F490710

General Info

Members Datasets Scaffolds Average Seq Length
1141 389 2282 248

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100436913|Ga0070689_1004369131
Length 289
Sequence LPLVGLLRRPNPSNPAIISVYLGCSVALWLTVLSVSSADTMLRGLWKLTWLEIKIFLREPLGVVGTVGLPVLVYVGLGRLLGPRVGRASPDVPRAVSVDLPILSVLLIVASAVLSLVAIIAIYREGGILRRLRATPLRPHTILTAHVLAKLLFTLVTLAVMVLAGRRYFPIPAAVPMVSFTVALLFTTVSLLSLGFLIASVVPTARFAQPIGTLVLYPMVGLSGLFVPIESLPPLLRALARVLPLTYAVSLLKGIWRGEGWSAHLGDVAVLTATFLVLMAASSRVFRWE

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
251 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
252 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
253 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
254 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
255 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
256 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
343 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
344 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
345 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
346 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
347 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
348 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
349 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
350 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
351 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
352 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
353 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
354 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
355 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
356 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
357 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
360 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
361 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
362 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
363 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
377 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
387 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 3.94
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100436913 3300005340 Bacteria 1112
2 MBSR1b_contig_8694521 2162886012 Bacteria 1460
3 JGI25406J46586_10004594 3300003203 Bacteria 6428
4 Ga0065704_10230603 3300005289 Bacteria 1044
5 Ga0065712_10003012 3300005290 Bacteria 6886
6 Ga0065712_10067827 3300005290 Bacteria 27716
7 Ga0065712_10088488 3300005290 Bacteria 2517
8 Ga0065715_10089309 3300005293 Bacteria 11310
9 Ga0065715_10187852 3300005293 Bacteria 1433
10 Ga0065715_10223470 3300005293 Unclassified 1262
11 Ga0065715_10342083 3300005293 Unclassified 965
12 Ga0065707_10093908 3300005295 Bacteria 3564
13 Ga0065707_10115964 3300005295 Bacteria 2252
14 Ga0065707_10297546 3300005295 Bacteria 1011
15 Ga0070658_10019311 3300005327 Bacteria 5458
16 Ga0070658_10048484 3300005327 Bacteria 3440
17 Ga0070658_10711479 3300005327 Unclassified 872
18 Ga0070676_10117171 3300005328 Bacteria 1667
19 Ga0070683_100175745 3300005329 Bacteria 2032
20 Ga0070683_100397046 3300005329 Bacteria 1315
21 Ga0070670_100024330 3300005331 Bacteria 5208
22 Ga0070670_100026632 3300005331 Bacteria 4974
23 Ga0070670_100149548 3300005331 Bacteria 2021
24 Ga0070670_100168545 3300005331 Bacteria 1899
25 Ga0070670_100325136 3300005331 Bacteria 1348
26 Ga0070677_10108876 3300005333 Bacteria 1234
27 Ga0068869_100027625 3300005334 Bacteria 3959
28 Ga0068869_100112833 3300005334 Bacteria 2070
29 Ga0070666_10060814 3300005335 Bacteria 2557
30 Ga0070680_100007823 3300005336 Bacteria 8146
31 Ga0070680_100396055 3300005336 Unclassified 1177
32 Ga0070682_100016079 3300005337 Bacteria 4346
33 Ga0070682_100196860 3300005337 Bacteria 1419
34 Ga0068868_100064218 3300005338 Bacteria 2914
35 Ga0068868_100101581 3300005338 Bacteria 2327
36 Ga0068868_100151438 3300005338 Bacteria 1910
37 Ga0068868_100226456 3300005338 Bacteria 1567
38 Ga0068868_100481958 3300005338 Bacteria 1084
39 Ga0070689_100062062 3300005340 Bacteria 2907
40 Ga0070689_100076859 3300005340 Bacteria 2616
41 Ga0070689_100409004 3300005340 Bacteria 1148
42 Ga0070691_10000314 3300005341 Bacteria 17078
43 Ga0070691_10139060 3300005341 Bacteria 1236
44 Ga0070661_100031365 3300005344 Bacteria 3843
45 Ga0070668_100600673 3300005347 Bacteria 963
46 Ga0070668_100660054 3300005347 Bacteria 919
47 Ga0070669_100000727 3300005353 Bacteria 24018
48 Ga0070669_100001162 3300005353 Bacteria 19218
49 Ga0070669_100057118 3300005353 Bacteria 2863
50 Ga0070669_100100205 3300005353 Bacteria 2184
51 Ga0070675_100000381 3300005354 Bacteria 30031
52 Ga0070675_100044978 3300005354 Bacteria 3612
53 Ga0070675_100194844 3300005354 Unclassified 1757
54 Ga0070675_100249057 3300005354 Bacteria 1554
55 Ga0070675_100532026 3300005354 Unclassified 1061
56 Ga0070671_100022701 3300005355 Bacteria 5127
57 Ga0070671_100051343 3300005355 Bacteria 3429
58 Ga0070671_100175466 3300005355 Bacteria 1813
59 Ga0070671_100280947 3300005355 Bacteria 1416
60 Ga0070674_100027520 3300005356 Bacteria 3727
61 Ga0070674_100032698 3300005356 Bacteria 3455
62 Ga0070674_100044535 3300005356 Bacteria 3026
63 Ga0070674_100083525 3300005356 Bacteria 2288
64 Ga0070674_100223752 3300005356 Bacteria 1465
65 Ga0070674_100319267 3300005356 Bacteria 1245
66 Ga0070674_100676614 3300005356 Bacteria 880
67 Ga0070673_100014110 3300005364 Bacteria 5552
68 Ga0070688_100016092 3300005365 Bacteria 4269
69 Ga0070688_100220527 3300005365 Bacteria 1336
70 Ga0070659_100009356 3300005366 Bacteria 7196
71 Ga0070659_100046618 3300005366 Bacteria 3398
72 Ga0070659_100161894 3300005366 Bacteria 1830
73 Ga0070709_10001985 3300005434 Bacteria 11148
74 Ga0070709_10127207 3300005434 Bacteria 1735
75 Ga0070709_10133103 3300005434 Bacteria 1700
76 Ga0070709_10319980 3300005434 Bacteria 1138
77 Ga0070714_100067256 3300005435 Unclassified 3089
78 Ga0070714_100069188 3300005435 Bacteria 3048
79 Ga0070714_100075091 3300005435 Bacteria 2932
80 Ga0070714_100300709 3300005435 Unclassified 1496
81 Ga0070713_100000180 3300005436 Bacteria 41991
82 Ga0070713_100001143 3300005436 Bacteria 17000
83 Ga0070713_100016132 3300005436 Bacteria 5611
84 Ga0070713_100032958 3300005436 Bacteria 4145
85 Ga0070713_100039295 3300005436 Bacteria 3840
86 Ga0070713_100082524 3300005436 Unclassified 2745
87 Ga0070713_100087678 3300005436 Bacteria 2670
88 Ga0070710_10020002 3300005437 Unclassified 3468
89 Ga0070710_10061563 3300005437 Unclassified 2138
90 Ga0070710_10126371 3300005437 Bacteria 1554
91 Ga0070701_10164448 3300005438 Bacteria 1288
92 Ga0070701_10270448 3300005438 Bacteria 1034
93 Ga0070711_100000441 3300005439 Bacteria 21555
94 Ga0070711_100000766 3300005439 Bacteria 16740
95 Ga0070711_100014055 3300005439 Bacteria 5037
96 Ga0070711_100015453 3300005439 Bacteria 4832
97 Ga0070711_100060355 3300005439 Bacteria 2636
98 Ga0070711_100109236 3300005439 Bacteria 2027
99 Ga0070711_100118775 3300005439 Bacteria 1952
100 Ga0070711_100355555 3300005439 Bacteria 1179
101 Ga0070711_100481411 3300005439 Unclassified 1020
102 Ga0070705_100288519 3300005440 Bacteria 1170
103 Ga0070700_100054072 3300005441 Bacteria 2508
104 Ga0070700_100173514 3300005441 Bacteria 1495
105 Ga0070694_100005219 3300005444 Bacteria 7849
106 Ga0070694_100006820 3300005444 Bacteria 6936
107 Ga0070708_100000081 3300005445 Bacteria 61675
108 Ga0070708_100018220 3300005445 Bacteria 5876
109 Ga0070708_100079703 3300005445 Bacteria 2962
110 Ga0070663_100024099 3300005455 Bacteria 4090
111 Ga0070663_100089958 3300005455 Bacteria 2272
112 Ga0070663_100102817 3300005455 Bacteria 2135
113 Ga0070663_100156217 3300005455 Bacteria 1753
114 Ga0070678_100020086 3300005456 Unclassified 4375
115 Ga0070678_100086375 3300005456 Bacteria 2393
116 Ga0070678_100176553 3300005456 Bacteria 1745
117 Ga0070678_100447338 3300005456 Unclassified 1131
118 Ga0070662_100016492 3300005457 Bacteria 4962
119 Ga0070662_100093100 3300005457 Bacteria 2267
120 Ga0070662_100272021 3300005457 Bacteria 1368
121 Ga0070662_100651408 3300005457 Unclassified 888
122 Ga0070681_10002730 3300005458 Bacteria 16264
123 Ga0070681_10063440 3300005458 Bacteria 3667
124 Ga0070681_10130184 3300005458 Bacteria 2448
125 Ga0068867_100042111 3300005459 Bacteria 3339
126 Ga0068867_100048895 3300005459 Bacteria 3112
127 Ga0068867_100098897 3300005459 Bacteria 2225
128 Ga0068867_100142008 3300005459 Bacteria 1878
129 Ga0068867_100339577 3300005459 Bacteria 1250
130 Ga0070685_10000943 3300005466 Bacteria 15645
131 Ga0070685_10032234 3300005466 Bacteria 2934
132 Ga0070706_100007119 3300005467 Bacteria 10520
133 Ga0070706_100012916 3300005467 Bacteria 7730
134 Ga0070706_100268267 3300005467 Viruses 1593
135 Ga0070706_100338038 3300005467 Bacteria 1404
136 Ga0070707_100001950 3300005468 Bacteria 19793
137 Ga0070707_100003644 3300005468 Bacteria 14526
138 Ga0070707_100177898 3300005468 Bacteria 2074
139 Ga0070707_100461679 3300005468 Bacteria 1231
140 Ga0070707_100579024 3300005468 Unclassified 1085
141 Ga0070698_100004310 3300005471 Bacteria 15649
142 Ga0070698_100115650 3300005471 Bacteria 2646
143 Ga0070698_100290800 3300005471 Bacteria 1565
144 Ga0070698_100416343 3300005471 Bacteria 1278
145 Ga0070698_100430025 3300005471 Unclassified 1255
146 Ga0070699_100010867 3300005518 Bacteria 7876
147 Ga0070699_100037867 3300005518 Bacteria 4175
148 Ga0070699_100060876 3300005518 Bacteria 3272
149 Ga0070699_100064883 3300005518 Bacteria 3167
150 Ga0070699_100159681 3300005518 Bacteria 1995
151 Ga0070699_100240453 3300005518 Bacteria 1616
152 Ga0070699_100486601 3300005518 Unclassified 1120
153 Ga0070699_100664849 3300005518 Unclassified 951
154 Ga0070699_100700912 3300005518 Bacteria 925
155 Ga0070679_100013189 3300005530 Bacteria 7912
156 Ga0070679_100023599 3300005530 Bacteria 6024
157 Ga0070679_100305928 3300005530 Bacteria 1540
158 Ga0070679_100398568 3300005530 Bacteria 1322
159 Ga0070684_100013274 3300005535 Bacteria 6638
160 Ga0070684_100241251 3300005535 Bacteria 1651
161 Ga0070684_100369140 3300005535 Bacteria 1321
162 Ga0070684_100439350 3300005535 Bacteria 1205
163 Ga0070684_100479562 3300005535 Bacteria 1151
164 Ga0070697_100001931 3300005536 Bacteria 15867
165 Ga0070697_100013572 3300005536 Bacteria 6391
166 Ga0070697_100143416 3300005536 Bacteria 2009
167 Ga0070697_100274591 3300005536 Bacteria 1445
168 Ga0070672_100057939 3300005543 Bacteria 3043
169 Ga0070672_100147881 3300005543 Bacteria 1942
170 Ga0070672_100369218 3300005543 Bacteria 1226
171 Ga0070686_100074218 3300005544 Bacteria 2235
172 Ga0070686_100094646 3300005544 Bacteria 2005
173 Ga0070686_100300668 3300005544 Bacteria 1190
174 Ga0070686_100345106 3300005544 Bacteria 1117
175 Ga0070686_100366287 3300005544 Unclassified 1087
176 Ga0070695_100000829 3300005545 Bacteria 16689
177 Ga0070695_100003902 3300005545 Bacteria 8706
178 Ga0070695_100152238 3300005545 Unclassified 1615
179 Ga0070695_100211902 3300005545 Unclassified 1391
