F490685
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1139 | 691 | 876 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0034937|Ga0496122_0034937_237_920 |
| Length | 227 |
| Sequence | MKYINKGKWNELHASRKGDLHMYSLNPEELSAKDNYKLMSGSIVPRPIAFVTTLSDHDGVINAAPFSFFNVVSSDPPLLSISVGRKNGVMKDTARNVLAHQELVVHICDESIIEEVNETAALLLPHESELERTRLTTVPSSMVSVPGVQEALIRMECKLYQHIPISNDAGIPVSDLLLVRIVQYHFSKQVYRADKGYILMDELKPVSRLAGNDYAKLGDRFTVIRPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 19 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 20 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 21 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 22 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 23 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 26 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 27 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 28 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 29 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 30 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 31 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 32 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 33 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 34 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 35 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 36 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 37 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 38 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 39 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 40 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 41 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 42 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 43 | 2791355199 | |||
| 44 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 45 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 46 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 47 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 48 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 49 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 50 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 51 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 52 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 53 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 54 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 55 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 56 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 57 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 58 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 59 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 60 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 61 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 62 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 63 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 64 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 65 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 66 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 67 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 68 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 69 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 70 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 71 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 72 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 73 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 74 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 75 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 76 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 77 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 78 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 79 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 80 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 81 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 82 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 83 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 84 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 85 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 86 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 87 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 88 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 89 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 90 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 91 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 92 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 93 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 94 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 95 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 96 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 97 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 98 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 99 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 100 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 101 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 102 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 103 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 104 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 105 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 106 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 107 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 108 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 109 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 110 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 111 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 112 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 113 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 114 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 115 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 116 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 117 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 118 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 119 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 120 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 121 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 122 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 123 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 124 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 125 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 126 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 127 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 128 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 129 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 130 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 131 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 132 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 133 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 134 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 135 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 136 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 137 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 138 | 2922368715 | |||
| 139 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 140 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 141 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 142 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 143 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 144 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 145 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 146 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 147 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 148 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 149 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 150 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 151 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 152 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 153 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 154 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 155 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 156 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 157 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 158 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 159 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 160 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 161 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 162 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 163 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 164 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 165 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 166 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 167 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 168 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 169 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 170 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 171 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 172 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 173 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 174 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 175 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 176 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 177 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 178 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 179 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 180 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 181 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 182 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 183 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 184 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 185 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 186 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 187 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 188 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 189 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 190 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 191 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 192 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 193 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 194 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 195 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 196 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 197 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 198 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 199 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 200 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 201 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 202 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 203 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 204 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 205 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 206 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 207 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 208 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 209 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 210 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 211 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 212 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 213 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 214 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 215 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 216 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 217 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 218 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 219 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 220 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 221 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 222 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 223 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 224 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 225 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 226 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 227 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 228 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 229 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 230 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 231 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 232 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 233 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 234 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 235 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 236 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 238 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 241 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 243 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 245 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 251 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 256 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 261 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 262 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 263 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 264 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 267 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 269 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 270 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 274 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 276 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 277 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 278 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 280 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 281 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 282 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 283 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 284 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 285 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 286 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 287 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 288 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 289 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 290 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 291 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 292 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 294 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 295 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 296 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 297 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 298 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 299 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 300 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 301 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 303 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 304 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 305 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 306 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 307 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 308 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 309 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 311 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 312 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 313 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 344 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 345 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 346 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 347 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 348 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 349 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 350 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 351 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 352 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 359 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 365 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 367 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 423 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 425 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 426 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 427 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 429 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 433 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 434 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 435 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 436 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 437 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 438 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 439 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 440 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 441 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 442 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 443 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 444 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 445 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 446 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 447 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 448 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 449 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 450 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 451 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 452 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 453 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 454 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 455 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 456 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 457 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 458 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 459 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 460 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 461 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 462 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 463 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 464 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 465 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 466 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 467 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 468 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 469 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 470 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 471 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 472 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 473 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 474 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 475 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 476 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 477 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 478 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 479 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 480 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 481 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 482 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 483 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 550 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 551 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 552 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 553 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 554 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 555 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 557 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 558 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 559 