 3300027360 | Bacteria | 1554 |
| 683 | Ga0209967_1004235 | 3300027364 | Unclassified | 1900 |
| 684 | Ga0209981_1000710 | 3300027378 | Bacteria | 4223 |
| 685 | Ga0209984_1003798 | 3300027424 | Bacteria | 1748 |
| 686 | Ga0209968_1003617 | 3300027526 | Bacteria | 2319 |
| 687 | Ga0209999_1000389 | 3300027543 | Bacteria | 6718 |
| 688 | Ga0209999_1006859 | 3300027543 | Bacteria | 2048 |
| 689 | Ga0209998_10000643 | 3300027717 | Bacteria | 9368 |
| 690 | Ga0209813_10142904 | 3300027866 | Bacteria | 851 |
| 691 | Ga0209974_10015654 | 3300027876 | Bacteria | 2519 |
| 692 | Ga0207428_10004350 | 3300027907 | Bacteria | 13528 |
| 693 | Ga0207428_10017349 | 3300027907 | Bacteria | 6180 |
| 694 | Ga0207428_10018214 | 3300027907 | Bacteria | 6002 |
| 695 | Ga0207428_10031150 | 3300027907 | Bacteria | 4405 |
| 696 | Ga0207428_10035437 | 3300027907 | Bacteria | 4078 |
| 697 | Ga0207428_10072230 | 3300027907 | Bacteria | 2709 |
| 698 | Ga0265356_1000423 | 3300028017 | Bacteria | 7674 |
| 699 | Ga0268266_10009803 | 3300028379 | Bacteria | 8425 |
| 700 | Ga0268266_10022674 | 3300028379 | Bacteria | 5345 |
| 701 | Ga0268266_10052185 | 3300028379 | Bacteria | 3511 |
| 702 | Ga0268266_10095384 | 3300028379 | Bacteria | 2613 |
| 703 | Ga0268266_10119392 | 3300028379 | Bacteria | 2345 |
| 704 | Ga0268266_10156817 | 3300028379 | Bacteria | 2057 |
| 705 | Ga0268266_10393427 | 3300028379 | Unclassified | 1309 |
| 706 | Ga0268265_10002430 | 3300028380 | Bacteria | 14059 |
| 707 | Ga0268265_10185104 | 3300028380 | Unclassified | 1793 |
| 708 | Ga0268265_10748772 | 3300028380 | Unclassified | 948 |
| 709 | Ga0268264_10047178 | 3300028381 | Bacteria | 3581 |
| 710 | Ga0268264_10051938 | 3300028381 | Bacteria | 3417 |
| 711 | Ga0268264_10080440 | 3300028381 | Unclassified | 2783 |
| 712 | Ga0268264_10592615 | 3300028381 | Bacteria | 1092 |
| 713 | Ga0265318_10002057 | 3300028577 | Bacteria | 11050 |
| 714 | Ga0265338_10001605 | 3300028800 | Bacteria | 36301 |
| 715 | Ga0265338_10013275 | 3300028800 | Bacteria | 9314 |
| 716 | Ga0265338_10047014 | 3300028800 | Bacteria | 3947 |
| 717 | Ga0265338_10059006 | 3300028800 | Bacteria | 3382 |
| 718 | Ga0265338_10079282 | 3300028800 | Bacteria | 2764 |
| 719 | Ga0265338_10147163 | 3300028800 | Bacteria | 1836 |
| 720 | Ga0265324_10015820 | 3300029957 | Bacteria | 2769 |
| 721 | Ga0265324_10053961 | 3300029957 | Bacteria | 1380 |
| 722 | Ga0316182_1026306 | 3300030745 | Bacteria | 853 |
| 723 | Ga0265762_1002849 | 3300030760 | Bacteria | 3091 |
| 724 | Ga0265762_1033164 | 3300030760 | Unclassified | 987 |
| 725 | Ga0265770_1006016 | 3300030878 | Bacteria | 1680 |
| 726 | Ga0265765_1001162 | 3300030879 | Bacteria | 2359 |
| 727 | Ga0265760_10001235 | 3300031090 | Bacteria | 7472 |
| 728 | Ga0265760_10001341 | 3300031090 | Bacteria | 7230 |
| 729 | Ga0265760_10008710 | 3300031090 | Bacteria | 2899 |
| 730 | Ga0265760_10022068 | 3300031090 | Bacteria | 1843 |
| 731 | Ga0265760_10026805 | 3300031090 | Bacteria | 1687 |
| 732 | Ga0265330_10001378 | 3300031235 | Bacteria | 14200 |
| 733 | Ga0265332_10026881 | 3300031238 | Bacteria | 2522 |
| 734 | Ga0265328_10008859 | 3300031239 | Bacteria | 4127 |
| 735 | Ga0265325_10001701 | 3300031241 | Bacteria | 15288 |
| 736 | Ga0265325_10015579 | 3300031241 | Bacteria | 4271 |
| 737 | Ga0265325_10110679 | 3300031241 | Bacteria | 1335 |
| 738 | Ga0265329_10007065 | 3300031242 | Bacteria | 4379 |
| 739 | Ga0265340_10004335 | 3300031247 | Bacteria | 7944 |
| 740 | Ga0265340_10016207 | 3300031247 | Bacteria | 3862 |
| 741 | Ga0265339_10001359 | 3300031249 | Bacteria | 18276 |
| 742 | Ga0265339_10001433 | 3300031249 | Bacteria | 17692 |
| 743 | Ga0265339_10015256 | 3300031249 | Bacteria | 4609 |
| 744 | Ga0265339_10070221 | 3300031249 | Bacteria | 1868 |
| 745 | Ga0265339_10099828 | 3300031249 | Bacteria | 1512 |
| 746 | Ga0265339_10195060 | 3300031249 | Unclassified | 1002 |
| 747 | Ga0265316_10000390 | 3300031344 | Bacteria | 50094 |
| 748 | Ga0265316_10010760 | 3300031344 | Bacteria | 8312 |
| 749 | Ga0265316_10038328 | 3300031344 | Bacteria | 3862 |
| 750 | Ga0265316_10055009 | 3300031344 | Bacteria | 3115 |
| 751 | Ga0307408_100048150 | 3300031548 | Bacteria | 3056 |
| 752 | Ga0307408_100139689 | 3300031548 | Bacteria | 1900 |
| 753 | Ga0307408_100151714 | 3300031548 | Bacteria | 1830 |
| 754 | Ga0307408_100174452 | 3300031548 | Unclassified | 1719 |
| 755 | Ga0307408_100183425 | 3300031548 | Bacteria | 1680 |
| 756 | Ga0307408_100295799 | 3300031548 | Bacteria | 1354 |
| 757 | Ga0265313_10003345 | 3300031595 | Bacteria | 13107 |
| 758 | Ga0265313_10021569 | 3300031595 | Bacteria | 3520 |
| 759 | Ga0265313_10056632 | 3300031595 | Bacteria | 1853 |
| 760 | Ga0265313_10074225 | 3300031595 | Unclassified | 1560 |
| 761 | Ga0265314_10000036 | 3300031711 | Bacteria | 234928 |
| 762 | Ga0265314_10011383 | 3300031711 | Bacteria | 7350 |
| 763 | Ga0265314_10022322 | 3300031711 | Bacteria | 4849 |
| 764 | Ga0265314_10189069 | 3300031711 | Bacteria | 1227 |
| 765 | Ga0265342_10000377 | 3300031712 | Bacteria | 49212 |
| 766 | Ga0265342_10014311 | 3300031712 | Bacteria | 5271 |
| 767 | Ga0265342_10099396 | 3300031712 | Bacteria | 1659 |
| 768 | Ga0265342_10171033 | 3300031712 | Bacteria | 1195 |
| 769 | Ga0307405_10082905 | 3300031731 | Bacteria | 2100 |
| 770 | Ga0307405_10217702 | 3300031731 | Bacteria | 1399 |
| 771 | Ga0307405_10286370 | 3300031731 | Bacteria | 1243 |
| 772 | Ga0307413_10089673 | 3300031824 | Bacteria | 1998 |
| 773 | Ga0307413_10218617 | 3300031824 | Viruses | 1390 |
| 774 | Ga0307410_10059563 | 3300031852 | Bacteria | 2607 |
| 775 | Ga0307410_10073363 | 3300031852 | Bacteria | 2379 |
| 776 | Ga0307410_10137436 | 3300031852 | Unclassified | 1803 |
| 777 | Ga0307410_10175072 | 3300031852 | Bacteria | 1620 |
| 778 | Ga0307406_10012696 | 3300031901 | Bacteria | 4805 |
| 779 | Ga0307406_10609316 | 3300031901 | Bacteria | 901 |
| 780 | Ga0307406_10708976 | 3300031901 | Unclassified | 841 |
| 781 | Ga0307407_10051735 | 3300031903 | Bacteria | 2356 |
| 782 | Ga0307407_10056869 | 3300031903 | Bacteria | 2267 |
| 783 | Ga0307407_10081474 | 3300031903 | Bacteria | 1959 |
| 784 | Ga0307407_10120970 | 3300031903 | Bacteria | 1660 |
| 785 | Ga0307407_10152042 | 3300031903 | Bacteria | 1505 |
| 786 | Ga0307407_10176583 | 3300031903 | Bacteria | 1412 |
| 787 | Ga0307412_10007208 | 3300031911 | Bacteria | 6311 |
| 788 | Ga0307409_100050964 | 3300031995 | Bacteria | 3165 |
| 789 | Ga0307409_100227697 | 3300031995 | Bacteria | 1687 |
| 790 | Ga0307409_100609221 | 3300031995 | Bacteria | 1080 |
| 791 | Ga0307416_100002533 | 3300032002 | Bacteria | 10516 |
| 792 | Ga0307416_100217433 | 3300032002 | Bacteria | 1829 |
| 793 | Ga0307416_100411547 | 3300032002 | Bacteria | 1393 |
| 794 | Ga0307416_100450504 | 3300032002 | Bacteria | 1339 |
| 795 | Ga0307416_100475009 | 3300032002 | Unclassified | 1309 |
| 796 | Ga0307416_100920258 | 3300032002 | Bacteria | 975 |
| 797 | Ga0307414_10031178 | 3300032004 | Bacteria | 3494 |
| 798 | Ga0307414_10407648 | 3300032004 | Bacteria | 1182 |
| 799 | Ga0307411_10023552 | 3300032005 | Bacteria | 3650 |
| 800 | Ga0307411_10060712 | 3300032005 | Bacteria | 2512 |
| 801 | Ga0307411_10352827 | 3300032005 | Bacteria | 1200 |
| 802 | Ga0307411_10786798 | 3300032005 | Unclassified | 836 |
| 803 | Ga0307415_100295942 | 3300032126 | Bacteria | 1338 |
| 804 | Ga0373956_0002098 | 3300035119 | Bacteria | 8262 |
| 805 | Ga0373956_0041023 | 3300035119 | Bacteria | 2054 |
| 806 | Ga0373943_0209967 | 3300035170 | Unclassified | 1081 |
| 807 | Ga0373955_0013885 | 3300035172 | Bacteria | 3908 |
| 808 | Ga0373955_0271183 | 3300035172 | Bacteria | 1020 |
| 809 | Ga0373931_0018469 | 3300035691 | Bacteria | 3470 |
| 810 | Ga0373935_0058605 | 3300035692 | Bacteria | 2460 |
| 811 | Ga0373927_0005068 | 3300035695 | Bacteria | 9116 |
| 812 | Ga0373933_0001471 | 3300035724 | Bacteria | 13798 |
| 813 | Ga0373933_0014088 | 3300035724 | Bacteria | 4440 |
| 814 | Ga0373933_0084803 | 3300035724 | Unclassified | 1947 |
| 815 | Ga0373933_0127262 | 3300035724 | Bacteria | 1599 |
| 816 | Ga0373947_0179311 | 3300035725 | Bacteria | 1378 |
| 817 | Ga0373947_0247796 | 3300035725 | Bacteria | 1177 |
| 818 | Ga0373937_0001030 | 3300036401 | Bacteria | 23591 |
| 819 | Ga0373937_0003079 | 3300036401 | Bacteria | 13946 |
| 820 | Ga0373937_0033841 | 3300036401 | Bacteria | 4645 |
| 821 | Ga0373937_0069458 | 3300036401 | Bacteria | 3248 |
| 822 | Ga0373937_0173832 | 3300036401 | Bacteria | 2021 |
| 823 | Ga0373937_0362514 | 3300036401 | Unclassified | 1374 |