180 Ga0070696_100002254 3300005546 Bacteria 12712
181 Ga0070696_100048110 3300005546 Bacteria 2959
182 Ga0070693_100000200 3300005547 Bacteria 28231
183 Ga0070693_100009327 3300005547 Bacteria 4877
184 Ga0070693_100051779 3300005547 Bacteria 2352
185 Ga0070665_100006550 3300005548 Bacteria 11834
186 Ga0070665_100010091 3300005548 Bacteria 9555
187 Ga0070665_100014615 3300005548 Bacteria 7878
188 Ga0070665_100077027 3300005548 Bacteria 3341
189 Ga0070665_100114428 3300005548 Bacteria 2700
190 Ga0070704_100001732 3300005549 Bacteria 11908
191 Ga0070704_100004385 3300005549 Bacteria 8147
192 Ga0070704_100334734 3300005549 Bacteria 1273
193 Ga0068855_100721648 3300005563 Bacteria 1065
194 Ga0070664_100003507 3300005564 Bacteria 12666
195 Ga0070664_100224856 3300005564 Bacteria 1680
196 Ga0070664_100287836 3300005564 Unclassified 1483
197 Ga0070664_100305136 3300005564 Unclassified 1439
198 Ga0070664_100369119 3300005564 Bacteria 1308
199 Ga0068857_100007741 3300005577 Bacteria 9254
200 Ga0068857_100041896 3300005577 Bacteria 4060
201 Ga0068857_100084299 3300005577 Bacteria 2840
202 Ga0068854_100240233 3300005578 Unclassified 1442
203 Ga0068856_100230003 3300005614 Bacteria 1869
204 Ga0070702_100063187 3300005615 Bacteria 2161
205 Ga0070702_100075026 3300005615 Bacteria 2008
206 Ga0068852_100024949 3300005616 Bacteria 4838
207 Ga0068852_100139429 3300005616 Bacteria 2242
208 Ga0068852_100205857 3300005616 Bacteria 1864
209 Ga0068859_100028342 3300005617 Bacteria 5614
210 Ga0068859_100077070 3300005617 Bacteria 3375
211 Ga0068859_100180594 3300005617 Bacteria 2193
212 Ga0068859_100388543 3300005617 Unclassified 1491
213 Ga0068859_100466009 3300005617 Unclassified 1359
214 Ga0068859_100543900 3300005617 Bacteria 1256
215 Ga0068859_100631281 3300005617 Bacteria 1164
216 Ga0068864_100001175 3300005618 Bacteria 21803
217 Ga0068864_100059408 3300005618 Bacteria 3308
218 Ga0068864_100147229 3300005618 Bacteria 2130
219 Ga0068864_100264731 3300005618 Bacteria 1600
220 Ga0068864_100286781 3300005618 Bacteria 1538
221 Ga0068866_10035405 3300005718 Unclassified 2438
222 Ga0068866_10058280 3300005718 Bacteria 1994
223 Ga0068866_10089494 3300005718 Bacteria 1673
224 Ga0068861_100208762 3300005719 Unclassified 1644
225 Ga0068861_100228329 3300005719 Unclassified 1577
226 Ga0068861_100492057 3300005719 Bacteria 1107
227 Ga0068851_10099905 3300005834 Bacteria 1538
228 Ga0068851_10191177 3300005834 Bacteria 1138
229 Ga0068863_100000704 3300005841 Bacteria 33679
230 Ga0068863_100012167 3300005841 Bacteria 8311
231 Ga0068863_100081146 3300005841 Bacteria 3072
232 Ga0068863_100421734 3300005841 Bacteria 1307
233 Ga0068863_100966734 3300005841 Unclassified 853
234 Ga0068858_100003039 3300005842 Bacteria 16816
235 Ga0068858_100027377 3300005842 Bacteria 5296
236 Ga0068858_100562186 3300005842 Unclassified 1105
237 Ga0068858_100583817 3300005842 Bacteria 1083
238 Ga0068858_100623729 3300005842 Bacteria 1047
239 Ga0068860_100064452 3300005843 Unclassified 3480
240 Ga0068860_100150761 3300005843 Bacteria 2239
241 Ga0068860_100155296 3300005843 Bacteria 2205
242 Ga0068860_100343566 3300005843 Bacteria 1468
243 Ga0068860_100679963 3300005843 Bacteria 1038
244 Ga0068862_100013068 3300005844 Bacteria 6867
245 Ga0068862_100201634 3300005844 Bacteria 1794
246 Ga0068862_100211572 3300005844 Unclassified 1752
247 Ga0068862_100301715 3300005844 Bacteria 1474
248 Ga0068862_100764520 3300005844 Unclassified 941
249 Ga0068862_100813603 3300005844 Bacteria 913
250 Ga0068862_100995715 3300005844 Bacteria 829
251 Ga0081455_10039113 3300005937 Bacteria 4195
252 Ga0081455_10369777 3300005937 Bacteria 1005
253 Ga0081539_10001216 3300005985 Bacteria 46061
254 Ga0070717_10000390 3300006028 Bacteria 28003
255 Ga0070717_10015105 3300006028 Bacteria 5954
256 Ga0075365_10012336 3300006038 Bacteria 5071
257 Ga0075368_10019197 3300006042 Bacteria 2579
258 Ga0075368_10029364 3300006042 Bacteria 2126
259 Ga0075364_10111183 3300006051 Bacteria 1828
260 Ga0075432_10081893 3300006058 Bacteria 1171
261 Ga0070715_10005229 3300006163 Unclassified 4312
262 Ga0070715_10033098 3300006163 Bacteria 2110
263 Ga0070716_100008491 3300006173 Bacteria 5097
264 Ga0070716_100076673 3300006173 Bacteria 1982
265 Ga0070716_100099815 3300006173 Bacteria 1777
266 Ga0070716_100149312 3300006173 Bacteria 1501
267 Ga0070716_100343200 3300006173 Bacteria 1054
268 Ga0070712_100000424 3300006175 Bacteria 24251
269 Ga0070712_100000774 3300006175 Bacteria 18882
270 Ga0075367_10019708 3300006178 Bacteria 3744
271 Ga0075367_10150968 3300006178 Unclassified 1442
272 Ga0075367_10229048 3300006178 Unclassified 1164
273 Ga0075366_10037914 3300006195 Bacteria 2847
274 Ga0075366_10041787 3300006195 Bacteria 2715
275 Ga0075366_10143594 3300006195 Bacteria 1444
276 Ga0097621_100051496 3300006237 Bacteria 3351
277 Ga0097621_100090730 3300006237 Bacteria 2557
278 Ga0097621_100115283 3300006237 Bacteria 2274
279 Ga0097621_100152891 3300006237 Bacteria 1979
280 Ga0097621_100207508 3300006237 Bacteria 1703
281 Ga0097621_100274545 3300006237 Unclassified 1482
282 Ga0097621_100359368 3300006237 Unclassified 1297
283 Ga0097621_100484628 3300006237 Unclassified 1118
284 Ga0097621_100841627 3300006237 Unclassified 852
285 Ga0075370_10042865 3300006353 Bacteria 2557
286 Ga0068871_100023117 3300006358 Bacteria 4802
287 Ga0068871_100047401 3300006358 Bacteria 3466
288 Ga0068871_100064046 3300006358 Bacteria 3008
289 Ga0068871_100262882 3300006358 Unclassified 1506
290 Ga0068871_100271419 3300006358 Bacteria 1482
291 Ga0068871_100896367 3300006358 Unclassified 822
292 Ga0075428_100012869 3300006844 Bacteria 9310
293 Ga0075428_100020050 3300006844 Bacteria 7404
294 Ga0075428_100026426 3300006844 Bacteria 6426
295 Ga0075428_100192939 3300006844 Bacteria 2203
296 Ga0075428_100207079 3300006844 Bacteria 2120
297 Ga0075428_100390752 3300006844 Bacteria 1491
298 Ga0075428_101030199 3300006844 Bacteria 871
299 Ga0075430_100035079 3300006846 Bacteria 4258
300 Ga0075430_100099702 3300006846 Bacteria 2426
301 Ga0075430_100224238 3300006846 Bacteria 1559
302 Ga0075430_100238233 3300006846 Bacteria 1508
303 Ga0075430_100247581 3300006846 Bacteria 1477
304 Ga0075430_100400093 3300006846 Bacteria 1133
305 Ga0075431_100028762 3300006847 Bacteria 5714
306 Ga0075431_100030652 3300006847 Bacteria 5541
307 Ga0075431_100053177 3300006847 Bacteria 4175
308 Ga0075431_100094974 3300006847 Bacteria 3078
309 Ga0075431_100166805 3300006847 Unclassified 2263
310 Ga0075431_100225150 3300006847 Bacteria 1912
311 Ga0075433_10011743 3300006852 Bacteria 7053
312 Ga0075433_10074249 3300006852 Bacteria 2992
313 Ga0075433_10107478 3300006852 Bacteria 2474
314 Ga0075433_10122773 3300006852 Bacteria 2307
315 Ga0075433_10198946 3300006852 Bacteria 1782
316 Ga0075433_10199807 3300006852 Bacteria 1777
317 Ga0075433_10554907 3300006852 Unclassified 1010
318 Ga0075434_100000098 3300006871 Bacteria 48574
319 Ga0075434_100011671 3300006871 Bacteria 8297
320 Ga0075434_100027710 3300006871 Bacteria 5563
321 Ga0075434_100081905 3300006871 Bacteria 3224
322 Ga0075434_100145485 3300006871 Bacteria 2390
323 Ga0075434_100222295 3300006871 Bacteria 1908
324 Ga0075434_100649152 3300006871 Unclassified 1073
325 Ga0075429_100053555 3300006880 Bacteria 3511
326 Ga0075429_100086373 3300006880 Bacteria 2734
327 Ga0075429_100108416 3300006880 Bacteria 2427
328 Ga0075429_100171615 3300006880 Bacteria 1899
329 Ga0075429_100560626 3300006880 Bacteria 1001
330 Ga0068865_100002032 3300006881 Bacteria 11941
331 Ga0068865_100009144 3300006881 Bacteria 6132
332 Ga0068865_100094661 3300006881 Bacteria 2174
333 Ga0068865_100291421 3300006881 Bacteria 1303
334 Ga0068865_100531964 3300006881 Unclassified 984
335 Ga0075436_100000037 3300006914 Bacteria 83376
336 Ga0075436_100005387 3300006914 Bacteria 8807
337 Ga0075436_100006638 3300006914 Bacteria 7926
338 Ga0075436_100006643 3300006914 Bacteria 7922
339 Ga0075436_100045018 3300006914 Bacteria 3044
340 Ga0075436_100045696 3300006914 Bacteria 3021
341 Ga0075436_100295354 3300006914 Bacteria 1160
342 Ga0097620_100028342 3300006931 Bacteria 5614
343 Ga0097620_100077072 3300006931 Bacteria 3375
344 Ga0097620_100180599 3300006931 Bacteria 2193
345 Ga0097620_100388540 3300006931 Unclassified 1491
346 Ga0097620_100466114 3300006931 Unclassified 1359
347 Ga0097620_100543864 3300006931 Bacteria 1256
348 Ga0097620_100631254 3300006931 Bacteria 1164
349 Ga0075435_100000020 3300007076 Bacteria 91240
350 Ga0075435_100004674 3300007076 Bacteria 9441
351 Ga0075435_100009374 3300007076 Bacteria 7083
352 Ga0075435_100080339 3300007076 Unclassified 2677
353 Ga0075435_100165792 3300007076 Unclassified 1863
354 Ga0075435_100586085 3300007076 Unclassified 967
355 Ga0105240_10024898 3300009093 Bacteria 7878
356 Ga0105240_10057307 3300009093 Bacteria 4868
357 Ga0105240_10123688 3300009093 Bacteria 3112
358 Ga0111539_10002591 3300009094 Bacteria 23946
359 Ga0111539_10002914 3300009094 Bacteria 22702
360 Ga0111539_10003917 3300009094 Bacteria 19571
361 Ga0111539_10035761 3300009094 Bacteria 6012
362 Ga0111539_10041050 3300009094 Bacteria 5565
363 Ga0111539_10070775 3300009094 Bacteria 4117
364 Ga0111539_10097410 3300009094 Unclassified 3455
365 Ga0111539_10270335 3300009094 Bacteria 1979
366 Ga0111539_10534548 3300009094 Unclassified 1366
367 Ga0111539_10729611 3300009094 Bacteria 1153
368 Ga0111539_10876032 3300009094 Unclassified 1044
369 Ga0111539_10911847 3300009094 Bacteria 1022
370 Ga0105245_10038798 3300009098 Bacteria 4238
371 Ga0105245_10231365 3300009098 Bacteria 1788
372 Ga0105245_10265833 3300009098 Bacteria 1671
373 Ga0105247_10038134 3300009101 Bacteria 2932
374 Ga0105247_10038653 3300009101 Bacteria 2914
375 Ga0105247_10137752 3300009101 Unclassified 1596
376 Ga0114129_10000174 3300009147 Bacteria 70648
377 Ga0114129_10000192 3300009147 Bacteria 68551
378 Ga0114129_10000275 3300009147 Bacteria 58684
379 Ga0114129_10005113 3300009147 Bacteria 18461
380 Ga0114129_10008970 3300009147 Bacteria 14259
381 Ga0114129_10022135 3300009147 Bacteria 9021
382 Ga0114129_10048805 3300009147 Bacteria 5950
383 Ga0114129_10061464 3300009147 Bacteria 5249
384 Ga0114129_10099321 3300009147 Bacteria 4029
385 Ga0114129_10153629 3300009147 Bacteria 3149
386 Ga0114129_10165848 3300009147 Bacteria 3014
387 Ga0114129_10253945 3300009147 Bacteria 2359
388 Ga0114129_10579457 3300009147 Bacteria 1456
389 Ga0114129_10588951 3300009147 Bacteria 1442
390 Ga0114129_10766159 3300009147 Bacteria 1234
391 Ga0114129_11135104 3300009147 Unclassified 977
392 Ga0105243_10033909 3300009148 Bacteria 3949
393 Ga0105243_10123793 3300009148 Bacteria 2184
394 Ga0105243_10405874 3300009148 Unclassified 1267
395 Ga0105243_10535370 3300009148 Unclassified 1116
396 Ga0105241_10087351 3300009174 Bacteria 2454
397 Ga0105242_10026761 3300009176 Bacteria 4573
398 Ga0105242_10068681 3300009176 Bacteria 2933
399 Ga0105248_10002305 3300009177 Bacteria 21144