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 560 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 561 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 562 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 563 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 564 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 565 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 566 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 567 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 568 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 569 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 570 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 571 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 572 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 573 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 574 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 583 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 584 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 585 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 586 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 587 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 588 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 589 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 590 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 595 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 596 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 597 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 598 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 601 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 602 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 604 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 605 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 606 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 607 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 608 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 609 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 610 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 611 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 612 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 613 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 614 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 615 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 616 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 617 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 618 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 619 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 620 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 621 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 622 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 623 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 624 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 625 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 626 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 627 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 629 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 630 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 631 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 632 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 633 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 634 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 635 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 636 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 637 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 638 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 639 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 640 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 641 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 642 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 643 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 644 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 645 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 648 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 649 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 650 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 651 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 652 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 653 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 654 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 655 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 656 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 657 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 658 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 659 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 660 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 661 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 662 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 663 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 664 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 665 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 666 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 667 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 668 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 669 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 670 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 671 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 672 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 673 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 674 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 675 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 676 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 677 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 678 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 679 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 680 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 681 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 682 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 683 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 684 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 685 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 686 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 687 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 688 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 689 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 690 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 691 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.87 |
| Metatranscriptomes | 0.18 |
| Isolates | 22.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 16.77 |
| Nodule | 13.61 |
| Rhizoplane | 3.34 |
| Rhizosphere | 50.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005977 | 3300000546 | Bacteria | 1322 |
| 2 | JGI24751J29686_10006535 | 3300002459 | Bacteria | 2377 |
| 3 | JGI25151J46595_10000092 | 3300003187 | Bacteria | 122327 |
| 4 | JGI25151J46595_10022130 | 3300003187 | Bacteria | 2645 |
| 5 | JGI25406J46586_10008340 | 3300003203 | Bacteria | 4698 |
| 6 | JGI25165J46597_1012920 | 3300003214 | Bacteria | 1158 |
| 7 | JGI25153J46596_10001467 | 3300003215 | Bacteria | 14075 |
| 8 | rootH2_10092218 | 3300003320 | Bacteria | 2213 |
| 9 | rootH2_10141663 | 3300003320 | Bacteria | 1212 |
| 10 | rootH1_10048035 | 3300003323 | Bacteria | 2375 |
| 11 | Ga0006562J51391_1001650 | 3300003578 | Bacteria | 8110 |
| 12 | JGI25404J52841_10008233 | 3300003659 | Bacteria | 2217 |
| 13 | Ga0055535_1005445 | 3300003761 | Bacteria | 2788 |
| 14 | Ga0055541_1001604 | 3300003841 | Bacteria | 4844 |
| 15 | Ga0055541_1004867 | 3300003841 | Bacteria | 2399 |
| 16 | Ga0065165_1000721 | 3300005262 | Bacteria | 46476 |
| 17 | Ga0065165_1002559 | 3300005262 | Bacteria | 15029 |
| 18 | Ga0065165_1004090 | 3300005262 | Bacteria | 9430 |
| 19 | Ga0065165_1080195 | 3300005262 | Bacteria | 848 |
| 20 | Ga0065165_1106275 | 3300005262 | Bacteria | 696 |
| 21 | Ga0070670_100076296 | 3300005331 | Bacteria | 2880 |
| 22 | Ga0070670_100269477 | 3300005331 | Bacteria | 1485 |
| 23 | Ga0070670_100279772 | 3300005331 | Bacteria | 1457 |
| 24 | Ga0070670_100321528 | 3300005331 | Bacteria | 1356 |
| 25 | Ga0070670_100402324 | 3300005331 | Bacteria | 1209 |
| 26 | Ga0068869_100012248 | 3300005334 | Bacteria | 5660 |
| 27 | Ga0068869_100014751 | 3300005334 | Bacteria | 5226 |
| 28 | Ga0070666_10206179 | 3300005335 | Bacteria | 1384 |
| 29 | Ga0070666_10229163 | 3300005335 | Bacteria | 1312 |
| 30 | Ga0070682_100319110 | 3300005337 | Bacteria | 1147 |
| 31 | Ga0068868_100022444 | 3300005338 | Bacteria | 4762 |
| 32 | Ga0068868_100228403 | 3300005338 | Bacteria | 1560 |
| 33 | Ga0068868_100384969 | 3300005338 | Bacteria | 1207 |
| 34 | Ga0070660_100276476 | 3300005339 | Bacteria | 1373 |
| 35 | Ga0070660_100602404 | 3300005339 | Bacteria | 919 |
| 36 | Ga0070689_100371420 | 3300005340 | Bacteria | 1204 |
| 37 | Ga0070691_10228147 | 3300005341 | Bacteria | 990 |
| 38 | Ga0070691_10320120 | 3300005341 | Bacteria | 853 |
| 39 | Ga0070687_100320587 | 3300005343 | Bacteria | 990 |
| 40 | Ga0070668_100172968 | 3300005347 | Bacteria | 1759 |
| 41 | Ga0070668_100193104 | 3300005347 | Bacteria | 1668 |
| 42 | Ga0070668_100282209 | 3300005347 | Bacteria | 1387 |
| 43 | Ga0070669_100157870 | 3300005353 | Bacteria | 1760 |
| 44 | Ga0070669_100190525 | 3300005353 | Bacteria | 1608 |
| 45 | Ga0070669_100220429 | 3300005353 | Bacteria | 1499 |
| 46 | Ga0070669_100678368 | 3300005353 | Bacteria | 869 |
| 47 | Ga0070671_100034394 | 3300005355 | Bacteria | 4195 |
| 48 | Ga0070671_100962965 | 3300005355 | Bacteria | 747 |
| 49 | Ga0070674_100519460 | 3300005356 | Bacteria | 994 |
| 50 | Ga0070673_100130100 | 3300005364 | Bacteria | 2110 |
| 51 | Ga0070673_100149449 | 3300005364 | Bacteria | 1977 |
| 52 | Ga0070688_100160624 | 3300005365 | Bacteria | 1544 |
| 53 | Ga0070688_100265915 | 3300005365 | Bacteria | 1227 |
| 54 | Ga0070667_100317446 | 3300005367 | Bacteria | 1405 |
| 55 | Ga0070667_100804449 | 3300005367 | Bacteria | 873 |
| 56 | Ga0070714_100035957 | 3300005435 | Bacteria | 4152 |
| 57 | Ga0070713_100038145 | 3300005436 | Bacteria | 3890 |
| 58 | Ga0070701_10304046 | 3300005438 | Bacteria | 981 |
| 59 | Ga0070700_100521815 | 3300005441 | Bacteria | 918 |
| 60 | Ga0070700_100526974 | 3300005441 | Bacteria | 914 |
| 61 | Ga0070694_100707468 | 3300005444 | Bacteria | 820 |
| 62 | Ga0070663_100038701 | 3300005455 | Bacteria | 3328 |
| 63 | Ga0070663_100046883 | 3300005455 | Bacteria | 3060 |
| 64 | Ga0070663_100196110 | 3300005455 | Bacteria | 1574 |
| 65 | Ga0070663_100496606 | 3300005455 | Bacteria | 1013 |
| 66 | Ga0070678_100026848 | 3300005456 | Bacteria | 3900 |
| 67 | Ga0070678_100108538 | 3300005456 | Bacteria | 2167 |
| 68 | Ga0070678_100438800 | 3300005456 | Bacteria | 1141 |
| 69 | Ga0070678_100628095 | 3300005456 | Bacteria | 961 |
| 70 | Ga0070662_100260563 | 3300005457 | Bacteria | 1397 |
| 71 | Ga0070662_100287269 | 3300005457 | Bacteria | 1332 |
| 72 | Ga0068867_100034759 | 3300005459 | Bacteria | 3655 |
| 73 | Ga0068867_100589833 | 3300005459 | Bacteria | 968 |
| 74 | Ga0068867_100660086 | 3300005459 | Bacteria | 918 |
| 75 | Ga0070685_10052113 | 3300005466 | Bacteria | 2367 |
| 76 | Ga0070685_10641289 | 3300005466 | Bacteria | 769 |
| 77 | Ga0070706_100640543 | 3300005467 | Bacteria | 987 |
| 78 | Ga0070707_100605017 | 3300005468 | Bacteria | 1059 |
| 79 | Ga0070698_100420106 | 3300005471 | Bacteria | 1271 |
| 80 | Ga0070699_100170101 | 3300005518 | Bacteria | 1931 |
| 81 | Ga0068853_100476971 | 3300005539 | Bacteria | 1176 |
| 82 | Ga0068853_101068800 | 3300005539 | Bacteria | 778 |
| 83 | Ga0070672_100109865 | 3300005543 | Bacteria | 2246 |
| 84 | Ga0070672_100322472 | 3300005543 | Bacteria | 1313 |
| 85 | Ga0070686_100624003 | 3300005544 | Bacteria | 852 |
| 86 | Ga0070695_100693265 | 3300005545 | Bacteria | 808 |
| 87 | Ga0070696_100143541 | 3300005546 | Bacteria | 1747 |
| 88 | Ga0070693_100040234 | 3300005547 | Bacteria | 2623 |
| 89 | Ga0070665_100041904 | 3300005548 | Bacteria | 4602 |
| 90 | Ga0070665_100308833 | 3300005548 | Bacteria | 1585 |
| 91 | Ga0070665_100453634 | 3300005548 | Bacteria | 1292 |
| 92 | Ga0070665_101188277 | 3300005548 | Bacteria | 774 |
| 93 | Ga0068855_100540447 | 3300005563 | Bacteria | 1262 |
| 94 | Ga0070664_100266933 | 3300005564 | Bacteria | 1541 |
| 95 | Ga0068857_100022482 | 3300005577 | Bacteria | 5549 |
| 96 | Ga0068857_100342759 | 3300005577 | Bacteria | 1383 |
| 97 | Ga0068854_100289266 | 3300005578 | Bacteria | 1322 |
| 98 | Ga0068854_100314427 | 3300005578 | Bacteria | 1271 |
| 99 | Ga0068856_100022223 | 3300005614 | Bacteria | 6167 |
| 100 | Ga0068856_100160011 | 3300005614 | Bacteria | 2262 |
| 101 | Ga0070702_100175176 | 3300005615 | Bacteria | 1399 |
| 102 | Ga0068852_100278498 | 3300005616 | Bacteria | 1612 |
| 103 | Ga0068852_100509469 | 3300005616 | Bacteria | 1199 |
| 104 | Ga0068859_100073186 | 3300005617 | Bacteria | 3464 |
| 105 | Ga0068859_100125968 | 3300005617 | Bacteria | 2630 |
| 106 | Ga0068859_100151529 | 3300005617 | Bacteria | 2394 |
| 107 | Ga0068859_100351684 | 3300005617 | Bacteria | 1568 |
| 108 | Ga0068859_101463494 | 3300005617 | Bacteria | 754 |
| 109 | Ga0068864_100047670 | 3300005618 | Bacteria | 3681 |
| 110 | Ga0068864_100088380 | 3300005618 | Bacteria | 2729 |
| 111 | Ga0068864_100386862 | 3300005618 | Bacteria | 1327 |
| 112 | Ga0068864_100475491 | 3300005618 | Bacteria | 1199 |
| 113 | Ga0068861_100117358 | 3300005719 | Bacteria | 2141 |
| 114 | Ga0068861_101100548 | 3300005719 | Bacteria | 764 |
| 115 | Ga0068851_10289365 | 3300005834 | Bacteria | 939 |
| 116 | Ga0068870_10088970 | 3300005840 | Bacteria | 1723 |
| 117 | Ga0068870_10253870 | 3300005840 | Bacteria | 1091 |
| 118 | Ga0068863_100397335 | 3300005841 | Bacteria | 1348 |
| 119 | Ga0068863_100959968 | 3300005841 | Bacteria | 856 |
| 120 | Ga0068858_100387714 | 3300005842 | Bacteria | 1341 |
| 121 | Ga0068858_100483855 | 3300005842 | Bacteria | 1195 |
| 122 | Ga0068862_100364573 | 3300005844 | Bacteria | 1344 |
| 123 | Ga0068862_100493951 | 3300005844 | Bacteria | 1160 |
| 124 | Ga0068862_100637640 | 3300005844 | Bacteria | 1026 |
| 125 | Ga0068862_100793781 | 3300005844 | Bacteria | 924 |
| 126 | Ga0068862_101103713 | 3300005844 | Bacteria | 788 |
| 127 | Ga0081455_10004734 | 3300005937 | Bacteria | 15128 |
| 128 | Ga0081455_10037279 | 3300005937 | Bacteria | 4320 |
| 129 | Ga0081455_10063826 | 3300005937 | Bacteria | 3088 |
| 130 | Ga0081455_10190092 | 3300005937 | Bacteria | 1547 |
| 131 | Ga0081455_10280756 | 3300005937 | Bacteria | 1203 |
| 132 | Ga0081538_10071091 | 3300005981 | Bacteria | 1917 |
| 133 | Ga0081540_1000390 | 3300005983 | Bacteria | 43721 |
| 134 | Ga0081540_1002694 | 3300005983 | Bacteria | 14452 |
| 135 | Ga0081540_1003284 | 3300005983 | Bacteria | 12855 |
| 136 | Ga0081540_1003420 | 3300005983 | Bacteria | 12550 |
| 137 | Ga0081540_1015811 | 3300005983 | Bacteria | 4759 |
| 138 | Ga0081540_1029232 | 3300005983 | Bacteria | 3075 |
| 139 | Ga0081539_10003489 | 3300005985 | Bacteria | 19217 |
| 140 | Ga0081539_10047799 | 3300005985 | Bacteria | 2440 |
| 141 | Ga0070717_10280534 | 3300006028 | Bacteria | 1478 |
| 142 | Ga0075365_10017375 | 3300006038 | Bacteria | 4400 |
| 143 | Ga0075365_10092377 | 3300006038 | Bacteria | 2063 |
| 144 | Ga0075365_10397627 | 3300006038 | Bacteria | 972 |
| 145 | Ga0075365_10442097 | 3300006038 | Bacteria | 918 |
| 146 | Ga0075368_10092045 | 3300006042 | Bacteria | 1240 |
| 147 | Ga0075368_10103329 | 3300006042 | Bacteria | 1172 |
| 148 | Ga0075363_100033572 | 3300006048 | Bacteria | 2673 |
| 149 | Ga0075363_100153111 | 3300006048 | Bacteria | 1302 |
| 150 | Ga0075363_100194318 | 3300006048 | Bacteria | 1158 |
| 151 | Ga0075363_100261271 | 3300006048 | Bacteria | 999 |
| 152 | Ga0075364_10086883 | 3300006051 | Bacteria | 2072 |
| 153 | Ga0075364_10128578 | 3300006051 | Bacteria | 1699 |
| 154 | Ga0075364_10189803 | 3300006051 | Bacteria | 1391 |
| 155 | Ga0075364_10194845 | 3300006051 | Bacteria | 1372 |
| 156 | Ga0075362_10019947 | 3300006177 | Bacteria | 2795 |
| 157 | Ga0075362_10035162 | 3300006177 | Bacteria | 2186 |
| 158 | Ga0075362_10168065 | 3300006177 | Bacteria | 1058 |
| 159 | Ga0075367_10091224 | 3300006178 | Bacteria | 1853 |
| 160 | Ga0075367_10479403 | 3300006178 | Bacteria | 789 |
| 161 | Ga0075369_10002966 | 3300006186 | Bacteria | 6130 |
| 162 | Ga0075369_10034442 | 3300006186 | Bacteria | 2149 |
| 163 | Ga0075369_10054941 | 3300006186 | Bacteria | 1729 |
| 164 | Ga0075369_10133778 | 3300006186 | Bacteria | 1128 |
| 165 | Ga0075366_10044839 | 3300006195 | Bacteria | 2621 |
| 166 | Ga0075366_10045750 | 3300006195 | Bacteria | 2593 |
| 167 | Ga0097621_100302485 | 3300006237 | Bacteria | 1413 |
| 168 | Ga0097621_100312723 | 3300006237 | Bacteria | 1390 |
| 169 | Ga0097621_100973438 | 3300006237 | Bacteria | 793 |
| 170 | Ga0075370_10058180 | 3300006353 | Bacteria | 2198 |
| 171 | Ga0075370_10116718 | 3300006353 | Bacteria | 1552 |
| 172 | Ga0068871_100079482 | 3300006358 | Bacteria | 2713 |
| 173 | Ga0068871_100687026 | 3300006358 | Bacteria | 937 |
| 174 | Ga0075428_100070070 | 3300006844 | Bacteria | 3833 |
| 175 | Ga0075430_100674779 | 3300006846 | Bacteria | 852 |
| 176 | Ga0075433_11067386 | 3300006852 | Bacteria | 703 |
| 177 | Ga0075434_100158304 | 3300006871 | Bacteria | 2284 |
| 178 | Ga0075434_100435588 | 3300006871 | Bacteria | 1332 |
| 179 | Ga0068865_100863473 | 3300006881 | Bacteria | 785 |
| 180 | Ga0097620_100073191 | 3300006931 | Bacteria | 3464 |
| 181 | Ga0097620_100125976 | 3300006931 | Bacteria | 2630 |
| 182 | Ga0097620_100151527 | 3300006931 | Bacteria | 2394 |
| 183 | Ga0097620_100351653 | 3300006931 | Bacteria | 1568 |
| 184 | Ga0097620_101463484 | 3300006931 | Bacteria | 754 |
| 185 | Ga0099825_1045808 | 3300006941 | Bacteria | 1086 |
| 186 | Ga0099824_1018090 | 3300006942 | Bacteria | 5885 |
| 187 | Ga0075435_100362370 | 3300007076 | Bacteria | 1244 |
| 188 | Ga0105251_10078838 | 3300009011 | Bacteria | 1525 |
| 189 | Ga0105244_10007742 | 3300009036 | Bacteria | 6798 |
| 190 | Ga0105244_10039646 | 3300009036 | Bacteria | 2451 |
| 191 | Ga0105250_10032667 | 3300009092 | Bacteria | 2090 |
| 192 | Ga0105250_10181026 | 3300009092 | Bacteria | 884 |
| 193 | Ga0105240_10005052 | 3300009093 | Bacteria | 19785 |
| 194 | Ga0105240_10019107 | 3300009093 | Bacteria | 9162 |
| 195 | Ga0105240_10876793 | 3300009093 | Bacteria | 967 |
| 196 | Ga0105240_11013165 | 3300009093 | Bacteria | 887 |
| 197 | Ga0111539_10393326 | 3300009094 | Bacteria | 1615 |
| 198 | Ga0105245_10033284 | 3300009098 | Bacteria | 4567 |
| 199 | Ga0105245_10034208 | 3300009098 | Bacteria | 4506 |
| 200 | Ga0105245_10256255 | 3300009098 | Bacteria | 1701 |
| 201 | Ga0105245_10671872 | 3300009098 | Bacteria | 1067 |
| 202 | Ga0105247_10022331 | 3300009101 | Bacteria | 3810 |
| 203 | Ga0105247_10040222 | 3300009101 | Bacteria | 2857 |
| 204 | Ga0105247_10304604 | 3300009101 | Bacteria | 1106 |
| 205 | Ga0114129_10118949 | 3300009147 | Bacteria | 3639 |
| 206 | Ga0105243_10169476 | 3300009148 | Bacteria | 1890 |
| 207 | Ga0105243_10642790 | 3300009148 | Bacteria | 1027 |
| 208 | Ga0105243_10803084 | 3300009148 | Bacteria | 927 |
| 209 | Ga0105241_10120387 | 3300009174 | Bacteria | 2113 |
| 210 | Ga0105241_10121698 | 3300009174 | Bacteria | 2102 |
| 211 | Ga0105241_10158637 | 3300009174 | Bacteria | 1857 |
| 212 | Ga0105242_10317343 | 3300009176 | Bacteria | 1428 |
| 213 | Ga0105242_10730025 | 3300009176 | Bacteria | 973 |
| 214 | Ga0105248_10063571 | 3300009177 | Bacteria | 4143 |
| 215 | Ga0105248_10073791 | 3300009177 | Bacteria | 3834 |
| 216 | Ga0105248_10084328 | 3300009177 | Bacteria | 3574 |
| 217 | Ga0105248_10278611 | 3300009177 | Bacteria | 1883 |
| 218 | Ga0105237_10001825 | 3300009545 | Bacteria | 27462 |
| 219 | Ga0105237_10273975 | 3300009545 | Bacteria | 1690 |
| 220 | Ga0105237_10480836 | 3300009545 | Bacteria | 1248 |