| 824 | Ga0373925_0003129 | 3300037068 | Bacteria | 12993 |
| 825 | Ga0373925_0083786 | 3300037068 | Bacteria | 2429 |
| 826 | Ga0373925_0247614 | 3300037068 | Bacteria | 1429 |
| 827 | Ga0395905_0453062 | 3300037471 | Bacteria | 1181 |
| 828 | Ga0436363_0539142 | 3300039450 | Unclassified | 943 |
| 829 | Ga0451791_1176516 | 3300041451 | Bacteria | 984 |
| 830 | Ga0451798_0445253 | 3300041458 | Bacteria | 930 |
| 831 | Ga0450923_003291 | 3300042125 | Bacteria | 2421 |
| 832 | Ga0450923_014069 | 3300042125 | Bacteria | 1480 |
| 833 | Ga0450894_008837 | 3300042131 | Bacteria | 1304 |
| 834 | Ga0450895_006956 | 3300042132 | Bacteria | 932 |
| 835 | Ga0450896_000837 | 3300042133 | Bacteria | 3493 |
| 836 | Ga0450896_009039 | 3300042133 | Bacteria | 1386 |
| 837 | Ga0450906_017884 | 3300042145 | Bacteria | 1275 |
| 838 | Ga0450908_003258 | 3300042184 | Bacteria | 3163 |
| 839 | Ga0439434_0092754 | 3300042435 | Unclassified | 967 |
| 840 | Ga0439435_0004469 | 3300042436 | Bacteria | 3015 |
| 841 | Ga0439435_0014096 | 3300042436 | Bacteria | 1970 |
| 842 | Ga0439440_0096651 | 3300042993 | Bacteria | 799 |
| 843 | Ga0453683_0088864 | 3300044673 | Bacteria | 1936 |
| 844 | Ga0453684_0040322 | 3300044712 | Bacteria | 6343 |
| 845 | Ga0451576_0053807 | 3300045051 | Bacteria | 4215 |
| 846 | Ga0451576_0103412 | 3300045051 | Bacteria | 2963 |
| 847 | Ga0451576_0282680 | 3300045051 | Bacteria | 1735 |
| 848 | Ga0466967_0028686 | 3300045976 | Bacteria | 4650 |
| 849 | Ga0495592_0017164 | 3300046454 | Bacteria | 5497 |
| 850 | Ga0495592_0081347 | 3300046454 | Unclassified | 2342 |
| 851 | Ga0495592_0083672 | 3300046454 | Bacteria | 2304 |
| 852 | Ga0495592_0161553 | 3300046454 | Archaea | 1541 |
| 853 | Ga0495603_0010045 | 3300046455 | Bacteria | 5726 |
| 854 | Ga0495603_0054628 | 3300046455 | Bacteria | 2367 |
| 855 | Ga0495629_0033455 | 3300046459 | Bacteria | 3636 |
| 856 | Ga0495629_0078901 | 3300046459 | Bacteria | 2298 |
| 857 | Ga0495629_0371005 | 3300046459 | Unclassified | 975 |
| 858 | Ga0495638_0258703 | 3300046460 | Unclassified | 956 |
| 859 | Ga0495651_0037993 | 3300046462 | Bacteria | 3749 |
| 860 | Ga0495651_0199714 | 3300046462 | Bacteria | 1400 |
| 861 | Ga0495653_0099170 | 3300046463 | Bacteria | 2114 |
| 862 | Ga0495653_0136064 | 3300046463 | Bacteria | 1733 |
| 863 | Ga0495653_0181458 | 3300046463 | Bacteria | 1444 |
| 864 | Ga0495580_0013226 | 3300046472 | Bacteria | 6309 |
| 865 | Ga0495580_0028251 | 3300046472 | Bacteria | 4079 |
| 866 | Ga0495580_0067093 | 3300046472 | Bacteria | 2511 |
| 867 | Ga0495580_0079671 | 3300046472 | Bacteria | 2284 |
| 868 | Ga0495580_0093087 | 3300046472 | Bacteria | 2098 |
| 869 | Ga0495580_0102057 | 3300046472 | Bacteria | 1994 |
| 870 | Ga0495580_0228324 | 3300046472 | Bacteria | 1278 |
| 871 | Ga0495582_0056920 | 3300046473 | Bacteria | 2155 |
| 872 | Ga0495582_0079881 | 3300046473 | Bacteria | 1816 |
| 873 | Ga0495639_0052566 | 3300046475 | Unclassified | 1855 |
| 874 | Ga0495639_0201324 | 3300046475 | Bacteria | 975 |
| 875 | Ga0495662_0085681 | 3300046476 | Bacteria | 1534 |
| 876 | Ga0495664_0050182 | 3300046477 | Bacteria | 2477 |
| 877 | Ga0495664_0187083 | 3300046477 | Bacteria | 1255 |
| 878 | Ga0495664_0297103 | 3300046477 | Unclassified | 975 |
| 879 | Ga0495585_0035699 | 3300046492 | Bacteria | 2808 |
| 880 | Ga0495594_0003320 | 3300046499 | Bacteria | 8324 |
| 881 | Ga0495594_0008275 | 3300046499 | Bacteria | 5355 |
| 882 | Ga0495594_0042823 | 3300046499 | Bacteria | 2480 |
| 883 | Ga0495608_0027773 | 3300046511 | Bacteria | 3848 |
| 884 | Ga0495608_0131840 | 3300046511 | Unclassified | 1599 |
| 885 | Ga0495628_0081840 | 3300046516 | Bacteria | 2508 |
| 886 | Ga0495628_0150551 | 3300046516 | Unclassified | 1773 |
| 887 | Ga0495628_0212094 | 3300046516 | Bacteria | 1456 |
| 888 | Ga0495628_0216009 | 3300046516 | Bacteria | 1441 |
| 889 | Ga0495630_0010653 | 3300046517 | Bacteria | 6636 |
| 890 | Ga0495630_0152070 | 3300046517 | Bacteria | 1761 |
| 891 | Ga0495630_0280250 | 3300046517 | Unclassified | 1273 |
| 892 | Ga0495631_0032023 | 3300046518 | Bacteria | 2372 |
| 893 | Ga0495643_0003764 | 3300046522 | Bacteria | 10963 |
| 894 | Ga0495644_0000109 | 3300046523 | Bacteria | 39201 |
| 895 | Ga0495663_0094403 | 3300046525 | Bacteria | 978 |
| 896 | Ga0495652_0041555 | 3300046529 | Bacteria | 3969 |
| 897 | Ga0495652_0085712 | 3300046529 | Bacteria | 2588 |
| 898 | Ga0495652_0151957 | 3300046529 | Bacteria | 1808 |
| 899 | Ga0495652_0225891 | 3300046529 | Unclassified | 1403 |
| 900 | Ga0495652_0347145 | 3300046529 | Bacteria | 1064 |
| 901 | Ga0495652_0390713 | 3300046529 | Bacteria | 987 |
| 902 | Ga0495665_0030788 | 3300046531 | Bacteria | 2871 |
| 903 | Ga0495665_0178545 | 3300046531 | Unclassified | 1104 |
| 904 | Ga0495640_0037807 | 3300046533 | Bacteria | 3401 |
| 905 | Ga0495640_0253150 | 3300046533 | Unclassified | 1102 |
| 906 | Ga0495586_0035800 | 3300046535 | Bacteria | 2667 |
| 907 | Ga0495586_0119484 | 3300046535 | Unclassified | 1471 |
| 908 | Ga0495586_0236429 | 3300046535 | Unclassified | 1041 |
| 909 | Ga0495587_0025928 | 3300046536 | Bacteria | 3578 |
| 910 | Ga0495587_0029174 | 3300046536 | Bacteria | 3351 |
| 911 | Ga0495587_0123175 | 3300046536 | Bacteria | 1484 |
| 912 | Ga0495587_0136670 | 3300046536 | Bacteria | 1400 |
| 913 | Ga0495598_0005985 | 3300046537 | Bacteria | 2724 |
| 914 | Ga0495609_0020406 | 3300046538 | Bacteria | 3062 |
| 915 | Ga0495621_0014470 | 3300046539 | Bacteria | 2497 |
| 916 | Ga0495645_0016503 | 3300046543 | Bacteria | 5274 |
| 917 | Ga0495645_0178684 | 3300046543 | Bacteria | 1456 |
| 918 | Ga0495645_0192796 | 3300046543 | Bacteria | 1387 |
| 919 | Ga0495645_0208075 | 3300046543 | Unclassified | 1323 |
| 920 | Ga0495645_0216281 | 3300046543 | Bacteria | 1291 |
| 921 | Ga0495645_0311346 | 3300046543 | Bacteria | 1025 |
| 922 | Ga0495622_0192448 | 3300046557 | Unclassified | 911 |
| 923 | Ga0495667_0039839 | 3300046559 | Bacteria | 3122 |
| 924 | Ga0495656_0197048 | 3300046615 | Unclassified | 998 |
| 925 | Ga0495625_0031576 | 3300046660 | Bacteria | 3937 |
| 926 | Ga0495635_0049008 | 3300046663 | Bacteria | 2912 |
| 927 | Ga0495657_0192659 | 3300046675 | Unclassified | 1245 |
| 928 | Ga0495599_0038419 | 3300046678 | Bacteria | 3008 |
| 929 | Ga0495599_0079212 | 3300046678 | Unclassified | 2052 |
| 930 | Ga0495623_0090094 | 3300046679 | Bacteria | 1884 |
| 931 | Ga0495646_0078664 | 3300046680 | Bacteria | 1927 |
| 932 | Ga0495646_0101678 | 3300046680 | Bacteria | 1647 |
| 933 | Ga0495647_0019003 | 3300046681 | Bacteria | 2453 |
| 934 | Ga0495658_0033654 | 3300046683 | Bacteria | 2809 |
| 935 | Ga0495658_0077383 | 3300046683 | Bacteria | 1945 |
| 936 | Ga0495613_0009371 | 3300046689 | Bacteria | 7264 |
| 937 | Ga0495613_0047184 | 3300046689 | Bacteria | 3182 |
| 938 | Ga0495624_0299484 | 3300046690 | Unclassified | 970 |
| 939 | Ga0495600_0019687 | 3300046809 | Bacteria | 4313 |
| 940 | Ga0495600_0279910 | 3300046809 | Unclassified | 1056 |
| 941 | Ga0495581_0054528 | 3300047315 | Bacteria | 2308 |
| 942 | Ga0495604_0000316 | 3300047317 | Bacteria | 43437 |
| 943 | Ga0495604_0042575 | 3300047317 | Bacteria | 3558 |
| 944 | Ga0495604_0342442 | 3300047317 | Bacteria | 995 |
| 945 | Ga0495674_0054208 | 3300047319 | Bacteria | 3522 |
| 946 | Ga0495674_0063090 | 3300047319 | Bacteria | 3224 |
| 947 | Ga0495674_0083402 | 3300047319 | Bacteria | 2740 |
| 948 | Ga0495674_0142328 | 3300047319 | Bacteria | 2015 |
| 949 | Ga0495674_0238692 | 3300047319 | Bacteria | 1498 |
| 950 | Ga0495674_0387908 | 3300047319 | Unclassified | 1129 |
| 951 | Ga0495674_0388382 | 3300047319 | Unclassified | 1128 |
| 952 | Ga0495672_0102811 | 3300047320 | Bacteria | 1546 |
| 953 | Ga0495680_0187100 | 3300047322 | Bacteria | 1491 |
| 954 | Ga0495680_0222615 | 3300047322 | Bacteria | 1346 |
| 955 | Ga0495683_0087409 | 3300047323 | Bacteria | 1514 |
| 956 | Ga0495684_0006774 | 3300047471 | Bacteria | 8895 |
| 957 | Ga0495684_0056684 | 3300047471 | Bacteria | 2987 |
| 958 | Ga0495684_0066907 | 3300047471 | Bacteria | 2732 |
| 959 | Ga0495684_0181837 | 3300047471 | Bacteria | 1558 |
| 960 | Ga0495684_0217385 | 3300047471 | Bacteria | 1403 |
| 961 | Ga0495684_0253897 | 3300047471 | Unclassified | 1278 |
| 962 | Ga0495593_0114561 | 3300047673 | Bacteria | 1375 |
| 963 | Ga0495602_0010139 | 3300048088 | Bacteria | 9781 |
| 964 | Ga0495602_0116057 | 3300048088 | Unclassified | 2164 |
| 965 | Ga0495614_0024936 | 3300048089 | Bacteria | 2581 |
| 966 | Ga0495614_0124447 | 3300048089 | Bacteria | 1139 |
| 967 | Ga0496100_0046526 | 3300048903 | Bacteria | 2791 |