400 Ga0105248_10008586 3300009177 Bacteria 11220
401 Ga0105248_10026590 3300009177 Bacteria 6436
402 Ga0105248_10048444 3300009177 Bacteria 4767
403 Ga0105248_10131427 3300009177 Bacteria 2824
404 Ga0105248_10185846 3300009177 Bacteria 2342
405 Ga0105248_10233198 3300009177 Bacteria 2072
406 Ga0105248_10306691 3300009177 Bacteria 1788
407 Ga0105248_10582472 3300009177 Unclassified 1262
408 Ga0105248_11135072 3300009177 Bacteria 883
409 Ga0105237_10031580 3300009545 Bacteria 5366
410 Ga0105237_10279603 3300009545 Bacteria 1672
411 Ga0105237_10366173 3300009545 Bacteria 1446
412 Ga0105238_10063520 3300009551 Bacteria 3693
413 Ga0105238_10099977 3300009551 Bacteria 2883
414 Ga0105238_10178492 3300009551 Bacteria 2100
415 Ga0105249_10000517 3300009553 Bacteria 35617
416 Ga0105249_10006590 3300009553 Bacteria 10104
417 Ga0105249_10055970 3300009553 Bacteria 3611
418 Ga0105249_10154988 3300009553 Unclassified 2208
419 Ga0105249_10649785 3300009553 Bacteria 1112
420 Ga0105249_10831416 3300009553 Bacteria 988
421 Ga0105239_10394456 3300010375 Bacteria 1566
422 Ga0105239_10625030 3300010375 Unclassified 1229
423 Ga0105246_10206590 3300011119 Bacteria 1530
424 Ga0157373_10137237 3300013100 Bacteria 1720
425 Ga0157370_10603578 3300013104 Bacteria 1005
426 Ga0157369_10104725 3300013105 Bacteria 3012
427 Ga0157369_10331994 3300013105 Bacteria 1580
428 Ga0157374_10137113 3300013296 Bacteria 2373
429 Ga0157378_10001096 3300013297 Bacteria 24704
430 Ga0157378_10033718 3300013297 Bacteria 4527
431 Ga0157378_10046860 3300013297 Unclassified 3842
432 Ga0157378_10105791 3300013297 Bacteria 2573
433 Ga0157378_10198639 3300013297 Unclassified 1896
434 Ga0157378_10261550 3300013297 Bacteria 1660
435 Ga0157378_10279585 3300013297 Unclassified 1608
436 Ga0163162_10000370 3300013306 Bacteria 40835
437 Ga0163162_10129753 3300013306 Bacteria 2629
438 Ga0163162_10169437 3300013306 Bacteria 2308
439 Ga0163162_10216115 3300013306 Bacteria 2047
440 Ga0157372_10030751 3300013307 Bacteria 5875
441 Ga0157372_10036897 3300013307 Bacteria 5390
442 Ga0157372_10070222 3300013307 Bacteria 3940
443 Ga0157372_10691920 3300013307 Bacteria 1187
444 Ga0157372_10821614 3300013307 Bacteria 1079
445 Ga0157375_10063743 3300013308 Bacteria 3668
446 Ga0157375_10691508 3300013308 Bacteria 1174
447 Ga0157375_11018630 3300013308 Unclassified 967
448 Ga0163163_10010921 3300014325 Bacteria 8203
449 Ga0163163_10115060 3300014325 Bacteria 2721
450 Ga0163163_10123563 3300014325 Unclassified 2624
451 Ga0163163_10256300 3300014325 Bacteria 1800
452 Ga0163163_10305448 3300014325 Bacteria 1643
453 Ga0157380_10048552 3300014326 Bacteria 3343
454 Ga0157380_10060343 3300014326 Bacteria 3030
455 Ga0157380_10071651 3300014326 Unclassified 2804
456 Ga0157380_10086528 3300014326 Bacteria 2575
457 Ga0157380_10090930 3300014326 Bacteria 2519
458 Ga0157380_10128178 3300014326 Bacteria 2160
459 Ga0157380_10666729 3300014326 Unclassified 1040
460 Ga0157377_10025904 3300014745 Bacteria 3132
461 Ga0157377_10067967 3300014745 Unclassified 2052
462 Ga0157377_10165134 3300014745 Bacteria 1380
463 Ga0157377_10354231 3300014745 Bacteria 986
464 Ga0157379_10025716 3300014968 Bacteria 5232
465 Ga0157379_10053135 3300014968 Bacteria 3619
466 Ga0157379_10177184 3300014968 Bacteria 1925
467 Ga0157379_10186808 3300014968 Bacteria 1873
468 Ga0157379_10299618 3300014968 Unclassified 1465
469 Ga0157379_10668075 3300014968 Unclassified 974
470 Ga0157379_10696431 3300014968 Bacteria 953
471 Ga0157376_10003558 3300014969 Bacteria 10744
472 Ga0157376_10009627 3300014969 Bacteria 7030
473 Ga0157376_10027273 3300014969 Bacteria 4525
474 Ga0157376_10141167 3300014969 Bacteria 2161
475 Ga0157376_10545064 3300014969 Unclassified 1147
476 Ga0157376_10587519 3300014969 Bacteria 1107
477 Ga0157376_10653701 3300014969 Bacteria 1052
478 Ga0163161_10331170 3300017792 Bacteria 1206
479 Ga0163161_10463331 3300017792 Bacteria 1026
480 Ga0163161_10504719 3300017792 Bacteria 985
481 Ga0224572_1046239 3300024225 Unclassified 815
482 Ga0228598_1001375 3300024227 Bacteria 5346
483 Ga0207697_10000143 3300025315 Bacteria 34721
484 Ga0207697_10019067 3300025315 Bacteria 2809
485 Ga0207697_10039033 3300025315 Unclassified 1948
486 Ga0207682_10184740 3300025893 Bacteria 953
487 Ga0207692_10006630 3300025898 Bacteria 4706
488 Ga0207692_10028479 3300025898 Unclassified 2643
489 Ga0207692_10045854 3300025898 Unclassified 2189
490 Ga0207692_10189142 3300025898 Bacteria 1204
491 Ga0207642_10062595 3300025899 Bacteria 1736
492 Ga0207642_10096895 3300025899 Bacteria 1471
493 Ga0207710_10098964 3300025900 Unclassified 1373
494 Ga0207710_10168468 3300025900 Unclassified 1070
495 Ga0207688_10002686 3300025901 Bacteria 9626
496 Ga0207680_10031017 3300025903 Bacteria 3024
497 Ga0207680_10547803 3300025903 Bacteria 826
498 Ga0207647_10031204 3300025904 Bacteria 3430
499 Ga0207685_10016219 3300025905 Bacteria 2380
500 Ga0207685_10043484 3300025905 Bacteria 1693
501 Ga0207685_10049662 3300025905 Bacteria 1612
502 Ga0207685_10214862 3300025905 Bacteria 911
503 Ga0207699_10004012 3300025906 Bacteria 7044
504 Ga0207699_10006533 3300025906 Bacteria 5654
505 Ga0207699_10031968 3300025906 Bacteria 2961
506 Ga0207645_10081854 3300025907 Bacteria 2069
507 Ga0207645_10266798 3300025907 Bacteria 1135
508 Ga0207643_10004131 3300025908 Bacteria 7821
509 Ga0207684_10038320 3300025910 Bacteria 4067
510 Ga0207684_10083434 3300025910 Bacteria 2721
511 Ga0207654_10210395 3300025911 Unclassified 1285
512 Ga0207707_10170658 3300025912 Bacteria 1901
513 Ga0207695_10068686 3300025913 Bacteria 3630
514 Ga0207695_10072281 3300025913 Bacteria 3520
515 Ga0207695_10153992 3300025913 Unclassified 2235
516 Ga0207671_10189948 3300025914 Bacteria 1601
517 Ga0207693_10000777 3300025915 Bacteria 28620
518 Ga0207693_10001047 3300025915 Bacteria 24726
519 Ga0207693_10002215 3300025915 Bacteria 16946
520 Ga0207693_10083296 3300025915 Bacteria 2505
521 Ga0207663_10001539 3300025916 Bacteria 10795
522 Ga0207663_10019520 3300025916 Bacteria 3821
523 Ga0207663_10023854 3300025916 Unclassified 3518
524 Ga0207663_10031948 3300025916 Bacteria 3121
525 Ga0207663_10070153 3300025916 Bacteria 2257
526 Ga0207663_10075561 3300025916 Bacteria 2187
527 Ga0207663_10209827 3300025916 Bacteria 1411
528 Ga0207663_10392933 3300025916 Bacteria 1059
529 Ga0207660_10016841 3300025917 Bacteria 4846
530 Ga0207660_10124929 3300025917 Bacteria 1953
531 Ga0207657_10337769 3300025919 Unclassified 1189
532 Ga0207649_10007720 3300025920 Bacteria 5851
533 Ga0207649_10512717 3300025920 Unclassified 913
534 Ga0207652_10004402 3300025921 Bacteria 11475
535 Ga0207652_10016347 3300025921 Bacteria 6057
536 Ga0207652_10192956 3300025921 Unclassified 1832
537 Ga0207652_10329028 3300025921 Bacteria 1380
538 Ga0207646_10001929 3300025922 Bacteria 24924
539 Ga0207646_10003702 3300025922 Bacteria 17067
540 Ga0207646_10043474 3300025922 Bacteria 4034
541 Ga0207646_10500073 3300025922 Bacteria 1095
542 Ga0207646_10589136 3300025922 Unclassified 999
543 Ga0207681_10007137 3300025923 Bacteria 6851
544 Ga0207681_10014326 3300025923 Bacteria 4925
545 Ga0207681_10042100 3300025923 Bacteria 3048
546 Ga0207681_10054804 3300025923 Bacteria 2713
547 Ga0207650_10048321 3300025925 Bacteria 3138
548 Ga0207650_10079065 3300025925 Bacteria 2490
549 Ga0207650_10106585 3300025925 Bacteria 2164
550 Ga0207650_10174640 3300025925 Bacteria 1709
551 Ga0207650_10181421 3300025925 Bacteria 1678
552 Ga0207650_10441673 3300025925 Unclassified 1082
553 Ga0207659_10004795 3300025926 Bacteria 8201
554 Ga0207659_10057577 3300025926 Bacteria 2787
555 Ga0207659_10716376 3300025926 Bacteria 857
556 Ga0207687_10022662 3300025927 Bacteria 4182
557 Ga0207687_10028103 3300025927 Bacteria 3778
558 Ga0207687_10455461 3300025927 Unclassified 1062
559 Ga0207700_10000198 3300025928 Bacteria 35892
560 Ga0207700_10005511 3300025928 Bacteria 7590
561 Ga0207700_10008571 3300025928 Bacteria 6344
562 Ga0207700_10012349 3300025928 Bacteria 5503
563 Ga0207700_10025819 3300025928 Bacteria 4087
564 Ga0207700_10136987 3300025928 Unclassified 2007
565 Ga0207664_10060517 3300025929 Bacteria 3018
566 Ga0207664_10165331 3300025929 Unclassified 1890
567 Ga0207644_10019983 3300025931 Bacteria 4549
568 Ga0207644_10155052 3300025931 Bacteria 1775
569 Ga0207644_10158149 3300025931 Bacteria 1759
570 Ga0207644_10196790 3300025931 Unclassified 1588
571 Ga0207690_10060792 3300025932 Bacteria 2566
572 Ga0207690_10061061 3300025932 Bacteria 2561
573 Ga0207706_10001040 3300025933 Bacteria 28167
574 Ga0207706_10032441 3300025933 Bacteria 4651
575 Ga0207706_10108239 3300025933 Bacteria 2446
576 Ga0207686_10015467 3300025934 Bacteria 4266
577 Ga0207686_10070869 3300025934 Bacteria 2241
578 Ga0207686_10088992 3300025934 Bacteria 2034
579 Ga0207686_10103537 3300025934 Bacteria 1905
580 Ga0207709_10102484 3300025935 Bacteria 1895
581 Ga0207709_10330029 3300025935 Bacteria 1145
582 Ga0207670_10041666 3300025936 Bacteria 3021
583 Ga0207670_10261625 3300025936 Bacteria 1341
584 Ga0207670_10301876 3300025936 Bacteria 1254
585 Ga0207670_10338749 3300025936 Unclassified 1188
586 Ga0207669_10002051 3300025937 Bacteria 8527
587 Ga0207669_10043725 3300025937 Bacteria 2626
588 Ga0207669_10051604 3300025937 Unclassified 2465
589 Ga0207669_10068597 3300025937 Bacteria 2216
590 Ga0207669_10083401 3300025937 Bacteria 2055
591 Ga0207669_10228453 3300025937 Bacteria 1371
592 Ga0207669_10457950 3300025937 Bacteria 1012
593 Ga0207669_10594096 3300025937 Archaea 899
594 Ga0207704_10002974 3300025938 Bacteria 7660
595 Ga0207704_10076603 3300025938 Bacteria 2143
596 Ga0207704_10121676 3300025938 Bacteria 1788
597 Ga0207704_10122989 3300025938 Bacteria 1780
598 Ga0207665_10011723 3300025939 Bacteria 5759
599 Ga0207665_10041165 3300025939 Bacteria 3084
600 Ga0207665_10103546 3300025939 Bacteria 1991
601 Ga0207665_10223987 3300025939 Unclassified 1379
602 Ga0207691_10001772 3300025940 Bacteria 21258
603 Ga0207691_10002031 3300025940 Bacteria 19804
604 Ga0207691_10005687 3300025940 Bacteria 12050
605 Ga0207691_10015894 3300025940 Bacteria 7151
606 Ga0207691_10219525 3300025940 Bacteria 1649
607 Ga0207691_10390815 3300025940 Unclassified 1187
608 Ga0207711_10055231 3300025941 Bacteria 3410
609 Ga0207711_10100293 3300025941 Bacteria 2561
610 Ga0207711_10106747 3300025941 Bacteria 2485
611 Ga0207689_10035057 3300025942 Bacteria 4168
612 Ga0207689_10058008 3300025942 Bacteria 3184
613 Ga0207689_10060049 3300025942 Bacteria 3127
614 Ga0207689_10067178 3300025942 Unclassified 2947
615 Ga0207661_10002181 3300025944 Bacteria 13503
616 Ga0207661_10122440 3300025944 Bacteria 2216
617 Ga0207679_10009204 3300025945 Bacteria 6315
618 Ga0207679_10078085 3300025945 Bacteria 2521
619 Ga0207679_10099555 3300025945 Bacteria 2270
620 Ga0207667_10088075 3300025949 Bacteria 3211
621 Ga0207667_10463330 3300025949 Bacteria 1287
622 Ga0207667_10522288 3300025949 Bacteria 1203
623 Ga0207651_10009512 3300025960 Bacteria 5330