| 221 | Ga0105237_10492313 | 3300009545 | Bacteria | 1233 |
| 222 | Ga0105237_10666050 | 3300009545 | Bacteria | 1047 |
| 223 | Ga0105238_10056920 | 3300009551 | Bacteria | 3922 |
| 224 | Ga0105238_10146838 | 3300009551 | Bacteria | 2334 |
| 225 | Ga0105238_10150526 | 3300009551 | Bacteria | 2302 |
| 226 | Ga0105238_10184001 | 3300009551 | Bacteria | 2066 |
| 227 | Ga0105249_10707211 | 3300009553 | Bacteria | 1068 |
| 228 | Ga0105239_10031864 | 3300010375 | Bacteria | 5793 |
| 229 | Ga0105239_10100812 | 3300010375 | Bacteria | 3194 |
| 230 | Ga0105239_10259769 | 3300010375 | Bacteria | 1952 |
| 231 | Ga0105239_10410759 | 3300010375 | Bacteria | 1533 |
| 232 | Ga0105246_10011457 | 3300011119 | Bacteria | 5503 |
| 233 | Ga0105246_10044778 | 3300011119 | Bacteria | 3009 |
| 234 | Ga0105246_10061328 | 3300011119 | Bacteria | 2616 |
| 235 | Ga0105246_10064157 | 3300011119 | Bacteria | 2565 |
| 236 | Ga0105246_10189572 | 3300011119 | Bacteria | 1590 |
| 237 | Ga0157371_10385093 | 3300013102 | Bacteria | 1024 |
| 238 | Ga0157369_10040360 | 3300013105 | Bacteria | 5095 |
| 239 | Ga0157369_10068769 | 3300013105 | Bacteria | 3805 |
| 240 | Ga0157374_10070147 | 3300013296 | Bacteria | 3301 |
| 241 | Ga0157378_10105000 | 3300013297 | Bacteria | 2583 |
| 242 | Ga0157378_10113876 | 3300013297 | Bacteria | 2484 |
| 243 | Ga0157378_10532100 | 3300013297 | Bacteria | 1178 |
| 244 | Ga0157378_11479224 | 3300013297 | Bacteria | 723 |
| 245 | Ga0163162_10856109 | 3300013306 | Bacteria | 1024 |
| 246 | Ga0157372_10247662 | 3300013307 | Bacteria | 2068 |
| 247 | Ga0157372_10862475 | 3300013307 | Bacteria | 1051 |
| 248 | Ga0157375_10280354 | 3300013308 | Bacteria | 1830 |
| 249 | Ga0157375_10336382 | 3300013308 | Bacteria | 1675 |
| 250 | Ga0157375_10624976 | 3300013308 | Bacteria | 1235 |
| 251 | Ga0157375_10726359 | 3300013308 | Bacteria | 1146 |
| 252 | Ga0163163_10061762 | 3300014325 | Bacteria | 3712 |
| 253 | Ga0163163_10366073 | 3300014325 | Bacteria | 1498 |
| 254 | Ga0163163_10596850 | 3300014325 | Bacteria | 1167 |
| 255 | Ga0163163_11053803 | 3300014325 | Bacteria | 876 |
| 256 | Ga0163163_11592971 | 3300014325 | Bacteria | 714 |
| 257 | Ga0157380_10357302 | 3300014326 | Bacteria | 1369 |
| 258 | Ga0157377_10177955 | 3300014745 | Bacteria | 1335 |
| 259 | Ga0157379_10330879 | 3300014968 | Bacteria | 1392 |
| 260 | Ga0157376_10234717 | 3300014969 | Bacteria | 1705 |
| 261 | Ga0157376_10441547 | 3300014969 | Bacteria | 1267 |
| 262 | Ga0157376_10457076 | 3300014969 | Bacteria | 1247 |
| 263 | Ga0163161_10315342 | 3300017792 | Bacteria | 1235 |
| 264 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 265 | Ga0214544_1041736 | 3300021320 | Bacteria | 965 |
| 266 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 267 | Ga0214542_1027972 | 3300021321 | Bacteria | 2503 |
| 268 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 269 | Ga0214545_1018297 | 3300021324 | Bacteria | 6429 |
| 270 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 271 | Ga0214543_1024430 | 3300021327 | Bacteria | 3738 |
| 272 | Ga0213873_10071207 | 3300021358 | Bacteria | 958 |
| 273 | Ga0213872_10010153 | 3300021361 | Bacteria | 4491 |
| 274 | Ga0213876_10019228 | 3300021384 | Bacteria | 3608 |
| 275 | Ga0213875_10009576 | 3300021388 | Bacteria | 4899 |
| 276 | Ga0213871_10043735 | 3300021441 | Bacteria | 1209 |
| 277 | Ga0209784_101922 | 3300025224 | Bacteria | 2362 |
| 278 | Ga0209566_100035 | 3300025225 | Bacteria | 314893 |
| 279 | Ga0209566_100086 | 3300025225 | Bacteria | 148250 |
| 280 | Ga0209147_108509 | 3300025229 | Bacteria | 1270 |
| 281 | Ga0209563_102773 | 3300025230 | Bacteria | 3833 |
| 282 | Ga0209437_100938 | 3300025233 | Bacteria | 10986 |
| 283 | Ga0209258_101224 | 3300025242 | Bacteria | 9935 |
| 284 | Ga0209258_104743 | 3300025242 | Bacteria | 2485 |
| 285 | Ga0207425_1011699 | 3300025245 | Bacteria | 2081 |
| 286 | Ga0209677_101607 | 3300025253 | Bacteria | 9538 |
| 287 | Ga0209677_103983 | 3300025253 | Bacteria | 4479 |
| 288 | Ga0209148_1000216 | 3300025254 | Bacteria | 98209 |
| 289 | Ga0209233_1012199 | 3300025261 | Bacteria | 2498 |
| 290 | Ga0209455_1001447 | 3300025272 | Bacteria | 10717 |
| 291 | Ga0209025_1000011 | 3300025294 | Bacteria | 976387 |
| 292 | Ga0209025_1007977 | 3300025294 | Bacteria | 7741 |
| 293 | Ga0209025_1028047 | 3300025294 | Bacteria | 2771 |
| 294 | Ga0209025_1068651 | 3300025294 | Bacteria | 1272 |
| 295 | Ga0209564_1013127 | 3300025295 | Bacteria | 3545 |
| 296 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 297 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 298 | Ga0209758_1000673 | 3300025297 | Bacteria | 51032 |
| 299 | Ga0209758_1004929 | 3300025297 | Bacteria | 10730 |
| 300 | Ga0209758_1019668 | 3300025297 | Bacteria | 3242 |
| 301 | Ga0209758_1021569 | 3300025297 | Bacteria | 2997 |
| 302 | Ga0209758_1035445 | 3300025297 | Bacteria | 1967 |
| 303 | Ga0209758_1035446 | 3300025297 | Bacteria | 1967 |
| 304 | Ga0209256_1004892 | 3300025299 | Bacteria | 8059 |
| 305 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 306 | Ga0207426_1001742 | 3300025302 | Bacteria | 16568 |
| 307 | Ga0207426_1006201 | 3300025302 | Bacteria | 5254 |
| 308 | Ga0209051_1018369 | 3300025303 | Bacteria | 3095 |
| 309 | Ga0209257_1006231 | 3300025304 | Bacteria | 7816 |
| 310 | Ga0207656_10267260 | 3300025321 | Bacteria | 841 |
| 311 | Ga0207653_10015012 | 3300025885 | Bacteria | 2431 |
| 312 | Ga0207682_10008049 | 3300025893 | Bacteria | 4184 |
| 313 | Ga0207642_10140995 | 3300025899 | Bacteria | 1271 |
| 314 | Ga0207688_10057659 | 3300025901 | Bacteria | 2184 |
| 315 | Ga0207688_10101989 | 3300025901 | Bacteria | 1658 |
| 316 | Ga0207688_10212039 | 3300025901 | Bacteria | 1164 |
| 317 | Ga0207680_10452540 | 3300025903 | Bacteria | 911 |
| 318 | Ga0207647_10004864 | 3300025904 | Bacteria | 9927 |
| 319 | Ga0207699_10021493 | 3300025906 | Bacteria | 3479 |
| 320 | Ga0207645_10047946 | 3300025907 | Bacteria | 2728 |
| 321 | Ga0207645_10294922 | 3300025907 | Bacteria | 1079 |
| 322 | Ga0207643_10088900 | 3300025908 | Bacteria | 1799 |
| 323 | Ga0207643_10359630 | 3300025908 | Bacteria | 915 |
| 324 | Ga0207705_10038556 | 3300025909 | Bacteria | 3421 |
| 325 | Ga0207654_10034330 | 3300025911 | Bacteria | 2818 |
| 326 | Ga0207654_10050460 | 3300025911 | Bacteria | 2391 |
| 327 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 328 | Ga0207695_10106220 | 3300025913 | Bacteria | 2794 |
| 329 | Ga0207671_10047393 | 3300025914 | Bacteria | 3181 |
| 330 | Ga0207671_10383348 | 3300025914 | Bacteria | 1117 |
| 331 | Ga0207662_10124668 | 3300025918 | Bacteria | 1618 |
| 332 | Ga0207662_10432304 | 3300025918 | Bacteria | 897 |
| 333 | Ga0207657_10209135 | 3300025919 | Bacteria | 1566 |
| 334 | Ga0207646_10822493 | 3300025922 | Bacteria | 826 |
| 335 | Ga0207681_10167225 | 3300025923 | Bacteria | 1663 |
| 336 | Ga0207681_10248139 | 3300025923 | Bacteria | 1389 |
| 337 | Ga0207694_10035608 | 3300025924 | Bacteria | 3820 |
| 338 | Ga0207694_10098536 | 3300025924 | Bacteria | 2314 |
| 339 | Ga0207694_10266496 | 3300025924 | Bacteria | 1404 |
| 340 | Ga0207694_10484105 | 3300025924 | Bacteria | 1035 |
| 341 | Ga0207650_10197201 | 3300025925 | Bacteria | 1611 |
| 342 | Ga0207650_10354181 | 3300025925 | Bacteria | 1208 |
| 343 | Ga0207687_10030856 | 3300025927 | Bacteria | 3618 |
| 344 | Ga0207687_10167310 | 3300025927 | Bacteria | 1692 |
| 345 | Ga0207700_10007619 | 3300025928 | Bacteria | 6641 |
| 346 | Ga0207644_10022449 | 3300025931 | Bacteria | 4312 |
| 347 | Ga0207644_10620338 | 3300025931 | Bacteria | 899 |
| 348 | Ga0207644_10729388 | 3300025931 | Bacteria | 827 |
| 349 | Ga0207644_10828581 | 3300025931 | Bacteria | 774 |
| 350 | Ga0207690_10445071 | 3300025932 | Bacteria | 1040 |
| 351 | Ga0207706_10123452 | 3300025933 | Bacteria | 2278 |
| 352 | Ga0207706_10167711 | 3300025933 | Bacteria | 1930 |
| 353 | Ga0207706_10887395 | 3300025933 | Bacteria | 754 |
| 354 | Ga0207686_10143777 | 3300025934 | Bacteria | 1652 |
| 355 | Ga0207709_10247948 | 3300025935 | Bacteria | 1299 |
| 356 | Ga0207709_10304390 | 3300025935 | Bacteria | 1187 |
| 357 | Ga0207709_10413130 | 3300025935 | Bacteria | 1035 |
| 358 | Ga0207670_10539057 | 3300025936 | Bacteria | 952 |
| 359 | Ga0207670_11033401 | 3300025936 | Bacteria | 692 |
| 360 | Ga0207669_10471804 | 3300025937 | Bacteria | 998 |
| 361 | Ga0207704_10393599 | 3300025938 | Bacteria | 1091 |
| 362 | Ga0207691_10126016 | 3300025940 | Bacteria | 2266 |
| 363 | Ga0207691_10149350 | 3300025940 | Bacteria | 2055 |
| 364 | Ga0207711_10063181 | 3300025941 | Bacteria | 3196 |
| 365 | Ga0207711_10245950 | 3300025941 | Bacteria | 1641 |
| 366 | Ga0207711_10463309 | 3300025941 | Bacteria | 1180 |
| 367 | Ga0207711_10707794 | 3300025941 | Bacteria | 939 |
| 368 | Ga0207689_10020050 | 3300025942 | Bacteria | 5629 |
| 369 | Ga0207689_10047569 | 3300025942 | Bacteria | 3540 |
| 370 | Ga0207689_10105485 | 3300025942 | Bacteria | 2315 |
| 371 | Ga0207689_10718830 | 3300025942 | Bacteria | 842 |
| 372 | Ga0207661_10409628 | 3300025944 | Bacteria | 1230 |
| 373 | Ga0207679_10047663 | 3300025945 | Bacteria | 3114 |
| 374 | Ga0207667_10276364 | 3300025949 | Bacteria | 1717 |
| 375 | Ga0207667_10606140 | 3300025949 | Bacteria | 1104 |
| 376 | Ga0207712_10186329 | 3300025961 | Bacteria | 1634 |
| 377 | Ga0207712_10309407 | 3300025961 | Bacteria | 1300 |
| 378 | Ga0207712_10377490 | 3300025961 | Bacteria | 1185 |
| 379 | Ga0207668_10085734 | 3300025972 | Bacteria | 2299 |
| 380 | Ga0207668_10277138 | 3300025972 | Bacteria | 1373 |
| 381 | Ga0207668_10695164 | 3300025972 | Bacteria | 893 |
| 382 | Ga0207658_10264865 | 3300025986 | Bacteria | 1466 |
| 383 | Ga0207658_10357272 | 3300025986 | Bacteria | 1274 |
| 384 | Ga0207677_10036683 | 3300026023 | Bacteria | 3197 |
| 385 | Ga0207677_10226708 | 3300026023 | Bacteria | 1502 |
| 386 | Ga0207677_10691835 | 3300026023 | Bacteria | 904 |
| 387 | Ga0207677_10719657 | 3300026023 | Bacteria | 887 |
| 388 | Ga0207703_10091998 | 3300026035 | Bacteria | 2552 |
| 389 | Ga0207703_10693380 | 3300026035 | Bacteria | 968 |
| 390 | Ga0207639_10102987 | 3300026041 | Bacteria | 2312 |
| 391 | Ga0207639_10108879 | 3300026041 | Bacteria | 2253 |
| 392 | Ga0207639_10158701 | 3300026041 | Bacteria | 1903 |
| 393 | Ga0207639_10357750 | 3300026041 | Bacteria | 1306 |
| 394 | Ga0207678_10008858 | 3300026067 | Bacteria | 8861 |
| 395 | Ga0207678_10015151 | 3300026067 | Bacteria | 6782 |
| 396 | Ga0207678_10111519 | 3300026067 | Bacteria | 2334 |
| 397 | Ga0207708_10235845 | 3300026075 | Bacteria | 1470 |
| 398 | Ga0207708_10336260 | 3300026075 | Bacteria | 1235 |
| 399 | Ga0207702_10057935 | 3300026078 | Bacteria | 3295 |
| 400 | Ga0207702_10100353 | 3300026078 | Bacteria | 2554 |
| 401 | Ga0207641_10293589 | 3300026088 | Bacteria | 1533 |
| 402 | Ga0207648_10095376 | 3300026089 | Bacteria | 2602 |
| 403 | Ga0207648_10158250 | 3300026089 | Bacteria | 2000 |
| 404 | Ga0207648_10243676 | 3300026089 | Bacteria | 1601 |
| 405 | Ga0207676_10142815 | 3300026095 | Bacteria | 2051 |
| 406 | Ga0207676_10382169 | 3300026095 | Bacteria | 1311 |
| 407 | Ga0207674_10032725 | 3300026116 | Bacteria | 5451 |
| 408 | Ga0207674_10123589 | 3300026116 | Bacteria | 2554 |
| 409 | Ga0207674_10199575 | 3300026116 | Bacteria | 1950 |
| 410 | Ga0207674_10353888 | 3300026116 | Bacteria | 1420 |
| 411 | Ga0207674_10609757 | 3300026116 | Bacteria | 1054 |
| 412 | Ga0207675_100279429 | 3300026118 | Bacteria | 1622 |
| 413 | Ga0207675_100481726 | 3300026118 | Bacteria | 1233 |
| 414 | Ga0207675_100597433 | 3300026118 | Bacteria | 1106 |
| 415 | Ga0207683_10007253 | 3300026121 | Bacteria | 9501 |
| 416 | Ga0207683_10090513 | 3300026121 | Bacteria | 2725 |
| 417 | Ga0207683_10337142 | 3300026121 | Bacteria | 1382 |
| 418 | Ga0207683_10463792 | 3300026121 | Bacteria | 1168 |
| 419 | Ga0207698_10007921 | 3300026142 | Bacteria | 6692 |
| 420 | Ga0207698_10245268 | 3300026142 | Bacteria | 1635 |
| 421 | Ga0207698_10336364 | 3300026142 | Bacteria | 1420 |
| 422 | Ga0209389_1000062 | 3300027296 | Bacteria | 102842 |
| 423 | Ga0209389_1000072 | 3300027296 | Bacteria | 96795 |
| 424 | Ga0209371_1019012 | 3300027312 | Bacteria | 1728 |
| 425 | Ga0209589_1000270 | 3300027357 | Bacteria | 65577 |
| 426 | Ga0209489_100160 | 3300027361 | Bacteria | 102842 |
| 427 | Ga0209489_100206 | 3300027361 | Bacteria | 96866 |
| 428 | Ga0209700_101128 | 3300027363 | Bacteria | 54168 |
| 429 | Ga0209813_10266380 | 3300027866 | Bacteria | 656 |
| 430 | Ga0207428_10102978 | 3300027907 | Bacteria | 2204 |
| 431 | Ga0268266_10001098 | 3300028379 | Bacteria | 33929 |
| 432 | Ga0268266_10001919 | 3300028379 | Bacteria | 23365 |
| 433 | Ga0268266_10486100 | 3300028379 | Bacteria | 1177 |
| 434 | Ga0268265_10036180 | 3300028380 | Bacteria | 3614 |
| 435 | Ga0268265_10221601 | 3300028380 | Bacteria | 1655 |
| 436 | Ga0268265_10459711 | 3300028380 | Bacteria | 1191 |
| 437 | Ga0268264_10014095 | 3300028381 | Bacteria | 6572 |
| 438 | Ga0268264_10239379 | 3300028381 | Bacteria | 1680 |
| 439 | Ga0268264_10438915 | 3300028381 | Bacteria | 1262 |
| 440 | Ga0268264_11045418 | 3300028381 | Bacteria | 824 |
| 441 | Ga0307517_10000196 | 3300028786 | Bacteria | 102384 |
| 442 | Ga0307517_10114104 | 3300028786 | Bacteria | 2035 |
| 443 | Ga0307517_10407164 | 3300028786 | Bacteria | 718 |
| 444 | Ga0307515_10019983 | 3300028794 | Bacteria | 11996 |
| 445 | Ga0268256_1021141 | 3300030500 | Bacteria | 1738 |
| 446 | Ga0307513_10141261 | 3300031456 | Bacteria | 2334 |
| 447 | Ga0307509_10197820 | 3300031507 | Bacteria | 1851 |
| 448 | Ga0307508_10052012 | 3300031616 | Bacteria | 3640 |
| 449 | Ga0307516_10353780 | 3300031730 | Bacteria | 1134 |
| 450 | Ga0307516_10431605 | 3300031730 | Bacteria | 975 |
| 451 | Ga0307405_10099014 | 3300031731 | Bacteria | 1951 |
| 452 | Ga0307405_10895696 | 3300031731 | Bacteria | 750 |
| 453 | Ga0307413_10314742 | 3300031824 | Bacteria | 1193 |
| 454 | Ga0307406_10518675 | 3300031901 | Bacteria | 969 |
| 455 | Ga0307406_10801133 | 3300031901 | Bacteria | 795 |
| 456 | Ga0307412_10223506 | 3300031911 | Bacteria | 1445 |
| 457 | Ga0307409_100112259 | 3300031995 | Bacteria | 2288 |
| 458 | Ga0307411_10204501 | 3300032005 | Bacteria | 1519 |
| 459 | Ga0307415_100176875 | 3300032126 | Bacteria | 1670 |
| 460 | Ga0307415_100249504 | 3300032126 | Bacteria | 1441 |
| 461 | Ga0307510_10002425 | 3300033180 | Bacteria | 21169 |
| 462 | Ga0307510_10018360 | 3300033180 | Bacteria | 8233 |
| 463 | Ga0307510_10057078 | 3300033180 | Bacteria | 4057 |
| 464 | Ga0307510_10163534 | 3300033180 | Bacteria | 1818 |
| 465 | Ga0373932_0119323 | 3300035112 | Bacteria | 878 |
| 466 | Ga0373939_0076974 | 3300035114 | Bacteria | 1100 |
| 467 | Ga0373943_0187121 | 3300035170 | Bacteria | 1141 |
| 468 | Ga0373927_0162707 | 3300035695 | Bacteria | 1462 |
| 469 | Ga0395900_0143981 | 3300037418 | Bacteria | 2438 |
| 470 | Ga0395898_0470465 | 3300037466 | Bacteria | 1196 |
| 471 | Ga0395905_0000710 | 3300037471 | Bacteria | 44148 |
| 472 | Ga0395905_0283473 | 3300037471 | Bacteria | 1543 |
| 473 | Ga0436364_0076794 | 3300037853 | Bacteria | 1034 |
| 474 | Ga0436364_0719642 | 3300037853 | Bacteria | 10746 |
| 475 | Ga0436364_0755794 | 3300037853 | Bacteria | 2402 |
| 476 | Ga0436364_1287204 | 3300037853 | Bacteria | 8685 |
| 477 | Ga0395901_0348752 | 3300038443 | Bacteria | 1528 |
| 478 | Ga0395901_0530948 | 3300038443 | Bacteria | 1194 |
| 479 | Ga0436365_0750351 | 3300039437 | Bacteria | 31692 |
| 480 | Ga0436365_1110743 | 3300039437 | Bacteria | 2255 |
| 481 | Ga0436365_1414759 | 3300039437 | Bacteria | 4154 |
| 482 | Ga0436365_1523781 | 3300039437 | Bacteria | 719 |
| 483 | Ga0436365_1562201 | 3300039437 | Bacteria | 3252 |
| 484 | Ga0436360_0952465 | 3300039438 | Bacteria | 2123 |
| 485 | Ga0436361_0083564 | 3300039447 | Bacteria | 6115 |
| 486 | Ga0436361_0573468 | 3300039447 | Bacteria | 1131 |
| 487 | Ga0436362_1274308 | 3300039453 | Bacteria | 1010 |
| 488 | Ga0439436_0014817 | 3300041404 | Bacteria | 2348 |
| 489 | Ga0439439_0005528 | 3300041406 | Bacteria | 2889 |
| 490 | Ga0439465_0069447 | 3300041413 | Bacteria | 1179 |
| 491 | Ga0451791_0118347 | 3300041451 | Bacteria | 900 |
| 492 | Ga0451791_1327348 | 3300041451 | Bacteria | 925 |
| 493 | Ga0451793_0550299 | 3300041452 | Bacteria | 803 |
| 494 | Ga0451800_0369308 | 3300041459 | Bacteria | 809 |
| 495 | Ga0451802_0032404 | 3300041460 | Bacteria | 1602 |
| 496 | Ga0451841_0667089 | 3300041498 | Bacteria | 820 |
| 497 | Ga0451843_1581240 | 3300041509 | Bacteria | 676 |
| 498 | Ga0439449_0000025 | 3300042007 | Bacteria | 44502 |
| 499 | Ga0439457_008775 | 3300042014 | Unclassified | 2372 |
| 500 | Ga0439462_0013810 | 3300042015 | Bacteria | 2072 |
| 501 | Ga0439459_0040149 | 3300042438 | Bacteria | 991 |
| 502 | Ga0466969_0030722 | 3300044656 | Bacteria | 2737 |
| 503 | Ga0466972_0004442 | 3300044658 | Bacteria | 7017 |
| 504 | Ga0466966_0002418 | 3300044684 | Bacteria | 12199 |
| 505 | Ga0466966_0019149 | 3300044684 | Bacteria | 4506 |
| 506 | Ga0466961_0000324 | 3300044693 | Bacteria | 31518 |
| 507 | Ga0466963_0028999 | 3300044694 | Bacteria | 3559 |
| 508 | Ga0466968_0038269 | 3300044735 | Bacteria | 2015 |
| 509 | Ga0466970_0419641 | 3300044765 | Bacteria | 765 |
| 510 | Ga0466960_0030151 | 3300044901 | Bacteria | 2494 |
| 511 | Ga0466960_0088008 | 3300044901 | Bacteria | 1578 |
| 512 | Ga0466959_0157829 | 3300045049 | Bacteria | 1595 |
| 513 | Ga0451576_0507654 | 3300045051 | Bacteria | 1267 |
| 514 | Ga0495592_0206014 | 3300046454 | Bacteria | 1324 |
| 515 | Ga0495592_0230498 | 3300046454 | Bacteria | 1233 |
| 516 | Ga0495592_0396612 | 3300046454 | Bacteria | 875 |
| 517 | Ga0495603_0056082 | 3300046455 | Bacteria | 2333 |
| 518 | Ga0495603_0196008 | 3300046455 | Bacteria | 1167 |
| 519 | Ga0495591_045145 | 3300046458 | Bacteria | 1230 |
| 520 | Ga0495629_0026002 | 3300046459 | Bacteria | 4159 |
| 521 | Ga0495638_0006922 | 3300046460 | Bacteria | 8180 |
| 522 | Ga0495638_0100023 | 3300046460 | Bacteria | 1735 |
| 523 | Ga0495638_0134477 | 3300046460 | Bacteria | 1450 |
| 524 | Ga0495638_0174155 | 3300046460 | Bacteria | 1232 |
| 525 | Ga0495651_0034935 | 3300046462 | Bacteria | 3917 |
| 526 | Ga0495605_0047265 | 3300046474 | Bacteria | 2111 |
| 527 | Ga0495605_0051963 | 3300046474 | Bacteria | 1994 |
| 528 | Ga0495605_0076469 | 3300046474 | Bacteria | 1572 |
| 529 | Ga0495605_0119154 | 3300046474 | Bacteria | 1198 |
| 530 | Ga0495605_0244523 | 3300046474 | Bacteria | 769 |
| 531 | Ga0495584_0249418 | 3300046491 | Bacteria | 902 |
| 532 | Ga0495584_0262191 | 3300046491 | Bacteria | 878 |
| 533 | Ga0495585_0026108 | 3300046492 | Bacteria | 3338 |
| 534 | Ga0495585_0167513 | 3300046492 | Bacteria | 1137 |
| 535 | Ga0495585_0220782 | 3300046492 | Bacteria | 956 |
| 536 | Ga0495585_0245380 | 3300046492 | Bacteria | 895 |
| 537 | Ga0495594_0089994 | 3300046499 | Bacteria | 1719 |
| 538 | Ga0495596_0035379 | 3300046500 | Bacteria | 1980 |
| 539 | Ga0495596_0233987 | 3300046500 | Bacteria | 713 |
| 540 | Ga0495607_0066487 | 3300046501 | Bacteria | 2028 |
| 541 | Ga0495607_0097545 | 3300046501 | Bacteria | 1580 |
| 542 | Ga0495607_0205620 | 3300046501 | Bacteria | 972 |
| 543 | Ga0495583_0050842 | 3300046506 | Bacteria | 1892 |
| 544 | Ga0495606_0048572 | 3300046507 | Bacteria | 2789 |
| 545 | Ga0495606_0069620 | 3300046507 | Bacteria | 2221 |
| 546 | Ga0495606_0308217 | 3300046507 | Bacteria | 855 |
| 547 | Ga0495606_0363317 | 3300046507 | Bacteria | 764 |
| 548 | Ga0495610_0012561 | 3300046512 | Bacteria | 5087 |
| 549 | Ga0495610_0082066 | 3300046512 | Bacteria | 1478 |
| 550 | Ga0495610_0098846 | 3300046512 | Bacteria | 1310 |
| 551 | Ga0495616_0028704 | 3300046513 | Bacteria | 2943 |
| 552 | Ga0495618_0161306 | 3300046514 | Bacteria | 1429 |
| 553 | Ga0495620_0013026 | 3300046515 | Bacteria | 4269 |
| 554 | Ga0495628_0448504 | 3300046516 | Bacteria | 937 |
| 555 | Ga0495631_0037053 | 3300046518 | Bacteria | 2174 |
| 556 | Ga0495632_0069194 | 3300046519 | Bacteria | 1700 |
| 557 | Ga0495632_0132614 | 3300046519 | Bacteria | 1158 |