| 968 | Ga0496100_0072079 | 3300048903 | Bacteria | 2308 |
| 969 | Ga0496100_0094185 | 3300048903 | Bacteria | 2051 |
| 970 | Ga0496101_0001837 | 3300048904 | Bacteria | 12801 |
| 971 | Ga0496101_0148706 | 3300048904 | Bacteria | 1790 |
| 972 | Ga0496101_0456376 | 3300048904 | Bacteria | 1008 |
| 973 | Ga0496102_0301087 | 3300048905 | Bacteria | 1511 |
| 974 | Ga0496102_0467491 | 3300048905 | Unclassified | 1182 |
| 975 | Ga0496104_0003735 | 3300048907 | Bacteria | 13150 |
| 976 | Ga0496104_0008309 | 3300048907 | Bacteria | 9219 |
| 977 | Ga0496104_0024458 | 3300048907 | Bacteria | 5555 |
| 978 | Ga0496104_0151114 | 3300048907 | Bacteria | 2229 |
| 979 | Ga0496104_0170574 | 3300048907 | Unclassified | 2086 |
| 980 | Ga0496104_0343306 | 3300048907 | Bacteria | 1406 |
| 981 | Ga0496104_0358902 | 3300048907 | Bacteria | 1370 |
| 982 | Ga0496104_0540880 | 3300048907 | Bacteria | 1076 |
| 983 | Ga0496105_0057040 | 3300048908 | Bacteria | 3225 |
| 984 | Ga0496105_0214782 | 3300048908 | Bacteria | 1567 |
| 985 | Ga0496105_0369591 | 3300048908 | Unclassified | 1143 |
| 986 | Ga0496106_0067050 | 3300048909 | Bacteria | 2735 |
| 987 | Ga0496106_0098327 | 3300048909 | Bacteria | 2267 |
| 988 | Ga0496106_0175523 | 3300048909 | Bacteria | 1700 |
| 989 | Ga0496107_0013317 | 3300048910 | Bacteria | 5746 |
| 990 | Ga0496108_0005593 | 3300048911 | Bacteria | 10171 |
| 991 | Ga0496108_0007576 | 3300048911 | Bacteria | 8792 |
| 992 | Ga0496109_0001076 | 3300048912 | Bacteria | 22664 |
| 993 | Ga0496109_0002699 | 3300048912 | Bacteria | 14878 |
| 994 | Ga0496109_0096662 | 3300048912 | Bacteria | 2737 |
| 995 | Ga0496109_0218401 | 3300048912 | Bacteria | 1793 |
| 996 | Ga0496110_0035447 | 3300048913 | Bacteria | 4328 |
| 997 | Ga0496110_0054407 | 3300048913 | Unclassified | 3520 |
| 998 | Ga0496111_0008105 | 3300048914 | Bacteria | 6938 |
| 999 | Ga0496112_0014045 | 3300048915 | Bacteria | 7413 |
| 1000 | Ga0496112_0042091 | 3300048915 | Bacteria | 4469 |
| 1001 | Ga0496112_0161409 | 3300048915 | Bacteria | 2208 |
| 1002 | Ga0496113_0001631 | 3300048916 | Bacteria | 12647 |
| 1003 | Ga0496114_0004686 | 3300048917 | Bacteria | 10632 |
| 1004 | Ga0496114_0086563 | 3300048917 | Unclassified | 2656 |
| 1005 | Ga0496114_0218872 | 3300048917 | Bacteria | 1671 |
| 1006 | Ga0496114_0347937 | 3300048917 | Bacteria | 1311 |
| 1007 | Ga0496115_0021362 | 3300048918 | Bacteria | 5000 |
| 1008 | Ga0496115_0055490 | 3300048918 | Unclassified | 3182 |
| 1009 | Ga0496115_0133278 | 3300048918 | Bacteria | 2048 |
| 1010 | Ga0501291_007916 | 3300049514 | Bacteria | 1454 |
| 1011 | Ga0501036_0058624 | 3300049572 | Bacteria | 3262 |
| 1012 | Ga0501037_0394262 | 3300049573 | Unclassified | 950 |
| 1013 | Ga0501040_0191520 | 3300049576 | Bacteria | 1451 |
| 1014 | Ga0501041_0031028 | 3300049577 | Bacteria | 3227 |
| 1015 | Ga0501069_0027812 | 3300049585 | Bacteria | 3100 |
| 1016 | Ga0501071_0012615 | 3300049587 | Bacteria | 5739 |
| 1017 | Ga0501071_0049679 | 3300049587 | Bacteria | 3020 |
| 1018 | Ga0501075_0011221 | 3300049591 | Bacteria | 6337 |
| 1019 | Ga0501076_0076897 | 3300049592 | Bacteria | 2677 |
| 1020 | Ga0501076_0478742 | 3300049592 | Archaea | 1026 |
| 1021 | Ga0501077_0147882 | 3300049593 | Bacteria | 1491 |
| 1022 | Ga0501077_0314520 | 3300049593 | Archaea | 998 |
| 1023 | Ga0501198_017588 | 3300049649 | Unclassified | 1114 |
| 1024 | Ga0501202_007714 | 3300049652 | Viruses | 1950 |
| 1025 | Ga0501217_001467 | 3300049661 | Bacteria | 4431 |
| 1026 | Ga0501223_002624 | 3300049663 | Bacteria | 3961 |
| 1027 | Ga0501224_000395 | 3300049664 | Bacteria | 5193 |
| 1028 | Ga0501227_010631 | 3300049665 | Bacteria | 1996 |
| 1029 | Ga0501230_005381 | 3300049667 | Bacteria | 1809 |
| 1030 | Ga0501233_005145 | 3300049668 | Bacteria | 2421 |
| 1031 | Ga0501235_000489 | 3300049669 | Bacteria | 7865 |
| 1032 | Ga0501242_002627 | 3300049674 | Bacteria | 1902 |
| 1033 | Ga0501243_000954 | 3300049675 | Bacteria | 4053 |
| 1034 | Ga0501249_005818 | 3300049679 | Bacteria | 2521 |
| 1035 | Ga0501253_001128 | 3300049683 | Bacteria | 2613 |
| 1036 | Ga0501257_002139 | 3300049686 | Bacteria | 4131 |
| 1037 | Ga0501257_040600 | 3300049686 | Bacteria | 1142 |
| 1038 | Ga0501225_0002679 | 3300049705 | Bacteria | 5465 |
| 1039 | Ga0501225_0024051 | 3300049705 | Bacteria | 1678 |
| 1040 | Ga0501234_001150 | 3300049707 | Bacteria | 4177 |
| 1041 | Ga0501079_0046282 | 3300049741 | Bacteria | 3357 |
| 1042 | Ga0501079_0177253 | 3300049741 | Bacteria | 1663 |
| 1043 | Ga0501266_002342 | 3300049763 | Bacteria | 2397 |
| 1044 | Ga0501268_000019 | 3300049765 | Bacteria | 13906 |
| 1045 | Ga0501271_006873 | 3300049768 | Bacteria | 1137 |
| 1046 | Ga0501274_004109 | 3300049771 | Unclassified | 1191 |
| 1047 | Ga0501283_010898 | 3300049779 | Bacteria | 1344 |
| 1048 | Ga0501045_0296795 | 3300049824 | Unclassified | 1203 |
| 1049 | nmdc:mga00v17_104704_c1 | 3300050491 | Bacteria | 1789 |
| 1050 | nmdc:mga00v17_137747_c1 | 3300050491 | Bacteria | 1563 |
| 1051 | nmdc:mga0yw44_71820_c1 | 3300050492 | Bacteria | 2150 |
| 1052 | nmdc:mga0k408_110591_c1 | 3300050493 | Bacteria | 1624 |
| 1053 | nmdc:mga0k408_17100_c1 | 3300050493 | Unclassified | 1973 |
| 1054 | nmdc:mga0k408_375805_c1 | 3300050493 | Bacteria | 847 |
| 1055 | nmdc:mga0k408_52122_c1 | 3300050493 | Bacteria | 2371 |
| 1056 | nmdc:mga06z11_231402_c1 | 3300050494 | Bacteria | 1083 |
| 1057 | nmdc:mga06z11_23354_c1 | 3300050494 | Bacteria | 2904 |
| 1058 | nmdc:mga06z11_261575_c1 | 3300050494 | Unclassified | 1021 |
| 1059 | nmdc:mga07m45_29874_c1 | 3300050496 | Bacteria | 3017 |
| 1060 | nmdc:mga05p37_1385_c1 | 3300050507 | Bacteria | 28201 |
| 1061 | nmdc:mga05p37_157704_c1 | 3300050507 | Bacteria | 2773 |
| 1062 | nmdc:mga05p37_210934_c1 | 3300050507 | Unclassified | 2348 |
| 1063 | nmdc:mga05p37_232070_c1 | 3300050507 | Bacteria | 2223 |
| 1064 | nmdc:mga05p37_53519_c1 | 3300050507 | Bacteria | 4963 |
| 1065 | nmdc:mga05p37_57686_c1 | 3300050507 | Bacteria | 4149 |
| 1066 | nmdc:mga05p37_610326_c1 | 3300050507 | Unclassified | 1230 |
| 1067 | nmdc:mga05p37_611814_c1 | 3300050507 | Bacteria | 1228 |
| 1068 | nmdc:mga05p37_64060_c1 | 3300050507 | Bacteria | 4523 |
| 1069 | nmdc:mga05p37_64713_c1 | 3300050507 | Bacteria | 4499 |
| 1070 | nmdc:mga05p37_77687_c1 | 3300050507 | Bacteria | 4087 |
| 1071 | nmdc:mga05p37_870676_c1 | 3300050507 | Bacteria | 975 |
| 1072 | nmdc:mga05p37_984476_c1 | 3300050507 | Bacteria | 898 |
| 1073 | nmdc:mga05p37_9_c1 | 3300050507 | Bacteria | 151480 |
| 1074 | nmdc:mga09592_283598_c1 | 3300050508 | Bacteria | 1436 |
| 1075 | nmdc:mga09592_481142_c1 | 3300050508 | Bacteria | 1070 |
| 1076 | nmdc:mga09592_62037_c1 | 3300050508 | Bacteria | 3162 |
| 1077 | nmdc:mga0qj67_123324_c1 | 3300050509 | Bacteria | 2096 |
| 1078 | nmdc:mga0qj67_12797_c1 | 3300050509 | Bacteria | 6328 |
| 1079 | nmdc:mga0qj67_128340_c1 | 3300050509 | Bacteria | 2052 |
| 1080 | nmdc:mga0qj67_452652_c1 | 3300050509 | Bacteria | 1034 |
| 1081 | nmdc:mga0qj67_76609_c1 | 3300050509 | Bacteria | 2675 |
| 1082 | nmdc:mga06r32_134158_c1 | 3300050510 | Unclassified | 2450 |
| 1083 | nmdc:mga06r32_397895_c1 | 3300050510 | Bacteria | 1359 |
| 1084 | nmdc:mga06r32_421883_c1 | 3300050510 | Bacteria | 1315 |
| 1085 | nmdc:mga06r32_59331_c1 | 3300050510 | Bacteria | 3679 |
| 1086 | nmdc:mga06r32_777784_c1 | 3300050510 | Bacteria | 919 |
| 1087 | nmdc:mga06r32_786454_c1 | 3300050510 | Bacteria | 913 |
| 1088 | nmdc:mga06r32_85303_c1 | 3300050510 | Bacteria | 3079 |
| 1089 | nmdc:mga08y16_116416_c1 | 3300050511 | Bacteria | 2782 |
| 1090 | nmdc:mga08y16_117029_c1 | 3300050511 | Bacteria | 2775 |
| 1091 | nmdc:mga08y16_222407_c1 | 3300050511 | Unclassified | 1954 |
| 1092 | nmdc:mga08y16_241962_c1 | 3300050511 | Bacteria | 1865 |
| 1093 | nmdc:mga08y16_26376_c1 | 3300050511 | Bacteria | 6127 |
| 1094 | nmdc:mga08y16_416043_c1 | 3300050511 | Bacteria | 1374 |
| 1095 | nmdc:mga08y16_42484_c1 | 3300050511 | Bacteria | 4761 |
| 1096 | nmdc:mga08y16_47457_c1 | 3300050511 | Bacteria | 4495 |
| 1097 | nmdc:mga08y16_589981_c1 | 3300050511 | Bacteria | 1121 |
| 1098 | nmdc:mga08y16_67155_c1 | 3300050511 | Bacteria | 3741 |
| 1099 | nmdc:mga0n895_15479_c1 | 3300050512 | Bacteria | 6956 |
| 1100 | nmdc:mga0n895_240866_c1 | 3300050512 | Bacteria | 1836 |
| 1101 | nmdc:mga0n895_26976_c1 | 3300050512 | Bacteria | 5449 |
| 1102 | nmdc:mga0n895_48370_c1 | 3300050512 | Bacteria | 3797 |
| 1103 | nmdc:mga0n895_5297_c1 | 3300050512 | Bacteria | 10744 |
| 1104 | nmdc:mga0n895_80_c1 | 3300050512 | Bacteria | 54788 |