624 Ga0207651_10051872 3300025960 Bacteria 2794
625 Ga0207651_10159240 3300025960 Bacteria 1768
626 Ga0207651_10540568 3300025960 Unclassified 1012
627 Ga0207651_10629556 3300025960 Bacteria 940
628 Ga0207712_10005715 3300025961 Bacteria 7839
629 Ga0207712_10018718 3300025961 Bacteria 4514
630 Ga0207712_10031016 3300025961 Bacteria 3598
631 Ga0207668_10197776 3300025972 Bacteria 1598
632 Ga0207640_10231360 3300025981 Unclassified 1422
633 Ga0207658_10207493 3300025986 Bacteria 1640
634 Ga0207658_10458895 3300025986 Bacteria 1129
635 Ga0207658_10622705 3300025986 Bacteria 971
636 Ga0207677_10018985 3300026023 Bacteria 4141
637 Ga0207677_10122991 3300026023 Bacteria 1956
638 Ga0207677_10502626 3300026023 Unclassified 1048
639 Ga0207703_10022356 3300026035 Bacteria 4960
640 Ga0207703_10206038 3300026035 Bacteria 1750
641 Ga0207639_10057652 3300026041 Bacteria 2983
642 Ga0207639_10090509 3300026041 Bacteria 2447
643 Ga0207678_10022795 3300026067 Bacteria 5483
644 Ga0207678_10116577 3300026067 Bacteria 2279
645 Ga0207678_10249368 3300026067 Bacteria 1520
646 Ga0207708_10040016 3300026075 Bacteria 3573
647 Ga0207708_10111785 3300026075 Bacteria 2121
648 Ga0207708_10470049 3300026075 Unclassified 1050
649 Ga0207702_10148735 3300026078 Bacteria 2128
650 Ga0207641_10002046 3300026088 Bacteria 19179
651 Ga0207641_10062188 3300026088 Bacteria 3185
652 Ga0207641_10142883 3300026088 Bacteria 2162
653 Ga0207641_10395844 3300026088 Unclassified 1325
654 Ga0207641_10454030 3300026088 Bacteria 1239
655 Ga0207648_10025474 3300026089 Bacteria 5268
656 Ga0207648_10079346 3300026089 Unclassified 2863
657 Ga0207648_10882872 3300026089 Bacteria 835
658 Ga0207676_10014980 3300026095 Bacteria 5587
659 Ga0207676_10141259 3300026095 Bacteria 2062
660 Ga0207676_10319130 3300026095 Bacteria 1425
661 Ga0207676_10507766 3300026095 Bacteria 1146
662 Ga0207676_10570234 3300026095 Bacteria 1084
663 Ga0207674_10000575 3300026116 Bacteria 48309
664 Ga0207674_10050804 3300026116 Bacteria 4234
665 Ga0207674_10060999 3300026116 Bacteria 3811
666 Ga0207675_100015566 3300026118 Bacteria 7094
667 Ga0207675_100050343 3300026118 Bacteria 3887
668 Ga0207675_100071374 3300026118 Bacteria 3247
669 Ga0207675_100090262 3300026118 Bacteria 2881
670 Ga0207675_100188437 3300026118 Bacteria 1978
671 Ga0207675_100324138 3300026118 Bacteria 1505
672 Ga0207683_10004709 3300026121 Bacteria 11761
673 Ga0207683_10029677 3300026121 Bacteria 4736
674 Ga0207683_10030498 3300026121 Bacteria 4672
675 Ga0207683_10180490 3300026121 Bacteria 1914
676 Ga0207683_10248801 3300026121 Bacteria 1622
677 Ga0207683_10419621 3300026121 Bacteria 1232
678 Ga0207698_10034543 3300026142 Bacteria 3687
679 Ga0207698_10039495 3300026142 Bacteria 3497
680 Ga0207698_10170029 3300026142 Bacteria 1918
681 Ga0207698_10244188 3300026142 Bacteria 1638
682 Ga0209969_1007367 3300027360 Bacteria 1554
683 Ga0209967_1004235 3300027364 Unclassified 1900
684 Ga0209981_1000710 3300027378 Bacteria 4223
685 Ga0209984_1003798 3300027424 Bacteria 1748
686 Ga0209968_1003617 3300027526 Bacteria 2319
687 Ga0209999_1000389 3300027543 Bacteria 6718
688 Ga0209999_1006859 3300027543 Bacteria 2048
689 Ga0209998_10000643 3300027717 Bacteria 9368
690 Ga0209813_10142904 3300027866 Bacteria 851
691 Ga0209974_10015654 3300027876 Bacteria 2519
692 Ga0207428_10004350 3300027907 Bacteria 13528
693 Ga0207428_10017349 3300027907 Bacteria 6180
694 Ga0207428_10018214 3300027907 Bacteria 6002
695 Ga0207428_10031150 3300027907 Bacteria 4405
696 Ga0207428_10035437 3300027907 Bacteria 4078
697 Ga0207428_10072230 3300027907 Bacteria 2709
698 Ga0265356_1000423 3300028017 Bacteria 7674
699 Ga0268266_10009803 3300028379 Bacteria 8425
700 Ga0268266_10022674 3300028379 Bacteria 5345
701 Ga0268266_10052185 3300028379 Bacteria 3511
702 Ga0268266_10095384 3300028379 Bacteria 2613
703 Ga0268266_10119392 3300028379 Bacteria 2345
704 Ga0268266_10156817 3300028379 Bacteria 2057
705 Ga0268266_10393427 3300028379 Unclassified 1309
706 Ga0268265_10002430 3300028380 Bacteria 14059
707 Ga0268265_10185104 3300028380 Unclassified 1793
708 Ga0268265_10748772 3300028380 Unclassified 948
709 Ga0268264_10047178 3300028381 Bacteria 3581
710 Ga0268264_10051938 3300028381 Bacteria 3417
711 Ga0268264_10080440 3300028381 Unclassified 2783
712 Ga0268264_10592615 3300028381 Bacteria 1092
713 Ga0265318_10002057 3300028577 Bacteria 11050
714 Ga0265338_10001605 3300028800 Bacteria 36301
715 Ga0265338_10013275 3300028800 Bacteria 9314
716 Ga0265338_10047014 3300028800 Bacteria 3947
717 Ga0265338_10059006 3300028800 Bacteria 3382
718 Ga0265338_10079282 3300028800 Bacteria 2764
719 Ga0265338_10147163 3300028800 Bacteria 1836
720 Ga0265324_10015820 3300029957 Bacteria 2769
721 Ga0265324_10053961 3300029957 Bacteria 1380
722 Ga0316182_1026306 3300030745 Bacteria 853
723 Ga0265762_1002849 3300030760 Bacteria 3091
724 Ga0265762_1033164 3300030760 Unclassified 987
725 Ga0265770_1006016 3300030878 Bacteria 1680
726 Ga0265765_1001162 3300030879 Bacteria 2359
727 Ga0265760_10001235 3300031090 Bacteria 7472
728 Ga0265760_10001341 3300031090 Bacteria 7230
729 Ga0265760_10008710 3300031090 Bacteria 2899
730 Ga0265760_10022068 3300031090 Bacteria 1843
731 Ga0265760_10026805 3300031090 Bacteria 1687
732 Ga0265330_10001378 3300031235 Bacteria 14200
733 Ga0265332_10026881 3300031238 Bacteria 2522
734 Ga0265328_10008859 3300031239 Bacteria 4127
735 Ga0265325_10001701 3300031241 Bacteria 15288
736 Ga0265325_10015579 3300031241 Bacteria 4271
737 Ga0265325_10110679 3300031241 Bacteria 1335
738 Ga0265329_10007065 3300031242 Bacteria 4379
739 Ga0265340_10004335 3300031247 Bacteria 7944
740 Ga0265340_10016207 3300031247 Bacteria 3862
741 Ga0265339_10001359 3300031249 Bacteria 18276
742 Ga0265339_10001433 3300031249 Bacteria 17692
743 Ga0265339_10015256 3300031249 Bacteria 4609
744 Ga0265339_10070221 3300031249 Bacteria 1868
745 Ga0265339_10099828 3300031249 Bacteria 1512
746 Ga0265339_10195060 3300031249 Unclassified 1002
747 Ga0265316_10000390 3300031344 Bacteria 50094
748 Ga0265316_10010760 3300031344 Bacteria 8312
749 Ga0265316_10038328 3300031344 Bacteria 3862
750 Ga0265316_10055009 3300031344 Bacteria 3115
751 Ga0307408_100048150 3300031548 Bacteria 3056
752 Ga0307408_100139689 3300031548 Bacteria 1900
753 Ga0307408_100151714 3300031548 Bacteria 1830
754 Ga0307408_100174452 3300031548 Unclassified 1719
755 Ga0307408_100183425 3300031548 Bacteria 1680
756 Ga0307408_100295799 3300031548 Bacteria 1354
757 Ga0265313_10003345 3300031595 Bacteria 13107
758 Ga0265313_10021569 3300031595 Bacteria 3520
759 Ga0265313_10056632 3300031595 Bacteria 1853
760 Ga0265313_10074225 3300031595 Unclassified 1560
761 Ga0265314_10000036 3300031711 Bacteria 234928
762 Ga0265314_10011383 3300031711 Bacteria 7350
763 Ga0265314_10022322 3300031711 Bacteria 4849
764 Ga0265314_10189069 3300031711 Bacteria 1227
765 Ga0265342_10000377 3300031712 Bacteria 49212
766 Ga0265342_10014311 3300031712 Bacteria 5271
767 Ga0265342_10099396 3300031712 Bacteria 1659
768 Ga0265342_10171033 3300031712 Bacteria 1195
769 Ga0307405_10082905 3300031731 Bacteria 2100
770 Ga0307405_10217702 3300031731 Bacteria 1399
771 Ga0307405_10286370 3300031731 Bacteria 1243
772 Ga0307413_10089673 3300031824 Bacteria 1998
773 Ga0307413_10218617 3300031824 Viruses 1390
774 Ga0307410_10059563 3300031852 Bacteria 2607
775 Ga0307410_10073363 3300031852 Bacteria 2379
776 Ga0307410_10137436 3300031852 Unclassified 1803
777 Ga0307410_10175072 3300031852 Bacteria 1620
778 Ga0307406_10012696 3300031901 Bacteria 4805
779 Ga0307406_10609316 3300031901 Bacteria 901
780 Ga0307406_10708976 3300031901 Unclassified 841
781 Ga0307407_10051735 3300031903 Bacteria 2356
782 Ga0307407_10056869 3300031903 Bacteria 2267
783 Ga0307407_10081474 3300031903 Bacteria 1959
784 Ga0307407_10120970 3300031903 Bacteria 1660
785 Ga0307407_10152042 3300031903 Bacteria 1505
786 Ga0307407_10176583 3300031903 Bacteria 1412
787 Ga0307412_10007208 3300031911 Bacteria 6311
788 Ga0307409_100050964 3300031995 Bacteria 3165
789 Ga0307409_100227697 3300031995 Bacteria 1687
790 Ga0307409_100609221 3300031995 Bacteria 1080
791 Ga0307416_100002533 3300032002 Bacteria 10516
792 Ga0307416_100217433 3300032002 Bacteria 1829
793 Ga0307416_100411547 3300032002 Bacteria 1393
794 Ga0307416_100450504 3300032002 Bacteria 1339
795 Ga0307416_100475009 3300032002 Unclassified 1309
796 Ga0307416_100920258 3300032002 Bacteria 975
797 Ga0307414_10031178 3300032004 Bacteria 3494
798 Ga0307414_10407648 3300032004 Bacteria 1182
799 Ga0307411_10023552 3300032005 Bacteria 3650
800 Ga0307411_10060712 3300032005 Bacteria 2512
801 Ga0307411_10352827 3300032005 Bacteria 1200
802 Ga0307411_10786798 3300032005 Unclassified 836
803 Ga0307415_100295942 3300032126 Bacteria 1338
804 Ga0373956_0002098 3300035119 Bacteria 8262
805 Ga0373956_0041023 3300035119 Bacteria 2054
806 Ga0373943_0209967 3300035170 Unclassified 1081
807 Ga0373955_0013885 3300035172 Bacteria 3908
808 Ga0373955_0271183 3300035172 Bacteria 1020
809 Ga0373931_0018469 3300035691 Bacteria 3470
810 Ga0373935_0058605 3300035692 Bacteria 2460
811 Ga0373927_0005068 3300035695 Bacteria 9116
812 Ga0373933_0001471 3300035724 Bacteria 13798
813 Ga0373933_0014088 3300035724 Bacteria 4440
814 Ga0373933_0084803 3300035724 Unclassified 1947
815 Ga0373933_0127262 3300035724 Bacteria 1599
816 Ga0373947_0179311 3300035725 Bacteria 1378
817 Ga0373947_0247796 3300035725 Bacteria 1177
818 Ga0373937_0001030 3300036401 Bacteria 23591
819 Ga0373937_0003079 3300036401 Bacteria 13946
820 Ga0373937_0033841 3300036401 Bacteria 4645
821 Ga0373937_0069458 3300036401 Bacteria 3248
822 Ga0373937_0173832 3300036401 Bacteria 2021
823 Ga0373937_0362514 3300036401 Unclassified 1374
824 Ga0373925_0003129 3300037068 Bacteria 12993
825 Ga0373925_0083786 3300037068 Bacteria 2429
826 Ga0373925_0247614 3300037068 Bacteria 1429
827 Ga0395905_0453062 3300037471 Bacteria 1181
828 Ga0436363_0539142 3300039450 Unclassified 943
829 Ga0451791_1176516 3300041451 Bacteria 984
830 Ga0451798_0445253 3300041458 Bacteria 930
831 Ga0450923_003291 3300042125 Bacteria 2421
832 Ga0450923_014069 3300042125 Bacteria 1480
833 Ga0450894_008837 3300042131 Bacteria 1304
834 Ga0450895_006956 3300042132 Bacteria 932
835 Ga0450896_000837 3300042133 Bacteria 3493
836 Ga0450896_009039 3300042133 Bacteria 1386
837 Ga0450906_017884 3300042145 Bacteria 1275
838 Ga0450908_003258 3300042184 Bacteria 3163
839 Ga0439434_0092754 3300042435 Unclassified 967
840 Ga0439435_0004469 3300042436 Bacteria 3015
841 Ga0439435_0014096 3300042436 Bacteria 1970
842 Ga0439440_0096651 3300042993 Bacteria 799
843 Ga0453683_0088864 3300044673 Bacteria 1936
844 Ga0453684_0040322 3300044712 Bacteria 6343
845 Ga0451576_0053807 3300045051 Bacteria 4215
846 Ga0451576_0103412 3300045051 Bacteria 2963
847 Ga0451576_0282680 3300045051 Bacteria 1735
848 Ga0466967_0028686 3300045976 Bacteria 4650