| 558 | Ga0495632_0244547 | 3300046519 | Bacteria | 806 |
| 559 | Ga0495637_0177699 | 3300046520 | Bacteria | 791 |
| 560 | Ga0495643_0073425 | 3300046522 | Bacteria | 1792 |
| 561 | Ga0495643_0170775 | 3300046522 | Bacteria | 1063 |
| 562 | Ga0495648_0078158 | 3300046524 | Bacteria | 1893 |
| 563 | Ga0495648_0125099 | 3300046524 | Bacteria | 1376 |
| 564 | Ga0495648_0170726 | 3300046524 | Bacteria | 1115 |
| 565 | Ga0495642_0187161 | 3300046528 | Bacteria | 902 |
| 566 | Ga0495652_0027290 | 3300046529 | Bacteria | 5032 |
| 567 | Ga0495652_0299044 | 3300046529 | Bacteria | 1171 |
| 568 | Ga0495654_0018207 | 3300046530 | Bacteria | 3684 |
| 569 | Ga0495587_0047845 | 3300046536 | Bacteria | 2535 |
| 570 | Ga0495598_0041682 | 3300046537 | Bacteria | 1344 |
| 571 | Ga0495609_0068566 | 3300046538 | Bacteria | 1560 |
| 572 | Ga0495609_0095650 | 3300046538 | Bacteria | 1289 |
| 573 | Ga0495597_0072336 | 3300046542 | Bacteria | 1483 |
| 574 | Ga0495597_0089784 | 3300046542 | Bacteria | 1306 |
| 575 | Ga0495597_0305828 | 3300046542 | Bacteria | 616 |
| 576 | Ga0495622_0021059 | 3300046557 | Bacteria | 3037 |
| 577 | Ga0495622_0039845 | 3300046557 | Bacteria | 2188 |
| 578 | Ga0495633_0081329 | 3300046558 | Bacteria | 1507 |
| 579 | Ga0495633_0158827 | 3300046558 | Bacteria | 1043 |
| 580 | Ga0495667_0098051 | 3300046559 | Bacteria | 1898 |
| 581 | Ga0495656_0039635 | 3300046615 | Bacteria | 1958 |
| 582 | Ga0495668_0054485 | 3300046616 | Bacteria | 2210 |
| 583 | Ga0495668_0114275 | 3300046616 | Bacteria | 1476 |
| 584 | Ga0495668_0118375 | 3300046616 | Bacteria | 1449 |
| 585 | Ga0495668_0176269 | 3300046616 | Bacteria | 1171 |
| 586 | Ga0495634_0048467 | 3300046642 | Bacteria | 2860 |
| 587 | Ga0495625_0096038 | 3300046660 | Bacteria | 2042 |
| 588 | Ga0495625_0141186 | 3300046660 | Bacteria | 1625 |
| 589 | Ga0495625_0235325 | 3300046660 | Bacteria | 1195 |
| 590 | Ga0495635_0039556 | 3300046663 | Bacteria | 3261 |
| 591 | Ga0495659_0062482 | 3300046664 | Bacteria | 1378 |
| 592 | Ga0495661_0082112 | 3300046665 | Bacteria | 1856 |
| 593 | Ga0495661_0154702 | 3300046665 | Bacteria | 1236 |
| 594 | Ga0495661_0166016 | 3300046665 | Bacteria | 1181 |
| 595 | Ga0495588_0068955 | 3300046674 | Bacteria | 1837 |
| 596 | Ga0495588_0116574 | 3300046674 | Bacteria | 1407 |
| 597 | Ga0495657_0230830 | 3300046675 | Bacteria | 1119 |
| 598 | Ga0495646_0301078 | 3300046680 | Bacteria | 848 |
| 599 | Ga0495647_0010283 | 3300046681 | Bacteria | 3184 |
| 600 | Ga0495669_0045783 | 3300046684 | Bacteria | 1951 |
| 601 | Ga0495669_0163072 | 3300046684 | Bacteria | 1058 |
| 602 | Ga0495624_0186716 | 3300046690 | Bacteria | 1261 |
| 603 | Ga0495671_0151795 | 3300046692 | Bacteria | 1128 |
| 604 | Ga0495671_0155609 | 3300046692 | Bacteria | 1112 |
| 605 | Ga0495649_0108323 | 3300046694 | Bacteria | 1474 |
| 606 | Ga0495589_0143357 | 3300046794 | Bacteria | 1143 |
| 607 | Ga0495600_0103179 | 3300046809 | Bacteria | 1858 |
| 608 | Ga0495581_0225941 | 3300047315 | Bacteria | 1095 |
| 609 | Ga0495604_0115420 | 3300047317 | Bacteria | 1951 |
| 610 | Ga0495604_0419547 | 3300047317 | Bacteria | 878 |
| 611 | Ga0495636_0330569 | 3300047318 | Bacteria | 717 |
| 612 | Ga0495674_0119121 | 3300047319 | Bacteria | 2232 |
| 613 | Ga0495676_0028252 | 3300047321 | Bacteria | 4793 |
| 614 | Ga0495676_0036568 | 3300047321 | Bacteria | 4098 |
| 615 | Ga0495676_0316557 | 3300047321 | Bacteria | 1049 |
| 616 | Ga0495683_0179878 | 3300047323 | Bacteria | 966 |
| 617 | Ga0495687_050286 | 3300047443 | Bacteria | 1777 |
| 618 | Ga0495677_0282310 | 3300047445 | Bacteria | 651 |
| 619 | Ga0495679_034860 | 3300047446 | Bacteria | 1599 |
| 620 | Ga0495685_089361 | 3300047447 | Bacteria | 1022 |
| 621 | Ga0495673_0056106 | 3300047469 | Bacteria | 1706 |
| 622 | Ga0495673_0075947 | 3300047469 | Bacteria | 1402 |
| 623 | Ga0495681_0064641 | 3300047470 | Bacteria | 1675 |
| 624 | Ga0495684_0336736 | 3300047471 | Bacteria | 1075 |
| 625 | Ga0495593_0370936 | 3300047673 | Bacteria | 715 |
| 626 | Ga0495602_0056666 | 3300048088 | Bacteria | 3444 |
| 627 | Ga0496101_0080746 | 3300048904 | Bacteria | 2403 |
| 628 | Ga0496102_0013587 | 3300048905 | Bacteria | 7057 |
| 629 | Ga0496102_0900449 | 3300048905 | Bacteria | 806 |
| 630 | Ga0496104_0031429 | 3300048907 | Bacteria | 4937 |
| 631 | Ga0496104_0059165 | 3300048907 | Bacteria | 3627 |
| 632 | Ga0496105_0019733 | 3300048908 | Bacteria | 5438 |
| 633 | Ga0496105_0027418 | 3300048908 | Bacteria | 4653 |
| 634 | Ga0496105_0236469 | 3300048908 | Bacteria | 1483 |
| 635 | Ga0496106_0032474 | 3300048909 | Bacteria | 3892 |
| 636 | Ga0496106_0185232 | 3300048909 | Bacteria | 1654 |
| 637 | Ga0496106_0228129 | 3300048909 | Bacteria | 1486 |
| 638 | Ga0496106_0433607 | 3300048909 | Bacteria | 1056 |
| 639 | Ga0496106_0521764 | 3300048909 | Bacteria | 954 |
| 640 | Ga0496107_0173292 | 3300048910 | Bacteria | 1601 |
| 641 | Ga0496107_0383552 | 3300048910 | Bacteria | 1045 |
| 642 | Ga0496108_0096731 | 3300048911 | Bacteria | 2515 |
| 643 | Ga0496108_0575578 | 3300048911 | Bacteria | 982 |
| 644 | Ga0496109_0213814 | 3300048912 | Bacteria | 1813 |
| 645 | Ga0496109_0359484 | 3300048912 | Bacteria | 1375 |
| 646 | Ga0496110_0077186 | 3300048913 | Bacteria | 2963 |
| 647 | Ga0496110_0106130 | 3300048913 | Bacteria | 2520 |
| 648 | Ga0496110_0139014 | 3300048913 | Bacteria | 2196 |
| 649 | Ga0496110_0642889 | 3300048913 | Bacteria | 960 |
| 650 | Ga0496110_1013780 | 3300048913 | Bacteria | 738 |
| 651 | Ga0496111_0320510 | 3300048914 | Bacteria | 1148 |
| 652 | Ga0496112_0053052 | 3300048915 | Bacteria | 3981 |
| 653 | Ga0496113_0424221 | 3300048916 | Bacteria | 1068 |
| 654 | Ga0496113_0637739 | 3300048916 | Bacteria | 852 |
| 655 | Ga0496114_0011812 | 3300048917 | Bacteria | 6989 |
| 656 | Ga0496114_0935398 | 3300048917 | Bacteria | 749 |
| 657 | Ga0496115_0182239 | 3300048918 | Unclassified | 1736 |
| 658 | Ga0496116_0011308 | 3300048919 | Bacteria | 7405 |
| 659 | Ga0496116_0022209 | 3300048919 | Bacteria | 4761 |
| 660 | Ga0496116_0045939 | 3300048919 | Bacteria | 2951 |
| 661 | Ga0496116_0061458 | 3300048919 | Bacteria | 2432 |
| 662 | Ga0496116_0101125 | 3300048919 | Bacteria | 1722 |
| 663 | Ga0496116_0116367 | 3300048919 | Bacteria | 1558 |
| 664 | Ga0496116_0127317 | 3300048919 | Bacteria | 1460 |
| 665 | Ga0496116_0319628 | 3300048919 | Unclassified | 728 |
| 666 | Ga0496116_0362387 | 3300048919 | Bacteria | 658 |
| 667 | Ga0496117_0008289 | 3300048920 | Bacteria | 9890 |
| 668 | Ga0496117_0091766 | 3300048920 | Bacteria | 1952 |
| 669 | Ga0496117_0187294 | 3300048920 | Bacteria | 1183 |
| 670 | Ga0496117_0243722 | 3300048920 | Bacteria | 985 |
| 671 | Ga0496118_0011811 | 3300048921 | Bacteria | 8476 |
| 672 | Ga0496118_0026226 | 3300048921 | Bacteria | 4971 |
| 673 | Ga0496118_0038064 | 3300048921 | Bacteria | 3860 |
| 674 | Ga0496118_0066963 | 3300048921 | Bacteria | 2619 |
| 675 | Ga0496118_0081688 | 3300048921 | Bacteria | 2268 |
| 676 | Ga0496118_0138218 | 3300048921 | Bacteria | 1550 |
| 677 | Ga0496118_0149520 | 3300048921 | Bacteria | 1464 |
| 678 | Ga0496118_0161098 | 3300048921 | Bacteria | 1387 |
| 679 | Ga0496119_0011318 | 3300048922 | Bacteria | 7407 |
| 680 | Ga0496119_0019471 | 3300048922 | Bacteria | 4997 |
| 681 | Ga0496119_0053579 | 3300048922 | Bacteria | 2463 |
| 682 | Ga0496119_0087385 | 3300048922 | Bacteria | 1779 |
| 683 | Ga0496119_0100067 | 3300048922 | Bacteria | 1629 |
| 684 | Ga0496119_0247284 | 3300048922 | Bacteria | 901 |
| 685 | Ga0496120_0008182 | 3300048923 | Bacteria | 7665 |
| 686 | Ga0496120_0011217 | 3300048923 | Bacteria | 6181 |
| 687 | Ga0496120_0031156 | 3300048923 | Bacteria | 3234 |
| 688 | Ga0496120_0260218 | 3300048923 | Bacteria | 810 |
| 689 | Ga0496120_0386129 | 3300048923 | Bacteria | 621 |
| 690 | Ga0496121_0000385 | 3300048924 | Bacteria | 90105 |
| 691 | Ga0496121_0019557 | 3300048924 | Bacteria | 6763 |
| 692 | Ga0496121_0020698 | 3300048924 | Bacteria | 6491 |
| 693 | Ga0496121_0052575 | 3300048924 | Bacteria | 3419 |
| 694 | Ga0496121_0059413 | 3300048924 | Bacteria | 3153 |
| 695 | Ga0496121_0061831 | 3300048924 | Bacteria | 3070 |
| 696 | Ga0496121_0115968 | 3300048924 | Bacteria | 2032 |
| 697 | Ga0496121_0171782 | 3300048924 | Unclassified | 1574 |
| 698 | Ga0496121_0189191 | 3300048924 | Bacteria | 1477 |
| 699 | Ga0496121_0230496 | 3300048924 | Bacteria | 1297 |
| 700 | Ga0496121_0306453 | 3300048924 | Bacteria | 1075 |
| 701 | Ga0496122_0020644 | 3300048925 | Bacteria | 5936 |
| 702 | Ga0496122_0034937 | 3300048925 | Bacteria | 4103 |
| 703 | Ga0496122_0049005 | 3300048925 | Bacteria | 3242 |
| 704 | Ga0496122_0119178 | 3300048925 | Bacteria | 1707 |
| 705 | Ga0496122_0162597 | 3300048925 | Bacteria | 1359 |
| 706 | Ga0496122_0268277 | 3300048925 | Bacteria | 942 |
| 707 | Ga0496122_0309747 | 3300048925 | Bacteria | 846 |
| 708 | Ga0496123_0035712 | 3300048926 | Bacteria | 3537 |
| 709 | Ga0496123_0101571 | 3300048926 | Bacteria | 1672 |
| 710 | Ga0496123_0106375 | 3300048926 | Bacteria | 1616 |
| 711 | Ga0496124_0024791 | 3300048927 | Bacteria | 5445 |
| 712 | Ga0496124_0042228 | 3300048927 | Bacteria | 3928 |
| 713 | Ga0496124_0056592 | 3300048927 | Bacteria | 3307 |
| 714 | Ga0496124_0103018 | 3300048927 | Bacteria | 2309 |
| 715 | Ga0496124_0105393 | 3300048927 | Bacteria | 2278 |
| 716 | Ga0496124_0127929 | 3300048927 | Bacteria | 2022 |
| 717 | Ga0496124_0195402 | 3300048927 | Bacteria | 1544 |
| 718 | Ga0496124_0336336 | 3300048927 | Bacteria | 1074 |
| 719 | Ga0496124_0407652 | 3300048927 | Bacteria | 941 |
| 720 | Ga0496125_0001624 | 3300048928 | Bacteria | 31668 |
| 721 | Ga0496125_0009603 | 3300048928 | Bacteria | 9897 |
| 722 | Ga0496125_0011997 | 3300048928 | Bacteria | 8629 |
| 723 | Ga0496125_0073441 | 3300048928 | Bacteria | 2659 |
| 724 | Ga0496125_0168177 | 3300048928 | Bacteria | 1478 |
| 725 | Ga0496125_0174668 | 3300048928 | Bacteria | 1439 |
| 726 | Ga0496125_0187454 | 3300048928 | Bacteria | 1370 |
| 727 | Ga0496126_0005539 | 3300048929 | Bacteria | 14372 |
| 728 | Ga0496126_0012136 | 3300048929 | Bacteria | 8844 |
| 729 | Ga0496126_0046270 | 3300048929 | Bacteria | 3993 |
| 730 | Ga0496126_0054918 | 3300048929 | Bacteria | 3605 |
| 731 | Ga0496126_0058664 | 3300048929 | Bacteria | 3468 |
| 732 | Ga0496126_0101673 | 3300048929 | Bacteria | 2514 |
| 733 | Ga0496126_0189392 | 3300048929 | Bacteria | 1743 |
| 734 | Ga0496126_0191230 | 3300048929 | Bacteria | 1733 |
| 735 | Ga0496126_0290391 | 3300048929 | Bacteria | 1352 |
| 736 | Ga0495682_0082694 | 3300049460 | Bacteria | 1155 |
| 737 | Ga0495682_0160173 | 3300049460 | Bacteria | 801 |
| 738 | Ga0501040_0354214 | 3300049576 | Bacteria | 1052 |
| 739 | Ga0501067_0256727 | 3300049583 | Bacteria | 973 |
| 740 | Ga0501069_0306168 | 3300049585 | Bacteria | 932 |
| 741 | Ga0501072_0005470 | 3300049588 | Bacteria | 9672 |
| 742 | Ga0501076_0200135 | 3300049592 | Bacteria | 1631 |
| 743 | Ga0501083_0017990 | 3300049744 | Bacteria | 4929 |
| 744 | Ga0501083_0104790 | 3300049744 | Bacteria | 1863 |
| 745 | Ga0501044_0060247 | 3300049823 | Bacteria | 3887 |
| 746 | nmdc:mga03683_111095_c1 | 3300050489 | Bacteria | 1212 |
| 747 | nmdc:mga03683_132301_c1 | 3300050489 | Bacteria | 1117 |
| 748 | nmdc:mga03n38_260768_c1 | 3300050490 | Bacteria | 919 |
| 749 | nmdc:mga00v17_119137_c1 | 3300050491 | Bacteria | 1680 |
| 750 | nmdc:mga00v17_40638_c1 | 3300050491 | Bacteria | 2790 |
| 751 | nmdc:mga0yw44_105680_c1 | 3300050492 | Bacteria | 1799 |
| 752 | nmdc:mga0yw44_178244_c1 | 3300050492 | Bacteria | 1398 |
| 753 | nmdc:mga0yw44_179543_c1 | 3300050492 | Bacteria | 1393 |
| 754 | nmdc:mga0yw44_20981_c1 | 3300050492 | Bacteria | 3636 |
| 755 | nmdc:mga0yw44_319521_c1 | 3300050492 | Bacteria | 1042 |
| 756 | nmdc:mga0yw44_51441_c1 | 3300050492 | Bacteria | 2494 |
| 757 | nmdc:mga0yw44_608085_c1 | 3300050492 | Bacteria | 743 |
| 758 | nmdc:mga0yw44_8581_c1 | 3300050492 | Bacteria | 5103 |
| 759 | nmdc:mga0k408_378583_c1 | 3300050493 | Bacteria | 843 |
| 760 | nmdc:mga0k408_5289_c1 | 3300050493 | Bacteria | 6853 |
| 761 | nmdc:mga0k408_74953_c1 | 3300050493 | Bacteria | 1977 |
| 762 | nmdc:mga06z11_21787_c1 | 3300050494 | Bacteria | 2983 |
| 763 | nmdc:mga06z11_303415_c1 | 3300050494 | Bacteria | 950 |
| 764 | nmdc:mga06z11_391985_c1 | 3300050494 | Bacteria | 835 |
| 765 | nmdc:mga06z11_44366_c1 | 3300050494 | Bacteria | 2242 |
| 766 | nmdc:mga04h51_24889_c1 | 3300050495 | Bacteria | 1838 |
| 767 | nmdc:mga07m45_196195_c1 | 3300050496 | Bacteria | 1174 |
| 768 | nmdc:mga07m45_247912_c1 | 3300050496 | Bacteria | 1036 |
| 769 | nmdc:mga07m45_267915_c1 | 3300050496 | Bacteria | 994 |
| 770 | nmdc:mga07m45_435776_c1 | 3300050496 | Bacteria | 760 |
| 771 | nmdc:mga05p37_96999_c1 | 3300050507 | Bacteria | 3632 |
| 772 | nmdc:mga0qj67_634343_c1 | 3300050509 | Bacteria | 853 |
| 773 | nmdc:mga08y16_86315_c1 | 3300050511 | Bacteria | 3270 |
| 774 | nmdc:mga0n895_252685_c1 | 3300050512 | Bacteria | 1789 |
| 775 | nmdc:mga0n895_456065_c1 | 3300050512 | Bacteria | 1290 |
| 776 | nmdc:mga08x19_614961_c1 | 3300050514 | Bacteria | 770 |
| 777 | nmdc:mga0a205_818705_c1 | 3300050515 | Bacteria | 779 |
| 778 | nmdc:mga0a205_836351_c1 | 3300050515 | Bacteria | 768 |
| 779 | nmdc:mga0sz30_121410_c1 | 3300050516 | Bacteria | 1148 |
| 780 | nmdc:mga0sz30_23751_c1 | 3300050516 | Bacteria | 2498 |
| 781 | nmdc:mga0sz30_43538_c1 | 3300050516 | Bacteria | 1890 |
| 782 | nmdc:mga0sz30_85822_c1 | 3300050516 | Bacteria | 1366 |
| 783 | nmdc:mga0sz30_90231_c1 | 3300050516 | Bacteria | 1333 |
| 784 | Ga0500635_0038061 | 3300053080 | Bacteria | 1594 |
| 785 | Ga0500635_0130770 | 3300053080 | Bacteria | 946 |
| 786 | Ga0495655_0074753 | 3300053083 | Bacteria | 955 |
| 787 | Ga0495619_0296383 | 3300053085 | Bacteria | 1120 |
| 788 | Ga0500578_0078489 | 3300053086 | Bacteria | 2101 |
| 789 | Ga0500578_0227404 | 3300053086 | Bacteria | 1132 |
| 790 | Ga0500643_000210 | 3300053087 | Bacteria | 55059 |
| 791 | Ga0500643_027964 | 3300053087 | Bacteria | 1747 |
| 792 | Ga0500643_034542 | 3300053087 | Bacteria | 1522 |
| 793 | Ga0500644_0015890 | 3300053088 | Bacteria | 2157 |
| 794 | Ga0500581_094737 | 3300053089 | Bacteria | 1475 |
| 795 | Ga0500646_0039027 | 3300053090 | Bacteria | 1331 |
| 796 | Ga0500583_0137198 | 3300053092 | Bacteria | 1214 |
| 797 | Ga0500651_0044122 | 3300053093 | Bacteria | 2808 |
| 798 | Ga0500651_0133456 | 3300053093 | Bacteria | 1500 |
| 799 | Ga0500651_0275141 | 3300053093 | Unclassified | 973 |
| 800 | Ga0500566_0005375 | 3300053094 | Bacteria | 7616 |
| 801 | Ga0500566_0016861 | 3300053094 | Bacteria | 4287 |
| 802 | Ga0500640_071568 | 3300053095 | Bacteria | 1486 |
| 803 | Ga0500641_0009642 | 3300053096 | Bacteria | 3472 |
| 804 | Ga0500641_0079733 | 3300053096 | Bacteria | 1388 |
| 805 | Ga0500650_0087386 | 3300053098 | Bacteria | 1459 |
| 806 | Ga0500555_008898 | 3300053103 | Bacteria | 2867 |
| 807 | Ga0500555_022271 | 3300053103 | Bacteria | 1821 |
| 808 | Ga0500555_039334 | 3300053103 | Bacteria | 1321 |
| 809 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 810 | Ga0500556_0009402 | 3300053104 | Bacteria | 2840 |
| 811 | Ga0500556_0053913 | 3300053104 | Bacteria | 1463 |
| 812 | Ga0500557_000034 | 3300053105 | Bacteria | 71225 |
| 813 | Ga0500562_013400 | 3300053108 | Bacteria | 2093 |
| 814 | Ga0500562_016909 | 3300053108 | Bacteria | 1876 |
| 815 | Ga0500562_021432 | 3300053108 | Bacteria | 1681 |
| 816 | Ga0500569_008862 | 3300053109 | Bacteria | 2315 |
| 817 | Ga0500569_050540 | 3300053109 | Bacteria | 1253 |
| 818 | Ga0500592_005117 | 3300053116 | Bacteria | 2082 |
| 819 | Ga0500592_011853 | 3300053116 | Bacteria | 1394 |
| 820 | Ga0500593_022884 | 3300053117 | Bacteria | 2762 |
| 821 | Ga0500594_0010902 | 3300053118 | Bacteria | 2117 |
| 822 | Ga0500594_0028708 | 3300053118 | Bacteria | 1450 |
| 823 | Ga0500595_000665 | 3300053119 | Bacteria | 20620 |
| 824 | Ga0500595_002372 | 3300053119 | Bacteria | 9413 |
| 825 | Ga0500595_004206 | 3300053119 | Bacteria | 6510 |
| 826 | Ga0500595_032968 | 3300053119 | Bacteria | 1723 |
| 827 | Ga0500597_043919 | 3300053120 | Bacteria | 1888 |
| 828 | Ga0500608_011645 | 3300053122 | Bacteria | 3827 |
| 829 | Ga0500614_016922 | 3300053123 | Bacteria | 1642 |
| 830 | Ga0500621_208680 | 3300053126 | Bacteria | 686 |
| 831 | Ga0500642_0000053 | 3300053130 | Bacteria | 71632 |
| 832 | Ga0500642_0000167 | 3300053130 | Bacteria | 27218 |
| 833 | Ga0500642_0014576 | 3300053130 | Bacteria | 2930 |
| 834 | Ga0500642_0014948 | 3300053130 | Bacteria | 2903 |
| 835 | Ga0500642_0055120 | 3300053130 | Bacteria | 1767 |
| 836 | Ga0500642_0059513 | 3300053130 | Bacteria | 1711 |
| 837 | Ga0500652_001522 | 3300053131 | Bacteria | 7114 |
| 838 | Ga0500655_075826 | 3300053133 | Bacteria | 688 |
| 839 | Ga0500658_0032658 | 3300053134 | Bacteria | 2042 |
| 840 | Ga0500559_0177366 | 3300053136 | Bacteria | 1003 |
| 841 | Ga0500568_0059458 | 3300053139 | Bacteria | 1483 |
| 842 | Ga0500577_0032842 | 3300053142 | Bacteria | 1829 |
| 843 | Ga0500577_0065289 | 3300053142 | Bacteria | 1412 |
| 844 | Ga0500577_0157458 | 3300053142 | Bacteria | 966 |
| 845 | Ga0500588_0166240 | 3300053146 | Bacteria | 805 |
| 846 | Ga0500588_0186811 | 3300053146 | Bacteria | 763 |
| 847 | Ga0500588_0191882 | 3300053146 | Bacteria | 754 |
| 848 | Ga0500589_105651 | 3300053147 | Bacteria | 1216 |
| 849 | Ga0500590_138053 | 3300053148 | Bacteria | 1118 |
| 850 | Ga0500604_0004751 | 3300053151 | Bacteria | 3599 |
| 851 | Ga0500604_0073337 | 3300053151 | Bacteria | 1095 |
| 852 | Ga0500604_0110037 | 3300053151 | Bacteria | 914 |
| 853 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 854 | Ga0500620_077788 | 3300053155 | Bacteria | 1147 |
| 855 | Ga0500620_117420 | 3300053155 | Bacteria | 932 |
| 856 | Ga0500622_0000826 | 3300053156 | Bacteria | 26531 |
| 857 | Ga0500622_0099540 | 3300053156 | Bacteria | 1433 |
| 858 | Ga0500627_0028603 | 3300053158 | Bacteria | 2316 |
| 859 | Ga0500633_0048037 | 3300053160 | Bacteria | 1462 |
| 860 | Ga0500634_0116844 | 3300053161 | Bacteria | 1305 |
| 861 | Ga0500634_0144840 | 3300053161 | Bacteria | 1119 |
| 862 | Ga0500638_126172 | 3300053162 | Bacteria | 1165 |
| 863 | Ga0500639_177906 | 3300053163 | Bacteria | 945 |
| 864 | Ga0500636_0000033 | 3300053177 | Bacteria | 72990 |
| 865 | Ga0500636_0136147 | 3300053177 | Bacteria | 1364 |
| 866 | Ga0500637_0000356 | 3300053178 | Bacteria | 17344 |
| 867 | Ga0500649_085079 | 3300053722 | Bacteria | 1279 |
| 868 | Ga0500645_005159 | 3300053730 | Bacteria | 4867 |
| 869 | Ga0500645_006872 | 3300053730 | Bacteria | 4018 |
| 870 | Ga0500645_032492 | 3300053730 | Bacteria | 1565 |
| 871 | Ga0500601_000010 | 3300053737 | Bacteria | 45442 |
| 872 | Ga0500661_000328 | 3300055283 | Bacteria | 8643 |
| 873 | Ga0500661_001465 | 3300055283 | Bacteria | 4430 |
| 874 | Ga0587079_055204 | 3300059647 | Bacteria | 845 |
| 875 | Ga0501082_0002219 | 3300060353 | Bacteria | 16983 |
| 876 | Ga0501082_0223448 | 3300060353 | Bacteria | 1639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048919 | Ga0496116_0362387 | Ga0496116_0362387_47_562 | 166 |
| 2 | 3300048923 | Ga0496120_0386129 | Ga0496120_0386129_82_597 | 166 |
| 3 | 3300048925 | Ga0496122_0268277 | Ga0496122_0268277_342_857 | 166 |
| 4 | 3300046542 | Ga0495597_0305828 | Ga0495597_0305828_15_539 | 169 |
| 5 | iso_pu_bacteria | 2857472729 | 2857479022 | 193 |
| 6 | iso_pu_bacteria | 2511231119 | 2511701330 | 194 |
| 7 | iso_pu_bacteria | 2540341094 | 2540608528 | 194 |
| 8 | iso_pu_bacteria | 2545555800 | 2545557955 | 194 |
| 9 | iso_pu_bacteria | 2554235283 | 2555468507 | 194 |
| 10 | iso_pu_bacteria | 2576861599 | 2578932351 | 194 |
| 11 | iso_pu_bacteria | 2599185353 | 2600199796 | 194 |
| 12 | iso_pu_bacteria | 2630968484 | 2631986526 | 194 |
| 13 | iso_pu_bacteria | 2643221543 | 2643736499 | 194 |
| 14 | iso_pu_bacteria | 2643221735 | 2644738687 | 194 |
| 15 | iso_pu_bacteria | 2648501850 | 2651530948 | 194 |
| 16 | iso_pu_bacteria | 2671180844 | 2674421812 | 194 |
| 17 | iso_pu_bacteria | 2684623153 | 2686998650 | 194 |
| 18 | iso_pu_bacteria | 2687453109 | 2687499930 | 194 |