| 1105 | nmdc:mga0n895_876854_c1 | 3300050512 | Unclassified | 884 |
| 1106 | nmdc:mga0rr50_35_c1 | 3300050513 | Bacteria | 91254 |
| 1107 | nmdc:mga0rr50_371681_c1 | 3300050513 | Bacteria | 1205 |
| 1108 | nmdc:mga0rr50_396702_c1 | 3300050513 | Unclassified | 1165 |
| 1109 | nmdc:mga0rr50_4248_c1 | 3300050513 | Bacteria | 8383 |
| 1110 | nmdc:mga0rr50_68137_c1 | 3300050513 | Unclassified | 2705 |
| 1111 | nmdc:mga08x19_31980_c1 | 3300050514 | Bacteria | 3314 |
| 1112 | nmdc:mga08x19_33934_c1 | 3300050514 | Bacteria | 3223 |
| 1113 | nmdc:mga08x19_64_c2 | 3300050514 | Bacteria | 86912 |
| 1114 | nmdc:mga08x19_690_c1 | 3300050514 | Bacteria | 21659 |
| 1115 | nmdc:mga0a205_127322_c1 | 3300050515 | Bacteria | 2446 |
| 1116 | nmdc:mga0a205_133478_c1 | 3300050515 | Bacteria | 2383 |
| 1117 | nmdc:mga0a205_135534_c1 | 3300050515 | Bacteria | 2363 |
| 1118 | nmdc:mga0a205_17397_c1 | 3300050515 | Bacteria | 6738 |
| 1119 | nmdc:mga0a205_267463_c1 | 3300050515 | Bacteria | 1587 |
| 1120 | nmdc:mga0a205_329345_c1 | 3300050515 | Bacteria | 1397 |
| 1121 | nmdc:mga0a205_38775_c1 | 3300050515 | Bacteria | 4585 |
| 1122 | nmdc:mga0a205_492229_c1 | 3300050515 | Bacteria | 1083 |
| 1123 | Ga0495601_0165332 | 3300053077 | Unclassified | 1446 |
| 1124 | Ga0500610_0154014 | 3300053079 | Bacteria | 1149 |
| 1125 | Ga0495619_0168264 | 3300053085 | Bacteria | 1515 |
| 1126 | Ga0495619_0488652 | 3300053085 | Bacteria | 847 |
| 1127 | Ga0500646_0107132 | 3300053090 | Bacteria | 884 |
| 1128 | Ga0500641_0002653 | 3300053096 | Bacteria | 6320 |
| 1129 | Ga0500568_0006179 | 3300053139 | Bacteria | 6057 |
| 1130 | Ga0501084_0204826 | 3300054114 | Bacteria | 1665 |
| 1131 | Ga0501084_0263253 | 3300054114 | Bacteria | 1456 |
| 1132 | Ga0590071_000088 | 3300059421 | Bacteria | 25182 |
| 1133 | Ga0590071_001754 | 3300059421 | Bacteria | 5602 |
| 1134 | Ga0590071_002832 | 3300059421 | Bacteria | 4339 |
| 1135 | Ga0590071_070597 | 3300059421 | Bacteria | 860 |
| 1136 | Ga0590075_000373 | 3300059424 | Bacteria | 12269 |
| 1137 | Ga0590075_013540 | 3300059424 | Bacteria | 1990 |
| 1138 | Ga0590077_000528 | 3300059426 | Bacteria | 10558 |
| 1139 | Ga0590077_002992 | 3300059426 | Bacteria | 3540 |
| 1140 | Ga0501082_0245802 | 3300060353 | Bacteria | 1557 |
| 1141 | Ga0501082_1031409 | 3300060353 | Bacteria | 719 |
| 1142 | Ga0070689_100436913 | |||
| 1143 | MBSR1b_contig_8694521 | |||
| 1144 | JGI25406J46586_10004594 | |||
| 1145 | Ga0065704_10230603 | |||
| 1146 | Ga0065712_10003012 | |||
| 1147 | Ga0065712_10067827 | |||
| 1148 | Ga0065712_10088488 | |||
| 1149 | Ga0065715_10089309 | |||
| 1150 | Ga0065715_10187852 | |||
| 1151 | Ga0065715_10223470 | |||
| 1152 | Ga0065715_10342083 | |||
| 1153 | Ga0065707_10093908 | |||
| 1154 | Ga0065707_10115964 | |||
| 1155 | Ga0065707_10297546 | |||
| 1156 | Ga0070658_10019311 | |||
| 1157 | Ga0070658_10048484 | |||
| 1158 | Ga0070658_10711479 | |||
| 1159 | Ga0070676_10117171 | |||
| 1160 | Ga0070683_100175745 | |||
| 1161 | Ga0070683_100397046 | |||
| 1162 | Ga0070670_100024330 | |||
| 1163 | Ga0070670_100026632 | |||
| 1164 | Ga0070670_100149548 | |||
| 1165 | Ga0070670_100168545 | |||
| 1166 | Ga0070670_100325136 | |||
| 1167 | Ga0070677_10108876 | |||
| 1168 | Ga0068869_100027625 | |||
| 1169 | Ga0068869_100112833 | |||
| 1170 | Ga0070666_10060814 | |||
| 1171 | Ga0070680_100007823 | |||
| 1172 | Ga0070680_100396055 | |||
| 1173 | Ga0070682_100016079 | |||
| 1174 | Ga0070682_100196860 | |||
| 1175 | Ga0068868_100064218 | |||
| 1176 | Ga0068868_100101581 | |||
| 1177 | Ga0068868_100151438 | |||
| 1178 | Ga0068868_100226456 | |||
| 1179 | Ga0068868_100481958 | |||
| 1180 | Ga0070689_100062062 | |||
| 1181 | Ga0070689_100076859 | |||
| 1182 | Ga0070689_100409004 | |||
| 1183 | Ga0070691_10000314 | |||
| 1184 | Ga0070691_10139060 | |||
| 1185 | Ga0070661_100031365 | |||
| 1186 | Ga0070668_100600673 | |||
| 1187 | Ga0070668_100660054 | |||
| 1188 | Ga0070669_100000727 | |||
| 1189 | Ga0070669_100001162 | |||
| 1190 | Ga0070669_100057118 | |||
| 1191 | Ga0070669_100100205 | |||
| 1192 | Ga0070675_100000381 | |||
| 1193 | Ga0070675_100044978 | |||
| 1194 | Ga0070675_100194844 | |||
| 1195 | Ga0070675_100249057 | |||
| 1196 | Ga0070675_100532026 | |||
| 1197 | Ga0070671_100022701 | |||
| 1198 | Ga0070671_100051343 | |||
| 1199 | Ga0070671_100175466 | |||
| 1200 | Ga0070671_100280947 | |||
| 1201 | Ga0070674_100027520 | |||
| 1202 | Ga0070674_100032698 | |||
| 1203 | Ga0070674_100044535 | |||
| 1204 | Ga0070674_100083525 | |||
| 1205 | Ga0070674_100223752 | |||
| 1206 | Ga0070674_100319267 | |||
| 1207 | Ga0070674_100676614 | |||
| 1208 | Ga0070673_100014110 | |||
| 1209 | Ga0070688_100016092 | |||
| 1210 | Ga0070688_100220527 | |||
| 1211 | Ga0070659_100009356 | |||
| 1212 | Ga0070659_100046618 | |||
| 1213 | Ga0070659_100161894 | |||
| 1214 | Ga0070709_10001985 | |||
| 1215 | Ga0070709_10127207 | |||
| 1216 | Ga0070709_10133103 | |||
| 1217 | Ga0070709_10319980 | |||
| 1218 | Ga0070714_100067256 | |||
| 1219 | Ga0070714_100069188 | |||
| 1220 | Ga0070714_100075091 | |||
| 1221 | Ga0070714_100300709 | |||
| 1222 | Ga0070713_100000180 | |||
| 1223 | Ga0070713_100001143 | |||
| 1224 | Ga0070713_100016132 | |||
| 1225 | Ga0070713_100032958 | |||
| 1226 | Ga0070713_100039295 | |||
| 1227 | Ga0070713_100082524 | |||
| 1228 | Ga0070713_100087678 | |||
| 1229 | Ga0070710_10020002 | |||
| 1230 | Ga0070710_10061563 | |||
| 1231 | Ga0070710_10126371 | |||
| 1232 | Ga0070701_10164448 | |||
| 1233 | Ga0070701_10270448 | |||
| 1234 | Ga0070711_100000441 | |||
| 1235 | Ga0070711_100000766 | |||
| 1236 | Ga0070711_100014055 | |||
| 1237 | Ga0070711_100015453 | |||
| 1238 | Ga0070711_100060355 | |||
| 1239 | Ga0070711_100109236 | |||
| 1240 | Ga0070711_100118775 | |||
| 1241 | Ga0070711_100355555 | |||
| 1242 | Ga0070711_100481411 | |||
| 1243 | Ga0070705_100288519 | |||
| 1244 | Ga0070700_100054072 | |||
| 1245 | Ga0070700_100173514 | |||
| 1246 | Ga0070694_100005219 | |||
| 1247 | Ga0070694_100006820 | |||
| 1248 | Ga0070708_100000081 | |||
| 1249 | Ga0070708_100018220 | |||
| 1250 | Ga0070708_100079703 | |||
| 1251 | Ga0070663_100024099 | |||
| 1252 | Ga0070663_100089958 | |||
| 1253 | Ga0070663_100102817 | |||
| 1254 | Ga0070663_100156217 | |||
| 1255 | Ga0070678_100020086 | |||
| 1256 | Ga0070678_100086375 | |||
| 1257 | Ga0070678_100176553 | |||
| 1258 | Ga0070678_100447338 | |||
| 1259 | Ga0070662_100016492 | |||
| 1260 | Ga0070662_100093100 | |||
| 1261 | Ga0070662_100272021 | |||
| 1262 | Ga0070662_100651408 | |||
| 1263 | Ga0070681_10002730 | |||
| 1264 | Ga0070681_10063440 | |||
| 1265 | Ga0070681_10130184 | |||
| 1266 | Ga0068867_100042111 | |||
| 1267 | Ga0068867_100048895 | |||
| 1268 | Ga0068867_100098897 | |||
| 1269 | Ga0068867_100142008 | |||
| 1270 | Ga0068867_100339577 | |||
| 1271 | Ga0070685_10000943 | |||
| 1272 | Ga0070685_10032234 | |||
| 1273 | Ga0070706_100007119 | |||
| 1274 | Ga0070706_100012916 | |||
| 1275 | Ga0070706_100268267 | |||
| 1276 | Ga0070706_100338038 | |||
| 1277 | Ga0070707_100001950 | |||
| 1278 | Ga0070707_100003644 | |||
| 1279 | Ga0070707_100177898 | |||
| 1280 | Ga0070707_100461679 | |||
| 1281 | Ga0070707_100579024 | |||
| 1282 | Ga0070698_100004310 | |||
| 1283 | Ga0070698_100115650 | |||
| 1284 | Ga0070698_100290800 | |||
| 1285 | Ga0070698_100416343 | |||
| 1286 | Ga0070698_100430025 | |||
| 1287 | Ga0070699_100010867 | |||
| 1288 | Ga0070699_100037867 | |||
| 1289 | Ga0070699_100060876 | |||
| 1290 | Ga0070699_100064883 | |||
| 1291 | Ga0070699_100159681 | |||
| 1292 | Ga0070699_100240453 | |||
| 1293 | Ga0070699_100486601 | |||
| 1294 | Ga0070699_100664849 | |||
| 1295 | Ga0070699_100700912 | |||
| 1296 | Ga0070679_100013189 | |||
| 1297 | Ga0070679_100023599 | |||
| 1298 | Ga0070679_100305928 | |||
| 1299 | Ga0070679_100398568 | |||
| 1300 | Ga0070684_100013274 | |||
| 1301 | Ga0070684_100241251 | |||
| 1302 | Ga0070684_100369140 | |||
| 1303 | Ga0070684_100439350 | |||
| 1304 | Ga0070684_100479562 | |||
| 1305 | Ga0070697_100001931 | |||
| 1306 | Ga0070697_100013572 | |||
| 1307 | Ga0070697_100143416 | |||
| 1308 | Ga0070697_100274591 | |||
| 1309 | Ga0070672_100057939 | |||
| 1310 | Ga0070672_100147881 | |||
| 1311 | Ga0070672_100369218 | |||
| 1312 | Ga0070686_100074218 | |||
| 1313 | Ga0070686_100094646 | |||
| 1314 | Ga0070686_100300668 | |||
| 1315 | Ga0070686_100345106 | |||
| 1316 | Ga0070686_100366287 | |||
| 1317 | Ga0070695_100000829 | |||
| 1318 | Ga0070695_100003902 | |||
| 1319 | Ga0070695_100152238 | |||
| 1320 | Ga0070695_100211902 | |||
| 1321 | Ga0070696_100002254 | |||