849 Ga0495592_0017164 3300046454 Bacteria 5497
850 Ga0495592_0081347 3300046454 Unclassified 2342
851 Ga0495592_0083672 3300046454 Bacteria 2304
852 Ga0495592_0161553 3300046454 Archaea 1541
853 Ga0495603_0010045 3300046455 Bacteria 5726
854 Ga0495603_0054628 3300046455 Bacteria 2367
855 Ga0495629_0033455 3300046459 Bacteria 3636
856 Ga0495629_0078901 3300046459 Bacteria 2298
857 Ga0495629_0371005 3300046459 Unclassified 975
858 Ga0495638_0258703 3300046460 Unclassified 956
859 Ga0495651_0037993 3300046462 Bacteria 3749
860 Ga0495651_0199714 3300046462 Bacteria 1400
861 Ga0495653_0099170 3300046463 Bacteria 2114
862 Ga0495653_0136064 3300046463 Bacteria 1733
863 Ga0495653_0181458 3300046463 Bacteria 1444
864 Ga0495580_0013226 3300046472 Bacteria 6309
865 Ga0495580_0028251 3300046472 Bacteria 4079
866 Ga0495580_0067093 3300046472 Bacteria 2511
867 Ga0495580_0079671 3300046472 Bacteria 2284
868 Ga0495580_0093087 3300046472 Bacteria 2098
869 Ga0495580_0102057 3300046472 Bacteria 1994
870 Ga0495580_0228324 3300046472 Bacteria 1278
871 Ga0495582_0056920 3300046473 Bacteria 2155
872 Ga0495582_0079881 3300046473 Bacteria 1816
873 Ga0495639_0052566 3300046475 Unclassified 1855
874 Ga0495639_0201324 3300046475 Bacteria 975
875 Ga0495662_0085681 3300046476 Bacteria 1534
876 Ga0495664_0050182 3300046477 Bacteria 2477
877 Ga0495664_0187083 3300046477 Bacteria 1255
878 Ga0495664_0297103 3300046477 Unclassified 975
879 Ga0495585_0035699 3300046492 Bacteria 2808
880 Ga0495594_0003320 3300046499 Bacteria 8324
881 Ga0495594_0008275 3300046499 Bacteria 5355
882 Ga0495594_0042823 3300046499 Bacteria 2480
883 Ga0495608_0027773 3300046511 Bacteria 3848
884 Ga0495608_0131840 3300046511 Unclassified 1599
885 Ga0495628_0081840 3300046516 Bacteria 2508
886 Ga0495628_0150551 3300046516 Unclassified 1773
887 Ga0495628_0212094 3300046516 Bacteria 1456
888 Ga0495628_0216009 3300046516 Bacteria 1441
889 Ga0495630_0010653 3300046517 Bacteria 6636
890 Ga0495630_0152070 3300046517 Bacteria 1761
891 Ga0495630_0280250 3300046517 Unclassified 1273
892 Ga0495631_0032023 3300046518 Bacteria 2372
893 Ga0495643_0003764 3300046522 Bacteria 10963
894 Ga0495644_0000109 3300046523 Bacteria 39201
895 Ga0495663_0094403 3300046525 Bacteria 978
896 Ga0495652_0041555 3300046529 Bacteria 3969
897 Ga0495652_0085712 3300046529 Bacteria 2588
898 Ga0495652_0151957 3300046529 Bacteria 1808
899 Ga0495652_0225891 3300046529 Unclassified 1403
900 Ga0495652_0347145 3300046529 Bacteria 1064
901 Ga0495652_0390713 3300046529 Bacteria 987
902 Ga0495665_0030788 3300046531 Bacteria 2871
903 Ga0495665_0178545 3300046531 Unclassified 1104
904 Ga0495640_0037807 3300046533 Bacteria 3401
905 Ga0495640_0253150 3300046533 Unclassified 1102
906 Ga0495586_0035800 3300046535 Bacteria 2667
907 Ga0495586_0119484 3300046535 Unclassified 1471
908 Ga0495586_0236429 3300046535 Unclassified 1041
909 Ga0495587_0025928 3300046536 Bacteria 3578
910 Ga0495587_0029174 3300046536 Bacteria 3351
911 Ga0495587_0123175 3300046536 Bacteria 1484
912 Ga0495587_0136670 3300046536 Bacteria 1400
913 Ga0495598_0005985 3300046537 Bacteria 2724
914 Ga0495609_0020406 3300046538 Bacteria 3062
915 Ga0495621_0014470 3300046539 Bacteria 2497
916 Ga0495645_0016503 3300046543 Bacteria 5274
917 Ga0495645_0178684 3300046543 Bacteria 1456
918 Ga0495645_0192796 3300046543 Bacteria 1387
919 Ga0495645_0208075 3300046543 Unclassified 1323
920 Ga0495645_0216281 3300046543 Bacteria 1291
921 Ga0495645_0311346 3300046543 Bacteria 1025
922 Ga0495622_0192448 3300046557 Unclassified 911
923 Ga0495667_0039839 3300046559 Bacteria 3122
924 Ga0495656_0197048 3300046615 Unclassified 998
925 Ga0495625_0031576 3300046660 Bacteria 3937
926 Ga0495635_0049008 3300046663 Bacteria 2912
927 Ga0495657_0192659 3300046675 Unclassified 1245
928 Ga0495599_0038419 3300046678 Bacteria 3008
929 Ga0495599_0079212 3300046678 Unclassified 2052
930 Ga0495623_0090094 3300046679 Bacteria 1884
931 Ga0495646_0078664 3300046680 Bacteria 1927
932 Ga0495646_0101678 3300046680 Bacteria 1647
933 Ga0495647_0019003 3300046681 Bacteria 2453
934 Ga0495658_0033654 3300046683 Bacteria 2809
935 Ga0495658_0077383 3300046683 Bacteria 1945
936 Ga0495613_0009371 3300046689 Bacteria 7264
937 Ga0495613_0047184 3300046689 Bacteria 3182
938 Ga0495624_0299484 3300046690 Unclassified 970
939 Ga0495600_0019687 3300046809 Bacteria 4313
940 Ga0495600_0279910 3300046809 Unclassified 1056
941 Ga0495581_0054528 3300047315 Bacteria 2308
942 Ga0495604_0000316 3300047317 Bacteria 43437
943 Ga0495604_0042575 3300047317 Bacteria 3558
944 Ga0495604_0342442 3300047317 Bacteria 995
945 Ga0495674_0054208 3300047319 Bacteria 3522
946 Ga0495674_0063090 3300047319 Bacteria 3224
947 Ga0495674_0083402 3300047319 Bacteria 2740
948 Ga0495674_0142328 3300047319 Bacteria 2015
949 Ga0495674_0238692 3300047319 Bacteria 1498
950 Ga0495674_0387908 3300047319 Unclassified 1129
951 Ga0495674_0388382 3300047319 Unclassified 1128
952 Ga0495672_0102811 3300047320 Bacteria 1546
953 Ga0495680_0187100 3300047322 Bacteria 1491
954 Ga0495680_0222615 3300047322 Bacteria 1346
955 Ga0495683_0087409 3300047323 Bacteria 1514
956 Ga0495684_0006774 3300047471 Bacteria 8895
957 Ga0495684_0056684 3300047471 Bacteria 2987
958 Ga0495684_0066907 3300047471 Bacteria 2732
959 Ga0495684_0181837 3300047471 Bacteria 1558
960 Ga0495684_0217385 3300047471 Bacteria 1403
961 Ga0495684_0253897 3300047471 Unclassified 1278
962 Ga0495593_0114561 3300047673 Bacteria 1375
963 Ga0495602_0010139 3300048088 Bacteria 9781
964 Ga0495602_0116057 3300048088 Unclassified 2164
965 Ga0495614_0024936 3300048089 Bacteria 2581
966 Ga0495614_0124447 3300048089 Bacteria 1139
967 Ga0496100_0046526 3300048903 Bacteria 2791
968 Ga0496100_0072079 3300048903 Bacteria 2308
969 Ga0496100_0094185 3300048903 Bacteria 2051
970 Ga0496101_0001837 3300048904 Bacteria 12801
971 Ga0496101_0148706 3300048904 Bacteria 1790
972 Ga0496101_0456376 3300048904 Bacteria 1008
973 Ga0496102_0301087 3300048905 Bacteria 1511
974 Ga0496102_0467491 3300048905 Unclassified 1182
975 Ga0496104_0003735 3300048907 Bacteria 13150
976 Ga0496104_0008309 3300048907 Bacteria 9219
977 Ga0496104_0024458 3300048907 Bacteria 5555
978 Ga0496104_0151114 3300048907 Bacteria 2229
979 Ga0496104_0170574 3300048907 Unclassified 2086
980 Ga0496104_0343306 3300048907 Bacteria 1406
981 Ga0496104_0358902 3300048907 Bacteria 1370
982 Ga0496104_0540880 3300048907 Bacteria 1076
983 Ga0496105_0057040 3300048908 Bacteria 3225
984 Ga0496105_0214782 3300048908 Bacteria 1567
985 Ga0496105_0369591 3300048908 Unclassified 1143
986 Ga0496106_0067050 3300048909 Bacteria 2735
987 Ga0496106_0098327 3300048909 Bacteria 2267
988 Ga0496106_0175523 3300048909 Bacteria 1700
989 Ga0496107_0013317 3300048910 Bacteria 5746
990 Ga0496108_0005593 3300048911 Bacteria 10171
991 Ga0496108_0007576 3300048911 Bacteria 8792
992 Ga0496109_0001076 3300048912 Bacteria 22664
993 Ga0496109_0002699 3300048912 Bacteria 14878
994 Ga0496109_0096662 3300048912 Bacteria 2737
995 Ga0496109_0218401 3300048912 Bacteria 1793
996 Ga0496110_0035447 3300048913 Bacteria 4328
997 Ga0496110_0054407 3300048913 Unclassified 3520
998 Ga0496111_0008105 3300048914 Bacteria 6938
999 Ga0496112_0014045 3300048915 Bacteria 7413
1000 Ga0496112_0042091 3300048915 Bacteria 4469
1001 Ga0496112_0161409 3300048915 Bacteria 2208
1002 Ga0496113_0001631 3300048916 Bacteria 12647
1003 Ga0496114_0004686 3300048917 Bacteria 10632
1004 Ga0496114_0086563 3300048917 Unclassified 2656
1005 Ga0496114_0218872 3300048917 Bacteria 1671
1006 Ga0496114_0347937 3300048917 Bacteria 1311
1007 Ga0496115_0021362 3300048918 Bacteria 5000
1008 Ga0496115_0055490 3300048918 Unclassified 3182
1009 Ga0496115_0133278 3300048918 Bacteria 2048
1010 Ga0501291_007916 3300049514 Bacteria 1454
1011 Ga0501036_0058624 3300049572 Bacteria 3262
1012 Ga0501037_0394262 3300049573 Unclassified 950
1013 Ga0501040_0191520 3300049576 Bacteria 1451
1014 Ga0501041_0031028 3300049577 Bacteria 3227
1015 Ga0501069_0027812 3300049585 Bacteria 3100
1016 Ga0501071_0012615 3300049587 Bacteria 5739
1017 Ga0501071_0049679 3300049587 Bacteria 3020
1018 Ga0501075_0011221 3300049591 Bacteria 6337
1019 Ga0501076_0076897 3300049592 Bacteria 2677
1020 Ga0501076_0478742 3300049592 Archaea 1026
1021 Ga0501077_0147882 3300049593 Bacteria 1491
1022 Ga0501077_0314520 3300049593 Archaea 998
1023 Ga0501198_017588 3300049649 Unclassified 1114
1024 Ga0501202_007714 3300049652 Viruses 1950
1025 Ga0501217_001467 3300049661 Bacteria 4431
1026 Ga0501223_002624 3300049663 Bacteria 3961
1027 Ga0501224_000395 3300049664 Bacteria 5193
1028 Ga0501227_010631 3300049665 Bacteria 1996
1029 Ga0501230_005381 3300049667 Bacteria 1809
1030 Ga0501233_005145 3300049668 Bacteria 2421
1031 Ga0501235_000489 3300049669 Bacteria 7865
1032 Ga0501242_002627 3300049674 Bacteria 1902
1033 Ga0501243_000954 3300049675 Bacteria 4053
1034 Ga0501249_005818 3300049679 Bacteria 2521
1035 Ga0501253_001128 3300049683 Bacteria 2613
1036 Ga0501257_002139 3300049686 Bacteria 4131
1037 Ga0501257_040600 3300049686 Bacteria 1142
1038 Ga0501225_0002679 3300049705 Bacteria 5465
1039 Ga0501225_0024051 3300049705 Bacteria 1678
1040 Ga0501234_001150 3300049707 Bacteria 4177
1041 Ga0501079_0046282 3300049741 Bacteria 3357
1042 Ga0501079_0177253 3300049741 Bacteria 1663
1043 Ga0501266_002342 3300049763 Bacteria 2397
1044 Ga0501268_000019 3300049765 Bacteria 13906
1045 Ga0501271_006873 3300049768 Bacteria 1137
1046 Ga0501274_004109 3300049771 Unclassified 1191
1047 Ga0501283_010898 3300049779 Bacteria 1344
1048 Ga0501045_0296795 3300049824 Unclassified 1203
1049 nmdc:mga00v17_104704_c1 3300050491 Bacteria 1789
1050 nmdc:mga00v17_137747_c1 3300050491 Bacteria 1563
1051 nmdc:mga0yw44_71820_c1 3300050492 Bacteria 2150
1052 nmdc:mga0k408_110591_c1 3300050493 Bacteria 1624
1053 nmdc:mga0k408_17100_c1 3300050493 Unclassified 1973
1054 nmdc:mga0k408_375805_c1 3300050493 Bacteria 847
1055 nmdc:mga0k408_52122_c1 3300050493 Bacteria 2371
1056 nmdc:mga06z11_231402_c1 3300050494 Bacteria 1083
1057 nmdc:mga06z11_23354_c1 3300050494 Bacteria 2904
1058 nmdc:mga06z11_261575_c1 3300050494 Unclassified 1021
1059 nmdc:mga07m45_29874_c1 3300050496 Bacteria 3017
1060 nmdc:mga05p37_1385_c1 3300050507 Bacteria 28201
1061 nmdc:mga05p37_157704_c1 3300050507 Bacteria 2773
1062 nmdc:mga05p37_210934_c1 3300050507 Unclassified 2348
1063 nmdc:mga05p37_232070_c1 3300050507 Bacteria 2223
1064 nmdc:mga05p37_53519_c1 3300050507 Bacteria 4963
1065 nmdc:mga05p37_57686_c1 3300050507 Bacteria 4149
1066 nmdc:mga05p37_610326_c1 3300050507 Unclassified 1230
1067 nmdc:mga05p37_611814_c1 3300050507 Bacteria 1228
1068 nmdc:mga05p37_64060_c1 3300050507 Bacteria 4523
1069 nmdc:mga05p37_64713_c1 3300050507 Bacteria 4499
1070 nmdc:mga05p37_77687_c1 3300050507 Bacteria 4087
1071 nmdc:mga05p37_870676_c1 3300050507 Bacteria 975
1072 nmdc:mga05p37_984476_c1 3300050507 Bacteria 898
1073 nmdc:mga05p37_9_c1 3300050507 Bacteria 151480