| 19 | iso_pu_bacteria | 2695420354 | 2695629285 | 194 |
| 20 | iso_pu_bacteria | 2716884898 | 2717915014 | 194 |
| 21 | iso_pu_bacteria | 2721755693 | 2723604575 | 194 |
| 22 | iso_pu_bacteria | 2728369359 | 2730135216 | 194 |
| 23 | iso_pu_bacteria | 2751185905 | 2753809974 | 194 |
| 24 | iso_pu_bacteria | 2802428803 | 2802436837 | 194 |
| 25 | iso_pu_bacteria | 2808606399 | 2809053668 | 194 |
| 26 | iso_pu_bacteria | 2818991468 | 2819722848 | 194 |
| 27 | iso_pu_bacteria | 2823526263 | 2823529870 | 194 |
| 28 | iso_pu_bacteria | 2860837431 | 2860841337 | 194 |
| 29 | iso_pu_bacteria | 2864733723 | 2864739451 | 194 |
| 30 | iso_pu_bacteria | 2877768649 | 2877772219 | 194 |
| 31 | iso_pu_bacteria | 2880169592 | 2880173058 | 194 |
| 32 | iso_pu_bacteria | 2889042446 | 2889045132 | 194 |
| 33 | iso_pu_bacteria | 2889276214 | 2889280482 | 194 |
| 34 | iso_pu_bacteria | 2889295896 | 2889299995 | 194 |
| 35 | iso_pu_bacteria | 2897109615 | 2897113336 | 194 |
| 36 | iso_pu_bacteria | 2904490793 | 2904492024 | 194 |
| 37 | iso_pu_bacteria | 2904560550 | 2904561659 | 194 |
| 38 | iso_pu_bacteria | 2904595352 | 2904595586 | 194 |
| 39 | iso_pu_bacteria | 2904755435 | 2904762624 | 194 |
| 40 | iso_pu_bacteria | 2908665501 | 2908667126 | 194 |
| 41 | iso_pu_bacteria | 2919093281 | 2919094858 | 194 |
| 42 | iso_pu_bacteria | 2919160200 | 2919161260 | 194 |
| 43 | iso_pu_bacteria | 2919726948 | 2919727434 | 194 |
| 44 | iso_pu_bacteria | 2929206907 | 2929207685 | 194 |
| 45 | iso_pu_bacteria | 2931384279 | 2931388567 | 194 |
| 46 | iso_pu_bacteria | 2939702853 | 2939705340 | 194 |
| 47 | iso_pu_bacteria | 2945991243 | 2945992842 | 194 |
| 48 | iso_pu_bacteria | 2946053406 | 2946055584 | 194 |
| 49 | iso_pu_bacteria | 2954773129 | 2954776699 | 194 |
| 50 | iso_pu_bacteria | 2962290636 | 2962294572 | 194 |
| 51 | iso_pu_bacteria | 2969136845 | 2969140506 | 194 |
| 52 | iso_pu_bacteria | 2969141011 | 2969144776 | 194 |
| 53 | iso_pu_bacteria | 2969770375 | 2969771020 | 194 |
| 54 | iso_pu_bacteria | 2971893375 | 2971896901 | 194 |
| 55 | iso_pu_bacteria | 2980492589 | 2980496334 | 194 |
| 56 | iso_pu_bacteria | 2981284811 | 2981286915 | 194 |
| 57 | iso_pu_bacteria | 2981289755 | 2981291866 | 194 |
| 58 | iso_pu_bacteria | 2981980479 | 2981982553 | 194 |
| 59 | iso_pu_bacteria | 2981985349 | 2981987661 | 194 |
| 60 | iso_pu_bacteria | 2984527788 | 2984529331 | 194 |
| 61 | iso_pu_bacteria | 2984532647 | 2984535437 | 194 |
| 62 | iso_pu_bacteria | 3006879489 | 3006883040 | 194 |
| 63 | iso_pu_bacteria | 648028048 | 648170616 | 194 |
| 64 | iso_pu_bacteria | 8002317523 | 8002319449 | 194 |
| 65 | iso_pu_bacteria | 8022630665 | 8022632436 | 194 |
| 66 | iso_pu_bacteria | 8022653035 | 8022656789 | 194 |
| 67 | iso_pu_bacteria | 8046991243 | 8046992928 | 194 |
| 68 | iso_pu_bacteria | 8051952484 | 8051954167 | 194 |
| 69 | iso_pu_bacteria | 8052174270 | 8052175748 | 194 |
| 70 | 3300003187 | JGI25151J46595_10022130 | JGI25151J46595_100221303 | 195 |
| 71 | 3300003761 | Ga0055535_1005445 | Ga0055535_10054453 | 195 |
| 72 | 3300025242 | Ga0209258_101224 | Ga0209258_1012243 | 195 |
| 73 | 3300025294 | Ga0209025_1007977 | Ga0209025_10079777 | 195 |
| 74 | iso_pu_bacteria | 2821111986 | 2821113318 | 195 |
| 75 | iso_pu_bacteria | 2885526491 | 2885526587 | 195 |
| 76 | iso_pu_bacteria | 2904162308 | 2904165136 | 195 |
| 77 | iso_pu_bacteria | 2907202186 | 2907204819 | 195 |
| 78 | iso_pu_bacteria | 2643221676 | 2644426134 | 196 |
| 79 | 3300003187 | JGI25151J46595_10000092 | JGI25151J46595_1000009248 | 197 |
| 80 | 3300003578 | Ga0006562J51391_1001650 | Ga0006562J51391_10016508 | 197 |
| 81 | 3300003841 | Ga0055541_1001604 | Ga0055541_10016045 | 197 |
| 82 | 3300003841 | Ga0055541_1004867 | Ga0055541_10048673 | 197 |
| 83 | 3300009011 | Ga0105251_10078838 | Ga0105251_100788382 | 197 |
| 84 | 3300009036 | Ga0105244_10007742 | Ga0105244_100077425 | 197 |
| 85 | 3300009036 | Ga0105244_10039646 | Ga0105244_100396462 | 197 |
| 86 | 3300011119 | Ga0105246_10044778 | Ga0105246_100447783 | 197 |
| 87 | 3300025224 | Ga0209784_101922 | Ga0209784_1019222 | 197 |
| 88 | 3300025225 | Ga0209566_100035 | Ga0209566_100035175 | 197 |
| 89 | 3300025225 | Ga0209566_100086 | Ga0209566_100086130 | 197 |
| 90 | 3300025229 | Ga0209147_108509 | Ga0209147_1085092 | 197 |
| 91 | 3300025233 | Ga0209437_100938 | Ga0209437_1009382 | 197 |
| 92 | 3300025242 | Ga0209258_104743 | Ga0209258_1047433 | 197 |
| 93 | 3300025294 | Ga0209025_1000011 | Ga0209025_1000011484 | 197 |
| 94 | 3300025294 | Ga0209025_1028047 | Ga0209025_10280473 | 197 |
| 95 | 3300025294 | Ga0209025_1068651 | Ga0209025_10686511 | 197 |
| 96 | 3300027312 | Ga0209371_1019012 | Ga0209371_10190123 | 197 |
| 97 | 3300030500 | Ga0268256_1021141 | Ga0268256_10211413 | 197 |
| 98 | 3300041404 | Ga0439436_0014817 | Ga0439436_0014817_1038_1679 | 197 |
| 99 | 3300041406 | Ga0439439_0005528 | Ga0439439_0005528_1747_2388 | 197 |
| 100 | 3300042007 | Ga0439449_0000025 | Ga0439449_0000025_22627_23268 | 197 |
| 101 | 3300042014 | Ga0439457_008775 | Ga0439457_008775_1413_2054 | 197 |
| 102 | 3300042015 | Ga0439462_0013810 | Ga0439462_0013810_919_1560 | 197 |
| 103 | 3300046665 | Ga0495661_0166016 | Ga0495661_0166016_303_917 | 197 |
| 104 | 3300048919 | Ga0496116_0011308 | Ga0496116_0011308_4177_4788 | 197 |
| 105 | 3300048919 | Ga0496116_0022209 | Ga0496116_0022209_1219_1839 | 197 |
| 106 | 3300048919 | Ga0496116_0061458 | Ga0496116_0061458_221_841 | 197 |
| 107 | 3300048919 | Ga0496116_0319628 | Ga0496116_0319628_97_708 | 197 |
| 108 | 3300048920 | Ga0496117_0008289 | Ga0496117_0008289_5478_6089 | 197 |
| 109 | 3300048921 | Ga0496118_0011811 | Ga0496118_0011811_2373_2984 | 197 |
| 110 | 3300048922 | Ga0496119_0011318 | Ga0496119_0011318_1137_1748 | 197 |
| 111 | 3300048923 | Ga0496120_0008182 | Ga0496120_0008182_5208_5819 | 197 |
| 112 | 3300048924 | Ga0496121_0052575 | Ga0496121_0052575_1434_2045 | 197 |
| 113 | 3300048924 | Ga0496121_0059413 | Ga0496121_0059413_1840_2460 | 197 |
| 114 | 3300048924 | Ga0496121_0061831 | Ga0496121_0061831_731_1342 | 197 |
| 115 | 3300048924 | Ga0496121_0171782 | Ga0496121_0171782_49_669 | 197 |
| 116 | 3300048925 | Ga0496122_0020644 | Ga0496122_0020644_666_1277 | 197 |
| 117 | 3300048925 | Ga0496122_0034937 | Ga0496122_0034937_237_920 | 197 |
| 118 | 3300048925 | Ga0496122_0049005 | Ga0496122_0049005_1468_2079 | 197 |
| 119 | 3300048925 | Ga0496122_0162597 | Ga0496122_0162597_333_953 | 197 |
| 120 | 3300048925 | Ga0496122_0309747 | Ga0496122_0309747_117_737 | 197 |
| 121 | 3300048926 | Ga0496123_0035712 | Ga0496123_0035712_1343_1954 | 197 |
| 122 | 3300048926 | Ga0496123_0101571 | Ga0496123_0101571_108_791 | 197 |
| 123 | 3300048927 | Ga0496124_0042228 | Ga0496124_0042228_1327_1947 | 197 |
| 124 | 3300048927 | Ga0496124_0056592 | Ga0496124_0056592_430_1050 | 197 |
| 125 | 3300048927 | Ga0496124_0105393 | Ga0496124_0105393_417_1028 | 197 |
| 126 | 3300048927 | Ga0496124_0336336 | Ga0496124_0336336_442_1053 | 197 |
| 127 | 3300048928 | Ga0496125_0001624 | Ga0496125_0001624_29698_30309 | 197 |
| 128 | 3300048928 | Ga0496125_0009603 | Ga0496125_0009603_419_1039 | 197 |
| 129 | 3300048929 | Ga0496126_0054918 | Ga0496126_0054918_48_659 | 197 |
| 130 | 3300059647 | Ga0587079_055204 | Ga0587079_055204_101_715 | 197 |
| 131 | iso_pu_bacteria | 2811994870 | 2812313840 | 197 |
| 132 | iso_pu_bacteria | 2939679117 | 2939682680 | 197 |
| 133 | iso_pu_bacteria | 2602042107 | 2603857907 | 198 |
| 134 | iso_pu_bacteria | 2857524615 | 2857527281 | 198 |
| 135 | iso_pu_bacteria | 2919073203 | 2919078396 | 198 |
| 136 | iso_pu_bacteria | 2828305725 | 2828307161 | 199 |
| 137 | iso_pu_bacteria | 2507262055 | 2507504586 | 201 |
| 138 | iso_pu_bacteria | 2508501009 | 2508546014 | 201 |
| 139 | iso_pu_bacteria | 2508501042 | 2508694861 | 201 |
| 140 | iso_pu_bacteria | 2511231028 | 2511393398 | 201 |
| 141 | iso_pu_bacteria | 2513237092 | 2513626549 | 201 |
| 142 | iso_pu_bacteria | 2513237094 | 2513638454 | 201 |
| 143 | iso_pu_bacteria | 2513237095 | 2513649366 | 201 |
| 144 | iso_pu_bacteria | 2513237098 | 2513671656 | 201 |
| 145 | iso_pu_bacteria | 2513237102 | 2513699381 | 201 |
| 146 | iso_pu_bacteria | 2513237139 | 2513875563 | 201 |
| 147 | iso_pu_bacteria | 2513237161 | 2514011046 | 201 |
| 148 | iso_pu_bacteria | 2515154112 | 2515624206 | 201 |
| 149 | iso_pu_bacteria | 2517093001 | 2517102911 | 201 |
| 150 | iso_pu_bacteria | 2524023205 | 2524438726 | 201 |
| 151 | iso_pu_bacteria | 2528768022 | 2528854444 | 201 |
| 152 | iso_pu_bacteria | 2617270735 | 2617347590 | 201 |
| 153 | iso_pu_bacteria | 2617270741 | 2617376998 | 201 |
| 154 | iso_pu_bacteria | 2721755755 | 2723845158 | 201 |
| 155 | iso_pu_bacteria | 2728368998 | 2728748007 | 201 |
| 156 | iso_pu_bacteria | 2744054633 | 2745080486 | 201 |
| 157 | iso_pu_bacteria | 2791355196 | 2793063568 | 201 |
| 158 | iso_pu_bacteria | 2791355199 | 2793080921 | 201 |
| 159 | iso_pu_bacteria | 2802429603 | 2805921082 | 201 |
| 160 | iso_pu_bacteria | 2816332527 | 2818237046 | 201 |
| 161 | iso_pu_bacteria | 2824600985 | 2824606344 | 201 |
| 162 | iso_pu_bacteria | 2824609381 | 2824612081 | 201 |
| 163 | iso_pu_bacteria | 2824617872 | 2824619220 | 201 |
| 164 | iso_pu_bacteria | 2824626560 | 2824628131 | 201 |
| 165 | iso_pu_bacteria | 2824635225 | 2824636907 | 201 |
| 166 | iso_pu_bacteria | 2824644064 | 2824645709 | 201 |
| 167 | iso_pu_bacteria | 2824653114 | 2824658468 | 201 |
| 168 | iso_pu_bacteria | 2824661429 | 2824668034 | 201 |
| 169 | iso_pu_bacteria | 2824671348 | 2824676764 | 201 |
| 170 | iso_pu_bacteria | 2824679649 | 2824683241 | 201 |
| 171 | iso_pu_bacteria | 2824687955 | 2824694044 | 201 |
| 172 | iso_pu_bacteria | 2824696289 | 2824701597 | 201 |
| 173 | iso_pu_bacteria | 2824704595 | 2824710293 | 201 |
| 174 | iso_pu_bacteria | 2824714736 | 2824715888 | 201 |
| 175 | iso_pu_bacteria | 2824723954 | 2824725370 | 201 |
| 176 | iso_pu_bacteria | 2824732956 | 2824736866 | 201 |
| 177 | iso_pu_bacteria | 2824746037 | 2824747593 | 201 |
| 178 | iso_pu_bacteria | 2824753945 | 2824760913 | 201 |
| 179 | iso_pu_bacteria | 2824763712 | 2824767678 | 201 |
| 180 | iso_pu_bacteria | 2824773399 | 2824777069 | 201 |
| 181 | iso_pu_bacteria | 2838122688 | 2838129182 | 201 |
| 182 | iso_pu_bacteria | 2841941048 | 2841944190 | 201 |
| 183 | iso_pu_bacteria | 2841949485 | 2841954635 | 201 |
| 184 | iso_pu_bacteria | 2841957949 | 2841963068 | 201 |
| 185 | iso_pu_bacteria | 2841966195 | 2841968972 | 201 |
| 186 | iso_pu_bacteria | 2841974524 | 2841979746 | 201 |
| 187 | iso_pu_bacteria | 2841983080 | 2841989658 | 201 |
| 188 | iso_pu_bacteria | 2842038055 | 2842044175 | 201 |
| 189 | iso_pu_bacteria | 2842045827 | 2842051836 | 201 |
| 190 | iso_pu_bacteria | 2847930680 | 2847931827 | 201 |
| 191 | iso_pu_bacteria | 2847939898 | 2847941488 | 201 |
| 192 | iso_pu_bacteria | 2849076700 | 2849082399 | 201 |
| 193 | iso_pu_bacteria | 2857509624 | 2857516533 | 201 |
| 194 | iso_pu_bacteria | 2874590934 | 2874595508 | 201 |
| 195 | iso_pu_bacteria | 2874604998 | 2874605127 | 201 |
| 196 | iso_pu_bacteria | 2874612657 | 2874615902 | 201 |
| 197 | iso_pu_bacteria | 2874620515 | 2874621517 | 201 |
| 198 | iso_pu_bacteria | 2874628541 | 2874629453 | 201 |
| 199 | iso_pu_bacteria | 2874645413 | 2874647053 | 201 |
| 200 | iso_pu_bacteria | 2876761206 | 2876765881 | 201 |
| 201 | iso_pu_bacteria | 2876771140 | 2876775702 | 201 |
| 202 | iso_pu_bacteria | 2876808645 | 2876813287 | 201 |
| 203 | iso_pu_bacteria | 2876818435 | 2876823694 | 201 |
| 204 | iso_pu_bacteria | 2879074833 | 2879079793 | 201 |
| 205 | iso_pu_bacteria | 2879083081 | 2879091263 | 201 |
| 206 | iso_pu_bacteria | 2879099564 | 2879103071 | 201 |
| 207 | iso_pu_bacteria | 2879110137 | 2879113631 | 201 |
| 208 | iso_pu_bacteria | 2879127579 | 2879131128 | 201 |
| 209 | iso_pu_bacteria | 2879142872 | 2879150334 | 201 |
| 210 | iso_pu_bacteria | 2881364244 | 2881369805 | 201 |
| 211 | iso_pu_bacteria | 2881665667 | 2881668646 | 201 |
| 212 | iso_pu_bacteria | 2885366525 | 2885368265 | 201 |
| 213 | iso_pu_bacteria | 2885383462 | 2885385128 | 201 |
| 214 | iso_pu_bacteria | 2888378607 | 2888380246 | 201 |
| 215 | iso_pu_bacteria | 2888388044 | 2888391277 | 201 |
| 216 | iso_pu_bacteria | 2888419890 | 2888427159 | 201 |
| 217 | iso_pu_bacteria | 2889033259 | 2889039901 | 201 |
| 218 | iso_pu_bacteria | 2903768456 | 2903769513 | 201 |
| 219 | iso_pu_bacteria | 2904666416 | 2904668186 | 201 |
| 220 | iso_pu_bacteria | 2904711408 | 2904719971 | 201 |
| 221 | iso_pu_bacteria | 2906626472 | 2906634554 | 201 |
| 222 | iso_pu_bacteria | 2908775508 | 2908782904 | 201 |
| 223 | iso_pu_bacteria | 2922361189 | 2922365293 | 201 |
| 224 | iso_pu_bacteria | 2922368715 | 2922369813 | 201 |
| 225 | iso_pu_bacteria | 2922386360 | 2922390915 | 201 |
| 226 | iso_pu_bacteria | 2922393267 | 2922398764 | 201 |
| 227 | iso_pu_bacteria | 2929615660 | 2929622828 | 201 |
| 228 | iso_pu_bacteria | 2929624759 | 2929632068 | 201 |
| 229 | iso_pu_bacteria | 2932794094 | 2932796192 | 201 |
| 230 | iso_pu_bacteria | 2932801729 | 2932807766 | 201 |
| 231 | iso_pu_bacteria | 2932809354 | 2932815408 | 201 |
| 232 | iso_pu_bacteria | 2932818245 | 2932825153 | 201 |
| 233 | iso_pu_bacteria | 2932828146 | 2932829321 | 201 |
| 234 | iso_pu_bacteria | 2933577622 | 2933584540 | 201 |
| 235 | iso_pu_bacteria | 2935608549 | 2935614215 | 201 |
| 236 | iso_pu_bacteria | 2935616580 | 2935617754 | 201 |
| 237 | iso_pu_bacteria | 2935638405 | 2935643799 | 201 |
| 238 | iso_pu_bacteria | 2935648319 | 2935651416 | 201 |
| 239 | iso_pu_bacteria | 2935656913 | 2935659816 | 201 |
| 240 | iso_pu_bacteria | 2935665750 | 2935670891 | 201 |
| 241 | iso_pu_bacteria | 2935675223 | 2935681511 | 201 |
| 242 | iso_pu_bacteria | 2935684952 | 2935692512 | 201 |
| 243 | iso_pu_bacteria | 2935694250 | 2935699274 | 201 |
| 244 | iso_pu_bacteria | 2935703347 | 2935710081 | 201 |
| 245 | iso_pu_bacteria | 2935713505 | 2935721130 | 201 |
| 246 | iso_pu_bacteria | 2935722832 | 2935730877 | 201 |
| 247 | iso_pu_bacteria | 2935732158 | 2935739819 | 201 |
| 248 | iso_pu_bacteria | 2935741537 | 2935748857 | 201 |
| 249 | iso_pu_bacteria | 2935750917 | 2935758727 | 201 |
| 250 | iso_pu_bacteria | 2935760218 | 2935767789 | 201 |
| 251 | iso_pu_bacteria | 2935769743 | 2935775585 | 201 |
| 252 | iso_pu_bacteria | 2935777560 | 2935779843 | 201 |
| 253 | iso_pu_bacteria | 2935785616 | 2935790113 | 201 |
| 254 | iso_pu_bacteria | 2935793552 | 2935798548 | 201 |
| 255 | iso_pu_bacteria | 2935801545 | 2935806755 | 201 |
| 256 | iso_pu_bacteria | 2935810662 | 2935817918 | 201 |
| 257 | iso_pu_bacteria | 2935819856 | 2935826466 | 201 |
| 258 | iso_pu_bacteria | 2935827899 | 2935834484 | 201 |
| 259 | iso_pu_bacteria | 2935837841 | 2935843791 | 201 |
| 260 | iso_pu_bacteria | 2935847175 | 2935851339 | 201 |
| 261 | iso_pu_bacteria | 2935855204 | 2935856747 | 201 |
| 262 | iso_pu_bacteria | 2935864058 | 2935868226 | 201 |
| 263 | iso_pu_bacteria | 2935873716 | 2935879584 | 201 |
| 264 | iso_pu_bacteria | 2935883170 | 2935887474 | 201 |
| 265 | iso_pu_bacteria | 2935908558 | 2935913303 | 201 |
| 266 | iso_pu_bacteria | 2935916978 | 2935922707 | 201 |
| 267 | iso_pu_bacteria | 2935926038 | 2935930772 | 201 |
| 268 | iso_pu_bacteria | 2935934488 | 2935939894 | 201 |
| 269 | iso_pu_bacteria | 2935942939 | 2935946843 | 201 |
| 270 | iso_pu_bacteria | 2935951376 | 2935955956 | 201 |
| 271 | iso_pu_bacteria | 2935959822 | 2935966253 | 201 |
| 272 | iso_pu_bacteria | 2935967501 | 2935972749 | 201 |
| 273 | iso_pu_bacteria | 2935975950 | 2935982540 | 201 |
| 274 | iso_pu_bacteria | 2935984226 | 2935984518 | 201 |
| 275 | iso_pu_bacteria | 2935992306 | 2935997090 | 201 |
| 276 | iso_pu_bacteria | 2936002035 | 2936009798 | 201 |
| 277 | iso_pu_bacteria | 2936011229 | 2936014232 | 201 |
| 278 | iso_pu_bacteria | 2936019824 | 2936022859 | 201 |
| 279 | iso_pu_bacteria | 2936028420 | 2936030996 | 201 |
| 280 | iso_pu_bacteria | 2936037263 | 2936044684 | 201 |
| 281 | iso_pu_bacteria | 2936046547 | 2936049117 | 201 |
| 282 | iso_pu_bacteria | 2936055302 | 2936055562 | 201 |
| 283 | iso_pu_bacteria | 2940556831 | 2940564683 | 201 |
| 284 | iso_pu_bacteria | 2941538514 | 2941545039 | 201 |
| 285 | iso_pu_bacteria | 3005483717 | 3005490389 | 201 |
| 286 | iso_pu_bacteria | 3005506211 | 3005509805 | 201 |
| 287 | iso_pu_bacteria | 3005587118 | 3005591091 | 201 |
| 288 | iso_pu_bacteria | 3005594810 | 3005595718 | 201 |
| 289 | iso_pu_bacteria | 8006984368 | 8006987117 | 201 |
| 290 | iso_pu_bacteria | 8006994254 | 8006998794 | 201 |
| 291 | iso_pu_bacteria | 8016522445 | 8016525537 | 201 |
| 292 | iso_pu_bacteria | 8016530956 | 8016539130 | 201 |
| 293 | iso_pu_bacteria | 8016539877 | 8016543417 | 201 |
| 294 | iso_pu_bacteria | 8016548790 | 8016549879 | 201 |
| 295 | iso_pu_bacteria | 8016557553 | 8016558291 | 201 |
| 296 | iso_pu_bacteria | 8016566248 | 8016568820 | 201 |
| 297 | iso_pu_bacteria | 8016575299 | 8016581464 | 201 |
| 298 | iso_pu_bacteria | 8016583857 | 8016587195 | 201 |
| 299 | iso_pu_bacteria | 8016595262 | 8016596288 | 201 |
| 300 | iso_pu_bacteria | 8016603502 | 8016607198 | 201 |
| 301 | iso_pu_bacteria | 8016613128 | 8016619098 | 201 |
| 302 | iso_pu_bacteria | 8016622563 | 8016630488 | 201 |
| 303 | iso_pu_bacteria | 8016630954 | 8016636594 | 201 |
| 304 | iso_pu_bacteria | 8017057580 | 8017057763 | 201 |
| 305 | iso_pu_bacteria | 8019530166 | 8019538799 | 201 |
| 306 | iso_pu_bacteria | 8019538911 | 8019541184 | 201 |
| 307 | iso_pu_bacteria | 8019547302 | 8019549433 | 201 |
| 308 | iso_pu_bacteria | 8019586578 | 8019596073 | 201 |
| 309 | iso_pu_bacteria | 8019597564 | 8019605641 | 201 |
| 310 | iso_pu_bacteria | 8019608314 | 8019612894 | 201 |
| 311 | iso_pu_bacteria | 8019619141 | 8019623578 | 201 |
| 312 | iso_pu_bacteria | 8019629233 | 8019638574 | 201 |
| 313 | iso_pu_bacteria | 8019638758 | 8019641170 | 201 |
| 314 | iso_pu_bacteria | 8019648815 | 8019653303 | 201 |
| 315 | iso_pu_bacteria | 8019659431 | 8019666375 | 201 |
| 316 | iso_pu_bacteria | 8019668869 | 8019676037 | 201 |
| 317 | iso_pu_bacteria | 8019678201 | 8019680108 | 201 |
| 318 | iso_pu_bacteria | 8019687851 | 8019693415 | 201 |
| 319 | iso_pu_bacteria | 8055742211 | 8055750731 | 201 |
| 320 | iso_pu_bacteria | 8056673599 | 8056673930 | 201 |
| 321 | iso_pu_bacteria | 8056967851 | 8056970561 | 201 |
| 322 | 3300003214 | JGI25165J46597_1012920 | JGI25165J46597_10129202 | 202 |
| 323 | 3300005455 | Ga0070663_100038701 | Ga0070663_1000387013 | 202 |
| 324 | 3300005548 | Ga0070665_100308833 | Ga0070665_1003088332 | 202 |
| 325 | 3300006051 | Ga0075364_10194845 | Ga0075364_101948452 | 202 |
| 326 | 3300006186 | Ga0075369_10034442 | Ga0075369_100344422 | 202 |
| 327 | 3300021384 | Ga0213876_10019228 | Ga0213876_100192284 | 202 |
| 328 | 3300021388 | Ga0213875_10009576 | Ga0213875_100095765 | 202 |
| 329 | 3300025253 | Ga0209677_103983 | Ga0209677_1039833 | 202 |
| 330 | 3300025261 | Ga0209233_1012199 | Ga0209233_10121992 | 202 |
| 331 | 3300025295 | Ga0209564_1013127 | Ga0209564_10131274 | 202 |
| 332 | 3300026067 | Ga0207678_10008858 | Ga0207678_1000885811 | 202 |
| 333 | 3300031731 | Ga0307405_10099014 | Ga0307405_100990142 | 202 |
| 334 | 3300037853 | Ga0436364_0719642 | Ga0436364_0719642_707_1324 | 202 |
| 335 | 3300037853 | Ga0436364_0755794 | Ga0436364_0755794_409_1020 | 202 |
| 336 | 3300039437 | Ga0436365_1414759 | Ga0436365_1414759_3494_4105 | 202 |
| 337 | 3300039437 | Ga0436365_1523781 | Ga0436365_1523781_14_625 | 202 |
| 338 | 3300039438 | Ga0436360_0952465 | Ga0436360_0952465_715_1323 | 202 |
| 339 | 3300044765 | Ga0466970_0419641 | Ga0466970_0419641_36_647 | 202 |
| 340 | 3300046474 | Ga0495605_0051963 | Ga0495605_0051963_95_703 | 202 |
| 341 | 3300046492 | Ga0495585_0167513 | Ga0495585_0167513_82_690 | 202 |
| 342 | 3300046500 | Ga0495596_0233987 | Ga0495596_0233987_11_619 | 202 |
| 343 | 3300046501 | Ga0495607_0066487 | Ga0495607_0066487_727_1335 | 202 |
| 344 | 3300046506 | Ga0495583_0050842 | Ga0495583_0050842_1104_1712 | 202 |