| 1322 | Ga0070696_100048110 | |||
| 1323 | Ga0070693_100000200 | |||
| 1324 | Ga0070693_100009327 | |||
| 1325 | Ga0070693_100051779 | |||
| 1326 | Ga0070665_100006550 | |||
| 1327 | Ga0070665_100010091 | |||
| 1328 | Ga0070665_100014615 | |||
| 1329 | Ga0070665_100077027 | |||
| 1330 | Ga0070665_100114428 | |||
| 1331 | Ga0070704_100001732 | |||
| 1332 | Ga0070704_100004385 | |||
| 1333 | Ga0070704_100334734 | |||
| 1334 | Ga0068855_100721648 | |||
| 1335 | Ga0070664_100003507 | |||
| 1336 | Ga0070664_100224856 | |||
| 1337 | Ga0070664_100287836 | |||
| 1338 | Ga0070664_100305136 | |||
| 1339 | Ga0070664_100369119 | |||
| 1340 | Ga0068857_100007741 | |||
| 1341 | Ga0068857_100041896 | |||
| 1342 | Ga0068857_100084299 | |||
| 1343 | Ga0068854_100240233 | |||
| 1344 | Ga0068856_100230003 | |||
| 1345 | Ga0070702_100063187 | |||
| 1346 | Ga0070702_100075026 | |||
| 1347 | Ga0068852_100024949 | |||
| 1348 | Ga0068852_100139429 | |||
| 1349 | Ga0068852_100205857 | |||
| 1350 | Ga0068859_100028342 | |||
| 1351 | Ga0068859_100077070 | |||
| 1352 | Ga0068859_100180594 | |||
| 1353 | Ga0068859_100388543 | |||
| 1354 | Ga0068859_100466009 | |||
| 1355 | Ga0068859_100543900 | |||
| 1356 | Ga0068859_100631281 | |||
| 1357 | Ga0068864_100001175 | |||
| 1358 | Ga0068864_100059408 | |||
| 1359 | Ga0068864_100147229 | |||
| 1360 | Ga0068864_100264731 | |||
| 1361 | Ga0068864_100286781 | |||
| 1362 | Ga0068866_10035405 | |||
| 1363 | Ga0068866_10058280 | |||
| 1364 | Ga0068866_10089494 | |||
| 1365 | Ga0068861_100208762 | |||
| 1366 | Ga0068861_100228329 | |||
| 1367 | Ga0068861_100492057 | |||
| 1368 | Ga0068851_10099905 | |||
| 1369 | Ga0068851_10191177 | |||
| 1370 | Ga0068863_100000704 | |||
| 1371 | Ga0068863_100012167 | |||
| 1372 | Ga0068863_100081146 | |||
| 1373 | Ga0068863_100421734 | |||
| 1374 | Ga0068863_100966734 | |||
| 1375 | Ga0068858_100003039 | |||
| 1376 | Ga0068858_100027377 | |||
| 1377 | Ga0068858_100562186 | |||
| 1378 | Ga0068858_100583817 | |||
| 1379 | Ga0068858_100623729 | |||
| 1380 | Ga0068860_100064452 | |||
| 1381 | Ga0068860_100150761 | |||
| 1382 | Ga0068860_100155296 | |||
| 1383 | Ga0068860_100343566 | |||
| 1384 | Ga0068860_100679963 | |||
| 1385 | Ga0068862_100013068 | |||
| 1386 | Ga0068862_100201634 | |||
| 1387 | Ga0068862_100211572 | |||
| 1388 | Ga0068862_100301715 | |||
| 1389 | Ga0068862_100764520 | |||
| 1390 | Ga0068862_100813603 | |||
| 1391 | Ga0068862_100995715 | |||
| 1392 | Ga0081455_10039113 | |||
| 1393 | Ga0081455_10369777 | |||
| 1394 | Ga0081539_10001216 | |||
| 1395 | Ga0070717_10000390 | |||
| 1396 | Ga0070717_10015105 | |||
| 1397 | Ga0075365_10012336 | |||
| 1398 | Ga0075368_10019197 | |||
| 1399 | Ga0075368_10029364 | |||
| 1400 | Ga0075364_10111183 | |||
| 1401 | Ga0075432_10081893 | |||
| 1402 | Ga0070715_10005229 | |||
| 1403 | Ga0070715_10033098 | |||
| 1404 | Ga0070716_100008491 | |||
| 1405 | Ga0070716_100076673 | |||
| 1406 | Ga0070716_100099815 | |||
| 1407 | Ga0070716_100149312 | |||
| 1408 | Ga0070716_100343200 | |||
| 1409 | Ga0070712_100000424 | |||
| 1410 | Ga0070712_100000774 | |||
| 1411 | Ga0075367_10019708 | |||
| 1412 | Ga0075367_10150968 | |||
| 1413 | Ga0075367_10229048 | |||
| 1414 | Ga0075366_10037914 | |||
| 1415 | Ga0075366_10041787 | |||
| 1416 | Ga0075366_10143594 | |||
| 1417 | Ga0097621_100051496 | |||
| 1418 | Ga0097621_100090730 | |||
| 1419 | Ga0097621_100115283 | |||
| 1420 | Ga0097621_100152891 | |||
| 1421 | Ga0097621_100207508 | |||
| 1422 | Ga0097621_100274545 | |||
| 1423 | Ga0097621_100359368 | |||
| 1424 | Ga0097621_100484628 | |||
| 1425 | Ga0097621_100841627 | |||
| 1426 | Ga0075370_10042865 | |||
| 1427 | Ga0068871_100023117 | |||
| 1428 | Ga0068871_100047401 | |||
| 1429 | Ga0068871_100064046 | |||
| 1430 | Ga0068871_100262882 | |||
| 1431 | Ga0068871_100271419 | |||
| 1432 | Ga0068871_100896367 | |||
| 1433 | Ga0075428_100012869 | |||
| 1434 | Ga0075428_100020050 | |||
| 1435 | Ga0075428_100026426 | |||
| 1436 | Ga0075428_100192939 | |||
| 1437 | Ga0075428_100207079 | |||
| 1438 | Ga0075428_100390752 | |||
| 1439 | Ga0075428_101030199 | |||
| 1440 | Ga0075430_100035079 | |||
| 1441 | Ga0075430_100099702 | |||
| 1442 | Ga0075430_100224238 | |||
| 1443 | Ga0075430_100238233 | |||
| 1444 | Ga0075430_100247581 | |||
| 1445 | Ga0075430_100400093 | |||
| 1446 | Ga0075431_100028762 | |||
| 1447 | Ga0075431_100030652 | |||
| 1448 | Ga0075431_100053177 | |||
| 1449 | Ga0075431_100094974 | |||
| 1450 | Ga0075431_100166805 | |||
| 1451 | Ga0075431_100225150 | |||
| 1452 | Ga0075433_10011743 | |||
| 1453 | Ga0075433_10074249 | |||
| 1454 | Ga0075433_10107478 | |||
| 1455 | Ga0075433_10122773 | |||
| 1456 | Ga0075433_10198946 | |||
| 1457 | Ga0075433_10199807 | |||
| 1458 | Ga0075433_10554907 | |||
| 1459 | Ga0075434_100000098 | |||
| 1460 | Ga0075434_100011671 | |||
| 1461 | Ga0075434_100027710 | |||
| 1462 | Ga0075434_100081905 | |||
| 1463 | Ga0075434_100145485 | |||
| 1464 | Ga0075434_100222295 | |||
| 1465 | Ga0075434_100649152 | |||
| 1466 | Ga0075429_100053555 | |||
| 1467 | Ga0075429_100086373 | |||
| 1468 | Ga0075429_100108416 | |||
| 1469 | Ga0075429_100171615 | |||
| 1470 | Ga0075429_100560626 | |||
| 1471 | Ga0068865_100002032 | |||
| 1472 | Ga0068865_100009144 | |||
| 1473 | Ga0068865_100094661 | |||
| 1474 | Ga0068865_100291421 | |||
| 1475 | Ga0068865_100531964 | |||
| 1476 | Ga0075436_100000037 | |||
| 1477 | Ga0075436_100005387 | |||
| 1478 | Ga0075436_100006638 | |||
| 1479 | Ga0075436_100006643 | |||
| 1480 | Ga0075436_100045018 | |||
| 1481 | Ga0075436_100045696 | |||
| 1482 | Ga0075436_100295354 | |||
| 1483 | Ga0097620_100028342 | |||
| 1484 | Ga0097620_100077072 | |||
| 1485 | Ga0097620_100180599 | |||
| 1486 | Ga0097620_100388540 | |||
| 1487 | Ga0097620_100466114 | |||
| 1488 | Ga0097620_100543864 | |||
| 1489 | Ga0097620_100631254 | |||
| 1490 | Ga0075435_100000020 | |||
| 1491 | Ga0075435_100004674 | |||
| 1492 | Ga0075435_100009374 | |||
| 1493 | Ga0075435_100080339 | |||
| 1494 | Ga0075435_100165792 | |||
| 1495 | Ga0075435_100586085 | |||
| 1496 | Ga0105240_10024898 | |||
| 1497 | Ga0105240_10057307 | |||
| 1498 | Ga0105240_10123688 | |||
| 1499 | Ga0111539_10002591 | |||
| 1500 | Ga0111539_10002914 | |||
| 1501 | Ga0111539_10003917 | |||
| 1502 | Ga0111539_10035761 | |||
| 1503 | Ga0111539_10041050 | |||
| 1504 | Ga0111539_10070775 | |||
| 1505 | Ga0111539_10097410 | |||
| 1506 | Ga0111539_10270335 | |||
| 1507 | Ga0111539_10534548 | |||
| 1508 | Ga0111539_10729611 | |||
| 1509 | Ga0111539_10876032 | |||
| 1510 | Ga0111539_10911847 | |||
| 1511 | Ga0105245_10038798 | |||
| 1512 | Ga0105245_10231365 | |||
| 1513 | Ga0105245_10265833 | |||
| 1514 | Ga0105247_10038134 | |||
| 1515 | Ga0105247_10038653 | |||
| 1516 | Ga0105247_10137752 | |||
| 1517 | Ga0114129_10000174 | |||
| 1518 | Ga0114129_10000192 | |||
| 1519 | Ga0114129_10000275 | |||
| 1520 | Ga0114129_10005113 | |||
| 1521 | Ga0114129_10008970 | |||
| 1522 | Ga0114129_10022135 | |||
| 1523 | Ga0114129_10048805 | |||
| 1524 | Ga0114129_10061464 | |||
| 1525 | Ga0114129_10099321 | |||
| 1526 | Ga0114129_10153629 | |||
| 1527 | Ga0114129_10165848 | |||
| 1528 | Ga0114129_10253945 | |||
| 1529 | Ga0114129_10579457 | |||
| 1530 | Ga0114129_10588951 | |||
| 1531 | Ga0114129_10766159 | |||
| 1532 | Ga0114129_11135104 | |||
| 1533 | Ga0105243_10033909 | |||
| 1534 | Ga0105243_10123793 | |||
| 1535 | Ga0105243_10405874 | |||
| 1536 | Ga0105243_10535370 | |||
| 1537 | Ga0105241_10087351 | |||
| 1538 | Ga0105242_10026761 | |||
| 1539 | Ga0105242_10068681 | |||
| 1540 | Ga0105248_10002305 | |||
| 1541 | Ga0105248_10008586 | |||
| 1542 | Ga0105248_10026590 | |||
| 1543 | Ga0105248_10048444 | |||
| 1544 | Ga0105248_10131427 | |||
| 1545 | Ga0105248_10185846 | |||
| 1546 | Ga0105248_10233198 | |||
| 1547 | Ga0105248_10306691 | |||
| 1548 | Ga0105248_10582472 | |||
| 1549 | Ga0105248_11135072 | |||
| 1550 | Ga0105237_10031580 | |||
| 1551 | Ga0105237_10279603 | |||
| 1552 | Ga0105237_10366173 | |||
| 1553 | Ga0105238_10063520 | |||
| 1554 | Ga0105238_10099977 | |||
| 1555 | Ga0105238_10178492 | |||
| 1556 | Ga0105249_10000517 | |||
| 1557 | Ga0105249_10006590 | |||
| 1558 | Ga0105249_10055970 | |||
| 1559 | Ga0105249_10154988 | |||
| 1560 | Ga0105249_10649785 | |||
| 1561 | Ga0105249_10831416 | |||
| 1562 | Ga0105239_10394456 | |||
| 1563 | Ga0105239_10625030 | |||
| 1564 | Ga0105246_10206590 | |||
| 1565 | Ga0157373_10137237 | |||
| 1566 | Ga0157370_10603578 | |||
| 1567 | Ga0157369_10104725 | |||
| 1568 | Ga0157369_10331994 | |||
| 1569 | Ga0157374_10137113 | |||
| 1570 | Ga0157378_10001096 | |||
| 1571 | Ga0157378_10033718 | |||
| 1572 | Ga0157378_10046860 | |||
| 1573 | Ga0157378_10105791 | |||
| 1574 | Ga0157378_10198639 | |||
| 1575 | Ga0157378_10261550 | |||
| 1576 | Ga0157378_10279585 | |||
| 1577 | Ga0163162_10000370 | |||
| 1578 | Ga0163162_10129753 | |||
| 1579 | Ga0163162_10169437 | |||
| 1580 | Ga0163162_10216115 | |||
| 1581 | Ga0157372_10030751 | |||
| 1582 | Ga0157372_10036897 | |||
| 1583 | Ga0157372_10070222 | |||
| 1584 | Ga0157372_10691920 | |||
| 1585 | Ga0157372_10821614 | |||
| 1586 | Ga0157375_10063743 | |||
| 1587 | Ga0157375_10691508 | |||
| 1588 | Ga0157375_11018630 | |||
| 1589 | Ga0163163_10010921 | |||
| 1590 | Ga0163163_10115060 | |||
| 1591 | Ga0163163_10123563 | |||
| 1592 | Ga0163163_10256300 | |||
| 1593 | Ga0163163_10305448 | |||
| 1594 | Ga0157380_10048552 | |||
| 1595 | Ga0157380_10060343 | |||
| 1596 | Ga0157380_10071651 | |||
| 1597 | Ga0157380_10086528 | |||
| 1598 | Ga0157380_10090930 | |||
| 1599 | Ga0157380_10128178 | |||
| 1600 | Ga0157380_10666729 | |||
| 1601 | Ga0157377_10025904 | |||
| 1602 | Ga0157377_10067967 | |||
| 1603 | Ga0157377_10165134 | |||
| 1604 | Ga0157377_10354231 | |||
| 1605 | Ga0157379_10025716 | |||
| 1606 | Ga0157379_10053135 | |||
| 1607 | Ga0157379_10177184 | |||
| 1608 | Ga0157379_10186808 | |||
| 1609 | Ga0157379_10299618 | |||
| 1610 | Ga0157379_10668075 | |||
| 1611 | Ga0157379_10696431 | |||
| 1612 | Ga0157376_10003558 | |||
| 1613 | Ga0157376_10009627 | |||
| 1614 | Ga0157376_10027273 | |||
| 1615 | Ga0157376_10141167 | |||
| 1616 | Ga0157376_10545064 | |||
| 1617 | Ga0157376_10587519 | |||
| 1618 | Ga0157376_10653701 | |||
| 1619 | Ga0163161_10331170 | |||
| 1620 | Ga0163161_10463331 | |||
| 1621 | Ga0163161_10504719 | |||
| 1622 | Ga0224572_1046239 | |||
| 1623 | Ga0228598_1001375 | |||
| 1624 | Ga0207697_10000143 | |||
| 1625 | Ga0207697_10019067 | |||
| 1626 | Ga0207697_10039033 | |||
| 1627 | Ga0207682_10184740 | |||
| 1628 | Ga0207692_10006630 | |||
| 1629 | Ga0207692_10028479 | |||
| 1630 | Ga0207692_10045854 | |||
| 1631 | Ga0207692_10189142 | |||
| 1632 | Ga0207642_10062595 | |||
| 1633 | Ga0207642_10096895 | |||
| 1634 | Ga0207710_10098964 | |||
| 1635 | Ga0207710_10168468 | |||
| 1636 | Ga0207688_10002686 | |||
| 1637 | Ga0207680_10031017 | |||
| 1638 | Ga0207680_10547803 | |||
| 1639 | Ga0207647_10031204 | |||
| 1640 | Ga0207685_10016219 | |||
| 1641 | Ga0207685_10043484 | |||
| 1642 | Ga0207685_10049662 | |||
| 1643 | Ga0207685_10214862 | |||
| 1644 | Ga0207699_10004012 | |||
| 1645 | Ga0207699_10006533 | |||
| 1646 | Ga0207699_10031968 | |||
| 1647 | Ga0207645_10081854 | |||
| 1648 | Ga0207645_10266798 | |||
| 1649 | Ga0207643_10004131 | |||
| 1650 | Ga0207684_10038320 | |||
| 1651 | Ga0207684_10083434 | |||
| 1652 | Ga0207654_10210395 | |||
| 1653 | Ga0207707_10170658 | |||
| 1654 | Ga0207695_10068686 | |||
| 1655 | Ga0207695_10072281 | |||
| 1656 | Ga0207695_10153992 | |||
| 1657 | Ga0207671_10189948 | |||
| 1658 | Ga0207693_10000777 | |||
| 1659 | Ga0207693_10001047 | |||
| 1660 | Ga0207693_10002215 | |||
| 1661 | Ga0207693_10083296 | |||
| 1662 | Ga0207663_10001539 | |||
| 1663 | Ga0207663_10019520 | |||
| 1664 | Ga0207663_10023854 | |||
| 1665 | Ga0207663_10031948 | |||
| 1666 | Ga0207663_10070153 | |||
| 1667 | Ga0207663_10075561 | |||
| 1668 | Ga0207663_10209827 | |||
| 1669 | Ga0207663_10392933 | |||
| 1670 | Ga0207660_10016841 | |||
| 1671 | Ga0207660_10124929 | |||
| 1672 | Ga0207657_10337769 | |||
| 1673 | Ga0207649_10007720 | |||
| 1674 | Ga0207649_10512717 | |||
| 1675 | Ga0207652_10004402 | |||
| 1676 | Ga0207652_10016347 | |||
| 1677 | Ga0207652_10192956 | |||
| 1678 | Ga0207652_10329028 | |||
| 1679 | Ga0207646_10001929 | |||
| 1680 | Ga0207646_10003702 | |||
| 1681 | Ga0207646_10043474 | |||
| 1682 | Ga0207646_10500073 | |||
| 1683 | Ga0207646_10589136 | |||
| 1684 | Ga0207681_10007137 | |||
| 1685 | Ga0207681_10014326 | |||
| 1686 | Ga0207681_10042100 | |||
| 1687 | Ga0207681_10054804 | |||
| 1688 | Ga0207650_10048321 | |||
| 1689 | Ga0207650_10079065 | |||
| 1690 | Ga0207650_10106585 | |||
| 1691 | Ga0207650_10174640 | |||
| 1692 | Ga0207650_10181421 | |||
| 1693 | Ga0207650_10441673 | |||
| 1694 | Ga0207659_10004795 | |||
| 1695 | Ga0207659_10057577 | |||
| 1696 | Ga0207659_10716376 | |||
| 1697 | Ga0207687_10022662 | |||
| 1698 | Ga0207687_10028103 | |||
| 1699 | Ga0207687_10455461 | |||
| 1700 | Ga0207700_10000198 | |||
| 1701 | Ga0207700_10005511 | |||
| 1702 | Ga0207700_10008571 | |||
| 1703 | Ga0207700_10012349 | |||
| 1704 | Ga0207700_10025819 | |||
| 1705 | Ga0207700_10136987 | |||
| 1706 | Ga0207664_10060517 | |||
| 1707 | Ga0207664_10165331 | |||
| 1708 | Ga0207644_10019983 | |||
| 1709 | Ga0207644_10155052 | |||
| 1710 | Ga0207644_10158149 | |||
| 1711 | Ga0207644_10196790 | |||
| 1712 | Ga0207690_10060792 | |||
| 1713 | Ga0207690_10061061 | |||
| 1714 | Ga0207706_10001040 | |||
| 1715 | Ga0207706_10032441 | |||
| 1716 | Ga0207706_10108239 | |||
| 1717 | Ga0207686_10015467 | |||
| 1718 | Ga0207686_10070869 | |||
| 1719 | Ga0207686_10088992 | |||
| 1720 | Ga0207686_10103537 | |||
| 1721 | Ga0207709_10102484 | |||
| 1722 | Ga0207709_10330029 | |||
| 1723 | Ga0207670_10041666 | |||
| 1724 | Ga0207670_10261625 | |||
| 1725 | Ga0207670_10301876 | |||
| 1726 | Ga0207670_10338749 | |||
| 1727 | Ga0207669_10002051 | |||
| 1728 | Ga0207669_10043725 | |||
| 1729 | Ga0207669_10051604 | |||
| 1730 | Ga0207669_10068597 | |||
| 1731 | Ga0207669_10083401 | |||
| 1732 | Ga0207669_10228453 | |||
| 1733 | Ga0207669_10457950 | |||
| 1734 | Ga0207669_10594096 | |||
| 1735 | Ga0207704_10002974 | |||
| 1736 | Ga0207704_10076603 | |||
| 1737 | Ga0207704_10121676 | |||
| 1738 | Ga0207704_10122989 | |||
| 1739 | Ga0207665_10011723 | |||
| 1740 | Ga0207665_10041165 | |||
| 1741 | Ga0207665_10103546 | |||
| 1742 | Ga0207665_10223987 | |||
| 1743 | Ga0207691_10001772 | |||
| 1744 | Ga0207691_10002031 | |||
| 1745 | Ga0207691_10005687 | |||
| 1746 | Ga0207691_10015894 | |||
| 1747 | Ga0207691_10219525 | |||
| 1748 | Ga0207691_10390815 | |||
| 1749 | Ga0207711_10055231 | |||
| 1750 | Ga0207711_10100293 | |||
| 1751 | Ga0207711_10106747 | |||
| 1752 | Ga0207689_10035057 | |||
| 1753 | Ga0207689_10058008 | |||
| 1754 | Ga0207689_10060049 | |||
| 1755 | Ga0207689_10067178 | |||
| 1756 | Ga0207661_10002181 | |||
| 1757 | Ga0207661_10122440 | |||
| 1758 | Ga0207679_10009204 | |||
| 1759 | Ga0207679_10078085 | |||
| 1760 | Ga0207679_10099555 | |||
| 1761 | Ga0207667_10088075 | |||
| 1762 | Ga0207667_10463330 | |||
| 1763 | Ga0207667_10522288 | |||
| 1764 | Ga0207651_10009512 | |||
| 1765 | Ga0207651_10051872 | |||
| 1766 | Ga0207651_10159240 | |||
| 1767 | Ga0207651_10540568 | |||
| 1768 | Ga0207651_10629556 | |||
| 1769 | Ga0207712_10005715 | |||
| 1770 | Ga0207712_10018718 | |||
| 1771 | Ga0207712_10031016 | |||
| 1772 | Ga0207668_10197776 | |||
| 1773 | Ga0207640_10231360 | |||
| 1774 | Ga0207658_10207493 | |||
| 1775 | Ga0207658_10458895 | |||
| 1776 | Ga0207658_10622705 | |||
| 1777 | Ga0207677_10018985 | |||
| 1778 | Ga0207677_10122991 | |||
| 1779 | Ga0207677_10502626 | |||
| 1780 | Ga0207703_10022356 | |||
| 1781 | Ga0207703_10206038 | |||
| 1782 | Ga0207639_10057652 | |||
| 1783 | Ga0207639_10090509 | |||
| 1784 | Ga0207678_10022795 | |||
| 1785 | Ga0207678_10116577 | |||
| 1786 | Ga0207678_10249368 | |||
| 1787 | Ga0207708_10040016 | |||
| 1788 | Ga0207708_10111785 | |||
| 1789 | Ga0207708_10470049 | |||
| 1790 | Ga0207702_10148735 | |||
| 1791 | Ga0207641_10002046 | |||
| 1792 | Ga0207641_10062188 | |||
| 1793 | Ga0207641_10142883 | |||
| 1794 | Ga0207641_10395844 | |||
| 1795 | Ga0207641_10454030 | |||
| 1796 | Ga0207648_10025474 | |||
| 1797 | Ga0207648_10079346 | |||
| 1798 | Ga0207648_10882872 | |||
| 1799 | Ga0207676_10014980 | |||
| 1800 | Ga0207676_10141259 | |||
| 1801 | Ga0207676_10319130 | |||
| 1802 | Ga0207676_10507766 | |||
| 1803 | Ga0207676_10570234 | |||
| 1804 | Ga0207674_10000575 | |||
| 1805 | Ga0207674_10050804 | |||
| 1806 | Ga0207674_10060999 | |||
| 1807 | Ga0207675_100015566 | |||
| 1808 | Ga0207675_100050343 | |||
| 1809 | Ga0207675_100071374 | |||
| 1810 | Ga0207675_100090262 | |||
| 1811 | Ga0207675_100188437 | |||
| 1812 | Ga0207675_100324138 | |||
| 1813 | Ga0207683_10004709 | |||
| 1814 | Ga0207683_10029677 | |||
| 1815 | Ga0207683_10030498 | |||
| 1816 | Ga0207683_10180490 | |||
| 1817 | Ga0207683_10248801 | |||
| 1818 | Ga0207683_10419621 | |||
| 1819 | Ga0207698_10034543 | |||
| 1820 | Ga0207698_10039495 | |||