1074 nmdc:mga09592_283598_c1 3300050508 Bacteria 1436
1075 nmdc:mga09592_481142_c1 3300050508 Bacteria 1070
1076 nmdc:mga09592_62037_c1 3300050508 Bacteria 3162
1077 nmdc:mga0qj67_123324_c1 3300050509 Bacteria 2096
1078 nmdc:mga0qj67_12797_c1 3300050509 Bacteria 6328
1079 nmdc:mga0qj67_128340_c1 3300050509 Bacteria 2052
1080 nmdc:mga0qj67_452652_c1 3300050509 Bacteria 1034
1081 nmdc:mga0qj67_76609_c1 3300050509 Bacteria 2675
1082 nmdc:mga06r32_134158_c1 3300050510 Unclassified 2450
1083 nmdc:mga06r32_397895_c1 3300050510 Bacteria 1359
1084 nmdc:mga06r32_421883_c1 3300050510 Bacteria 1315
1085 nmdc:mga06r32_59331_c1 3300050510 Bacteria 3679
1086 nmdc:mga06r32_777784_c1 3300050510 Bacteria 919
1087 nmdc:mga06r32_786454_c1 3300050510 Bacteria 913
1088 nmdc:mga06r32_85303_c1 3300050510 Bacteria 3079
1089 nmdc:mga08y16_116416_c1 3300050511 Bacteria 2782
1090 nmdc:mga08y16_117029_c1 3300050511 Bacteria 2775
1091 nmdc:mga08y16_222407_c1 3300050511 Unclassified 1954
1092 nmdc:mga08y16_241962_c1 3300050511 Bacteria 1865
1093 nmdc:mga08y16_26376_c1 3300050511 Bacteria 6127
1094 nmdc:mga08y16_416043_c1 3300050511 Bacteria 1374
1095 nmdc:mga08y16_42484_c1 3300050511 Bacteria 4761
1096 nmdc:mga08y16_47457_c1 3300050511 Bacteria 4495
1097 nmdc:mga08y16_589981_c1 3300050511 Bacteria 1121
1098 nmdc:mga08y16_67155_c1 3300050511 Bacteria 3741
1099 nmdc:mga0n895_15479_c1 3300050512 Bacteria 6956
1100 nmdc:mga0n895_240866_c1 3300050512 Bacteria 1836
1101 nmdc:mga0n895_26976_c1 3300050512 Bacteria 5449
1102 nmdc:mga0n895_48370_c1 3300050512 Bacteria 3797
1103 nmdc:mga0n895_5297_c1 3300050512 Bacteria 10744
1104 nmdc:mga0n895_80_c1 3300050512 Bacteria 54788
1105 nmdc:mga0n895_876854_c1 3300050512 Unclassified 884
1106 nmdc:mga0rr50_35_c1 3300050513 Bacteria 91254
1107 nmdc:mga0rr50_371681_c1 3300050513 Bacteria 1205
1108 nmdc:mga0rr50_396702_c1 3300050513 Unclassified 1165
1109 nmdc:mga0rr50_4248_c1 3300050513 Bacteria 8383
1110 nmdc:mga0rr50_68137_c1 3300050513 Unclassified 2705
1111 nmdc:mga08x19_31980_c1 3300050514 Bacteria 3314
1112 nmdc:mga08x19_33934_c1 3300050514 Bacteria 3223
1113 nmdc:mga08x19_64_c2 3300050514 Bacteria 86912
1114 nmdc:mga08x19_690_c1 3300050514 Bacteria 21659
1115 nmdc:mga0a205_127322_c1 3300050515 Bacteria 2446
1116 nmdc:mga0a205_133478_c1 3300050515 Bacteria 2383
1117 nmdc:mga0a205_135534_c1 3300050515 Bacteria 2363
1118 nmdc:mga0a205_17397_c1 3300050515 Bacteria 6738
1119 nmdc:mga0a205_267463_c1 3300050515 Bacteria 1587
1120 nmdc:mga0a205_329345_c1 3300050515 Bacteria 1397
1121 nmdc:mga0a205_38775_c1 3300050515 Bacteria 4585
1122 nmdc:mga0a205_492229_c1 3300050515 Bacteria 1083
1123 Ga0495601_0165332 3300053077 Unclassified 1446
1124 Ga0500610_0154014 3300053079 Bacteria 1149
1125 Ga0495619_0168264 3300053085 Bacteria 1515
1126 Ga0495619_0488652 3300053085 Bacteria 847
1127 Ga0500646_0107132 3300053090 Bacteria 884
1128 Ga0500641_0002653 3300053096 Bacteria 6320
1129 Ga0500568_0006179 3300053139 Bacteria 6057
1130 Ga0501084_0204826 3300054114 Bacteria 1665
1131 Ga0501084_0263253 3300054114 Bacteria 1456
1132 Ga0590071_000088 3300059421 Bacteria 25182
1133 Ga0590071_001754 3300059421 Bacteria 5602
1134 Ga0590071_002832 3300059421 Bacteria 4339
1135 Ga0590071_070597 3300059421 Bacteria 860
1136 Ga0590075_000373 3300059424 Bacteria 12269
1137 Ga0590075_013540 3300059424 Bacteria 1990
1138 Ga0590077_000528 3300059426 Bacteria 10558
1139 Ga0590077_002992 3300059426 Bacteria 3540
1140 Ga0501082_0245802 3300060353 Bacteria 1557
1141 Ga0501082_1031409 3300060353 Bacteria 719
1142 Ga0070689_100436913
1143 MBSR1b_contig_8694521
1144 JGI25406J46586_10004594
1145 Ga0065704_10230603
1146 Ga0065712_10003012
1147 Ga0065712_10067827
1148 Ga0065712_10088488
1149 Ga0065715_10089309
1150 Ga0065715_10187852
1151 Ga0065715_10223470
1152 Ga0065715_10342083
1153 Ga0065707_10093908
1154 Ga0065707_10115964
1155 Ga0065707_10297546
1156 Ga0070658_10019311
1157 Ga0070658_10048484
1158 Ga0070658_10711479
1159 Ga0070676_10117171
1160 Ga0070683_100175745
1161 Ga0070683_100397046
1162 Ga0070670_100024330
1163 Ga0070670_100026632
1164 Ga0070670_100149548
1165 Ga0070670_100168545
1166 Ga0070670_100325136
1167 Ga0070677_10108876
1168 Ga0068869_100027625
1169 Ga0068869_100112833
1170 Ga0070666_10060814
1171 Ga0070680_100007823
1172 Ga0070680_100396055
1173 Ga0070682_100016079
1174 Ga0070682_100196860
1175 Ga0068868_100064218
1176 Ga0068868_100101581
1177 Ga0068868_100151438
1178 Ga0068868_100226456
1179 Ga0068868_100481958
1180 Ga0070689_100062062
1181 Ga0070689_100076859
1182 Ga0070689_100409004
1183 Ga0070691_10000314
1184 Ga0070691_10139060
1185 Ga0070661_100031365
1186 Ga0070668_100600673
1187 Ga0070668_100660054
1188 Ga0070669_100000727
1189 Ga0070669_100001162
1190 Ga0070669_100057118
1191 Ga0070669_100100205
1192 Ga0070675_100000381
1193 Ga0070675_100044978
1194 Ga0070675_100194844
1195 Ga0070675_100249057
1196 Ga0070675_100532026
1197 Ga0070671_100022701
1198 Ga0070671_100051343
1199 Ga0070671_100175466
1200 Ga0070671_100280947
1201 Ga0070674_100027520
1202 Ga0070674_100032698
1203 Ga0070674_100044535
1204 Ga0070674_100083525
1205 Ga0070674_100223752
1206 Ga0070674_100319267
1207 Ga0070674_100676614
1208 Ga0070673_100014110
1209 Ga0070688_100016092
1210 Ga0070688_100220527
1211 Ga0070659_100009356
1212 Ga0070659_100046618
1213 Ga0070659_100161894
1214 Ga0070709_10001985
1215 Ga0070709_10127207
1216 Ga0070709_10133103
1217 Ga0070709_10319980
1218 Ga0070714_100067256
1219 Ga0070714_100069188
1220 Ga0070714_100075091
1221 Ga0070714_100300709
1222 Ga0070713_100000180
1223 Ga0070713_100001143
1224 Ga0070713_100016132
1225 Ga0070713_100032958
1226 Ga0070713_100039295
1227 Ga0070713_100082524
1228 Ga0070713_100087678
1229 Ga0070710_10020002
1230 Ga0070710_10061563
1231 Ga0070710_10126371
1232 Ga0070701_10164448
1233 Ga0070701_10270448
1234 Ga0070711_100000441
1235 Ga0070711_100000766
1236 Ga0070711_100014055
1237 Ga0070711_100015453
1238 Ga0070711_100060355
1239 Ga0070711_100109236
1240 Ga0070711_100118775
1241 Ga0070711_100355555
1242 Ga0070711_100481411
1243 Ga0070705_100288519
1244 Ga0070700_100054072
1245 Ga0070700_100173514
1246 Ga0070694_100005219
1247 Ga0070694_100006820
1248 Ga0070708_100000081
1249 Ga0070708_100018220
1250 Ga0070708_100079703
1251 Ga0070663_100024099
1252 Ga0070663_100089958
1253 Ga0070663_100102817
1254 Ga0070663_100156217
1255 Ga0070678_100020086
1256 Ga0070678_100086375
1257 Ga0070678_100176553
1258 Ga0070678_100447338
1259 Ga0070662_100016492
1260 Ga0070662_100093100
1261 Ga0070662_100272021
1262 Ga0070662_100651408
1263 Ga0070681_10002730
1264 Ga0070681_10063440
1265 Ga0070681_10130184
1266 Ga0068867_100042111
1267 Ga0068867_100048895
1268 Ga0068867_100098897
1269 Ga0068867_100142008
1270 Ga0068867_100339577
1271 Ga0070685_10000943
1272 Ga0070685_10032234
1273 Ga0070706_100007119
1274 Ga0070706_100012916
1275 Ga0070706_100268267
1276 Ga0070706_100338038
1277 Ga0070707_100001950
1278 Ga0070707_100003644
1279 Ga0070707_100177898
1280 Ga0070707_100461679
1281 Ga0070707_100579024
1282 Ga0070698_100004310
1283 Ga0070698_100115650
1284 Ga0070698_100290800
1285 Ga0070698_100416343
1286 Ga0070698_100430025
1287 Ga0070699_100010867
1288 Ga0070699_100037867
1289 Ga0070699_100060876
1290 Ga0070699_100064883
1291 Ga0070699_100159681
1292 Ga0070699_100240453
1293 Ga0070699_100486601
1294 Ga0070699_100664849
1295 Ga0070699_100700912
1296 Ga0070679_100013189
1297 Ga0070679_100023599
1298 Ga0070679_100305928
1299 Ga0070679_100398568
1300 Ga0070684_100013274
1301 Ga0070684_100241251
1302 Ga0070684_100369140
1303 Ga0070684_100439350
1304 Ga0070684_100479562
1305 Ga0070697_100001931
1306 Ga0070697_100013572
1307 Ga0070697_100143416
1308 Ga0070697_100274591
1309 Ga0070672_100057939
1310 Ga0070672_100147881
1311 Ga0070672_100369218
1312 Ga0070686_100074218
1313 Ga0070686_100094646
1314 Ga0070686_100300668
1315 Ga0070686_100345106
1316 Ga0070686_100366287
1317 Ga0070695_100000829
1318 Ga0070695_100003902
1319 Ga0070695_100152238
1320 Ga0070695_100211902
1321 Ga0070696_100002254
1322 Ga0070696_100048110
1323 Ga0070693_100000200
1324 Ga0070693_100009327
1325 Ga0070693_100051779
1326 Ga0070665_100006550
1327 Ga0070665_100010091
1328 Ga0070665_100014615
1329 Ga0070665_100077027
1330 Ga0070665_100114428
1331 Ga0070704_100001732
1332 Ga0070704_100004385
1333 Ga0070704_100334734
1334 Ga0068855_100721648
1335 Ga0070664_100003507
1336 Ga0070664_100224856
1337 Ga0070664_100287836
1338 Ga0070664_100305136
1339 Ga0070664_100369119
1340 Ga0068857_100007741
1341 Ga0068857_100041896
1342 Ga0068857_100084299
1343 Ga0068854_100240233
1344 Ga0068856_100230003
1345 Ga0070702_100063187
1346 Ga0070702_100075026
1347 Ga0068852_100024949
1348 Ga0068852_100139429
1349 Ga0068852_100205857
1350 Ga0068859_100028342
1351 Ga0068859_100077070
1352 Ga0068859_100180594
1353 Ga0068859_100388543
1354 Ga0068859_100466009
1355 Ga0068859_100543900
1356 Ga0068859_100631281
1357 Ga0068864_100001175
1358 Ga0068864_100059408
1359 Ga0068864_100147229
1360 Ga0068864_100264731
1361 Ga0068864_100286781
1362 Ga0068866_10035405
1363 Ga0068866_10058280
1364 Ga0068866_10089494
1365 Ga0068861_100208762
1366 Ga0068861_100228329
1367 Ga0068861_100492057
1368 Ga0068851_10099905
1369 Ga0068851_10191177
1370 Ga0068863_100000704
1371 Ga0068863_100012167
1372 Ga0068863_100081146
1373 Ga0068863_100421734
1374 Ga0068863_100966734
1375 Ga0068858_100003039
1376 Ga0068858_100027377
1377 Ga0068858_100562186
1378 Ga0068858_100583817
1379 Ga0068858_100623729
1380 Ga0068860_100064452
1381 Ga0068860_100150761
1382 Ga0068860_100155296
1383 Ga0068860_100343566
1384 Ga0068860_100679963
1385 Ga0068862_100013068
1386 Ga0068862_100201634
1387 Ga0068862_100211572
1388 Ga0068862_100301715
1389 Ga0068862_100764520
1390 Ga0068862_100813603
1391 Ga0068862_100995715
1392 Ga0081455_10039113
1393 Ga0081455_10369777
1394 Ga0081539_10001216
1395 Ga0070717_10000390
1396 Ga0070717_10015105
1397 Ga0075365_10012336
1398 Ga0075368_10019197
1399 Ga0075368_10029364
1400 Ga0075364_10111183
1401 Ga0075432_10081893
1402 Ga0070715_10005229
1403 Ga0070715_10033098
1404 Ga0070716_100008491
1405 Ga0070716_100076673
1406 Ga0070716_100099815
1407 Ga0070716_100149312
1408 Ga0070716_100343200
1409 Ga0070712_100000424
1410 Ga0070712_100000774
1411 Ga0075367_10019708
1412 Ga0075367_10150968
1413 Ga0075367_10229048
1414 Ga0075366_10037914
1415 Ga0075366_10041787
1416 Ga0075366_10143594
1417 Ga0097621_100051496
1418 Ga0097621_100090730
1419 Ga0097621_100115283
1420 Ga0097621_100152891
1421 Ga0097621_100207508
1422 Ga0097621_100274545
1423 Ga0097621_100359368
1424 Ga0097621_100484628
1425 Ga0097621_100841627
1426 Ga0075370_10042865
1427 Ga0068871_100023117
1428 Ga0068871_100047401
1429 Ga0068871_100064046
1430 Ga0068871_100262882
1431 Ga0068871_100271419
1432 Ga0068871_100896367
1433 Ga0075428_100012869
1434 Ga0075428_100020050
1435 Ga0075428_100026426
1436 Ga0075428_100192939
1437 Ga0075428_100207079
1438 Ga0075428_100390752
1439 Ga0075428_101030199
1440 Ga0075430_100035079
1441 Ga0075430_100099702
1442 Ga0075430_100224238
1443 Ga0075430_100238233
1444 Ga0075430_100247581
1445 Ga0075430_100400093
1446 Ga0075431_100028762
1447 Ga0075431_100030652
1448 Ga0075431_100053177
1449 Ga0075431_100094974
1450 Ga0075431_100166805
1451 Ga0075431_100225150
1452 Ga0075433_10011743
1453 Ga0075433_10074249
1454 Ga0075433_10107478
1455 Ga0075433_10122773
1456 Ga0075433_10198946
1457 Ga0075433_10199807
1458 Ga0075433_10554907
1459 Ga0075434_100000098
1460 Ga0075434_100011671
1461 Ga0075434_100027710
1462 Ga0075434_100081905
1463 Ga0075434_100145485
1464 Ga0075434_100222295
1465 Ga0075434_100649152
1466 Ga0075429_100053555
1467 Ga0075429_100086373
1468 Ga0075429_100108416
1469 Ga0075429_100171615
1470 Ga0075429_100560626
1471 Ga0068865_100002032
1472 Ga0068865_100009144
1473 Ga0068865_100094661
1474 Ga0068865_100291421
1475 Ga0068865_100531964
1476 Ga0075436_100000037
1477 Ga0075436_100005387
1478 Ga0075436_100006638
1479 Ga0075436_100006643
1480 Ga0075436_100045018
1481 Ga0075436_100045696
1482 Ga0075436_100295354
1483 Ga0097620_100028342
1484 Ga0097620_100077072
1485 Ga0097620_100180599
1486 Ga0097620_100388540
1487 Ga0097620_100466114
1488 Ga0097620_100543864
1489 Ga0097620_100631254
1490 Ga0075435_100000020
1491 Ga0075435_100004674
1492 Ga0075435_100009374
1493 Ga0075435_100080339
1494 Ga0075435_100165792
1495 Ga0075435_100586085
1496 Ga0105240_10024898
1497 Ga0105240_10057307
1498 Ga0105240_10123688
1499 Ga0111539_10002591
1500 Ga0111539_10002914
1501 Ga0111539_10003917
1502 Ga0111539_10035761
1503 Ga0111539_10041050
1504 Ga0111539_10070775
1505 Ga0111539_10097410
1506 Ga0111539_10270335
1507 Ga0111539_10534548
1508 Ga0111539_10729611
1509 Ga0111539_10876032
1510 Ga0111539_10911847
1511 Ga0105245_10038798
1512 Ga0105245_10231365
1513 Ga0105245_10265833
1514 Ga0105247_10038134
1515 Ga0105247_10038653
1516 Ga0105247_10137752
1517 Ga0114129_10000174
1518 Ga0114129_10000192
1519 Ga0114129_10000275
1520 Ga0114129_10005113
1521 Ga0114129_10008970
1522 Ga0114129_10022135
1523 Ga0114129_10048805
1524 Ga0114129_10061464
1525 Ga0114129_10099321
1526 Ga0114129_10153629
1527 Ga0114129_10165848
1528 Ga0114129_10253945
1529 Ga0114129_10579457
1530 Ga0114129_10588951
1531 Ga0114129_10766159
1532 Ga0114129_11135104
1533 Ga0105243_10033909
1534 Ga0105243_10123793
1535 Ga0105243_10405874
1536 Ga0105243_10535370
1537 Ga0105241_10087351
1538 Ga0105242_10026761
1539 Ga0105242_10068681
1540 Ga0105248_10002305
1541 Ga0105248_10008586
1542 Ga0105248_10026590
1543 Ga0105248_10048444
1544 Ga0105248_10131427
1545 Ga0105248_10185846
1546 Ga0105248_10233198
1547 Ga0105248_10306691
1548 Ga0105248_10582472
1549 Ga0105248_11135072
1550 Ga0105237_10031580
1551 Ga0105237_10279603
1552 Ga0105237_10366173
1553 Ga0105238_10063520
1554 Ga0105238_10099977
1555 Ga0105238_10178492
1556 Ga0105249_10000517
1557 Ga0105249_10006590
1558 Ga0105249_10055970
1559 Ga0105249_10154988
1560 Ga0105249_10649785
1561 Ga0105249_10831416
1562 Ga0105239_10394456
1563 Ga0105239_10625030
1564 Ga0105246_10206590
1565 Ga0157373_10137237
1566 Ga0157370_10603578
1567 Ga0157369_10104725
1568 Ga0157369_10331994
1569 Ga0157374_10137113
1570 Ga0157378_10001096
1571 Ga0157378_10033718
1572 Ga0157378_10046860
1573 Ga0157378_10105791
1574 Ga0157378_10198639
1575 Ga0157378_10261550
1576 Ga0157378_10279585
1577 Ga0163162_10000370
1578 Ga0163162_10129753
1579 Ga0163162_10169437
1580 Ga0163162_10216115
1581 Ga0157372_10030751
1582 Ga0157372_10036897
1583 Ga0157372_10070222
1584 Ga0157372_10691920
1585 Ga0157372_10821614
1586 Ga0157375_10063743
1587 Ga0157375_10691508
1588 Ga0157375_11018630
1589 Ga0163163_10010921
1590 Ga0163163_10115060
1591 Ga0163163_10123563
1592 Ga0163163_10256300
1593 Ga0163163_10305448
1594 Ga0157380_10048552
1595 Ga0157380_10060343
1596 Ga0157380_10071651
1597 Ga0157380_10086528
1598 Ga0157380_10090930
1599 Ga0157380_10128178
1600 Ga0157380_10666729
1601 Ga0157377_10025904
1602 Ga0157377_10067967
1603 Ga0157377_10165134
1604 Ga0157377_10354231
1605 Ga0157379_10025716
1606 Ga0157379_10053135
1607 Ga0157379_10177184
1608 Ga0157379_10186808
1609 Ga0157379_10299618
1610 Ga0157379_10668075
1611 Ga0157379_10696431
1612 Ga0157376_10003558
1613 Ga0157376_10009627
1614 Ga0157376_10027273
1615 Ga0157376_10141167
1616 Ga0157376_10545064
1617 Ga0157376_10587519
1618 Ga0157376_10653701
1619 Ga0163161_10331170
1620 Ga0163161_10463331
1621 Ga0163161_10504719
1622 Ga0224572_1046239
1623 Ga0228598_1001375
1624 Ga0207697_10000143
1625 Ga0207697_10019067
1626 Ga0207697_10039033
1627 Ga0207682_10184740
1628 Ga0207692_10006630
1629 Ga0207692_10028479
1630 Ga0207692_10045854
1631 Ga0207692_10189142
1632 Ga0207642_10062595
1633 Ga0207642_10096895
1634 Ga0207710_10098964
1635 Ga0207710_10168468
1636 Ga0207688_10002686
1637 Ga0207680_10031017
1638 Ga0207680_10547803
1639 Ga0207647_10031204
1640 Ga0207685_10016219
1641 Ga0207685_10043484
1642 Ga0207685_10049662
1643 Ga0207685_10214862
1644 Ga0207699_10004012
1645 Ga0207699_10006533
1646 Ga0207699_10031968
1647 Ga0207645_10081854
1648 Ga0207645_10266798
1649 Ga0207643_10004131
1650 Ga0207684_10038320
1651 Ga0207684_10083434
1652 Ga0207654_10210395
1653 Ga0207707_10170658
1654 Ga0207695_10068686
1655 Ga0207695_10072281
1656 Ga0207695_10153992
1657 Ga0207671_10189948
1658 Ga0207693_10000777
1659 Ga0207693_10001047
1660 Ga0207693_10002215
1661 Ga0207693_10083296
1662 Ga0207663_10001539
1663 Ga0207663_10019520
1664 Ga0207663_10023854
1665 Ga0207663_10031948
1666 Ga0207663_10070153
1667 Ga0207663_10075561
1668 Ga0207663_10209827
1669 Ga0207663_10392933
1670 Ga0207660_10016841
1671 Ga0207660_10124929
1672 Ga0207657_10337769
1673 Ga0207649_10007720
1674 Ga0207649_10512717
1675 Ga0207652_10004402
1676 Ga0207652_10016347
1677 Ga0207652_10192956
1678 Ga0207652_10329028
1679 Ga0207646_10001929
1680 Ga0207646_10003702
1681 Ga0207646_10043474
1682 Ga0207646_10500073
1683 Ga0207646_10589136
1684 Ga0207681_10007137
1685 Ga0207681_10014326
1686 Ga0207681_10042100
1687 Ga0207681_10054804
1688 Ga0207650_10048321
1689 Ga0207650_10079065
1690 Ga0207650_10106585
1691 Ga0207650_10174640
1692 Ga0207650_10181421
1693 Ga0207650_10441673
1694 Ga0207659_10004795
1695 Ga0207659_10057577
1696 Ga0207659_10716376
1697 Ga0207687_10022662
1698 Ga0207687_10028103
1699 Ga0207687_10455461
1700 Ga0207700_10000198
1701 Ga0207700_10005511
1702 Ga0207700_10008571
1703 Ga0207700_10012349
1704 Ga0207700_10025819
1705 Ga0207700_10136987
1706 Ga0207664_10060517
1707 Ga0207664_10165331
1708 Ga0207644_10019983
1709 Ga0207644_10155052
1710 Ga0207644_10158149
1711 Ga0207644_10196790
1712 Ga0207690_10060792
1713 Ga0207690_10061061
1714 Ga0207706_10001040
1715 Ga0207706_10032441
1716 Ga0207706_10108239
1717 Ga0207686_10015467
1718 Ga0207686_10070869
1719 Ga0207686_10088992
1720 Ga0207686_10103537
1721 Ga0207709_10102484
1722 Ga0207709_10330029
1723 Ga0207670_10041666
1724 Ga0207670_10261625
1725 Ga0207670_10301876
1726 Ga0207670_10338749
1727 Ga0207669_10002051
1728 Ga0207669_10043725
1729 Ga0207669_10051604
1730 Ga0207669_10068597
1731 Ga0207669_10083401
1732 Ga0207669_10228453
1733 Ga0207669_10457950
1734 Ga0207669_10594096
1735 Ga0207704_10002974
1736 Ga0207704_10076603
1737 Ga0207704_10121676
1738 Ga0207704_10122989
1739 Ga0207665_10011723
1740 Ga0207665_10041165
1741 Ga0207665_10103546
1742 Ga0207665_10223987
1743 Ga0207691_10001772
1744 Ga0207691_10002031
1745 Ga0207691_10005687
1746 Ga0207691_10015894
1747 Ga0207691_10219525
1748 Ga0207691_10390815
1749 Ga0207711_10055231
1750 Ga0207711_10100293
1751 Ga0207711_10106747
1752 Ga0207689_10035057
1753 Ga0207689_10058008
1754 Ga0207689_10060049
1755 Ga0207689_10067178
1756 Ga0207661_10002181
1757 Ga0207661_10122440
1758 Ga0207679_10009204
1759 Ga0207679_10078085
1760 Ga0207679_10099555
1761 Ga0207667_10088075
1762 Ga0207667_10463330
1763 Ga0207667_10522288
1764 Ga0207651_10009512
1765 Ga0207651_10051872
1766 Ga0207651_10159240
1767 Ga0207651_10540568
1768 Ga0207651_10629556
1769 Ga0207712_10005715
1770 Ga0207712_10018718
1771 Ga0207712_10031016
1772 Ga0207668_10197776
1773 Ga0207640_10231360
1774 Ga0207658_10207493
1775 Ga0207658_10458895
1776 Ga0207658_10622705
1777 Ga0207677_10018985
1778 Ga0207677_10122991
1779 Ga0207677_10502626
1780 Ga0207703_10022356
1781 Ga0207703_10206038
1782 Ga0207639_10057652
1783 Ga0207639_10090509
1784 Ga0207678_10022795
1785 Ga0207678_10116577
1786 Ga0207678_10249368
1787 Ga0207708_10040016
1788 Ga0207708_10111785
1789 Ga0207708_10470049
1790 Ga0207702_10148735
1791 Ga0207641_10002046
1792 Ga0207641_10062188
1793 Ga0207641_10142883
1794 Ga0207641_10395844
1795 Ga0207641_10454030
1796 Ga0207648_10025474
1797 Ga0207648_10079346
1798 Ga0207648_10882872
1799 Ga0207676_10014980
1800 Ga0207676_10141259
1801 Ga0207676_10319130
1802 Ga0207676_10507766
1803 Ga0207676_10570234
1804 Ga0207674_10000575
1805 Ga0207674_10050804
1806 Ga0207674_10060999
1807 Ga0207675_100015566
1808 Ga0207675_100050343
1809 Ga0207675_100071374
1810 Ga0207675_100090262
1811 Ga0207675_100188437
1812 Ga0207675_100324138
1813 Ga0207683_10004709
1814 Ga0207683_10029677
1815 Ga0207683_10030498
1816 Ga0207683_10180490
1817 Ga0207683_10248801
1818 Ga0207683_10419621
1819 Ga0207698_10034543
1820 Ga0207698_10039495
1821 Ga0207698_10170029
1822 Ga0207698_10244188
1823 Ga0209969_1007367
1824 Ga0209967_1004235
1825 Ga0209981_1000710
1826 Ga0209984_1003798
1827 Ga0209968_1003617
1828 Ga0209999_1000389
1829 Ga0209999_1006859
1830 Ga0209998_10000643
1831 Ga0209813_10142904
1832 Ga0209974_10015654
1833 Ga0207428_10004350
1834 Ga0207428_10017349
1835 Ga0207428_10018214
1836 Ga0207428_10031150
1837 Ga0207428_10035437
1838 Ga0207428_10072230
1839 Ga0265356_1000423
1840 Ga0268266_10009803
1841 Ga0268266_10022674
1842 Ga0268266_10052185
1843 Ga0268266_10095384
1844 Ga0268266_10119392
1845 Ga0268266_10156817
1846 Ga0268266_10393427
1847 Ga0268265_10002430
1848 Ga0268265_10185104
1849 Ga0268265_10748772
1850 Ga0268264_10047178
1851 Ga0268264_10051938
1852 Ga0268264_10080440
1853 Ga0268264_10592615
1854 Ga0265318_10002057
1855 Ga0265338_10001605
1856 Ga0265338_10013275
1857 Ga0265338_10047014
1858 Ga0265338_10059006
1859 Ga0265338_10079282
1860 Ga0265338_10147163
1861 Ga0265324_10015820
1862 Ga0265324_10053961
1863 Ga0316182_1026306
1864 Ga0265762_1002849
1865 Ga0265762_1033164
1866 Ga0265770_1006016
1867 Ga0265765_1001162
1868 Ga0265760_10001235
1869 Ga0265760_10001341
1870 Ga0265760_10008710
1871 Ga0265760_10022068
1872 Ga0265760_10026805
1873 Ga0265330_10001378
1874 Ga0265332_10026881
1875 Ga0265328_10008859
1876 Ga0265325_10001701
1877 Ga0265325_10015579
1878 Ga0265325_10110679
1879 Ga0265329_10007065
1880 Ga0265340_10004335
1881 Ga0265340_10016207
1882 Ga0265339_10001359
1883 Ga0265339_10001433
1884 Ga0265339_10015256
1885 Ga0265339_10070221
1886 Ga0265339_10099828
1887 Ga0265339_10195060
1888 Ga0265316_10000390
1889 Ga0265316_10010760
1890 Ga0265316_10038328
1891 Ga0265316_10055009
1892 Ga0307408_100048150
1893 Ga0307408_100139689
1894 Ga0307408_100151714
1895 Ga0307408_100174452
1896 Ga0307408_100183425
1897 Ga0307408_100295799
1898 Ga0265313_10003345
1899 Ga0265313_10021569
1900 Ga0265313_10056632
1901 Ga0265313_10074225
1902 Ga0265314_10000036
1903 Ga0265314_10011383
1904 Ga0265314_10022322
1905 Ga0265314_10189069
1906 Ga0265342_10000377
1907 Ga0265342_10014311
1908 Ga0265342_10099396
1909 Ga0265342_10171033
1910 Ga0307405_10082905
1911 Ga0307405_10217702
1912 Ga0307405_10286370
1913 Ga0307413_10089673
1914 Ga0307413_10218617
1915 Ga0307410_10059563
1916 Ga0307410_10073363
1917 Ga0307410_10137436
1918 Ga0307410_10175072
1919 Ga0307406_10012696
1920 Ga0307406_10609316
1921 Ga0307406_10708976
1922 Ga0307407_10051735
1923 Ga0307407_10056869
1924 Ga0307407_10081474
1925 Ga0307407_10120970
1926 Ga0307407_10152042
1927 Ga0307407_10176583
1928 Ga0307412_10007208
1929 Ga0307409_100050964
1930 Ga0307409_100227697
1931 Ga0307409_100609221
1932 Ga0307416_100002533
1933 Ga0307416_100217433
1934 Ga0307416_100411547
1935 Ga0307416_100450504
1936 Ga0307416_100475009
1937 Ga0307416_100920258
1938 Ga0307414_10031178
1939 Ga0307414_10407648
1940 Ga0307411_10023552
1941 Ga0307411_10060712
1942 Ga0307411_10352827
1943 Ga0307411_10786798
1944 Ga0307415_100295942
1945 Ga0373956_0002098
1946 Ga0373956_0041023
1947 Ga0373943_0209967
1948 Ga0373955_0013885
1949 Ga0373955_0271183
1950 Ga0373931_0018469
1951 Ga0373935_0058605
1952 Ga0373927_0005068
1953 Ga0373933_0001471
1954 Ga0373933_0014088
1955 Ga0373933_0084803
1956 Ga0373933_0127262
1957 Ga0373947_0179311
1958 Ga0373947_0247796
1959 Ga0373937_0001030
1960 Ga0373937_0003079
1961 Ga0373937_0033841
1962 Ga0373937_0069458
1963 Ga0373937_0173832
1964 Ga0373937_0362514
1965 Ga0373925_0003129
1966 Ga0373925_0083786
1967 Ga0373925_0247614
1968 Ga0395905_0453062
1969 Ga0436363_0539142
1970 Ga0451791_1176516
1971 Ga0451798_0445253
1972 Ga0450923_003291
1973 Ga0450923_014069
1974 Ga0450894_008837
1975 Ga0450895_006956
1976 Ga0450896_000837
1977 Ga0450896_009039
1978 Ga0450906_017884
1979 Ga0450908_003258
1980 Ga0439434_0092754
1981 Ga0439435_0004469
1982 Ga0439435_0014096
1983 Ga0439440_0096651
1984 Ga0453683_0088864
1985 Ga0453684_0040322
1986 Ga0451576_0053807
1987 Ga0451576_0103412
1988 Ga0451576_0282680
1989 Ga0466967_0028686
1990 Ga0495592_0017164
1991 Ga0495592_0081347
1992 Ga0495592_0083672
1993 Ga0495592_0161553
1994 Ga0495603_0010045
1995 Ga0495603_0054628
1996 Ga0495629_0033455
1997 Ga0495629_0078901
1998 Ga0495629_0371005
1999 Ga0495638_0258703
2000 Ga0495651_0037993
2001 Ga0495651_0199714
2002 Ga0495653_0099170
2003 Ga0495653_0136064
2004 Ga0495653_0181458
2005 Ga0495580_0013226
2006 Ga0495580_0028251
2007 Ga0495580_0067093
2008 Ga0495580_0079671
2009 Ga0495580_0093087
2010 Ga0495580_0102057
2011 Ga0495580_0228324
2012 Ga0495582_0056920
2013 Ga0495582_0079881
2014 Ga0495639_0052566
2015 Ga0495639_0201324
2016 Ga0495662_0085681
2017 Ga0495664_0050182
2018 Ga0495664_0187083
2019 Ga0495664_0297103
2020 Ga0495585_0035699
2021 Ga0495594_0003320
2022 Ga0495594_0008275
2023 Ga0495594_0042823
2024 Ga0495608_0027773
2025 Ga0495608_0131840
2026 Ga0495628_0081840
2027 Ga0495628_0150551
2028 Ga0495628_0212094
2029 Ga0495628_0216009
2030 Ga0495630_0010653
2031 Ga0495630_0152070
2032 Ga0495630_0280250
2033 Ga0495631_0032023
2034 Ga0495643_0003764
2035 Ga0495644_0000109
2036 Ga0495663_0094403
2037 Ga0495652_0041555
2038 Ga0495652_0085712
2039 Ga0495652_0151957
2040 Ga0495652_0225891
2041 Ga0495652_0347145
2042 Ga0495652_0390713
2043 Ga0495665_0030788
2044 Ga0495665_0178545
2045 Ga0495640_0037807
2046 Ga0495640_0253150
2047 Ga0495586_0035800
2048 Ga0495586_0119484
2049 Ga0495586_0236429
2050 Ga0495587_0025928
2051 Ga0495587_0029174
2052 Ga0495587_0123175
2053 Ga0495587_0136670
2054 Ga0495598_0005985
2055 Ga0495609_0020406
2056 Ga0495621_0014470
2057 Ga0495645_0016503
2058 Ga0495645_0178684
2059 Ga0495645_0192796
2060 Ga0495645_0208075
2061 Ga0495645_0216281
2062 Ga0495645_0311346
2063 Ga0495622_0192448
2064 Ga0495667_0039839
2065 Ga0495656_0197048
2066 Ga0495625_0031576
2067 Ga0495635_0049008
2068 Ga0495657_0192659
2069 Ga0495599_0038419
2070 Ga0495599_0079212
2071 Ga0495623_0090094
2072 Ga0495646_0078664
2073 Ga0495646_0101678
2074 Ga0495647_0019003
2075 Ga0495658_0033654
2076 Ga0495658_0077383
2077 Ga0495613_0009371
2078 Ga0495613_0047184
2079 Ga0495624_0299484
2080 Ga0495600_0019687
2081 Ga0495600_0279910
2082 Ga0495581_0054528
2083 Ga0495604_0000316
2084 Ga0495604_0042575
2085 Ga0495604_0342442
2086 Ga0495674_0054208
2087 Ga0495674_0063090
2088 Ga0495674_0083402
2089 Ga0495674_0142328
2090 Ga0495674_0238692
2091 Ga0495674_0387908
2092 Ga0495674_0388382
2093 Ga0495672_0102811
2094 Ga0495680_0187100
2095 Ga0495680_0222615
2096 Ga0495683_0087409
2097 Ga0495684_0006774
2098 Ga0495684_0056684
2099 Ga0495684_0066907
2100 Ga0495684_0181837
2101 Ga0495684_0217385
2102 Ga0495684_0253897
2103 Ga0495593_0114561
2104 Ga0495602_0010139
2105 Ga0495602_0116057
2106 Ga0495614_0024936
2107 Ga0495614_0124447
2108 Ga0496100_0046526
2109 Ga0496100_0072079
2110 Ga0496100_0094185
2111 Ga0496101_0001837
2112 Ga0496101_0148706
2113 Ga0496101_0456376
2114 Ga0496102_0301087
2115 Ga0496102_0467491
2116 Ga0496104_0003735
2117 Ga0496104_0008309
2118 Ga0496104_0024458
2119 Ga0496104_0151114
2120 Ga0496104_0170574
2121 Ga0496104_0343306
2122 Ga0496104_0358902
2123 Ga0496104_0540880
2124 Ga0496105_0057040
2125 Ga0496105_0214782
2126 Ga0496105_0369591
2127 Ga0496106_0067050
2128 Ga0496106_0098327
2129 Ga0496106_0175523
2130 Ga0496107_0013317
2131 Ga0496108_0005593
2132 Ga0496108_0007576
2133 Ga0496109_0001076
2134 Ga0496109_0002699
2135 Ga0496109_0096662
2136 Ga0496109_0218401
2137 Ga0496110_0035447
2138 Ga0496110_0054407
2139 Ga0496111_0008105
2140 Ga0496112_0014045
2141 Ga0496112_0042091
2142 Ga0496112_0161409
2143 Ga0496113_0001631
2144 Ga0496114_0004686
2145 Ga0496114_0086563
2146 Ga0496114_0218872
2147 Ga0496114_0347937
2148 Ga0496115_0021362
2149 Ga0496115_0055490
2150 Ga0496115_0133278
2151 Ga0501291_007916
2152 Ga0501036_0058624
2153 Ga0501037_0394262
2154 Ga0501040_0191520
2155 Ga0501041_0031028
2156 Ga0501069_0027812
2157 Ga0501071_0012615
2158 Ga0501071_0049679
2159 Ga0501075_0011221
2160 Ga0501076_0076897
2161 Ga0501076_0478742
2162 Ga0501077_0147882
2163 Ga0501077_0314520
2164 Ga0501198_017588
2165 Ga0501202_007714
2166 Ga0501217_001467
2167 Ga0501223_002624
2168 Ga0501224_000395
2169 Ga0501227_010631
2170 Ga0501230_005381
2171 Ga0501233_005145
2172 Ga0501235_000489
2173 Ga0501242_002627
2174 Ga0501243_000954
2175 Ga0501249_005818
2176 Ga0501253_001128
2177 Ga0501257_002139
2178 Ga0501257_040600
2179 Ga0501225_0002679
2180 Ga0501225_0024051
2181 Ga0501234_001150
2182 Ga0501079_0046282
2183 Ga0501079_0177253
2184 Ga0501266_002342
2185 Ga0501268_000019
2186 Ga0501271_006873
2187 Ga0501274_004109
2188 Ga0501283_010898
2189 Ga0501045_0296795
2190 nmdc:mga00v17_104704_c1
2191 nmdc:mga00v17_137747_c1
2192 nmdc:mga0yw44_71820_c1
2193 nmdc:mga0k408_110591_c1
2194 nmdc:mga0k408_17100_c1
2195 nmdc:mga0k408_375805_c1
2196 nmdc:mga0k408_52122_c1
2197 nmdc:mga06z11_231402_c1
2198 nmdc:mga06z11_23354_c1
2199 nmdc:mga06z11_261575_c1
2200 nmdc:mga07m45_29874_c1
2201 nmdc:mga05p37_1385_c1
2202 nmdc:mga05p37_157704_c1
2203 nmdc:mga05p37_210934_c1
2204 nmdc:mga05p37_232070_c1
2205 nmdc:mga05p37_53519_c1
2206 nmdc:mga05p37_57686_c1
2207 nmdc:mga05p37_610326_c1
2208 nmdc:mga05p37_611814_c1
2209 nmdc:mga05p37_64060_c1
2210 nmdc:mga05p37_64713_c1
2211 nmdc:mga05p37_77687_c1
2212 nmdc:mga05p37_870676_c1
2213 nmdc:mga05p37_984476_c1
2214 nmdc:mga05p37_9_c1
2215 nmdc:mga09592_283598_c1
2216 nmdc:mga09592_481142_c1
2217 nmdc:mga09592_62037_c1
2218 nmdc:mga0qj67_123324_c1
2219 nmdc:mga0qj67_12797_c1
2220 nmdc:mga0qj67_128340_c1
2221 nmdc:mga0qj67_452652_c1
2222 nmdc:mga0qj67_76609_c1
2223 nmdc:mga06r32_134158_c1
2224 nmdc:mga06r32_397895_c1
2225 nmdc:mga06r32_421883_c1
2226 nmdc:mga06r32_59331_c1
2227 nmdc:mga06r32_777784_c1
2228 nmdc:mga06r32_786454_c1
2229 nmdc:mga06r32_85303_c1
2230 nmdc:mga08y16_116416_c1
2231 nmdc:mga08y16_117029_c1
2232 nmdc:mga08y16_222407_c1
2233 nmdc:mga08y16_241962_c1
2234 nmdc:mga08y16_26376_c1
2235 nmdc:mga08y16_416043_c1
2236 nmdc:mga08y16_42484_c1
2237 nmdc:mga08y16_47457_c1
2238 nmdc:mga08y16_589981_c1
2239 nmdc:mga08y16_67155_c1
2240 nmdc:mga0n895_15479_c1
2241 nmdc:mga0n895_240866_c1
2242 nmdc:mga0n895_26976_c1
2243 nmdc:mga0n895_48370_c1
2244 nmdc:mga0n895_5297_c1
2245 nmdc:mga0n895_80_c1
2246 nmdc:mga0n895_876854_c1
2247 nmdc:mga0rr50_35_c1
2248 nmdc:mga0rr50_371681_c1
2249 nmdc:mga0rr50_396702_c1
2250 nmdc:mga0rr50_4248_c1
2251 nmdc:mga0rr50_68137_c1
2252 nmdc:mga08x19_31980_c1
2253 nmdc:mga08x19_33934_c1
2254 nmdc:mga08x19_64_c2
2255 nmdc:mga08x19_690_c1
2256 nmdc:mga0a205_127322_c1
2257 nmdc:mga0a205_133478_c1
2258 nmdc:mga0a205_135534_c1
2259 nmdc:mga0a205_17397_c1
2260 nmdc:mga0a205_267463_c1
2261 nmdc:mga0a205_329345_c1
2262 nmdc:mga0a205_38775_c1
2263 nmdc:mga0a205_492229_c1
2264 Ga0495601_0165332
2265 Ga0500610_0154014
2266 Ga0495619_0168264
2267 Ga0495619_0488652
2268 Ga0500646_0107132
2269 Ga0500641_0002653
2270 Ga0500568_0006179
2271 Ga0501084_0204826
2272 Ga0501084_0263253
2273 Ga0590071_000088
2274 Ga0590071_001754
2275 Ga0590071_002832
2276 Ga0590071_070597
2277 Ga0590075_000373
2278 Ga0590075_013540
2279 Ga0590077_000528
2280 Ga0590077_002992
2281 Ga0501082_0245802
2282 Ga0501082_1031409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

95

284

0.89

PF01061

ABC2_membrane

ABC-2 type transporter

43

256

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tc0-assembly1.cif.gz_A the structure of human abca1 in digitonin 0.8108 52 242
7tby-assembly1.cif.gz_A the structure of human abca1 in nanodisc 0.8089 52 242
7roq-assembly1.cif.gz_A alternative structure of human abca1 0.7816 54 242
7tdt-assembly1.cif.gz_A cryo-em structure of nanodisc-embedded human abca1 0.7783 54 240
7r89-assembly1.cif.gz_B the structure of human abcg5/abcg8 purified from yeast 0.7607 2 246
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8734 52 242 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8475 52 243 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8346 52 237 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6904 52 242 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6611 52 243 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2V7H8Q5-F1-model_v4 ABC transporter permease 0.9419 57 246 GO:0043190
GO:0140359
AF-A0A2V7T045-F1-model_v4 Transport permease protein 0.9342 1 246 GO:0043190
GO:0140359
AF-A0A2V7T045-F1-model_v4 Transport permease protein 0.9305 1 246 GO:0043190
GO:0140359
AF-A0A2V7H8Q5-F1-model_v4 ABC transporter permease 0.9278 57 246 GO:0043190
GO:0140359
AF-A0A5N9C183-F1-model_v4 Transport permease protein 0.9257 54 246 GO:0043190
GO:0140359

Map