| 345 | 3300046507 | Ga0495606_0308217 | Ga0495606_0308217_180_788 | 202 |
| 346 | 3300046512 | Ga0495610_0012561 | Ga0495610_0012561_95_703 | 202 |
| 347 | 3300046513 | Ga0495616_0028704 | Ga0495616_0028704_894_1502 | 202 |
| 348 | 3300046515 | Ga0495620_0013026 | Ga0495620_0013026_2276_2884 | 202 |
| 349 | 3300046518 | Ga0495631_0037053 | Ga0495631_0037053_859_1467 | 202 |
| 350 | 3300046519 | Ga0495632_0069194 | Ga0495632_0069194_943_1551 | 202 |
| 351 | 3300046524 | Ga0495648_0078158 | Ga0495648_0078158_446_1054 | 202 |
| 352 | 3300046530 | Ga0495654_0018207 | Ga0495654_0018207_2112_2720 | 202 |
| 353 | 3300046538 | Ga0495609_0095650 | Ga0495609_0095650_171_779 | 202 |
| 354 | 3300046542 | Ga0495597_0089784 | Ga0495597_0089784_348_956 | 202 |
| 355 | 3300046616 | Ga0495668_0114275 | Ga0495668_0114275_89_697 | 202 |
| 356 | 3300048919 | Ga0496116_0045939 | Ga0496116_0045939_1581_2189 | 202 |
| 357 | 3300048919 | Ga0496116_0101125 | Ga0496116_0101125_576_1184 | 202 |
| 358 | 3300048920 | Ga0496117_0091766 | Ga0496117_0091766_409_1017 | 202 |
| 359 | 3300048920 | Ga0496117_0187294 | Ga0496117_0187294_263_874 | 202 |
| 360 | 3300048921 | Ga0496118_0038064 | Ga0496118_0038064_2581_3189 | 202 |
| 361 | 3300048921 | Ga0496118_0066963 | Ga0496118_0066963_559_1170 | 202 |
| 362 | 3300048921 | Ga0496118_0138218 | Ga0496118_0138218_431_1039 | 202 |
| 363 | 3300048922 | Ga0496119_0087385 | Ga0496119_0087385_960_1568 | 202 |
| 364 | 3300048924 | Ga0496121_0115968 | Ga0496121_0115968_737_1348 | 202 |
| 365 | 3300048924 | Ga0496121_0189191 | Ga0496121_0189191_553_1161 | 202 |
| 366 | 3300048925 | Ga0496122_0119178 | Ga0496122_0119178_392_1000 | 202 |
| 367 | 3300048926 | Ga0496123_0106375 | Ga0496123_0106375_951_1559 | 202 |
| 368 | 3300048928 | Ga0496125_0011997 | Ga0496125_0011997_2546_3154 | 202 |
| 369 | 3300050491 | nmdc:mga00v17_40638_c1 | nmdc:mga00v17_40638_c1_1969_2577 | 202 |
| 370 | 3300050492 | nmdc:mga0yw44_179543_c1 | nmdc:mga0yw44_179543_c1_444_1052 | 202 |
| 371 | 3300050494 | nmdc:mga06z11_391985_c1 | nmdc:mga06z11_391985_c1_30_638 | 202 |
| 372 | 3300050496 | nmdc:mga07m45_435776_c1 | nmdc:mga07m45_435776_c1_73_681 | 202 |
| 373 | 3300050516 | nmdc:mga0sz30_90231_c1 | nmdc:mga0sz30_90231_c1_41_649 | 202 |
| 374 | 3300053087 | Ga0500643_027964 | Ga0500643_027964_707_1315 | 202 |
| 375 | 3300053088 | Ga0500644_0015890 | Ga0500644_0015890_546_1154 | 202 |
| 376 | 3300053089 | Ga0500581_094737 | Ga0500581_094737_644_1252 | 202 |
| 377 | 3300053093 | Ga0500651_0133456 | Ga0500651_0133456_387_995 | 202 |
| 378 | 3300053096 | Ga0500641_0009642 | Ga0500641_0009642_984_1592 | 202 |
| 379 | 3300053103 | Ga0500555_039334 | Ga0500555_039334_274_885 | 202 |
| 380 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_244003_244611 | 202 |
| 381 | 3300053108 | Ga0500562_021432 | Ga0500562_021432_580_1188 | 202 |
| 382 | 3300053109 | Ga0500569_008862 | Ga0500569_008862_387_995 | 202 |
| 383 | 3300053116 | Ga0500592_005117 | Ga0500592_005117_415_1023 | 202 |
| 384 | 3300053117 | Ga0500593_022884 | Ga0500593_022884_1212_1820 | 202 |
| 385 | 3300053130 | Ga0500642_0000167 | Ga0500642_0000167_23_631 | 202 |
| 386 | 3300053131 | Ga0500652_001522 | Ga0500652_001522_3188_3796 | 202 |
| 387 | 3300053151 | Ga0500604_0004751 | Ga0500604_0004751_349_957 | 202 |
| 388 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_139086_139694 | 202 |
| 389 | 3300053156 | Ga0500622_0000826 | Ga0500622_0000826_8492_9100 | 202 |
| 390 | 3300053158 | Ga0500627_0028603 | Ga0500627_0028603_1033_1641 | 202 |
| 391 | 3300053160 | Ga0500633_0048037 | Ga0500633_0048037_411_1019 | 202 |
| 392 | 3300053730 | Ga0500645_006872 | Ga0500645_006872_2245_2853 | 202 |
| 393 | 3300003659 | JGI25404J52841_10008233 | JGI25404J52841_100082332 | 203 |
| 394 | 3300005983 | Ga0081540_1000390 | Ga0081540_100039014 | 203 |
| 395 | 3300006048 | Ga0075363_100261271 | Ga0075363_1002612712 | 203 |
| 396 | 3300006186 | Ga0075369_10133778 | Ga0075369_101337782 | 203 |
| 397 | 3300037853 | Ga0436364_0076794 | Ga0436364_0076794_278_889 | 203 |
| 398 | 3300048918 | Ga0496115_0182239 | Ga0496115_0182239_714_1439 | 203 |
| 399 | 3300050492 | nmdc:mga0yw44_319521_c1 | nmdc:mga0yw44_319521_c1_71_694 | 203 |
| 400 | 3300050516 | nmdc:mga0sz30_121410_c1 | nmdc:mga0sz30_121410_c1_287_898 | 203 |
| 401 | 3300003320 | rootH2_10092218 | rootH2_100922181 | 204 |
| 402 | 3300003323 | rootH1_10048035 | rootH1_100480352 | 204 |
| 403 | 3300005355 | Ga0070671_100962965 | Ga0070671_1009629651 | 204 |
| 404 | 3300009177 | Ga0105248_10063571 | Ga0105248_100635715 | 204 |
| 405 | 3300025941 | Ga0207711_10063181 | Ga0207711_100631812 | 204 |
| 406 | 3300002459 | JGI24751J29686_10006535 | JGI24751J29686_100065353 | 205 |
| 407 | 3300003203 | JGI25406J46586_10008340 | JGI25406J46586_100083404 | 205 |
| 408 | 3300003215 | JGI25153J46596_10001467 | JGI25153J46596_1000146711 | 205 |
| 409 | 3300003320 | rootH2_10141663 | rootH2_101416632 | 205 |
| 410 | 3300005262 | Ga0065165_1000721 | Ga0065165_100072119 | 205 |
| 411 | 3300005262 | Ga0065165_1002559 | Ga0065165_10025598 | 205 |
| 412 | 3300005262 | Ga0065165_1004090 | Ga0065165_10040907 | 205 |
| 413 | 3300005262 | Ga0065165_1080195 | Ga0065165_10801952 | 205 |
| 414 | 3300005262 | Ga0065165_1106275 | Ga0065165_11062751 | 205 |
| 415 | 3300005331 | Ga0070670_100269477 | Ga0070670_1002694772 | 205 |
| 416 | 3300005331 | Ga0070670_100279772 | Ga0070670_1002797722 | 205 |
| 417 | 3300005331 | Ga0070670_100321528 | Ga0070670_1003215282 | 205 |
| 418 | 3300005331 | Ga0070670_100402324 | Ga0070670_1004023242 | 205 |
| 419 | 3300005334 | Ga0068869_100012248 | Ga0068869_1000122487 | 205 |
| 420 | 3300005334 | Ga0068869_100014751 | Ga0068869_1000147513 | 205 |
| 421 | 3300005335 | Ga0070666_10206179 | Ga0070666_102061792 | 205 |
| 422 | 3300005335 | Ga0070666_10229163 | Ga0070666_102291631 | 205 |
| 423 | 3300005337 | Ga0070682_100319110 | Ga0070682_1003191102 | 205 |
| 424 | 3300005338 | Ga0068868_100022444 | Ga0068868_1000224443 | 205 |
| 425 | 3300005338 | Ga0068868_100228403 | Ga0068868_1002284032 | 205 |
| 426 | 3300005338 | Ga0068868_100384969 | Ga0068868_1003849692 | 205 |
| 427 | 3300005339 | Ga0070660_100276476 | Ga0070660_1002764762 | 205 |
| 428 | 3300005339 | Ga0070660_100602404 | Ga0070660_1006024042 | 205 |
| 429 | 3300005340 | Ga0070689_100371420 | Ga0070689_1003714202 | 205 |
| 430 | 3300005341 | Ga0070691_10228147 | Ga0070691_102281472 | 205 |
| 431 | 3300005341 | Ga0070691_10320120 | Ga0070691_103201202 | 205 |
| 432 | 3300005343 | Ga0070687_100320587 | Ga0070687_1003205872 | 205 |
| 433 | 3300005347 | Ga0070668_100172968 | Ga0070668_1001729682 | 205 |
| 434 | 3300005347 | Ga0070668_100193104 | Ga0070668_1001931042 | 205 |
| 435 | 3300005347 | Ga0070668_100282209 | Ga0070668_1002822092 | 205 |
| 436 | 3300005353 | Ga0070669_100157870 | Ga0070669_1001578702 | 205 |
| 437 | 3300005353 | Ga0070669_100190525 | Ga0070669_1001905251 | 205 |
| 438 | 3300005353 | Ga0070669_100220429 | Ga0070669_1002204292 | 205 |
| 439 | 3300005353 | Ga0070669_100678368 | Ga0070669_1006783681 | 205 |
| 440 | 3300005355 | Ga0070671_100034394 | Ga0070671_1000343943 | 205 |
| 441 | 3300005356 | Ga0070674_100519460 | Ga0070674_1005194602 | 205 |
| 442 | 3300005364 | Ga0070673_100130100 | Ga0070673_1001301002 | 205 |
| 443 | 3300005364 | Ga0070673_100149449 | Ga0070673_1001494492 | 205 |
| 444 | 3300005365 | Ga0070688_100160624 | Ga0070688_1001606243 | 205 |
| 445 | 3300005365 | Ga0070688_100265915 | Ga0070688_1002659152 | 205 |
| 446 | 3300005367 | Ga0070667_100317446 | Ga0070667_1003174462 | 205 |
| 447 | 3300005367 | Ga0070667_100804449 | Ga0070667_1008044492 | 205 |
| 448 | 3300005435 | Ga0070714_100035957 | Ga0070714_1000359576 | 205 |
| 449 | 3300005436 | Ga0070713_100038145 | Ga0070713_1000381455 | 205 |
| 450 | 3300005438 | Ga0070701_10304046 | Ga0070701_103040461 | 205 |
| 451 | 3300005441 | Ga0070700_100521815 | Ga0070700_1005218151 | 205 |
| 452 | 3300005441 | Ga0070700_100526974 | Ga0070700_1005269741 | 205 |
| 453 | 3300005444 | Ga0070694_100707468 | Ga0070694_1007074681 | 205 |
| 454 | 3300005455 | Ga0070663_100046883 | Ga0070663_1000468832 | 205 |
| 455 | 3300005455 | Ga0070663_100196110 | Ga0070663_1001961102 | 205 |
| 456 | 3300005455 | Ga0070663_100496606 | Ga0070663_1004966061 | 205 |
| 457 | 3300005456 | Ga0070678_100026848 | Ga0070678_1000268482 | 205 |
| 458 | 3300005456 | Ga0070678_100108538 | Ga0070678_1001085382 | 205 |
| 459 | 3300005456 | Ga0070678_100438800 | Ga0070678_1004388002 | 205 |
| 460 | 3300005456 | Ga0070678_100628095 | Ga0070678_1006280952 | 205 |
| 461 | 3300005457 | Ga0070662_100260563 | Ga0070662_1002605632 | 205 |
| 462 | 3300005457 | Ga0070662_100287269 | Ga0070662_1002872692 | 205 |
| 463 | 3300005459 | Ga0068867_100034759 | Ga0068867_1000347594 | 205 |
| 464 | 3300005459 | Ga0068867_100589833 | Ga0068867_1005898331 | 205 |
| 465 | 3300005459 | Ga0068867_100660086 | Ga0068867_1006600862 | 205 |
| 466 | 3300005466 | Ga0070685_10052113 | Ga0070685_100521132 | 205 |
| 467 | 3300005466 | Ga0070685_10641289 | Ga0070685_106412891 | 205 |
| 468 | 3300005467 | Ga0070706_100640543 | Ga0070706_1006405432 | 205 |
| 469 | 3300005468 | Ga0070707_100605017 | Ga0070707_1006050171 | 205 |
| 470 | 3300005471 | Ga0070698_100420106 | Ga0070698_1004201062 | 205 |
| 471 | 3300005518 | Ga0070699_100170101 | Ga0070699_1001701012 | 205 |
| 472 | 3300005539 | Ga0068853_100476971 | Ga0068853_1004769712 | 205 |
| 473 | 3300005539 | Ga0068853_101068800 | Ga0068853_1010688001 | 205 |
| 474 | 3300005543 | Ga0070672_100109865 | Ga0070672_1001098651 | 205 |
| 475 | 3300005543 | Ga0070672_100322472 | Ga0070672_1003224722 | 205 |
| 476 | 3300005544 | Ga0070686_100624003 | Ga0070686_1006240032 | 205 |
| 477 | 3300005545 | Ga0070695_100693265 | Ga0070695_1006932651 | 205 |
| 478 | 3300005546 | Ga0070696_100143541 | Ga0070696_1001435411 | 205 |
| 479 | 3300005547 | Ga0070693_100040234 | Ga0070693_1000402343 | 205 |
| 480 | 3300005548 | Ga0070665_100041904 | Ga0070665_1000419044 | 205 |
| 481 | 3300005548 | Ga0070665_100453634 | Ga0070665_1004536342 | 205 |
| 482 | 3300005548 | Ga0070665_101188277 | Ga0070665_1011882771 | 205 |
| 483 | 3300005563 | Ga0068855_100540447 | Ga0068855_1005404472 | 205 |
| 484 | 3300005564 | Ga0070664_100266933 | Ga0070664_1002669332 | 205 |
| 485 | 3300005577 | Ga0068857_100022482 | Ga0068857_1000224822 | 205 |
| 486 | 3300005577 | Ga0068857_100342759 | Ga0068857_1003427592 | 205 |
| 487 | 3300005578 | Ga0068854_100289266 | Ga0068854_1002892662 | 205 |
| 488 | 3300005578 | Ga0068854_100314427 | Ga0068854_1003144272 | 205 |
| 489 | 3300005614 | Ga0068856_100022223 | Ga0068856_1000222236 | 205 |
| 490 | 3300005614 | Ga0068856_100160011 | Ga0068856_1001600113 | 205 |
| 491 | 3300005615 | Ga0070702_100175176 | Ga0070702_1001751762 | 205 |
| 492 | 3300005616 | Ga0068852_100278498 | Ga0068852_1002784982 | 205 |
| 493 | 3300005616 | Ga0068852_100509469 | Ga0068852_1005094692 | 205 |
| 494 | 3300005617 | Ga0068859_100073186 | Ga0068859_1000731863 | 205 |
| 495 | 3300005617 | Ga0068859_100125968 | Ga0068859_1001259684 | 205 |
| 496 | 3300005617 | Ga0068859_100151529 | Ga0068859_1001515293 | 205 |
| 497 | 3300005617 | Ga0068859_100351684 | Ga0068859_1003516842 | 205 |
| 498 | 3300005617 | Ga0068859_101463494 | Ga0068859_1014634941 | 205 |
| 499 | 3300005618 | Ga0068864_100047670 | Ga0068864_1000476705 | 205 |
| 500 | 3300005618 | Ga0068864_100088380 | Ga0068864_1000883802 | 205 |
| 501 | 3300005618 | Ga0068864_100386862 | Ga0068864_1003868622 | 205 |
| 502 | 3300005618 | Ga0068864_100475491 | Ga0068864_1004754912 | 205 |
| 503 | 3300005719 | Ga0068861_100117358 | Ga0068861_1001173582 | 205 |
| 504 | 3300005719 | Ga0068861_101100548 | Ga0068861_1011005482 | 205 |
| 505 | 3300005834 | Ga0068851_10289365 | Ga0068851_102893652 | 205 |
| 506 | 3300005840 | Ga0068870_10088970 | Ga0068870_100889702 | 205 |
| 507 | 3300005840 | Ga0068870_10253870 | Ga0068870_102538702 | 205 |
| 508 | 3300005841 | Ga0068863_100397335 | Ga0068863_1003973351 | 205 |
| 509 | 3300005841 | Ga0068863_100959968 | Ga0068863_1009599681 | 205 |
| 510 | 3300005842 | Ga0068858_100387714 | Ga0068858_1003877141 | 205 |
| 511 | 3300005842 | Ga0068858_100483855 | Ga0068858_1004838552 | 205 |
| 512 | 3300005844 | Ga0068862_100364573 | Ga0068862_1003645732 | 205 |
| 513 | 3300005844 | Ga0068862_100493951 | Ga0068862_1004939511 | 205 |
| 514 | 3300005844 | Ga0068862_100637640 | Ga0068862_1006376402 | 205 |
| 515 | 3300005844 | Ga0068862_100793781 | Ga0068862_1007937811 | 205 |
| 516 | 3300005844 | Ga0068862_101103713 | Ga0068862_1011037132 | 205 |
| 517 | 3300005937 | Ga0081455_10037279 | Ga0081455_100372792 | 205 |
| 518 | 3300005937 | Ga0081455_10063826 | Ga0081455_100638262 | 205 |
| 519 | 3300005937 | Ga0081455_10190092 | Ga0081455_101900922 | 205 |
| 520 | 3300005937 | Ga0081455_10280756 | Ga0081455_102807561 | 205 |
| 521 | 3300005981 | Ga0081538_10071091 | Ga0081538_100710912 | 205 |
| 522 | 3300005983 | Ga0081540_1002694 | Ga0081540_10026943 | 205 |
| 523 | 3300005983 | Ga0081540_1003284 | Ga0081540_100328413 | 205 |
| 524 | 3300005983 | Ga0081540_1003420 | Ga0081540_10034207 | 205 |
| 525 | 3300005983 | Ga0081540_1015811 | Ga0081540_10158115 | 205 |
| 526 | 3300005983 | Ga0081540_1029232 | Ga0081540_10292321 | 205 |
| 527 | 3300005985 | Ga0081539_10003489 | Ga0081539_100034895 | 205 |
| 528 | 3300005985 | Ga0081539_10047799 | Ga0081539_100477992 | 205 |
| 529 | 3300006028 | Ga0070717_10280534 | Ga0070717_102805342 | 205 |
| 530 | 3300006038 | Ga0075365_10017375 | Ga0075365_100173755 | 205 |
| 531 | 3300006038 | Ga0075365_10092377 | Ga0075365_100923772 | 205 |
| 532 | 3300006038 | Ga0075365_10397627 | Ga0075365_103976271 | 205 |
| 533 | 3300006038 | Ga0075365_10442097 | Ga0075365_104420972 | 205 |
| 534 | 3300006042 | Ga0075368_10092045 | Ga0075368_100920452 | 205 |
| 535 | 3300006042 | Ga0075368_10103329 | Ga0075368_101033292 | 205 |
| 536 | 3300006048 | Ga0075363_100033572 | Ga0075363_1000335723 | 205 |
| 537 | 3300006048 | Ga0075363_100153111 | Ga0075363_1001531112 | 205 |
| 538 | 3300006048 | Ga0075363_100194318 | Ga0075363_1001943182 | 205 |
| 539 | 3300006051 | Ga0075364_10086883 | Ga0075364_100868831 | 205 |
| 540 | 3300006051 | Ga0075364_10128578 | Ga0075364_101285782 | 205 |
| 541 | 3300006051 | Ga0075364_10189803 | Ga0075364_101898032 | 205 |
| 542 | 3300006177 | Ga0075362_10019947 | Ga0075362_100199472 | 205 |
| 543 | 3300006177 | Ga0075362_10035162 | Ga0075362_100351623 | 205 |
| 544 | 3300006177 | Ga0075362_10168065 | Ga0075362_101680652 | 205 |
| 545 | 3300006178 | Ga0075367_10091224 | Ga0075367_100912242 | 205 |
| 546 | 3300006178 | Ga0075367_10479403 | Ga0075367_104794031 | 205 |
| 547 | 3300006186 | Ga0075369_10002966 | Ga0075369_100029662 | 205 |
| 548 | 3300006186 | Ga0075369_10054941 | Ga0075369_100549411 | 205 |
| 549 | 3300006195 | Ga0075366_10044839 | Ga0075366_100448393 | 205 |
| 550 | 3300006195 | Ga0075366_10045750 | Ga0075366_100457503 | 205 |
| 551 | 3300006237 | Ga0097621_100302485 | Ga0097621_1003024852 | 205 |
| 552 | 3300006237 | Ga0097621_100312723 | Ga0097621_1003127232 | 205 |
| 553 | 3300006237 | Ga0097621_100973438 | Ga0097621_1009734382 | 205 |
| 554 | 3300006353 | Ga0075370_10058180 | Ga0075370_100581802 | 205 |
| 555 | 3300006353 | Ga0075370_10116718 | Ga0075370_101167182 | 205 |
| 556 | 3300006358 | Ga0068871_100079482 | Ga0068871_1000794822 | 205 |
| 557 | 3300006358 | Ga0068871_100687026 | Ga0068871_1006870262 | 205 |
| 558 | 3300006844 | Ga0075428_100070070 | Ga0075428_1000700704 | 205 |
| 559 | 3300006846 | Ga0075430_100674779 | Ga0075430_1006747792 | 205 |
| 560 | 3300006852 | Ga0075433_11067386 | Ga0075433_110673861 | 205 |
| 561 | 3300006871 | Ga0075434_100158304 | Ga0075434_1001583042 | 205 |
| 562 | 3300006881 | Ga0068865_100863473 | Ga0068865_1008634731 | 205 |
| 563 | 3300006931 | Ga0097620_100073191 | Ga0097620_1000731913 | 205 |
| 564 | 3300006931 | Ga0097620_100125976 | Ga0097620_1001259764 | 205 |
| 565 | 3300006931 | Ga0097620_100151527 | Ga0097620_1001515272 | 205 |
| 566 | 3300006931 | Ga0097620_100351653 | Ga0097620_1003516532 | 205 |
| 567 | 3300006931 | Ga0097620_101463484 | Ga0097620_1014634841 | 205 |
| 568 | 3300006941 | Ga0099825_1045808 | Ga0099825_10458082 | 205 |
| 569 | 3300006942 | Ga0099824_1018090 | Ga0099824_10180905 | 205 |
| 570 | 3300007076 | Ga0075435_100362370 | Ga0075435_1003623702 | 205 |
| 571 | 3300009092 | Ga0105250_10032667 | Ga0105250_100326672 | 205 |
| 572 | 3300009092 | Ga0105250_10181026 | Ga0105250_101810261 | 205 |
| 573 | 3300009093 | Ga0105240_10005052 | Ga0105240_1000505216 | 205 |
| 574 | 3300009093 | Ga0105240_10019107 | Ga0105240_100191073 | 205 |
| 575 | 3300009093 | Ga0105240_10876793 | Ga0105240_108767931 | 205 |
| 576 | 3300009093 | Ga0105240_11013165 | Ga0105240_110131652 | 205 |
| 577 | 3300009094 | Ga0111539_10393326 | Ga0111539_103933262 | 205 |
| 578 | 3300009098 | Ga0105245_10033284 | Ga0105245_100332845 | 205 |
| 579 | 3300009098 | Ga0105245_10034208 | Ga0105245_100342083 | 205 |
| 580 | 3300009098 | Ga0105245_10256255 | Ga0105245_102562552 | 205 |
| 581 | 3300009098 | Ga0105245_10671872 | Ga0105245_106718722 | 205 |
| 582 | 3300009101 | Ga0105247_10022331 | Ga0105247_100223312 | 205 |
| 583 | 3300009101 | Ga0105247_10040222 | Ga0105247_100402223 | 205 |
| 584 | 3300009101 | Ga0105247_10304604 | Ga0105247_103046041 | 205 |
| 585 | 3300009147 | Ga0114129_10118949 | Ga0114129_101189494 | 205 |
| 586 | 3300009148 | Ga0105243_10169476 | Ga0105243_101694762 | 205 |
| 587 | 3300009148 | Ga0105243_10642790 | Ga0105243_106427902 | 205 |
| 588 | 3300009148 | Ga0105243_10803084 | Ga0105243_108030842 | 205 |
| 589 | 3300009174 | Ga0105241_10120387 | Ga0105241_101203873 | 205 |
| 590 | 3300009174 | Ga0105241_10121698 | Ga0105241_101216981 | 205 |
| 591 | 3300009174 | Ga0105241_10158637 | Ga0105241_101586372 | 205 |
| 592 | 3300009176 | Ga0105242_10317343 | Ga0105242_103173432 | 205 |
| 593 | 3300009176 | Ga0105242_10730025 | Ga0105242_107300252 | 205 |
| 594 | 3300009177 | Ga0105248_10073791 | Ga0105248_100737912 | 205 |
| 595 | 3300009177 | Ga0105248_10084328 | Ga0105248_100843282 | 205 |
| 596 | 3300009177 | Ga0105248_10278611 | Ga0105248_102786112 | 205 |
| 597 | 3300009545 | Ga0105237_10001825 | Ga0105237_1000182524 | 205 |
| 598 | 3300009545 | Ga0105237_10273975 | Ga0105237_102739752 | 205 |
| 599 | 3300009545 | Ga0105237_10480836 | Ga0105237_104808362 | 205 |
| 600 | 3300009545 | Ga0105237_10492313 | Ga0105237_104923132 | 205 |
| 601 | 3300009545 | Ga0105237_10666050 | Ga0105237_106660502 | 205 |
| 602 | 3300009551 | Ga0105238_10056920 | Ga0105238_100569202 | 205 |
| 603 | 3300009551 | Ga0105238_10146838 | Ga0105238_101468383 | 205 |
| 604 | 3300009551 | Ga0105238_10150526 | Ga0105238_101505262 | 205 |
| 605 | 3300009551 | Ga0105238_10184001 | Ga0105238_101840012 | 205 |
| 606 | 3300009553 | Ga0105249_10707211 | Ga0105249_107072112 | 205 |
| 607 | 3300010375 | Ga0105239_10031864 | Ga0105239_100318645 | 205 |
| 608 | 3300010375 | Ga0105239_10100812 | Ga0105239_101008122 | 205 |
| 609 | 3300010375 | Ga0105239_10259769 | Ga0105239_102597692 | 205 |
| 610 | 3300010375 | Ga0105239_10410759 | Ga0105239_104107592 | 205 |
| 611 | 3300011119 | Ga0105246_10011457 | Ga0105246_100114573 | 205 |
| 612 | 3300011119 | Ga0105246_10061328 | Ga0105246_100613283 | 205 |
| 613 | 3300011119 | Ga0105246_10064157 | Ga0105246_100641572 | 205 |
| 614 | 3300011119 | Ga0105246_10189572 | Ga0105246_101895722 | 205 |
| 615 | 3300013102 | Ga0157371_10385093 | Ga0157371_103850931 | 205 |
| 616 | 3300013105 | Ga0157369_10040360 | Ga0157369_100403606 | 205 |
| 617 | 3300013105 | Ga0157369_10068769 | Ga0157369_100687695 | 205 |
| 618 | 3300013296 | Ga0157374_10070147 | Ga0157374_100701474 | 205 |
| 619 | 3300013297 | Ga0157378_10105000 | Ga0157378_101050002 | 205 |
| 620 | 3300013297 | Ga0157378_10113876 | Ga0157378_101138764 | 205 |
| 621 | 3300013297 | Ga0157378_10532100 | Ga0157378_105321002 | 205 |
| 622 | 3300013297 | Ga0157378_11479224 | Ga0157378_114792241 | 205 |