| 1821 | Ga0207698_10170029 | |||
| 1822 | Ga0207698_10244188 | |||
| 1823 | Ga0209969_1007367 | |||
| 1824 | Ga0209967_1004235 | |||
| 1825 | Ga0209981_1000710 | |||
| 1826 | Ga0209984_1003798 | |||
| 1827 | Ga0209968_1003617 | |||
| 1828 | Ga0209999_1000389 | |||
| 1829 | Ga0209999_1006859 | |||
| 1830 | Ga0209998_10000643 | |||
| 1831 | Ga0209813_10142904 | |||
| 1832 | Ga0209974_10015654 | |||
| 1833 | Ga0207428_10004350 | |||
| 1834 | Ga0207428_10017349 | |||
| 1835 | Ga0207428_10018214 | |||
| 1836 | Ga0207428_10031150 | |||
| 1837 | Ga0207428_10035437 | |||
| 1838 | Ga0207428_10072230 | |||
| 1839 | Ga0265356_1000423 | |||
| 1840 | Ga0268266_10009803 | |||
| 1841 | Ga0268266_10022674 | |||
| 1842 | Ga0268266_10052185 | |||
| 1843 | Ga0268266_10095384 | |||
| 1844 | Ga0268266_10119392 | |||
| 1845 | Ga0268266_10156817 | |||
| 1846 | Ga0268266_10393427 | |||
| 1847 | Ga0268265_10002430 | |||
| 1848 | Ga0268265_10185104 | |||
| 1849 | Ga0268265_10748772 | |||
| 1850 | Ga0268264_10047178 | |||
| 1851 | Ga0268264_10051938 | |||
| 1852 | Ga0268264_10080440 | |||
| 1853 | Ga0268264_10592615 | |||
| 1854 | Ga0265318_10002057 | |||
| 1855 | Ga0265338_10001605 | |||
| 1856 | Ga0265338_10013275 | |||
| 1857 | Ga0265338_10047014 | |||
| 1858 | Ga0265338_10059006 | |||
| 1859 | Ga0265338_10079282 | |||
| 1860 | Ga0265338_10147163 | |||
| 1861 | Ga0265324_10015820 | |||
| 1862 | Ga0265324_10053961 | |||
| 1863 | Ga0316182_1026306 | |||
| 1864 | Ga0265762_1002849 | |||
| 1865 | Ga0265762_1033164 | |||
| 1866 | Ga0265770_1006016 | |||
| 1867 | Ga0265765_1001162 | |||
| 1868 | Ga0265760_10001235 | |||
| 1869 | Ga0265760_10001341 | |||
| 1870 | Ga0265760_10008710 | |||
| 1871 | Ga0265760_10022068 | |||
| 1872 | Ga0265760_10026805 | |||
| 1873 | Ga0265330_10001378 | |||
| 1874 | Ga0265332_10026881 | |||
| 1875 | Ga0265328_10008859 | |||
| 1876 | Ga0265325_10001701 | |||
| 1877 | Ga0265325_10015579 | |||
| 1878 | Ga0265325_10110679 | |||
| 1879 | Ga0265329_10007065 | |||
| 1880 | Ga0265340_10004335 | |||
| 1881 | Ga0265340_10016207 | |||
| 1882 | Ga0265339_10001359 | |||
| 1883 | Ga0265339_10001433 | |||
| 1884 | Ga0265339_10015256 | |||
| 1885 | Ga0265339_10070221 | |||
| 1886 | Ga0265339_10099828 | |||
| 1887 | Ga0265339_10195060 | |||
| 1888 | Ga0265316_10000390 | |||
| 1889 | Ga0265316_10010760 | |||
| 1890 | Ga0265316_10038328 | |||
| 1891 | Ga0265316_10055009 | |||
| 1892 | Ga0307408_100048150 | |||
| 1893 | Ga0307408_100139689 | |||
| 1894 | Ga0307408_100151714 | |||
| 1895 | Ga0307408_100174452 | |||
| 1896 | Ga0307408_100183425 | |||
| 1897 | Ga0307408_100295799 | |||
| 1898 | Ga0265313_10003345 | |||
| 1899 | Ga0265313_10021569 | |||
| 1900 | Ga0265313_10056632 | |||
| 1901 | Ga0265313_10074225 | |||
| 1902 | Ga0265314_10000036 | |||
| 1903 | Ga0265314_10011383 | |||
| 1904 | Ga0265314_10022322 | |||
| 1905 | Ga0265314_10189069 | |||
| 1906 | Ga0265342_10000377 | |||
| 1907 | Ga0265342_10014311 | |||
| 1908 | Ga0265342_10099396 | |||
| 1909 | Ga0265342_10171033 | |||
| 1910 | Ga0307405_10082905 | |||
| 1911 | Ga0307405_10217702 | |||
| 1912 | Ga0307405_10286370 | |||
| 1913 | Ga0307413_10089673 | |||
| 1914 | Ga0307413_10218617 | |||
| 1915 | Ga0307410_10059563 | |||
| 1916 | Ga0307410_10073363 | |||
| 1917 | Ga0307410_10137436 | |||
| 1918 | Ga0307410_10175072 | |||
| 1919 | Ga0307406_10012696 | |||
| 1920 | Ga0307406_10609316 | |||
| 1921 | Ga0307406_10708976 | |||
| 1922 | Ga0307407_10051735 | |||
| 1923 | Ga0307407_10056869 | |||
| 1924 | Ga0307407_10081474 | |||
| 1925 | Ga0307407_10120970 | |||
| 1926 | Ga0307407_10152042 | |||
| 1927 | Ga0307407_10176583 | |||
| 1928 | Ga0307412_10007208 | |||
| 1929 | Ga0307409_100050964 | |||
| 1930 | Ga0307409_100227697 | |||
| 1931 | Ga0307409_100609221 | |||
| 1932 | Ga0307416_100002533 | |||
| 1933 | Ga0307416_100217433 | |||
| 1934 | Ga0307416_100411547 | |||
| 1935 | Ga0307416_100450504 | |||
| 1936 | Ga0307416_100475009 | |||
| 1937 | Ga0307416_100920258 | |||
| 1938 | Ga0307414_10031178 | |||
| 1939 | Ga0307414_10407648 | |||
| 1940 | Ga0307411_10023552 | |||
| 1941 | Ga0307411_10060712 | |||
| 1942 | Ga0307411_10352827 | |||
| 1943 | Ga0307411_10786798 | |||
| 1944 | Ga0307415_100295942 | |||
| 1945 | Ga0373956_0002098 | |||
| 1946 | Ga0373956_0041023 | |||
| 1947 | Ga0373943_0209967 | |||
| 1948 | Ga0373955_0013885 | |||
| 1949 | Ga0373955_0271183 | |||
| 1950 | Ga0373931_0018469 | |||
| 1951 | Ga0373935_0058605 | |||
| 1952 | Ga0373927_0005068 | |||
| 1953 | Ga0373933_0001471 | |||
| 1954 | Ga0373933_0014088 | |||
| 1955 | Ga0373933_0084803 | |||
| 1956 | Ga0373933_0127262 | |||
| 1957 | Ga0373947_0179311 | |||
| 1958 | Ga0373947_0247796 | |||
| 1959 | Ga0373937_0001030 | |||
| 1960 | Ga0373937_0003079 | |||
| 1961 | Ga0373937_0033841 | |||
| 1962 | Ga0373937_0069458 | |||
| 1963 | Ga0373937_0173832 | |||
| 1964 | Ga0373937_0362514 | |||
| 1965 | Ga0373925_0003129 | |||
| 1966 | Ga0373925_0083786 | |||
| 1967 | Ga0373925_0247614 | |||
| 1968 | Ga0395905_0453062 | |||
| 1969 | Ga0436363_0539142 | |||
| 1970 | Ga0451791_1176516 | |||
| 1971 | Ga0451798_0445253 | |||
| 1972 | Ga0450923_003291 | |||
| 1973 | Ga0450923_014069 | |||
| 1974 | Ga0450894_008837 | |||
| 1975 | Ga0450895_006956 | |||
| 1976 | Ga0450896_000837 | |||
| 1977 | Ga0450896_009039 | |||
| 1978 | Ga0450906_017884 | |||
| 1979 | Ga0450908_003258 | |||
| 1980 | Ga0439434_0092754 | |||
| 1981 | Ga0439435_0004469 | |||
| 1982 | Ga0439435_0014096 | |||
| 1983 | Ga0439440_0096651 | |||
| 1984 | Ga0453683_0088864 | |||
| 1985 | Ga0453684_0040322 | |||
| 1986 | Ga0451576_0053807 | |||
| 1987 | Ga0451576_0103412 | |||
| 1988 | Ga0451576_0282680 | |||
| 1989 | Ga0466967_0028686 | |||
| 1990 | Ga0495592_0017164 | |||
| 1991 | Ga0495592_0081347 | |||
| 1992 | Ga0495592_0083672 | |||
| 1993 | Ga0495592_0161553 | |||
| 1994 | Ga0495603_0010045 | |||
| 1995 | Ga0495603_0054628 | |||
| 1996 | Ga0495629_0033455 | |||
| 1997 | Ga0495629_0078901 | |||
| 1998 | Ga0495629_0371005 | |||
| 1999 | Ga0495638_0258703 | |||
| 2000 | Ga0495651_0037993 | |||
| 2001 | Ga0495651_0199714 | |||
| 2002 | Ga0495653_0099170 | |||
| 2003 | Ga0495653_0136064 | |||
| 2004 | Ga0495653_0181458 | |||
| 2005 | Ga0495580_0013226 | |||
| 2006 | Ga0495580_0028251 | |||
| 2007 | Ga0495580_0067093 | |||
| 2008 | Ga0495580_0079671 | |||
| 2009 | Ga0495580_0093087 | |||
| 2010 | Ga0495580_0102057 | |||
| 2011 | Ga0495580_0228324 | |||
| 2012 | Ga0495582_0056920 | |||
| 2013 | Ga0495582_0079881 | |||
| 2014 | Ga0495639_0052566 | |||
| 2015 | Ga0495639_0201324 | |||
| 2016 | Ga0495662_0085681 | |||
| 2017 | Ga0495664_0050182 | |||
| 2018 | Ga0495664_0187083 | |||
| 2019 | Ga0495664_0297103 | |||
| 2020 | Ga0495585_0035699 | |||
| 2021 | Ga0495594_0003320 | |||
| 2022 | Ga0495594_0008275 | |||
| 2023 | Ga0495594_0042823 | |||
| 2024 | Ga0495608_0027773 | |||
| 2025 | Ga0495608_0131840 | |||
| 2026 | Ga0495628_0081840 | |||
| 2027 | Ga0495628_0150551 | |||
| 2028 | Ga0495628_0212094 | |||
| 2029 | Ga0495628_0216009 | |||
| 2030 | Ga0495630_0010653 | |||
| 2031 | Ga0495630_0152070 | |||
| 2032 | Ga0495630_0280250 | |||
| 2033 | Ga0495631_0032023 | |||
| 2034 | Ga0495643_0003764 | |||
| 2035 | Ga0495644_0000109 | |||
| 2036 | Ga0495663_0094403 | |||
| 2037 | Ga0495652_0041555 | |||
| 2038 | Ga0495652_0085712 | |||
| 2039 | Ga0495652_0151957 | |||
| 2040 | Ga0495652_0225891 | |||
| 2041 | Ga0495652_0347145 | |||
| 2042 | Ga0495652_0390713 | |||
| 2043 | Ga0495665_0030788 | |||
| 2044 | Ga0495665_0178545 | |||
| 2045 | Ga0495640_0037807 | |||
| 2046 | Ga0495640_0253150 | |||
| 2047 | Ga0495586_0035800 | |||
| 2048 | Ga0495586_0119484 | |||
| 2049 | Ga0495586_0236429 | |||
| 2050 | Ga0495587_0025928 | |||
| 2051 | Ga0495587_0029174 | |||
| 2052 | Ga0495587_0123175 | |||
| 2053 | Ga0495587_0136670 | |||
| 2054 | Ga0495598_0005985 | |||
| 2055 | Ga0495609_0020406 | |||
| 2056 | Ga0495621_0014470 | |||
| 2057 | Ga0495645_0016503 | |||
| 2058 | Ga0495645_0178684 | |||
| 2059 | Ga0495645_0192796 | |||
| 2060 | Ga0495645_0208075 | |||
| 2061 | Ga0495645_0216281 | |||
| 2062 | Ga0495645_0311346 | |||
| 2063 | Ga0495622_0192448 | |||
| 2064 | Ga0495667_0039839 | |||
| 2065 | Ga0495656_0197048 | |||
| 2066 | Ga0495625_0031576 | |||
| 2067 | Ga0495635_0049008 | |||
| 2068 | Ga0495657_0192659 | |||
| 2069 | Ga0495599_0038419 | |||
| 2070 | Ga0495599_0079212 | |||
| 2071 | Ga0495623_0090094 | |||
| 2072 | Ga0495646_0078664 | |||
| 2073 | Ga0495646_0101678 | |||
| 2074 | Ga0495647_0019003 | |||
| 2075 | Ga0495658_0033654 | |||
| 2076 | Ga0495658_0077383 | |||
| 2077 | Ga0495613_0009371 | |||
| 2078 | Ga0495613_0047184 | |||
| 2079 | Ga0495624_0299484 | |||
| 2080 | Ga0495600_0019687 | |||
| 2081 | Ga0495600_0279910 | |||
| 2082 | Ga0495581_0054528 | |||
| 2083 | Ga0495604_0000316 | |||
| 2084 | Ga0495604_0042575 | |||
| 2085 | Ga0495604_0342442 | |||
| 2086 | Ga0495674_0054208 | |||
| 2087 | Ga0495674_0063090 | |||
| 2088 | Ga0495674_0083402 | |||
| 2089 | Ga0495674_0142328 | |||
| 2090 | Ga0495674_0238692 | |||
| 2091 | Ga0495674_0387908 | |||
| 2092 | Ga0495674_0388382 | |||
| 2093 | Ga0495672_0102811 | |||
| 2094 | Ga0495680_0187100 | |||
| 2095 | Ga0495680_0222615 | |||
| 2096 | Ga0495683_0087409 | |||
| 2097 | Ga0495684_0006774 | |||
| 2098 | Ga0495684_0056684 | |||
| 2099 | Ga0495684_0066907 | |||
| 2100 | Ga0495684_0181837 | |||
| 2101 | Ga0495684_0217385 | |||
| 2102 | Ga0495684_0253897 | |||
| 2103 | Ga0495593_0114561 | |||
| 2104 | Ga0495602_0010139 | |||
| 2105 | Ga0495602_0116057 | |||
| 2106 | Ga0495614_0024936 | |||
| 2107 | Ga0495614_0124447 | |||
| 2108 | Ga0496100_0046526 | |||
| 2109 | Ga0496100_0072079 | |||
| 2110 | Ga0496100_0094185 | |||
| 2111 | Ga0496101_0001837 | |||
| 2112 | Ga0496101_0148706 | |||
| 2113 | Ga0496101_0456376 | |||
| 2114 | Ga0496102_0301087 | |||
| 2115 | Ga0496102_0467491 | |||
| 2116 | Ga0496104_0003735 | |||
| 2117 | Ga0496104_0008309 | |||
| 2118 | Ga0496104_0024458 | |||
| 2119 | Ga0496104_0151114 | |||
| 2120 | Ga0496104_0170574 | |||
| 2121 | Ga0496104_0343306 | |||
| 2122 | Ga0496104_0358902 | |||
| 2123 | Ga0496104_0540880 | |||
| 2124 | Ga0496105_0057040 | |||
| 2125 | Ga0496105_0214782 | |||
| 2126 | Ga0496105_0369591 | |||
| 2127 | Ga0496106_0067050 | |||
| 2128 | Ga0496106_0098327 | |||
| 2129 | Ga0496106_0175523 | |||
| 2130 | Ga0496107_0013317 | |||
| 2131 | Ga0496108_0005593 | |||
| 2132 | Ga0496108_0007576 | |||
| 2133 | Ga0496109_0001076 | |||
| 2134 | Ga0496109_0002699 | |||
| 2135 | Ga0496109_0096662 | |||
| 2136 | Ga0496109_0218401 | |||
| 2137 | Ga0496110_0035447 | |||
| 2138 | Ga0496110_0054407 | |||
| 2139 | Ga0496111_0008105 | |||
| 2140 | Ga0496112_0014045 | |||
| 2141 | Ga0496112_0042091 | |||
| 2142 | Ga0496112_0161409 | |||
| 2143 | Ga0496113_0001631 | |||
| 2144 | Ga0496114_0004686 | |||
| 2145 | Ga0496114_0086563 | |||
| 2146 | Ga0496114_0218872 | |||
| 2147 | Ga0496114_0347937 | |||
| 2148 | Ga0496115_0021362 | |||
| 2149 | Ga0496115_0055490 | |||
| 2150 | Ga0496115_0133278 | |||
| 2151 | Ga0501291_007916 | |||
| 2152 | Ga0501036_0058624 | |||
| 2153 | Ga0501037_0394262 | |||
| 2154 | Ga0501040_0191520 | |||
| 2155 | Ga0501041_0031028 | |||
| 2156 | Ga0501069_0027812 | |||
| 2157 | Ga0501071_0012615 | |||
| 2158 | Ga0501071_0049679 | |||
| 2159 | Ga0501075_0011221 | |||
| 2160 | Ga0501076_0076897 | |||
| 2161 | Ga0501076_0478742 | |||
| 2162 | Ga0501077_0147882 | |||
| 2163 | Ga0501077_0314520 | |||
| 2164 | Ga0501198_017588 | |||
| 2165 | Ga0501202_007714 | |||
| 2166 | Ga0501217_001467 | |||
| 2167 | Ga0501223_002624 | |||
| 2168 | Ga0501224_000395 | |||
| 2169 | Ga0501227_010631 | |||
| 2170 | Ga0501230_005381 | |||
| 2171 | Ga0501233_005145 | |||
| 2172 | Ga0501235_000489 | |||
| 2173 | Ga0501242_002627 | |||
| 2174 | Ga0501243_000954 | |||
| 2175 | Ga0501249_005818 | |||
| 2176 | Ga0501253_001128 | |||
| 2177 | Ga0501257_002139 | |||
| 2178 | Ga0501257_040600 | |||
| 2179 | Ga0501225_0002679 | |||
| 2180 | Ga0501225_0024051 | |||
| 2181 | Ga0501234_001150 | |||
| 2182 | Ga0501079_0046282 | |||
| 2183 | Ga0501079_0177253 | |||
| 2184 | Ga0501266_002342 | |||
| 2185 | Ga0501268_000019 | |||
| 2186 | Ga0501271_006873 | |||
| 2187 | Ga0501274_004109 | |||
| 2188 | Ga0501283_010898 | |||
| 2189 | Ga0501045_0296795 | |||
| 2190 | nmdc:mga00v17_104704_c1 | |||
| 2191 | nmdc:mga00v17_137747_c1 | |||
| 2192 | nmdc:mga0yw44_71820_c1 | |||
| 2193 | nmdc:mga0k408_110591_c1 | |||
| 2194 | nmdc:mga0k408_17100_c1 | |||
| 2195 | nmdc:mga0k408_375805_c1 | |||
| 2196 | nmdc:mga0k408_52122_c1 | |||
| 2197 | nmdc:mga06z11_231402_c1 | |||
| 2198 | nmdc:mga06z11_23354_c1 | |||
| 2199 | nmdc:mga06z11_261575_c1 | |||
| 2200 | nmdc:mga07m45_29874_c1 | |||
| 2201 | nmdc:mga05p37_1385_c1 | |||
| 2202 | nmdc:mga05p37_157704_c1 | |||
| 2203 | nmdc:mga05p37_210934_c1 | |||
| 2204 | nmdc:mga05p37_232070_c1 | |||
| 2205 | nmdc:mga05p37_53519_c1 | |||
| 2206 | nmdc:mga05p37_57686_c1 | |||
| 2207 | nmdc:mga05p37_610326_c1 | |||
| 2208 | nmdc:mga05p37_611814_c1 | |||
| 2209 | nmdc:mga05p37_64060_c1 | |||
| 2210 | nmdc:mga05p37_64713_c1 | |||
| 2211 | nmdc:mga05p37_77687_c1 | |||
| 2212 | nmdc:mga05p37_870676_c1 | |||
| 2213 | nmdc:mga05p37_984476_c1 | |||
| 2214 | nmdc:mga05p37_9_c1 | |||
| 2215 | nmdc:mga09592_283598_c1 | |||
| 2216 | nmdc:mga09592_481142_c1 | |||
| 2217 | nmdc:mga09592_62037_c1 | |||
| 2218 | nmdc:mga0qj67_123324_c1 | |||
| 2219 | nmdc:mga0qj67_12797_c1 | |||
| 2220 | nmdc:mga0qj67_128340_c1 | |||
| 2221 | nmdc:mga0qj67_452652_c1 | |||
| 2222 | nmdc:mga0qj67_76609_c1 | |||
| 2223 | nmdc:mga06r32_134158_c1 | |||
| 2224 | nmdc:mga06r32_397895_c1 | |||
| 2225 | nmdc:mga06r32_421883_c1 | |||
| 2226 | nmdc:mga06r32_59331_c1 | |||
| 2227 | nmdc:mga06r32_777784_c1 | |||
| 2228 | nmdc:mga06r32_786454_c1 | |||
| 2229 | nmdc:mga06r32_85303_c1 | |||
| 2230 | nmdc:mga08y16_116416_c1 | |||
| 2231 | nmdc:mga08y16_117029_c1 | |||
| 2232 | nmdc:mga08y16_222407_c1 | |||
| 2233 | nmdc:mga08y16_241962_c1 | |||
| 2234 | nmdc:mga08y16_26376_c1 | |||
| 2235 | nmdc:mga08y16_416043_c1 | |||
| 2236 | nmdc:mga08y16_42484_c1 | |||
| 2237 | nmdc:mga08y16_47457_c1 | |||
| 2238 | nmdc:mga08y16_589981_c1 | |||
| 2239 | nmdc:mga08y16_67155_c1 | |||
| 2240 | nmdc:mga0n895_15479_c1 | |||
| 2241 | nmdc:mga0n895_240866_c1 | |||
| 2242 | nmdc:mga0n895_26976_c1 | |||
| 2243 | nmdc:mga0n895_48370_c1 | |||
| 2244 | nmdc:mga0n895_5297_c1 | |||
| 2245 | nmdc:mga0n895_80_c1 | |||
| 2246 | nmdc:mga0n895_876854_c1 | |||
| 2247 | nmdc:mga0rr50_35_c1 | |||
| 2248 | nmdc:mga0rr50_371681_c1 | |||
| 2249 | nmdc:mga0rr50_396702_c1 | |||
| 2250 | nmdc:mga0rr50_4248_c1 | |||
| 2251 | nmdc:mga0rr50_68137_c1 | |||
| 2252 | nmdc:mga08x19_31980_c1 | |||
| 2253 | nmdc:mga08x19_33934_c1 | |||
| 2254 | nmdc:mga08x19_64_c2 | |||
| 2255 | nmdc:mga08x19_690_c1 | |||
| 2256 | nmdc:mga0a205_127322_c1 | |||
| 2257 | nmdc:mga0a205_133478_c1 | |||
| 2258 | nmdc:mga0a205_135534_c1 | |||
| 2259 | nmdc:mga0a205_17397_c1 | |||
| 2260 | nmdc:mga0a205_267463_c1 | |||
| 2261 | nmdc:mga0a205_329345_c1 | |||
| 2262 | nmdc:mga0a205_38775_c1 | |||
| 2263 | nmdc:mga0a205_492229_c1 | |||
| 2264 | Ga0495601_0165332 | |||
| 2265 | Ga0500610_0154014 | |||
| 2266 | Ga0495619_0168264 | |||
| 2267 | Ga0495619_0488652 | |||
| 2268 | Ga0500646_0107132 | |||
| 2269 | Ga0500641_0002653 | |||
| 2270 | Ga0500568_0006179 | |||
| 2271 | Ga0501084_0204826 | |||
| 2272 | Ga0501084_0263253 | |||
| 2273 | Ga0590071_000088 | |||
| 2274 | Ga0590071_001754 | |||
| 2275 | Ga0590071_002832 | |||
| 2276 | Ga0590071_070597 | |||
| 2277 | Ga0590075_000373 | |||
| 2278 | Ga0590075_013540 | |||
| 2279 | Ga0590077_000528 | |||
| 2280 | Ga0590077_002992 | |||
| 2281 | Ga0501082_0245802 | |||
| 2282 | Ga0501082_1031409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tc0-assembly1.cif.gz_A | the structure of human abca1 in digitonin | 0.8108 | 52 | 242 |
| 7tby-assembly1.cif.gz_A | the structure of human abca1 in nanodisc | 0.8089 | 52 | 242 |
| 7roq-assembly1.cif.gz_A | alternative structure of human abca1 | 0.7816 | 54 | 242 |
| 7tdt-assembly1.cif.gz_A | cryo-em structure of nanodisc-embedded human abca1 | 0.7783 | 54 | 240 |
| 7r89-assembly1.cif.gz_B | the structure of human abcg5/abcg8 purified from yeast | 0.7607 | 2 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8734 | 52 | 242 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8475 | 52 | 243 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8346 | 52 | 237 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6904 | 52 | 242 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6611 | 52 | 243 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7H8Q5-F1-model_v4 | ABC transporter permease | 0.9419 | 57 | 246 |
GO:0043190
GO:0140359 |
| AF-A0A2V7T045-F1-model_v4 | Transport permease protein | 0.9342 | 1 | 246 |
GO:0043190
GO:0140359 |
| AF-A0A2V7T045-F1-model_v4 | Transport permease protein | 0.9305 | 1 | 246 |
GO:0043190
GO:0140359 |
| AF-A0A2V7H8Q5-F1-model_v4 | ABC transporter permease | 0.9278 | 57 | 246 |
GO:0043190
GO:0140359 |
| AF-A0A5N9C183-F1-model_v4 | Transport permease protein | 0.9257 | 54 | 246 |
GO:0043190
GO:0140359 |