| 623 | 3300013306 | Ga0163162_10856109 | Ga0163162_108561092 | 205 |
| 624 | 3300013307 | Ga0157372_10247662 | Ga0157372_102476622 | 205 |
| 625 | 3300013307 | Ga0157372_10862475 | Ga0157372_108624751 | 205 |
| 626 | 3300013308 | Ga0157375_10280354 | Ga0157375_102803542 | 205 |
| 627 | 3300013308 | Ga0157375_10336382 | Ga0157375_103363822 | 205 |
| 628 | 3300013308 | Ga0157375_10624976 | Ga0157375_106249761 | 205 |
| 629 | 3300013308 | Ga0157375_10726359 | Ga0157375_107263592 | 205 |
| 630 | 3300014325 | Ga0163163_10061762 | Ga0163163_100617623 | 205 |
| 631 | 3300014325 | Ga0163163_10366073 | Ga0163163_103660732 | 205 |
| 632 | 3300014325 | Ga0163163_10596850 | Ga0163163_105968502 | 205 |
| 633 | 3300014325 | Ga0163163_11053803 | Ga0163163_110538032 | 205 |
| 634 | 3300014325 | Ga0163163_11592971 | Ga0163163_115929711 | 205 |
| 635 | 3300014326 | Ga0157380_10357302 | Ga0157380_103573022 | 205 |
| 636 | 3300014745 | Ga0157377_10177955 | Ga0157377_101779552 | 205 |
| 637 | 3300014968 | Ga0157379_10330879 | Ga0157379_103308792 | 205 |
| 638 | 3300014969 | Ga0157376_10234717 | Ga0157376_102347172 | 205 |
| 639 | 3300014969 | Ga0157376_10441547 | Ga0157376_104415472 | 205 |
| 640 | 3300014969 | Ga0157376_10457076 | Ga0157376_104570762 | 205 |
| 641 | 3300017792 | Ga0163161_10315342 | Ga0163161_103153422 | 205 |
| 642 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007238 | 205 |
| 643 | 3300021320 | Ga0214544_1041736 | Ga0214544_10417362 | 205 |
| 644 | 3300021321 | Ga0214542_1000007 | Ga0214542_1000007144 | 205 |
| 645 | 3300021321 | Ga0214542_1027972 | Ga0214542_10279722 | 205 |
| 646 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006149 | 205 |
| 647 | 3300021324 | Ga0214545_1018297 | Ga0214545_10182976 | 205 |
| 648 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009238 | 205 |
| 649 | 3300021327 | Ga0214543_1024430 | Ga0214543_10244303 | 205 |
| 650 | 3300021358 | Ga0213873_10071207 | Ga0213873_100712072 | 205 |
| 651 | 3300021361 | Ga0213872_10010153 | Ga0213872_100101533 | 205 |
| 652 | 3300021441 | Ga0213871_10043735 | Ga0213871_100437352 | 205 |
| 653 | 3300025230 | Ga0209563_102773 | Ga0209563_1027733 | 205 |
| 654 | 3300025245 | Ga0207425_1011699 | Ga0207425_10116993 | 205 |
| 655 | 3300025253 | Ga0209677_101607 | Ga0209677_10160710 | 205 |
| 656 | 3300025254 | Ga0209148_1000216 | Ga0209148_100021657 | 205 |
| 657 | 3300025272 | Ga0209455_1001447 | Ga0209455_100144713 | 205 |
| 658 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015601 | 205 |
| 659 | 3300025297 | Ga0209758_1000161 | Ga0209758_100016166 | 205 |
| 660 | 3300025297 | Ga0209758_1000673 | Ga0209758_10006734 | 205 |
| 661 | 3300025297 | Ga0209758_1004929 | Ga0209758_10049298 | 205 |
| 662 | 3300025297 | Ga0209758_1019668 | Ga0209758_10196682 | 205 |
| 663 | 3300025297 | Ga0209758_1021569 | Ga0209758_10215692 | 205 |
| 664 | 3300025297 | Ga0209758_1035445 | Ga0209758_10354452 | 205 |
| 665 | 3300025297 | Ga0209758_1035446 | Ga0209758_10354462 | 205 |
| 666 | 3300025299 | Ga0209256_1004892 | Ga0209256_10048923 | 205 |
| 667 | 3300025302 | Ga0207426_1000186 | Ga0207426_1000186124 | 205 |
| 668 | 3300025302 | Ga0207426_1001742 | Ga0207426_10017429 | 205 |
| 669 | 3300025302 | Ga0207426_1006201 | Ga0207426_10062012 | 205 |
| 670 | 3300025303 | Ga0209051_1018369 | Ga0209051_10183692 | 205 |
| 671 | 3300025304 | Ga0209257_1006231 | Ga0209257_10062312 | 205 |
| 672 | 3300025321 | Ga0207656_10267260 | Ga0207656_102672602 | 205 |
| 673 | 3300025885 | Ga0207653_10015012 | Ga0207653_100150122 | 205 |
| 674 | 3300025893 | Ga0207682_10008049 | Ga0207682_100080495 | 205 |
| 675 | 3300025899 | Ga0207642_10140995 | Ga0207642_101409952 | 205 |
| 676 | 3300025901 | Ga0207688_10057659 | Ga0207688_100576592 | 205 |
| 677 | 3300025901 | Ga0207688_10101989 | Ga0207688_101019892 | 205 |
| 678 | 3300025901 | Ga0207688_10212039 | Ga0207688_102120391 | 205 |
| 679 | 3300025903 | Ga0207680_10452540 | Ga0207680_104525402 | 205 |
| 680 | 3300025904 | Ga0207647_10004864 | Ga0207647_100048644 | 205 |
| 681 | 3300025906 | Ga0207699_10021493 | Ga0207699_100214932 | 205 |
| 682 | 3300025907 | Ga0207645_10047946 | Ga0207645_100479462 | 205 |
| 683 | 3300025907 | Ga0207645_10294922 | Ga0207645_102949221 | 205 |
| 684 | 3300025908 | Ga0207643_10088900 | Ga0207643_100889002 | 205 |
| 685 | 3300025908 | Ga0207643_10359630 | Ga0207643_103596301 | 205 |
| 686 | 3300025909 | Ga0207705_10038556 | Ga0207705_100385563 | 205 |
| 687 | 3300025911 | Ga0207654_10034330 | Ga0207654_100343303 | 205 |
| 688 | 3300025911 | Ga0207654_10050460 | Ga0207654_100504602 | 205 |
| 689 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006227 | 205 |
| 690 | 3300025914 | Ga0207671_10047393 | Ga0207671_100473932 | 205 |
| 691 | 3300025914 | Ga0207671_10383348 | Ga0207671_103833482 | 205 |
| 692 | 3300025918 | Ga0207662_10124668 | Ga0207662_101246681 | 205 |
| 693 | 3300025918 | Ga0207662_10432304 | Ga0207662_104323042 | 205 |
| 694 | 3300025919 | Ga0207657_10209135 | Ga0207657_102091352 | 205 |
| 695 | 3300025922 | Ga0207646_10822493 | Ga0207646_108224932 | 205 |
| 696 | 3300025923 | Ga0207681_10167225 | Ga0207681_101672252 | 205 |
| 697 | 3300025923 | Ga0207681_10248139 | Ga0207681_102481392 | 205 |
| 698 | 3300025924 | Ga0207694_10035608 | Ga0207694_100356081 | 205 |
| 699 | 3300025924 | Ga0207694_10098536 | Ga0207694_100985362 | 205 |
| 700 | 3300025924 | Ga0207694_10266496 | Ga0207694_102664962 | 205 |
| 701 | 3300025924 | Ga0207694_10484105 | Ga0207694_104841052 | 205 |
| 702 | 3300025925 | Ga0207650_10197201 | Ga0207650_101972012 | 205 |
| 703 | 3300025927 | Ga0207687_10030856 | Ga0207687_100308564 | 205 |
| 704 | 3300025927 | Ga0207687_10167310 | Ga0207687_101673102 | 205 |
| 705 | 3300025928 | Ga0207700_10007619 | Ga0207700_100076193 | 205 |
| 706 | 3300025931 | Ga0207644_10022449 | Ga0207644_100224496 | 205 |
| 707 | 3300025931 | Ga0207644_10620338 | Ga0207644_106203382 | 205 |
| 708 | 3300025931 | Ga0207644_10729388 | Ga0207644_107293882 | 205 |
| 709 | 3300025931 | Ga0207644_10828581 | Ga0207644_108285811 | 205 |
| 710 | 3300025932 | Ga0207690_10445071 | Ga0207690_104450711 | 205 |
| 711 | 3300025933 | Ga0207706_10123452 | Ga0207706_101234522 | 205 |
| 712 | 3300025933 | Ga0207706_10167711 | Ga0207706_101677112 | 205 |
| 713 | 3300025933 | Ga0207706_10887395 | Ga0207706_108873951 | 205 |
| 714 | 3300025934 | Ga0207686_10143777 | Ga0207686_101437772 | 205 |
| 715 | 3300025935 | Ga0207709_10247948 | Ga0207709_102479482 | 205 |
| 716 | 3300025935 | Ga0207709_10304390 | Ga0207709_103043902 | 205 |
| 717 | 3300025935 | Ga0207709_10413130 | Ga0207709_104131301 | 205 |
| 718 | 3300025936 | Ga0207670_10539057 | Ga0207670_105390572 | 205 |
| 719 | 3300025936 | Ga0207670_11033401 | Ga0207670_110334011 | 205 |
| 720 | 3300025937 | Ga0207669_10471804 | Ga0207669_104718042 | 205 |
| 721 | 3300025938 | Ga0207704_10393599 | Ga0207704_103935992 | 205 |
| 722 | 3300025940 | Ga0207691_10126016 | Ga0207691_101260162 | 205 |
| 723 | 3300025940 | Ga0207691_10149350 | Ga0207691_101493502 | 205 |
| 724 | 3300025941 | Ga0207711_10245950 | Ga0207711_102459502 | 205 |
| 725 | 3300025941 | Ga0207711_10463309 | Ga0207711_104633092 | 205 |
| 726 | 3300025941 | Ga0207711_10707794 | Ga0207711_107077942 | 205 |
| 727 | 3300025942 | Ga0207689_10020050 | Ga0207689_100200502 | 205 |
| 728 | 3300025942 | Ga0207689_10047569 | Ga0207689_100475692 | 205 |
| 729 | 3300025942 | Ga0207689_10105485 | Ga0207689_101054853 | 205 |
| 730 | 3300025942 | Ga0207689_10718830 | Ga0207689_107188301 | 205 |
| 731 | 3300025944 | Ga0207661_10409628 | Ga0207661_104096282 | 205 |
| 732 | 3300025945 | Ga0207679_10047663 | Ga0207679_100476632 | 205 |
| 733 | 3300025949 | Ga0207667_10276364 | Ga0207667_102763642 | 205 |
| 734 | 3300025949 | Ga0207667_10606140 | Ga0207667_106061402 | 205 |
| 735 | 3300025961 | Ga0207712_10186329 | Ga0207712_101863293 | 205 |
| 736 | 3300025961 | Ga0207712_10309407 | Ga0207712_103094072 | 205 |
| 737 | 3300025961 | Ga0207712_10377490 | Ga0207712_103774901 | 205 |
| 738 | 3300025972 | Ga0207668_10085734 | Ga0207668_100857342 | 205 |
| 739 | 3300025972 | Ga0207668_10277138 | Ga0207668_102771381 | 205 |
| 740 | 3300025972 | Ga0207668_10695164 | Ga0207668_106951642 | 205 |
| 741 | 3300025986 | Ga0207658_10264865 | Ga0207658_102648652 | 205 |
| 742 | 3300025986 | Ga0207658_10357272 | Ga0207658_103572722 | 205 |
| 743 | 3300026023 | Ga0207677_10036683 | Ga0207677_100366835 | 205 |
| 744 | 3300026023 | Ga0207677_10226708 | Ga0207677_102267082 | 205 |
| 745 | 3300026023 | Ga0207677_10691835 | Ga0207677_106918351 | 205 |
| 746 | 3300026023 | Ga0207677_10719657 | Ga0207677_107196572 | 205 |
| 747 | 3300026035 | Ga0207703_10091998 | Ga0207703_100919984 | 205 |
| 748 | 3300026035 | Ga0207703_10693380 | Ga0207703_106933801 | 205 |
| 749 | 3300026041 | Ga0207639_10102987 | Ga0207639_101029873 | 205 |
| 750 | 3300026041 | Ga0207639_10108879 | Ga0207639_101088794 | 205 |
| 751 | 3300026041 | Ga0207639_10158701 | Ga0207639_101587012 | 205 |
| 752 | 3300026041 | Ga0207639_10357750 | Ga0207639_103577502 | 205 |
| 753 | 3300026067 | Ga0207678_10015151 | Ga0207678_100151513 | 205 |
| 754 | 3300026067 | Ga0207678_10111519 | Ga0207678_101115192 | 205 |
| 755 | 3300026075 | Ga0207708_10235845 | Ga0207708_102358452 | 205 |
| 756 | 3300026075 | Ga0207708_10336260 | Ga0207708_103362602 | 205 |
| 757 | 3300026078 | Ga0207702_10057935 | Ga0207702_100579354 | 205 |
| 758 | 3300026078 | Ga0207702_10100353 | Ga0207702_101003532 | 205 |
| 759 | 3300026088 | Ga0207641_10293589 | Ga0207641_102935892 | 205 |
| 760 | 3300026089 | Ga0207648_10095376 | Ga0207648_100953762 | 205 |
| 761 | 3300026089 | Ga0207648_10158250 | Ga0207648_101582502 | 205 |
| 762 | 3300026089 | Ga0207648_10243676 | Ga0207648_102436762 | 205 |
| 763 | 3300026095 | Ga0207676_10142815 | Ga0207676_101428153 | 205 |
| 764 | 3300026095 | Ga0207676_10382169 | Ga0207676_103821692 | 205 |
| 765 | 3300026116 | Ga0207674_10032725 | Ga0207674_100327252 | 205 |
| 766 | 3300026116 | Ga0207674_10123589 | Ga0207674_101235892 | 205 |
| 767 | 3300026116 | Ga0207674_10199575 | Ga0207674_101995751 | 205 |
| 768 | 3300026116 | Ga0207674_10353888 | Ga0207674_103538882 | 205 |
| 769 | 3300026116 | Ga0207674_10609757 | Ga0207674_106097572 | 205 |
| 770 | 3300026118 | Ga0207675_100279429 | Ga0207675_1002794292 | 205 |
| 771 | 3300026118 | Ga0207675_100481726 | Ga0207675_1004817262 | 205 |
| 772 | 3300026118 | Ga0207675_100597433 | Ga0207675_1005974332 | 205 |
| 773 | 3300026121 | Ga0207683_10007253 | Ga0207683_100072533 | 205 |
| 774 | 3300026121 | Ga0207683_10090513 | Ga0207683_100905133 | 205 |
| 775 | 3300026121 | Ga0207683_10337142 | Ga0207683_103371422 | 205 |
| 776 | 3300026121 | Ga0207683_10463792 | Ga0207683_104637922 | 205 |
| 777 | 3300026142 | Ga0207698_10007921 | Ga0207698_100079214 | 205 |
| 778 | 3300026142 | Ga0207698_10245268 | Ga0207698_102452682 | 205 |
| 779 | 3300026142 | Ga0207698_10336364 | Ga0207698_103363642 | 205 |
| 780 | 3300027296 | Ga0209389_1000062 | Ga0209389_100006263 | 205 |
| 781 | 3300027296 | Ga0209389_1000072 | Ga0209389_10000729 | 205 |
| 782 | 3300027357 | Ga0209589_1000270 | Ga0209589_100027059 | 205 |
| 783 | 3300027361 | Ga0209489_100160 | Ga0209489_10016063 | 205 |
| 784 | 3300027361 | Ga0209489_100206 | Ga0209489_1002069 | 205 |
| 785 | 3300027363 | Ga0209700_101128 | Ga0209700_10112848 | 205 |
| 786 | 3300027866 | Ga0209813_10266380 | Ga0209813_102663801 | 205 |
| 787 | 3300027907 | Ga0207428_10102978 | Ga0207428_101029782 | 205 |
| 788 | 3300028379 | Ga0268266_10001098 | Ga0268266_100010987 | 205 |
| 789 | 3300028379 | Ga0268266_10001919 | Ga0268266_1000191916 | 205 |
| 790 | 3300028379 | Ga0268266_10486100 | Ga0268266_104861002 | 205 |
| 791 | 3300028380 | Ga0268265_10036180 | Ga0268265_100361804 | 205 |
| 792 | 3300028380 | Ga0268265_10221601 | Ga0268265_102216012 | 205 |
| 793 | 3300028380 | Ga0268265_10459711 | Ga0268265_104597112 | 205 |
| 794 | 3300028381 | Ga0268264_10014095 | Ga0268264_100140954 | 205 |
| 795 | 3300028381 | Ga0268264_10239379 | Ga0268264_102393791 | 205 |
| 796 | 3300028381 | Ga0268264_10438915 | Ga0268264_104389152 | 205 |
| 797 | 3300028381 | Ga0268264_11045418 | Ga0268264_110454182 | 205 |
| 798 | 3300028786 | Ga0307517_10000196 | Ga0307517_1000019670 | 205 |
| 799 | 3300028786 | Ga0307517_10114104 | Ga0307517_101141042 | 205 |
| 800 | 3300028786 | Ga0307517_10407164 | Ga0307517_104071641 | 205 |
| 801 | 3300028794 | Ga0307515_10019983 | Ga0307515_100199833 | 205 |
| 802 | 3300031456 | Ga0307513_10141261 | Ga0307513_101412613 | 205 |
| 803 | 3300031507 | Ga0307509_10197820 | Ga0307509_101978203 | 205 |
| 804 | 3300031616 | Ga0307508_10052012 | Ga0307508_100520122 | 205 |
| 805 | 3300031730 | Ga0307516_10353780 | Ga0307516_103537802 | 205 |
| 806 | 3300031730 | Ga0307516_10431605 | Ga0307516_104316052 | 205 |
| 807 | 3300031731 | Ga0307405_10895696 | Ga0307405_108956961 | 205 |
| 808 | 3300031824 | Ga0307413_10314742 | Ga0307413_103147422 | 205 |
| 809 | 3300031901 | Ga0307406_10518675 | Ga0307406_105186752 | 205 |
| 810 | 3300031901 | Ga0307406_10801133 | Ga0307406_108011331 | 205 |
| 811 | 3300031911 | Ga0307412_10223506 | Ga0307412_102235062 | 205 |
| 812 | 3300031995 | Ga0307409_100112259 | Ga0307409_1001122592 | 205 |
| 813 | 3300032005 | Ga0307411_10204501 | Ga0307411_102045012 | 205 |
| 814 | 3300032126 | Ga0307415_100176875 | Ga0307415_1001768752 | 205 |
| 815 | 3300032126 | Ga0307415_100249504 | Ga0307415_1002495042 | 205 |
| 816 | 3300033180 | Ga0307510_10002425 | Ga0307510_1000242524 | 205 |
| 817 | 3300033180 | Ga0307510_10018360 | Ga0307510_100183606 | 205 |
| 818 | 3300033180 | Ga0307510_10057078 | Ga0307510_100570782 | 205 |
| 819 | 3300033180 | Ga0307510_10163534 | Ga0307510_101635342 | 205 |
| 820 | 3300035114 | Ga0373939_0076974 | Ga0373939_0076974_460_1077 | 205 |
| 821 | 3300035170 | Ga0373943_0187121 | Ga0373943_0187121_88_705 | 205 |
| 822 | 3300035695 | Ga0373927_0162707 | Ga0373927_0162707_829_1446 | 205 |
| 823 | 3300037466 | Ga0395898_0470465 | Ga0395898_0470465_67_684 | 205 |
| 824 | 3300037471 | Ga0395905_0000710 | Ga0395905_0000710_38597_39214 | 205 |
| 825 | 3300037471 | Ga0395905_0283473 | Ga0395905_0283473_258_875 | 205 |
| 826 | 3300037853 | Ga0436364_1287204 | Ga0436364_1287204_6124_6753 | 205 |
| 827 | 3300038443 | Ga0395901_0530948 | Ga0395901_0530948_449_1066 | 205 |
| 828 | 3300039437 | Ga0436365_1110743 | Ga0436365_1110743_586_1278 | 205 |
| 829 | 3300039437 | Ga0436365_1562201 | Ga0436365_1562201_138_833 | 205 |
| 830 | 3300039447 | Ga0436361_0083564 | Ga0436361_0083564_4506_5123 | 205 |
| 831 | 3300039447 | Ga0436361_0573468 | Ga0436361_0573468_398_1015 | 205 |
| 832 | 3300039453 | Ga0436362_1274308 | Ga0436362_1274308_224_841 | 205 |
| 833 | 3300041413 | Ga0439465_0069447 | Ga0439465_0069447_294_911 | 205 |
| 834 | 3300041451 | Ga0451791_0118347 | Ga0451791_0118347_193_810 | 205 |
| 835 | 3300041451 | Ga0451791_1327348 | Ga0451791_1327348_124_741 | 205 |
| 836 | 3300041452 | Ga0451793_0550299 | Ga0451793_0550299_109_726 | 205 |
| 837 | 3300041459 | Ga0451800_0369308 | Ga0451800_0369308_136_753 | 205 |
| 838 | 3300041460 | Ga0451802_0032404 | Ga0451802_0032404_879_1496 | 205 |
| 839 | 3300041498 | Ga0451841_0667089 | Ga0451841_0667089_79_696 | 205 |
| 840 | 3300041509 | Ga0451843_1581240 | Ga0451843_1581240_18_635 | 205 |
| 841 | 3300042438 | Ga0439459_0040149 | Ga0439459_0040149_101_718 | 205 |
| 842 | 3300044656 | Ga0466969_0030722 | Ga0466969_0030722_1080_1697 | 205 |
| 843 | 3300044658 | Ga0466972_0004442 | Ga0466972_0004442_3561_4178 | 205 |
| 844 | 3300044684 | Ga0466966_0002418 | Ga0466966_0002418_758_1375 | 205 |
| 845 | 3300044684 | Ga0466966_0019149 | Ga0466966_0019149_1566_2183 | 205 |
| 846 | 3300044693 | Ga0466961_0000324 | Ga0466961_0000324_13520_14137 | 205 |
| 847 | 3300044694 | Ga0466963_0028999 | Ga0466963_0028999_1048_1665 | 205 |
| 848 | 3300044735 | Ga0466968_0038269 | Ga0466968_0038269_586_1203 | 205 |
| 849 | 3300044901 | Ga0466960_0030151 | Ga0466960_0030151_758_1375 | 205 |
| 850 | 3300044901 | Ga0466960_0088008 | Ga0466960_0088008_328_945 | 205 |
| 851 | 3300045049 | Ga0466959_0157829 | Ga0466959_0157829_309_926 | 205 |
| 852 | 3300045051 | Ga0451576_0507654 | Ga0451576_0507654_430_1047 | 205 |
| 853 | 3300046454 | Ga0495592_0206014 | Ga0495592_0206014_549_1166 | 205 |
| 854 | 3300046454 | Ga0495592_0230498 | Ga0495592_0230498_74_691 | 205 |
| 855 | 3300046454 | Ga0495592_0396612 | Ga0495592_0396612_153_770 | 205 |
| 856 | 3300046455 | Ga0495603_0056082 | Ga0495603_0056082_1008_1625 | 205 |
| 857 | 3300046455 | Ga0495603_0196008 | Ga0495603_0196008_404_1021 | 205 |
| 858 | 3300046458 | Ga0495591_045145 | Ga0495591_045145_162_779 | 205 |
| 859 | 3300046459 | Ga0495629_0026002 | Ga0495629_0026002_158_775 | 205 |
| 860 | 3300046460 | Ga0495638_0006922 | Ga0495638_0006922_5339_5956 | 205 |
| 861 | 3300046460 | Ga0495638_0100023 | Ga0495638_0100023_965_1582 | 205 |
| 862 | 3300046460 | Ga0495638_0174155 | Ga0495638_0174155_27_647 | 205 |
| 863 | 3300046462 | Ga0495651_0034935 | Ga0495651_0034935_138_755 | 205 |
| 864 | 3300046474 | Ga0495605_0047265 | Ga0495605_0047265_722_1339 | 205 |
| 865 | 3300046474 | Ga0495605_0076469 | Ga0495605_0076469_626_1243 | 205 |
| 866 | 3300046474 | Ga0495605_0119154 | Ga0495605_0119154_239_856 | 205 |
| 867 | 3300046474 | Ga0495605_0244523 | Ga0495605_0244523_113_730 | 205 |
| 868 | 3300046491 | Ga0495584_0249418 | Ga0495584_0249418_219_836 | 205 |
| 869 | 3300046491 | Ga0495584_0262191 | Ga0495584_0262191_239_856 | 205 |
| 870 | 3300046492 | Ga0495585_0026108 | Ga0495585_0026108_315_932 | 205 |
| 871 | 3300046492 | Ga0495585_0220782 | Ga0495585_0220782_218_835 | 205 |
| 872 | 3300046492 | Ga0495585_0245380 | Ga0495585_0245380_178_795 | 205 |
| 873 | 3300046499 | Ga0495594_0089994 | Ga0495594_0089994_19_636 | 205 |
| 874 | 3300046500 | Ga0495596_0035379 | Ga0495596_0035379_713_1330 | 205 |
| 875 | 3300046501 | Ga0495607_0097545 | Ga0495607_0097545_548_1165 | 205 |
| 876 | 3300046501 | Ga0495607_0205620 | Ga0495607_0205620_79_696 | 205 |
| 877 | 3300046507 | Ga0495606_0048572 | Ga0495606_0048572_1945_2562 | 205 |
| 878 | 3300046507 | Ga0495606_0069620 | Ga0495606_0069620_1555_2172 | 205 |
| 879 | 3300046507 | Ga0495606_0363317 | Ga0495606_0363317_37_654 | 205 |
| 880 | 3300046512 | Ga0495610_0082066 | Ga0495610_0082066_304_921 | 205 |
| 881 | 3300046512 | Ga0495610_0098846 | Ga0495610_0098846_58_675 | 205 |
| 882 | 3300046514 | Ga0495618_0161306 | Ga0495618_0161306_713_1330 | 205 |
| 883 | 3300046516 | Ga0495628_0448504 | Ga0495628_0448504_103_720 | 205 |
| 884 | 3300046519 | Ga0495632_0132614 | Ga0495632_0132614_283_900 | 205 |
| 885 | 3300046520 | Ga0495637_0177699 | Ga0495637_0177699_61_678 | 205 |
| 886 | 3300046522 | Ga0495643_0073425 | Ga0495643_0073425_338_955 | 205 |
| 887 | 3300046522 | Ga0495643_0170775 | Ga0495643_0170775_359_976 | 205 |
| 888 | 3300046524 | Ga0495648_0125099 | Ga0495648_0125099_735_1355 | 205 |
| 889 | 3300046524 | Ga0495648_0170726 | Ga0495648_0170726_355_972 | 205 |
| 890 | 3300046528 | Ga0495642_0187161 | Ga0495642_0187161_176_793 | 205 |
| 891 | 3300046529 | Ga0495652_0027290 | Ga0495652_0027290_3314_3931 | 205 |
| 892 | 3300046529 | Ga0495652_0299044 | Ga0495652_0299044_287_904 | 205 |
| 893 | 3300046536 | Ga0495587_0047845 | Ga0495587_0047845_86_703 | 205 |
| 894 | 3300046537 | Ga0495598_0041682 | Ga0495598_0041682_104_721 | 205 |
| 895 | 3300046538 | Ga0495609_0068566 | Ga0495609_0068566_374_991 | 205 |
| 896 | 3300046542 | Ga0495597_0072336 | Ga0495597_0072336_528_1145 | 205 |
| 897 | 3300046557 | Ga0495622_0021059 | Ga0495622_0021059_296_913 | 205 |
| 898 | 3300046557 | Ga0495622_0039845 | Ga0495622_0039845_1473_2090 | 205 |
| 899 | 3300046558 | Ga0495633_0081329 | Ga0495633_0081329_214_831 | 205 |
| 900 | 3300046558 | Ga0495633_0158827 | Ga0495633_0158827_196_813 | 205 |
| 901 | 3300046559 | Ga0495667_0098051 | Ga0495667_0098051_107_724 | 205 |
| 902 | 3300046615 | Ga0495656_0039635 | Ga0495656_0039635_1266_1883 | 205 |
| 903 | 3300046616 | Ga0495668_0054485 | Ga0495668_0054485_1290_1907 | 205 |
| 904 | 3300046616 | Ga0495668_0118375 | Ga0495668_0118375_711_1328 | 205 |
| 905 | 3300046616 | Ga0495668_0176269 | Ga0495668_0176269_323_940 | 205 |
| 906 | 3300046642 | Ga0495634_0048467 | Ga0495634_0048467_146_763 | 205 |
| 907 | 3300046660 | Ga0495625_0096038 | Ga0495625_0096038_1266_1883 | 205 |
| 908 | 3300046660 | Ga0495625_0141186 | Ga0495625_0141186_697_1314 | 205 |
| 909 | 3300046660 | Ga0495625_0235325 | Ga0495625_0235325_194_811 | 205 |
| 910 | 3300046663 | Ga0495635_0039556 | Ga0495635_0039556_2133_2750 | 205 |
| 911 | 3300046664 | Ga0495659_0062482 | Ga0495659_0062482_726_1343 | 205 |
| 912 | 3300046665 | Ga0495661_0082112 | Ga0495661_0082112_91_708 | 205 |
| 913 | 3300046665 | Ga0495661_0154702 | Ga0495661_0154702_239_856 | 205 |
| 914 | 3300046674 | Ga0495588_0068955 | Ga0495588_0068955_130_747 | 205 |
| 915 | 3300046674 | Ga0495588_0116574 | Ga0495588_0116574_338_955 | 205 |
| 916 | 3300046675 | Ga0495657_0230830 | Ga0495657_0230830_416_1033 | 205 |
| 917 | 3300046680 | Ga0495646_0301078 | Ga0495646_0301078_82_699 | 205 |
| 918 | 3300046681 | Ga0495647_0010283 | Ga0495647_0010283_832_1449 | 205 |
| 919 | 3300046684 | Ga0495669_0045783 | Ga0495669_0045783_595_1212 | 205 |
| 920 | 3300046684 | Ga0495669_0163072 | Ga0495669_0163072_343_960 | 205 |
| 921 | 3300046690 | Ga0495624_0186716 | Ga0495624_0186716_38_655 | 205 |
| 922 | 3300046692 | Ga0495671_0155609 | Ga0495671_0155609_401_1018 | 205 |
| 923 | 3300046694 | Ga0495649_0108323 | Ga0495649_0108323_351_968 | 205 |
| 924 | 3300046794 | Ga0495589_0143357 | Ga0495589_0143357_274_891 | 205 |
| 925 | 3300046809 | Ga0495600_0103179 | Ga0495600_0103179_29_646 | 205 |
| 926 | 3300047315 | Ga0495581_0225941 | Ga0495581_0225941_307_924 | 205 |
| 927 | 3300047317 | Ga0495604_0115420 | Ga0495604_0115420_616_1233 | 205 |
| 928 | 3300047317 | Ga0495604_0419547 | Ga0495604_0419547_20_637 | 205 |
| 929 | 3300047318 | Ga0495636_0330569 | Ga0495636_0330569_55_672 | 205 |
| 930 | 3300047319 | Ga0495674_0119121 | Ga0495674_0119121_760_1377 | 205 |
| 931 | 3300047321 | Ga0495676_0028252 | Ga0495676_0028252_3385_4002 | 205 |
| 932 | 3300047321 | Ga0495676_0036568 | Ga0495676_0036568_3291_3908 | 205 |
| 933 | 3300047321 | Ga0495676_0316557 | Ga0495676_0316557_324_941 | 205 |
| 934 | 3300047323 | Ga0495683_0179878 | Ga0495683_0179878_277_894 | 205 |
| 935 | 3300047443 | Ga0495687_050286 | Ga0495687_050286_507_1124 | 205 |
| 936 | 3300047445 | Ga0495677_0282310 | Ga0495677_0282310_10_627 | 205 |
| 937 | 3300047446 | Ga0495679_034860 | Ga0495679_034860_130_747 | 205 |
| 938 | 3300047447 | Ga0495685_089361 | Ga0495685_089361_384_1001 | 205 |
| 939 | 3300047469 | Ga0495673_0056106 | Ga0495673_0056106_674_1291 | 205 |
| 940 | 3300047469 | Ga0495673_0075947 | Ga0495673_0075947_379_996 | 205 |
| 941 | 3300047470 | Ga0495681_0064641 | Ga0495681_0064641_69_686 | 205 |
| 942 | 3300047471 | Ga0495684_0336736 | Ga0495684_0336736_71_688 | 205 |
| 943 | 3300047673 | Ga0495593_0370936 | Ga0495593_0370936_51_668 | 205 |
| 944 | 3300048088 | Ga0495602_0056666 | Ga0495602_0056666_2461_3078 | 205 |
| 945 | 3300048904 | Ga0496101_0080746 | Ga0496101_0080746_77_694 | 205 |
| 946 | 3300048905 | Ga0496102_0013587 | Ga0496102_0013587_5773_6390 | 205 |
| 947 | 3300048905 | Ga0496102_0900449 | Ga0496102_0900449_34_651 | 205 |
| 948 | 3300048907 | Ga0496104_0031429 | Ga0496104_0031429_4027_4644 | 205 |
| 949 | 3300048907 | Ga0496104_0059165 | Ga0496104_0059165_442_1059 | 205 |
| 950 | 3300048908 | Ga0496105_0019733 | Ga0496105_0019733_2125_2742 | 205 |
| 951 | 3300048908 | Ga0496105_0027418 | Ga0496105_0027418_359_976 | 205 |
| 952 | 3300048908 | Ga0496105_0236469 | Ga0496105_0236469_746_1363 | 205 |
| 953 | 3300048909 | Ga0496106_0032474 | Ga0496106_0032474_2406_3023 | 205 |
| 954 | 3300048909 | Ga0496106_0185232 | Ga0496106_0185232_826_1443 | 205 |
| 955 | 3300048909 | Ga0496106_0228129 | Ga0496106_0228129_543_1160 | 205 |
| 956 | 3300048909 | Ga0496106_0433607 | Ga0496106_0433607_158_775 | 205 |
| 957 | 3300048909 | Ga0496106_0521764 | Ga0496106_0521764_262_879 | 205 |
| 958 | 3300048910 | Ga0496107_0173292 | Ga0496107_0173292_232_849 | 205 |
| 959 | 3300048910 | Ga0496107_0383552 | Ga0496107_0383552_342_959 | 205 |
| 960 | 3300048911 | Ga0496108_0096731 | Ga0496108_0096731_1328_1945 | 205 |
| 961 | 3300048911 | Ga0496108_0575578 | Ga0496108_0575578_345_962 | 205 |
| 962 | 3300048912 | Ga0496109_0213814 | Ga0496109_0213814_15_632 | 205 |
| 963 | 3300048912 | Ga0496109_0359484 | Ga0496109_0359484_243_860 | 205 |
| 964 | 3300048913 | Ga0496110_0077186 | Ga0496110_0077186_1544_2161 | 205 |
| 965 | 3300048913 | Ga0496110_0106130 | Ga0496110_0106130_1676_2293 | 205 |
| 966 | 3300048913 | Ga0496110_0139014 | Ga0496110_0139014_861_1478 | 205 |
| 967 | 3300048913 | Ga0496110_0642889 | Ga0496110_0642889_283_900 | 205 |
| 968 | 3300048913 | Ga0496110_1013780 | Ga0496110_1013780_32_649 | 205 |
| 969 | 3300048914 | Ga0496111_0320510 | Ga0496111_0320510_348_965 | 205 |
| 970 | 3300048915 | Ga0496112_0053052 | Ga0496112_0053052_643_1260 | 205 |
| 971 | 3300048916 | Ga0496113_0424221 | Ga0496113_0424221_429_1046 | 205 |
| 972 | 3300048916 | Ga0496113_0637739 | Ga0496113_0637739_35_652 | 205 |
| 973 | 3300048917 | Ga0496114_0011812 | Ga0496114_0011812_3324_3941 | 205 |
| 974 | 3300048919 | Ga0496116_0116367 | Ga0496116_0116367_56_673 | 205 |
| 975 | 3300048919 | Ga0496116_0127317 | Ga0496116_0127317_623_1240 | 205 |
| 976 | 3300048920 | Ga0496117_0243722 | Ga0496117_0243722_11_628 | 205 |
| 977 | 3300048921 | Ga0496118_0026226 | Ga0496118_0026226_4342_4959 | 205 |
| 978 | 3300048921 | Ga0496118_0081688 | Ga0496118_0081688_373_990 | 205 |
| 979 | 3300048921 | Ga0496118_0149520 | Ga0496118_0149520_730_1347 | 205 |
| 980 | 3300048921 | Ga0496118_0161098 | Ga0496118_0161098_444_1061 | 205 |
| 981 | 3300048922 | Ga0496119_0019471 | Ga0496119_0019471_2866_3483 | 205 |
| 982 | 3300048922 | Ga0496119_0053579 | Ga0496119_0053579_652_1269 | 205 |
| 983 | 3300048922 | Ga0496119_0100067 | Ga0496119_0100067_457_1074 | 205 |
| 984 | 3300048922 | Ga0496119_0247284 | Ga0496119_0247284_34_651 | 205 |
| 985 | 3300048923 | Ga0496120_0011217 | Ga0496120_0011217_2263_2880 | 205 |
| 986 | 3300048923 | Ga0496120_0031156 | Ga0496120_0031156_422_1039 | 205 |
| 987 | 3300048923 | Ga0496120_0260218 | Ga0496120_0260218_87_704 | 205 |
| 988 | 3300048924 | Ga0496121_0000385 | Ga0496121_0000385_39107_39724 | 205 |
| 989 | 3300048924 | Ga0496121_0019557 | Ga0496121_0019557_4797_5414 | 205 |
| 990 | 3300048924 | Ga0496121_0020698 | Ga0496121_0020698_5202_5819 | 205 |
| 991 | 3300048924 | Ga0496121_0230496 | Ga0496121_0230496_533_1150 | 205 |
| 992 | 3300048924 | Ga0496121_0306453 | Ga0496121_0306453_87_704 | 205 |
| 993 | 3300048927 | Ga0496124_0024791 | Ga0496124_0024791_4460_5077 | 205 |
| 994 | 3300048927 | Ga0496124_0103018 | Ga0496124_0103018_197_814 | 205 |
| 995 | 3300048927 | Ga0496124_0127929 | Ga0496124_0127929_49_666 | 205 |
| 996 | 3300048927 | Ga0496124_0195402 | Ga0496124_0195402_34_651 | 205 |
| 997 | 3300048927 | Ga0496124_0407652 | Ga0496124_0407652_226_843 | 205 |
| 998 | 3300048928 | Ga0496125_0073441 | Ga0496125_0073441_1598_2215 | 205 |
| 999 | 3300048928 | Ga0496125_0168177 | Ga0496125_0168177_52_669 | 205 |
| 1000 | 3300048928 | Ga0496125_0174668 | Ga0496125_0174668_580_1197 | 205 |
| 1001 | 3300048928 | Ga0496125_0187454 | Ga0496125_0187454_394_1011 | 205 |
| 1002 | 3300048929 | Ga0496126_0005539 | Ga0496126_0005539_10752_11369 | 205 |
| 1003 | 3300048929 | Ga0496126_0012136 | Ga0496126_0012136_6533_7150 | 205 |
| 1004 | 3300048929 | Ga0496126_0046270 | Ga0496126_0046270_362_985 | 205 |
| 1005 | 3300048929 | Ga0496126_0058664 | Ga0496126_0058664_2251_2868 | 205 |
| 1006 | 3300048929 | Ga0496126_0101673 | Ga0496126_0101673_1021_1638 | 205 |
| 1007 | 3300048929 | Ga0496126_0189392 | Ga0496126_0189392_926_1543 | 205 |
| 1008 | 3300048929 | Ga0496126_0191230 | Ga0496126_0191230_150_767 | 205 |
| 1009 | 3300048929 | Ga0496126_0290391 | Ga0496126_0290391_282_899 | 205 |
| 1010 | 3300049460 | Ga0495682_0160173 | Ga0495682_0160173_159_776 | 205 |
| 1011 | 3300049576 | Ga0501040_0354214 | Ga0501040_0354214_345_962 | 205 |
| 1012 | 3300049583 | Ga0501067_0256727 | Ga0501067_0256727_261_878 | 205 |
| 1013 | 3300049585 | Ga0501069_0306168 | Ga0501069_0306168_265_882 | 205 |
| 1014 | 3300049588 | Ga0501072_0005470 | Ga0501072_0005470_3538_4158 | 205 |
| 1015 | 3300049592 | Ga0501076_0200135 | Ga0501076_0200135_960_1577 | 205 |
| 1016 | 3300049744 | Ga0501083_0017990 | Ga0501083_0017990_70_687 | 205 |
| 1017 | 3300049744 | Ga0501083_0104790 | Ga0501083_0104790_500_1120 | 205 |
| 1018 | 3300049823 | Ga0501044_0060247 | Ga0501044_0060247_2000_2623 | 205 |
| 1019 | 3300050489 | nmdc:mga03683_111095_c1 | nmdc:mga03683_111095_c1_420_1040 | 205 |
| 1020 | 3300050489 | nmdc:mga03683_132301_c1 | nmdc:mga03683_132301_c1_482_1099 | 205 |
| 1021 | 3300050490 | nmdc:mga03n38_260768_c1 | nmdc:mga03n38_260768_c1_178_795 | 205 |
| 1022 | 3300050491 | nmdc:mga00v17_119137_c1 | nmdc:mga00v17_119137_c1_213_830 | 205 |
| 1023 | 3300050492 | nmdc:mga0yw44_105680_c1 | nmdc:mga0yw44_105680_c1_235_852 | 205 |
| 1024 | 3300050492 | nmdc:mga0yw44_178244_c1 | nmdc:mga0yw44_178244_c1_613_1230 | 205 |
| 1025 | 3300050492 | nmdc:mga0yw44_20981_c1 | nmdc:mga0yw44_20981_c1_2037_2654 | 205 |
| 1026 | 3300050492 | nmdc:mga0yw44_51441_c1 | nmdc:mga0yw44_51441_c1_1571_2188 | 205 |
| 1027 | 3300050492 | nmdc:mga0yw44_608085_c1 | nmdc:mga0yw44_608085_c1_29_646 | 205 |
| 1028 | 3300050492 | nmdc:mga0yw44_8581_c1 | nmdc:mga0yw44_8581_c1_1113_1730 | 205 |
| 1029 | 3300050493 | nmdc:mga0k408_378583_c1 | nmdc:mga0k408_378583_c1_46_663 | 205 |
| 1030 | 3300050493 | nmdc:mga0k408_5289_c1 | nmdc:mga0k408_5289_c1_5583_6200 | 205 |
| 1031 | 3300050493 | nmdc:mga0k408_74953_c1 | nmdc:mga0k408_74953_c1_1181_1798 | 205 |
| 1032 | 3300050494 | nmdc:mga06z11_21787_c1 | nmdc:mga06z11_21787_c1_69_686 | 205 |
| 1033 | 3300050494 | nmdc:mga06z11_303415_c1 | nmdc:mga06z11_303415_c1_132_749 | 205 |
| 1034 | 3300050494 | nmdc:mga06z11_44366_c1 | nmdc:mga06z11_44366_c1_767_1384 | 205 |
| 1035 | 3300050495 | nmdc:mga04h51_24889_c1 | nmdc:mga04h51_24889_c1_1202_1819 | 205 |
| 1036 | 3300050496 | nmdc:mga07m45_196195_c1 | nmdc:mga07m45_196195_c1_29_646 | 205 |
| 1037 | 3300050496 | nmdc:mga07m45_247912_c1 | nmdc:mga07m45_247912_c1_11_631 | 205 |
| 1038 | 3300050496 | nmdc:mga07m45_267915_c1 | nmdc:mga07m45_267915_c1_295_912 | 205 |
| 1039 | 3300050507 | nmdc:mga05p37_96999_c1 | nmdc:mga05p37_96999_c1_2818_3435 | 205 |
| 1040 | 3300050509 | nmdc:mga0qj67_634343_c1 | nmdc:mga0qj67_634343_c1_118_735 | 205 |
| 1041 | 3300050511 | nmdc:mga08y16_86315_c1 | nmdc:mga08y16_86315_c1_2342_2959 | 205 |
| 1042 | 3300050512 | nmdc:mga0n895_252685_c1 | nmdc:mga0n895_252685_c1_730_1347 | 205 |
| 1043 | 3300050514 | nmdc:mga08x19_614961_c1 | nmdc:mga08x19_614961_c1_96_713 | 205 |
| 1044 | 3300050515 | nmdc:mga0a205_818705_c1 | nmdc:mga0a205_818705_c1_83_700 | 205 |
| 1045 | 3300050515 | nmdc:mga0a205_836351_c1 | nmdc:mga0a205_836351_c1_93_710 | 205 |
| 1046 | 3300050516 | nmdc:mga0sz30_23751_c1 | nmdc:mga0sz30_23751_c1_1693_2310 | 205 |
| 1047 | 3300050516 | nmdc:mga0sz30_43538_c1 | nmdc:mga0sz30_43538_c1_328_945 | 205 |
| 1048 | 3300050516 | nmdc:mga0sz30_85822_c1 | nmdc:mga0sz30_85822_c1_372_989 | 205 |
| 1049 | 3300053080 | Ga0500635_0038061 | Ga0500635_0038061_827_1444 | 205 |
| 1050 | 3300053080 | Ga0500635_0130770 | Ga0500635_0130770_196_813 | 205 |
| 1051 | 3300053083 | Ga0495655_0074753 | Ga0495655_0074753_177_794 | 205 |
| 1052 | 3300053085 | Ga0495619_0296383 | Ga0495619_0296383_393_1010 | 205 |
| 1053 | 3300053086 | Ga0500578_0078489 | Ga0500578_0078489_1128_1745 | 205 |
| 1054 | 3300053086 | Ga0500578_0227404 | Ga0500578_0227404_313_933 | 205 |
| 1055 | 3300053087 | Ga0500643_000210 | Ga0500643_000210_53199_53816 | 205 |
| 1056 | 3300053087 | Ga0500643_034542 | Ga0500643_034542_515_1132 | 205 |
| 1057 | 3300053090 | Ga0500646_0039027 | Ga0500646_0039027_206_823 | 205 |
| 1058 | 3300053092 | Ga0500583_0137198 | Ga0500583_0137198_291_908 | 205 |
| 1059 | 3300053093 | Ga0500651_0275141 | Ga0500651_0275141_43_663 | 205 |
| 1060 | 3300053094 | Ga0500566_0005375 | Ga0500566_0005375_3651_4268 | 205 |
| 1061 | 3300053094 | Ga0500566_0016861 | Ga0500566_0016861_205_822 | 205 |
| 1062 | 3300053095 | Ga0500640_071568 | Ga0500640_071568_673_1290 | 205 |
| 1063 | 3300053096 | Ga0500641_0079733 | Ga0500641_0079733_144_761 | 205 |
| 1064 | 3300053098 | Ga0500650_0087386 | Ga0500650_0087386_360_977 | 205 |
| 1065 | 3300053103 | Ga0500555_008898 | Ga0500555_008898_355_972 | 205 |
| 1066 | 3300053103 | Ga0500555_022271 | Ga0500555_022271_664_1281 | 205 |
| 1067 | 3300053104 | Ga0500556_0009402 | Ga0500556_0009402_79_696 | 205 |
| 1068 | 3300053104 | Ga0500556_0053913 | Ga0500556_0053913_517_1134 | 205 |
| 1069 | 3300053105 | Ga0500557_000034 | Ga0500557_000034_62631_63248 | 205 |
| 1070 | 3300053108 | Ga0500562_013400 | Ga0500562_013400_707_1324 | 205 |
| 1071 | 3300053108 | Ga0500562_016909 | Ga0500562_016909_782_1399 | 205 |
| 1072 | 3300053109 | Ga0500569_050540 | Ga0500569_050540_390_1007 | 205 |
| 1073 | 3300053116 | Ga0500592_011853 | Ga0500592_011853_132_749 | 205 |
| 1074 | 3300053118 | Ga0500594_0028708 | Ga0500594_0028708_719_1336 | 205 |
| 1075 | 3300053119 | Ga0500595_000665 | Ga0500595_000665_12722_13342 | 205 |
| 1076 | 3300053119 | Ga0500595_002372 | Ga0500595_002372_2954_3571 | 205 |
| 1077 | 3300053119 | Ga0500595_004206 | Ga0500595_004206_5091_5708 | 205 |
| 1078 | 3300053119 | Ga0500595_032968 | Ga0500595_032968_703_1320 | 205 |
| 1079 | 3300053120 | Ga0500597_043919 | Ga0500597_043919_796_1413 | 205 |
| 1080 | 3300053122 | Ga0500608_011645 | Ga0500608_011645_1232_1849 | 205 |
| 1081 | 3300053123 | Ga0500614_016922 | Ga0500614_016922_156_773 | 205 |
| 1082 | 3300053126 | Ga0500621_208680 | Ga0500621_208680_47_664 | 205 |
| 1083 | 3300053130 | Ga0500642_0000053 | Ga0500642_0000053_15374_15991 | 205 |
| 1084 | 3300053130 | Ga0500642_0014576 | Ga0500642_0014576_289_906 | 205 |
| 1085 | 3300053130 | Ga0500642_0055120 | Ga0500642_0055120_393_1010 | 205 |
| 1086 | 3300053130 | Ga0500642_0059513 | Ga0500642_0059513_443_1060 | 205 |
| 1087 | 3300053133 | Ga0500655_075826 | Ga0500655_075826_52_669 | 205 |
| 1088 | 3300053134 | Ga0500658_0032658 | Ga0500658_0032658_420_1037 | 205 |
| 1089 | 3300053136 | Ga0500559_0177366 | Ga0500559_0177366_70_687 | 205 |
| 1090 | 3300053139 | Ga0500568_0059458 | Ga0500568_0059458_278_895 | 205 |
| 1091 | 3300053142 | Ga0500577_0032842 | Ga0500577_0032842_20_637 | 205 |
| 1092 | 3300053142 | Ga0500577_0065289 | Ga0500577_0065289_722_1339 | 205 |
| 1093 | 3300053142 | Ga0500577_0157458 | Ga0500577_0157458_27_644 | 205 |
| 1094 | 3300053146 | Ga0500588_0186811 | Ga0500588_0186811_59_676 | 205 |
| 1095 | 3300053146 | Ga0500588_0191882 | Ga0500588_0191882_59_676 | 205 |
| 1096 | 3300053147 | Ga0500589_105651 | Ga0500589_105651_553_1170 | 205 |
| 1097 | 3300053148 | Ga0500590_138053 | Ga0500590_138053_79_696 | 205 |
| 1098 | 3300053151 | Ga0500604_0073337 | Ga0500604_0073337_442_1059 | 205 |
| 1099 | 3300053151 | Ga0500604_0110037 | Ga0500604_0110037_272_889 | 205 |
| 1100 | 3300053155 | Ga0500620_077788 | Ga0500620_077788_485_1105 | 205 |
| 1101 | 3300053155 | Ga0500620_117420 | Ga0500620_117420_292_909 | 205 |
| 1102 | 3300053156 | Ga0500622_0099540 | Ga0500622_0099540_463_1080 | 205 |
| 1103 | 3300053161 | Ga0500634_0116844 | Ga0500634_0116844_518_1135 | 205 |
| 1104 | 3300053161 | Ga0500634_0144840 | Ga0500634_0144840_462_1079 | 205 |
| 1105 | 3300053162 | Ga0500638_126172 | Ga0500638_126172_125_742 | 205 |
| 1106 | 3300053163 | Ga0500639_177906 | Ga0500639_177906_183_800 | 205 |
| 1107 | 3300053177 | Ga0500636_0000033 | Ga0500636_0000033_65383_66000 | 205 |
| 1108 | 3300053177 | Ga0500636_0136147 | Ga0500636_0136147_653_1270 | 205 |
| 1109 | 3300053178 | Ga0500637_0000356 | Ga0500637_0000356_4434_5051 | 205 |
| 1110 | 3300053722 | Ga0500649_085079 | Ga0500649_085079_380_997 | 205 |
| 1111 | 3300053730 | Ga0500645_005159 | Ga0500645_005159_3740_4357 | 205 |
| 1112 | 3300053730 | Ga0500645_032492 | Ga0500645_032492_501_1121 | 205 |
| 1113 | 3300053737 | Ga0500601_000010 | Ga0500601_000010_35121_35738 | 205 |
| 1114 | 3300055283 | Ga0500661_000328 | Ga0500661_000328_3219_3836 | 205 |
| 1115 | 3300055283 | Ga0500661_001465 | Ga0500661_001465_3058_3675 | 205 |
| 1116 | 3300060353 | Ga0501082_0002219 | Ga0501082_0002219_16345_16962 | 205 |
| 1117 | 3300060353 | Ga0501082_0223448 | Ga0501082_0223448_431_1048 | 205 |
| 1118 | iso_pu_bacteria | 2508501128 | 2509149948 | 205 |
| 1119 | iso_pu_bacteria | 8006964411 | 8006965672 | 205 |
| 1120 | 3300005331 | Ga0070670_100076296 | Ga0070670_1000762964 | 206 |
| 1121 | 3300025925 | Ga0207650_10354181 | Ga0207650_103541812 | 206 |
| 1122 | 3300046460 | Ga0495638_0134477 | Ga0495638_0134477_685_1311 | 206 |
| 1123 | 3300048917 | Ga0496114_0935398 | Ga0496114_0935398_77_703 | 206 |
| 1124 | 3300049460 | Ga0495682_0082694 | Ga0495682_0082694_434_1060 | 206 |
| 1125 | 3300053093 | Ga0500651_0044122 | Ga0500651_0044122_1487_2113 | 206 |
| 1126 | 3300053118 | Ga0500594_0010902 | Ga0500594_0010902_812_1438 | 206 |
| 1127 | 3300053130 | Ga0500642_0014948 | Ga0500642_0014948_966_1592 | 206 |
| 1128 | 3300053146 | Ga0500588_0166240 | Ga0500588_0166240_27_653 | 206 |
| 1129 | 3300005937 | Ga0081455_10004734 | Ga0081455_100047346 | 207 |
| 1130 | 3300006871 | Ga0075434_100435588 | Ga0075434_1004355882 | 207 |
| 1131 | 3300035112 | Ga0373932_0119323 | Ga0373932_0119323_122_751 | 207 |
| 1132 | 3300046519 | Ga0495632_0244547 | Ga0495632_0244547_28_657 | 207 |
| 1133 | 3300046692 | Ga0495671_0151795 | Ga0495671_0151795_235_864 | 207 |
| 1134 | 3300050512 | nmdc:mga0n895_456065_c1 | nmdc:mga0n895_456065_c1_347_976 | 207 |
| 1135 | 3300000546 | LJNas_1005977 | LJNas_10059771 | 208 |
| 1136 | 3300025913 | Ga0207695_10106220 | Ga0207695_101062204 | 208 |
| 1137 | 3300037418 | Ga0395900_0143981 | Ga0395900_0143981_453_1106 | 208 |
| 1138 | 3300038443 | Ga0395901_0348752 | Ga0395901_0348752_235_888 | 208 |
| 1139 | 3300039437 | Ga0436365_0750351 | Ga0436365_0750351_7862_8521 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hx6-assembly1.cif.gz_B | streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 | 0.9067 | 24 | 162 |
| 4r82-assembly1.cif.gz_B | streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 in complex with nad and fad fragments | 0.9056 | 24 | 162 |
| 3rh7-assembly3.cif.gz_F | crystal structure of a putative oxidoreductase (sma0793) from sinorhizobium meliloti 1021 at 3.00 a resolution | 0.9044 | 24 | 161 |
| 3zoe-assembly1.cif.gz_B | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde | 0.884 | 25 | 195 |
| 4hx6-assembly4.cif.gz_H | streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 | 0.88 | 24 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fgeA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9208 | 24 | 186 | 2.30.110.10 |
| 2r6vA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9166 | 25 | 185 | 2.30.110.10 |
| 3rh7E01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8903 | 24 | 161 | 2.30.110.10 |
| 3zoeB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.884 | 25 | 195 | 2.30.110.10 |
| 3bpkA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8639 | 9 | 186 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317Z3M1-F1-model_v4 | Flavin reductase like domain-containing protein | 0.943 | 53 | 163 |
GO:0010181
GO:0016646 |
| AF-A0A4R3LUW8-F1-model_v4 | Flavin reductase like protein | 0.9392 | 57 | 195 |
GO:0010181
GO:0016646 |
| AF-A0A7V4W772-F1-model_v4 | Flavin reductase family protein | 0.9346 | 24 | 162 |
GO:0010181
GO:0016646 |
| AF-A0A1F9DK23-F1-model_v4 | Flavin reductase like domain-containing protein | 0.9315 | 25 | 159 |
GO:0010181
GO:0016646 |
| AF-A0A524N1W7-F1-model_v4 | Flavin reductase family protein | 0.9297 | 24 | 188 |
GO:0010181
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar