F490685

General Info

Members Datasets Scaffolds Average Seq Length
1139 691 876 204

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0034937|Ga0496122_0034937_237_920
Length 227
Sequence MKYINKGKWNELHASRKGDLHMYSLNPEELSAKDNYKLMSGSIVPRPIAFVTTLSDHDGVINAAPFSFFNVVSSDPPLLSISVGRKNGVMKDTARNVLAHQELVVHICDESIIEEVNETAALLLPHESELERTRLTTVPSSMVSVPGVQEALIRMECKLYQHIPISNDAGIPVSDLLLVRIVQYHFSKQVYRADKGYILMDELKPVSRLAGNDYAKLGDRFTVIRPE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
19 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
20 2554235283 Bacillus safensis VK Isolate Rhizosphere
21 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
22 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
27 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
28 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
29 2643221735 Bacillus sp. Root920 Isolate Unclassified
30 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
31 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
32 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
33 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
34 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
35 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
36 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
37 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
38 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
39 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
40 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
41 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
42 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
43 2791355199
44 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
45 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
46 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
47 2811994870 Bacillus sp. JB4 Isolate Unclassified
48 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
49 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
50 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
51 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
52 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
53 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
54 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
55 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
56 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
57 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
58 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
59 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
60 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
61 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
62 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
63 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
64 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
65 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
66 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
67 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
68 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
69 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
70 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
71 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
72 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
73 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
74 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
75 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
76 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
77 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
78 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
79 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
80 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
81 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
82 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
83 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
84 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
85 2857472729 Cohnella sp. R-74144 Isolate Unclassified
86 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
87 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
88 2860837431 Bacillus sp. WR11 Isolate Unclassified
89 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
90 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
91 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
92 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
93 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
94 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
95 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
96 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
97 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
98 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
99 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
100 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
101 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
102 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
103 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
104 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
105 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
106 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
107 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
108 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
109 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
110 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
111 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
112 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
113 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
114 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
115 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
116 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
117 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
118 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
119 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
120 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
121 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
122 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
123 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
124 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
125 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
126 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
127 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
128 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
129 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
130 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
131 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
132 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
133 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
134 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
135 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
136 2919726948 Bacillus pumilus 4489 Isolate Unclassified
137 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
138 2922368715
139 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
140 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
141 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
142 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
143 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
144 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
145 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
146 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
147 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
148 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
149 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
150 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
151 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
152 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
153 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
154 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
155 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
156 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
157 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
158 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
159 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
160 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
161 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
162 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
163 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
164 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
165 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
166 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
167 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
168 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
169 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
170 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
171 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
172 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
173 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
174 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
175 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
176 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
177 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
178 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
179 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
180 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
181 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
182 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
183 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
184 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
185 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
186 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
187 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
188 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
189 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
190 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
191 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
192 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
193 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
194 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
195 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
196 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
197 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
198 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
199 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
200 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
201 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
202 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
203 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
204 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
205 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
206 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
207 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
208 2969141011 Bacillus velezensis MH25 Isolate Unclassified
209 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
210 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
211 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
212 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
213 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
214 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
215 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
216 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
217 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
218 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
219 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
220 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
221 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
222 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
223 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
224 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
227 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
228 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
229 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
230 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
231 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
232 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
233 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
234 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
235 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
236 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
237 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
238 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
239 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
240 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
241 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
242 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
243 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
244 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
245 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
246 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
247 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
248 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
249 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
250 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
251 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
252 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
253 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
254 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
255 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
256 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
257 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
258 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
259 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
260 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
261 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
262 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
263 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
264 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
265 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
266 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
267 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
268 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
269 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
270 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
271 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
272 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
273 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
274 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
275 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
276 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
277 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
278 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
279 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
280 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
281 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
282 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
283 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
284 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
285 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
286 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
287 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
288 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
289 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
290 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
291 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
292 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
293 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
294 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
295 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
296 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
297 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
298 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
302 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
303 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
304 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
305 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
306 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
307 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
308 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
309 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
310 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
311 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
312 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
313 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
314 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
315 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
316 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
317 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
318 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
319 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
320 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
321 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
322 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
323 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
324 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
325 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
326 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
327 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
328 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
329 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
330 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
331 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
332 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
333 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
334 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
335 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
336 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
337 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
338 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
339 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
340 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
341 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
342 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
343 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
344 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
345 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
346 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
347 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
348 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
349 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
350 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
351 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
352 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
357 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
359 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
362 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
364 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
365 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
366 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
368 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
423 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
425 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
426 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
427 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
428 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
429 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
433 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
434 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
435 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
436 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
437 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
438 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
439 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
440 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
441 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
442 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
443 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
444 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
445 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
446 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
447 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
448 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
449 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
450 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
451 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
452 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
453 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
454 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
455 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
456 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
457 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
458 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
459 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
460 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
461 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
462 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
463 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
464 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
465 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
466 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
467 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
468 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
469 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
470 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
471 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
472 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
473 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
474 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
475 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
476 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
477 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
478 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
479 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
480 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
481 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
482 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
483 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
484 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
485 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
486 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
487 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
488 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
489 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
490 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
491 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
492 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
493 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
494 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
495 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
496 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
497 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
498 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
499 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
500 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
501 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
502 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
503 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
504 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
505 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
506 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
507 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
508 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
509 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
510 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
511 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
512 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
513 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
514 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
515 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
516 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
517 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
518 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
519 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
520 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
521 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
522 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
523 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
524 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
525 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
526 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
527 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
528 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
529 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
530 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
531 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
532 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
533 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
534 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
535 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
536 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
537 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
538 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
539 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
540 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
541 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
542 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
543 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
544 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
545 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
546 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
547 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
548 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
549 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
550 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
551 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
552 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
553 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
554 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
555 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
556 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
557 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
558 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
559 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
560 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
561 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
562 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
563 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
564 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
565 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
566 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
567 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
568 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
569 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
570 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
571 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
572 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
573 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
574 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
575 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
577 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
578 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
579 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
580 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
581 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
582 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
583 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
584 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
585 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
586 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
587 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
588 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
589 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
590 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
591 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
592 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
593 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
594 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
595 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
596 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
597 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
598 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
599 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
600 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
601 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
602 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
603 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
604 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
605 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
606 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
607 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
608 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
609 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
610 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
611 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
612 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
613 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
614 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
615 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
616 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
617 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
618 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
619 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
620 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
621 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
622 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
623 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
624 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
625 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
626 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
627 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
628 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
629 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
630 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
631 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
632 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
633 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
634 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
635 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
636 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
637 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
638 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
639 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
640 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
641 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
642 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
643 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
644 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
645 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
646 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
647 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
648 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
649 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
651 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
652 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
653 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
654 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
655 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
656 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
657 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
658 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
659 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
660 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
661 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
662 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
663 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
664 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
665 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
666 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
667 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
668 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
669 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
670 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
671 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
672 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
673 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
674 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
675 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
676 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
677 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
678 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
679 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
680 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
681 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
682 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
683 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
684 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
685 8022653035 Bacillus sp. Rc4 Isolate Unclassified
686 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
687 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
688 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
689 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
690 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
691 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.87
Metatranscriptomes 0.18
Isolates 22.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 16.77
Nodule 13.61
Rhizoplane 3.34
Rhizosphere 50.13
Stem 0
Stem Tuber 0
Unclassified 15.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1005977 3300000546 Bacteria 1322
2 JGI24751J29686_10006535 3300002459 Bacteria 2377
3 JGI25151J46595_10000092 3300003187 Bacteria 122327
4 JGI25151J46595_10022130 3300003187 Bacteria 2645
5 JGI25406J46586_10008340 3300003203 Bacteria 4698
6 JGI25165J46597_1012920 3300003214 Bacteria 1158
7 JGI25153J46596_10001467 3300003215 Bacteria 14075
8 rootH2_10092218 3300003320 Bacteria 2213
9 rootH2_10141663 3300003320 Bacteria 1212
10 rootH1_10048035 3300003323 Bacteria 2375
11 Ga0006562J51391_1001650 3300003578 Bacteria 8110
12 JGI25404J52841_10008233 3300003659 Bacteria 2217
13 Ga0055535_1005445 3300003761 Bacteria 2788
14 Ga0055541_1001604 3300003841 Bacteria 4844
15 Ga0055541_1004867 3300003841 Bacteria 2399
16 Ga0065165_1000721 3300005262 Bacteria 46476
17 Ga0065165_1002559 3300005262 Bacteria 15029
18 Ga0065165_1004090 3300005262 Bacteria 9430
19 Ga0065165_1080195 3300005262 Bacteria 848
20 Ga0065165_1106275 3300005262 Bacteria 696
21 Ga0070670_100076296 3300005331 Bacteria 2880
22 Ga0070670_100269477 3300005331 Bacteria 1485
23 Ga0070670_100279772 3300005331 Bacteria 1457
24 Ga0070670_100321528 3300005331 Bacteria 1356
25 Ga0070670_100402324 3300005331 Bacteria 1209
26 Ga0068869_100012248 3300005334 Bacteria 5660
27 Ga0068869_100014751 3300005334 Bacteria 5226
28 Ga0070666_10206179 3300005335 Bacteria 1384
29 Ga0070666_10229163 3300005335 Bacteria 1312
30 Ga0070682_100319110 3300005337 Bacteria 1147
31 Ga0068868_100022444 3300005338 Bacteria 4762
32 Ga0068868_100228403 3300005338 Bacteria 1560
33 Ga0068868_100384969 3300005338 Bacteria 1207
34 Ga0070660_100276476 3300005339 Bacteria 1373
35 Ga0070660_100602404 3300005339 Bacteria 919
36 Ga0070689_100371420 3300005340 Bacteria 1204
37 Ga0070691_10228147 3300005341 Bacteria 990
38 Ga0070691_10320120 3300005341 Bacteria 853
39 Ga0070687_100320587 3300005343 Bacteria 990
40 Ga0070668_100172968 3300005347 Bacteria 1759
41 Ga0070668_100193104 3300005347 Bacteria 1668
42 Ga0070668_100282209 3300005347 Bacteria 1387
43 Ga0070669_100157870 3300005353 Bacteria 1760
44 Ga0070669_100190525 3300005353 Bacteria 1608
45 Ga0070669_100220429 3300005353 Bacteria 1499
46 Ga0070669_100678368 3300005353 Bacteria 869
47 Ga0070671_100034394 3300005355 Bacteria 4195
48 Ga0070671_100962965 3300005355 Bacteria 747
49 Ga0070674_100519460 3300005356 Bacteria 994
50 Ga0070673_100130100 3300005364 Bacteria 2110
51 Ga0070673_100149449 3300005364 Bacteria 1977
52 Ga0070688_100160624 3300005365 Bacteria 1544
53 Ga0070688_100265915 3300005365 Bacteria 1227
54 Ga0070667_100317446 3300005367 Bacteria 1405
55 Ga0070667_100804449 3300005367 Bacteria 873
56 Ga0070714_100035957 3300005435 Bacteria 4152
57 Ga0070713_100038145 3300005436 Bacteria 3890
58 Ga0070701_10304046 3300005438 Bacteria 981
59 Ga0070700_100521815 3300005441 Bacteria 918
60 Ga0070700_100526974 3300005441 Bacteria 914
61 Ga0070694_100707468 3300005444 Bacteria 820
62 Ga0070663_100038701 3300005455 Bacteria 3328
63 Ga0070663_100046883 3300005455 Bacteria 3060
64 Ga0070663_100196110 3300005455 Bacteria 1574
65 Ga0070663_100496606 3300005455 Bacteria 1013
66 Ga0070678_100026848 3300005456 Bacteria 3900
67 Ga0070678_100108538 3300005456 Bacteria 2167
68 Ga0070678_100438800 3300005456 Bacteria 1141
69 Ga0070678_100628095 3300005456 Bacteria 961
70 Ga0070662_100260563 3300005457 Bacteria 1397
71 Ga0070662_100287269 3300005457 Bacteria 1332
72 Ga0068867_100034759 3300005459 Bacteria 3655
73 Ga0068867_100589833 3300005459 Bacteria 968
74 Ga0068867_100660086 3300005459 Bacteria 918
75 Ga0070685_10052113 3300005466 Bacteria 2367
76 Ga0070685_10641289 3300005466 Bacteria 769
77 Ga0070706_100640543 3300005467 Bacteria 987
78 Ga0070707_100605017 3300005468 Bacteria 1059
79 Ga0070698_100420106 3300005471 Bacteria 1271
80 Ga0070699_100170101 3300005518 Bacteria 1931
81 Ga0068853_100476971 3300005539 Bacteria 1176
82 Ga0068853_101068800 3300005539 Bacteria 778
83 Ga0070672_100109865 3300005543 Bacteria 2246
84 Ga0070672_100322472 3300005543 Bacteria 1313
85 Ga0070686_100624003 3300005544 Bacteria 852
86 Ga0070695_100693265 3300005545 Bacteria 808
87 Ga0070696_100143541 3300005546 Bacteria 1747
88 Ga0070693_100040234 3300005547 Bacteria 2623
89 Ga0070665_100041904 3300005548 Bacteria 4602
90 Ga0070665_100308833 3300005548 Bacteria 1585
91 Ga0070665_100453634 3300005548 Bacteria 1292
92 Ga0070665_101188277 3300005548 Bacteria 774
93 Ga0068855_100540447 3300005563 Bacteria 1262
94 Ga0070664_100266933 3300005564 Bacteria 1541
95 Ga0068857_100022482 3300005577 Bacteria 5549
96 Ga0068857_100342759 3300005577 Bacteria 1383
97 Ga0068854_100289266 3300005578 Bacteria 1322
98 Ga0068854_100314427 3300005578 Bacteria 1271
99 Ga0068856_100022223 3300005614 Bacteria 6167
100 Ga0068856_100160011 3300005614 Bacteria 2262
101 Ga0070702_100175176 3300005615 Bacteria 1399
102 Ga0068852_100278498 3300005616 Bacteria 1612
103 Ga0068852_100509469 3300005616 Bacteria 1199
104 Ga0068859_100073186 3300005617 Bacteria 3464
105 Ga0068859_100125968 3300005617 Bacteria 2630
106 Ga0068859_100151529 3300005617 Bacteria 2394
107 Ga0068859_100351684 3300005617 Bacteria 1568
108 Ga0068859_101463494 3300005617 Bacteria 754
109 Ga0068864_100047670 3300005618 Bacteria 3681
110 Ga0068864_100088380 3300005618 Bacteria 2729
111 Ga0068864_100386862 3300005618 Bacteria 1327
112 Ga0068864_100475491 3300005618 Bacteria 1199
113 Ga0068861_100117358 3300005719 Bacteria 2141
114 Ga0068861_101100548 3300005719 Bacteria 764
115 Ga0068851_10289365 3300005834 Bacteria 939
116 Ga0068870_10088970 3300005840 Bacteria 1723
117 Ga0068870_10253870 3300005840 Bacteria 1091
118 Ga0068863_100397335 3300005841 Bacteria 1348
119 Ga0068863_100959968 3300005841 Bacteria 856
120 Ga0068858_100387714 3300005842 Bacteria 1341
121 Ga0068858_100483855 3300005842 Bacteria 1195
122 Ga0068862_100364573 3300005844 Bacteria 1344
123 Ga0068862_100493951 3300005844 Bacteria 1160
124 Ga0068862_100637640 3300005844 Bacteria 1026
125 Ga0068862_100793781 3300005844 Bacteria 924
126 Ga0068862_101103713 3300005844 Bacteria 788
127 Ga0081455_10004734 3300005937 Bacteria 15128
128 Ga0081455_10037279 3300005937 Bacteria 4320
129 Ga0081455_10063826 3300005937 Bacteria 3088
130 Ga0081455_10190092 3300005937 Bacteria 1547
131 Ga0081455_10280756 3300005937 Bacteria 1203
132 Ga0081538_10071091 3300005981 Bacteria 1917
133 Ga0081540_1000390 3300005983 Bacteria 43721
134 Ga0081540_1002694 3300005983 Bacteria 14452
135 Ga0081540_1003284 3300005983 Bacteria 12855
136 Ga0081540_1003420 3300005983 Bacteria 12550
137 Ga0081540_1015811 3300005983 Bacteria 4759
138 Ga0081540_1029232 3300005983 Bacteria 3075
139 Ga0081539_10003489 3300005985 Bacteria 19217
140 Ga0081539_10047799 3300005985 Bacteria 2440
141 Ga0070717_10280534 3300006028 Bacteria 1478
142 Ga0075365_10017375 3300006038 Bacteria 4400
143 Ga0075365_10092377 3300006038 Bacteria 2063
144 Ga0075365_10397627 3300006038 Bacteria 972
145 Ga0075365_10442097 3300006038 Bacteria 918
146 Ga0075368_10092045 3300006042 Bacteria 1240
147 Ga0075368_10103329 3300006042 Bacteria 1172
148 Ga0075363_100033572 3300006048 Bacteria 2673
149 Ga0075363_100153111 3300006048 Bacteria 1302
150 Ga0075363_100194318 3300006048 Bacteria 1158
151 Ga0075363_100261271 3300006048 Bacteria 999
152 Ga0075364_10086883 3300006051 Bacteria 2072
153 Ga0075364_10128578 3300006051 Bacteria 1699
154 Ga0075364_10189803 3300006051 Bacteria 1391
155 Ga0075364_10194845 3300006051 Bacteria 1372
156 Ga0075362_10019947 3300006177 Bacteria 2795
157 Ga0075362_10035162 3300006177 Bacteria 2186
158 Ga0075362_10168065 3300006177 Bacteria 1058
159 Ga0075367_10091224 3300006178 Bacteria 1853
160 Ga0075367_10479403 3300006178 Bacteria 789
161 Ga0075369_10002966 3300006186 Bacteria 6130
162 Ga0075369_10034442 3300006186 Bacteria 2149
163 Ga0075369_10054941 3300006186 Bacteria 1729
164 Ga0075369_10133778 3300006186 Bacteria 1128
165 Ga0075366_10044839 3300006195 Bacteria 2621
166 Ga0075366_10045750 3300006195 Bacteria 2593
167 Ga0097621_100302485 3300006237 Bacteria 1413
168 Ga0097621_100312723 3300006237 Bacteria 1390
169 Ga0097621_100973438 3300006237 Bacteria 793
170 Ga0075370_10058180 3300006353 Bacteria 2198
171 Ga0075370_10116718 3300006353 Bacteria 1552
172 Ga0068871_100079482 3300006358 Bacteria 2713
173 Ga0068871_100687026 3300006358 Bacteria 937
174 Ga0075428_100070070 3300006844 Bacteria 3833
175 Ga0075430_100674779 3300006846 Bacteria 852
176 Ga0075433_11067386 3300006852 Bacteria 703
177 Ga0075434_100158304 3300006871 Bacteria 2284
178 Ga0075434_100435588 3300006871 Bacteria 1332
179 Ga0068865_100863473 3300006881 Bacteria 785
180 Ga0097620_100073191 3300006931 Bacteria 3464
181 Ga0097620_100125976 3300006931 Bacteria 2630
182 Ga0097620_100151527 3300006931 Bacteria 2394
183 Ga0097620_100351653 3300006931 Bacteria 1568
184 Ga0097620_101463484 3300006931 Bacteria 754
185 Ga0099825_1045808 3300006941 Bacteria 1086
186 Ga0099824_1018090 3300006942 Bacteria 5885
187 Ga0075435_100362370 3300007076 Bacteria 1244
188 Ga0105251_10078838 3300009011 Bacteria 1525
189 Ga0105244_10007742 3300009036 Bacteria 6798
190 Ga0105244_10039646 3300009036 Bacteria 2451
191 Ga0105250_10032667 3300009092 Bacteria 2090
192 Ga0105250_10181026 3300009092 Bacteria 884
193 Ga0105240_10005052 3300009093 Bacteria 19785
194 Ga0105240_10019107 3300009093 Bacteria 9162
195 Ga0105240_10876793 3300009093 Bacteria 967
196 Ga0105240_11013165 3300009093 Bacteria 887
197 Ga0111539_10393326 3300009094 Bacteria 1615
198 Ga0105245_10033284 3300009098 Bacteria 4567
199 Ga0105245_10034208 3300009098 Bacteria 4506
200 Ga0105245_10256255 3300009098 Bacteria 1701
201 Ga0105245_10671872 3300009098 Bacteria 1067
202 Ga0105247_10022331 3300009101 Bacteria 3810
203 Ga0105247_10040222 3300009101 Bacteria 2857
204 Ga0105247_10304604 3300009101 Bacteria 1106
205 Ga0114129_10118949 3300009147 Bacteria 3639
206 Ga0105243_10169476 3300009148 Bacteria 1890
207 Ga0105243_10642790 3300009148 Bacteria 1027
208 Ga0105243_10803084 3300009148 Bacteria 927
209 Ga0105241_10120387 3300009174 Bacteria 2113
210 Ga0105241_10121698 3300009174 Bacteria 2102
211 Ga0105241_10158637 3300009174 Bacteria 1857
212 Ga0105242_10317343 3300009176 Bacteria 1428
213 Ga0105242_10730025 3300009176 Bacteria 973
214 Ga0105248_10063571 3300009177 Bacteria 4143
215 Ga0105248_10073791 3300009177 Bacteria 3834
216 Ga0105248_10084328 3300009177 Bacteria 3574
217 Ga0105248_10278611 3300009177 Bacteria 1883
218 Ga0105237_10001825 3300009545 Bacteria 27462
219 Ga0105237_10273975 3300009545 Bacteria 1690
220 Ga0105237_10480836 3300009545 Bacteria 1248
221 Ga0105237_10492313 3300009545 Bacteria 1233
222 Ga0105237_10666050 3300009545 Bacteria 1047
223 Ga0105238_10056920 3300009551 Bacteria 3922
224 Ga0105238_10146838 3300009551 Bacteria 2334
225 Ga0105238_10150526 3300009551 Bacteria 2302
226 Ga0105238_10184001 3300009551 Bacteria 2066
227 Ga0105249_10707211 3300009553 Bacteria 1068
228 Ga0105239_10031864 3300010375 Bacteria 5793
229 Ga0105239_10100812 3300010375 Bacteria 3194
230 Ga0105239_10259769 3300010375 Bacteria 1952
231 Ga0105239_10410759 3300010375 Bacteria 1533
232 Ga0105246_10011457 3300011119 Bacteria 5503
233 Ga0105246_10044778 3300011119 Bacteria 3009
234 Ga0105246_10061328 3300011119 Bacteria 2616
235 Ga0105246_10064157 3300011119 Bacteria 2565
236 Ga0105246_10189572 3300011119 Bacteria 1590
237 Ga0157371_10385093 3300013102 Bacteria 1024
238 Ga0157369_10040360 3300013105 Bacteria 5095
239 Ga0157369_10068769 3300013105 Bacteria 3805
240 Ga0157374_10070147 3300013296 Bacteria 3301
241 Ga0157378_10105000 3300013297 Bacteria 2583
242 Ga0157378_10113876 3300013297 Bacteria 2484
243 Ga0157378_10532100 3300013297 Bacteria 1178
244 Ga0157378_11479224 3300013297 Bacteria 723
245 Ga0163162_10856109 3300013306 Bacteria 1024
246 Ga0157372_10247662 3300013307 Bacteria 2068
247 Ga0157372_10862475 3300013307 Bacteria 1051
248 Ga0157375_10280354 3300013308 Bacteria 1830
249 Ga0157375_10336382 3300013308 Bacteria 1675
250 Ga0157375_10624976 3300013308 Bacteria 1235
251 Ga0157375_10726359 3300013308 Bacteria 1146
252 Ga0163163_10061762 3300014325 Bacteria 3712
253 Ga0163163_10366073 3300014325 Bacteria 1498
254 Ga0163163_10596850 3300014325 Bacteria 1167
255 Ga0163163_11053803 3300014325 Bacteria 876
256 Ga0163163_11592971 3300014325 Bacteria 714
257 Ga0157380_10357302 3300014326 Bacteria 1369
258 Ga0157377_10177955 3300014745 Bacteria 1335
259 Ga0157379_10330879 3300014968 Bacteria 1392
260 Ga0157376_10234717 3300014969 Bacteria 1705
261 Ga0157376_10441547 3300014969 Bacteria 1267
262 Ga0157376_10457076 3300014969 Bacteria 1247
263 Ga0163161_10315342 3300017792 Bacteria 1235
264 Ga0214544_1000007 3300021320 Bacteria 379989
265 Ga0214544_1041736 3300021320 Bacteria 965
266 Ga0214542_1000007 3300021321 Bacteria 291816
267 Ga0214542_1027972 3300021321 Bacteria 2503
268 Ga0214545_1000006 3300021324 Bacteria 291693
269 Ga0214545_1018297 3300021324 Bacteria 6429
270 Ga0214543_1000009 3300021327 Bacteria 384302
271 Ga0214543_1024430 3300021327 Bacteria 3738
272 Ga0213873_10071207 3300021358 Bacteria 958
273 Ga0213872_10010153 3300021361 Bacteria 4491
274 Ga0213876_10019228 3300021384 Bacteria 3608
275 Ga0213875_10009576 3300021388 Bacteria 4899
276 Ga0213871_10043735 3300021441 Bacteria 1209
277 Ga0209784_101922 3300025224 Bacteria 2362
278 Ga0209566_100035 3300025225 Bacteria 314893
279 Ga0209566_100086 3300025225 Bacteria 148250
280 Ga0209147_108509 3300025229 Bacteria 1270
281 Ga0209563_102773 3300025230 Bacteria 3833
282 Ga0209437_100938 3300025233 Bacteria 10986
283 Ga0209258_101224 3300025242 Bacteria 9935
284 Ga0209258_104743 3300025242 Bacteria 2485
285 Ga0207425_1011699 3300025245 Bacteria 2081
286 Ga0209677_101607 3300025253 Bacteria 9538
287 Ga0209677_103983 3300025253 Bacteria 4479
288 Ga0209148_1000216 3300025254 Bacteria 98209
289 Ga0209233_1012199 3300025261 Bacteria 2498
290 Ga0209455_1001447 3300025272 Bacteria 10717
291 Ga0209025_1000011 3300025294 Bacteria 976387
292 Ga0209025_1007977 3300025294 Bacteria 7741
293 Ga0209025_1028047 3300025294 Bacteria 2771
294 Ga0209025_1068651 3300025294 Bacteria 1272
295 Ga0209564_1013127 3300025295 Bacteria 3545
296 Ga0209758_1000015 3300025297 Bacteria 851943
297 Ga0209758_1000161 3300025297 Bacteria 154278
298 Ga0209758_1000673 3300025297 Bacteria 51032
299 Ga0209758_1004929 3300025297 Bacteria 10730
300 Ga0209758_1019668 3300025297 Bacteria 3242
301 Ga0209758_1021569 3300025297 Bacteria 2997
302 Ga0209758_1035445 3300025297 Bacteria 1967
303 Ga0209758_1035446 3300025297 Bacteria 1967
304 Ga0209256_1004892 3300025299 Bacteria 8059
305 Ga0207426_1000186 3300025302 Bacteria 154130
306 Ga0207426_1001742 3300025302 Bacteria 16568
307 Ga0207426_1006201 3300025302 Bacteria 5254
308 Ga0209051_1018369 3300025303 Bacteria 3095
309 Ga0209257_1006231 3300025304 Bacteria 7816
310 Ga0207656_10267260 3300025321 Bacteria 841
311 Ga0207653_10015012 3300025885 Bacteria 2431
312 Ga0207682_10008049 3300025893 Bacteria 4184
313 Ga0207642_10140995 3300025899 Bacteria 1271
314 Ga0207688_10057659 3300025901 Bacteria 2184
315 Ga0207688_10101989 3300025901 Bacteria 1658
316 Ga0207688_10212039 3300025901 Bacteria 1164
317 Ga0207680_10452540 3300025903 Bacteria 911
318 Ga0207647_10004864 3300025904 Bacteria 9927
319 Ga0207699_10021493 3300025906 Bacteria 3479
320 Ga0207645_10047946 3300025907 Bacteria 2728
321 Ga0207645_10294922 3300025907 Bacteria 1079
322 Ga0207643_10088900 3300025908 Bacteria 1799
323 Ga0207643_10359630 3300025908 Bacteria 915
324 Ga0207705_10038556 3300025909 Bacteria 3421
325 Ga0207654_10034330 3300025911 Bacteria 2818
326 Ga0207654_10050460 3300025911 Bacteria 2391
327 Ga0207695_10000006 3300025913 Bacteria 1135309
328 Ga0207695_10106220 3300025913 Bacteria 2794
329 Ga0207671_10047393 3300025914 Bacteria 3181
330 Ga0207671_10383348 3300025914 Bacteria 1117
331 Ga0207662_10124668 3300025918 Bacteria 1618
332 Ga0207662_10432304 3300025918 Bacteria 897
333 Ga0207657_10209135 3300025919 Bacteria 1566
334 Ga0207646_10822493 3300025922 Bacteria 826
335 Ga0207681_10167225 3300025923 Bacteria 1663
336 Ga0207681_10248139 3300025923 Bacteria 1389
337 Ga0207694_10035608 3300025924 Bacteria 3820
338 Ga0207694_10098536 3300025924 Bacteria 2314
339 Ga0207694_10266496 3300025924 Bacteria 1404
340 Ga0207694_10484105 3300025924 Bacteria 1035
341 Ga0207650_10197201 3300025925 Bacteria 1611
342 Ga0207650_10354181 3300025925 Bacteria 1208
343 Ga0207687_10030856 3300025927 Bacteria 3618
344 Ga0207687_10167310 3300025927 Bacteria 1692
345 Ga0207700_10007619 3300025928 Bacteria 6641
346 Ga0207644_10022449 3300025931 Bacteria 4312
347 Ga0207644_10620338 3300025931 Bacteria 899
348 Ga0207644_10729388 3300025931 Bacteria 827
349 Ga0207644_10828581 3300025931 Bacteria 774
350 Ga0207690_10445071 3300025932 Bacteria 1040
351 Ga0207706_10123452 3300025933 Bacteria 2278
352 Ga0207706_10167711 3300025933 Bacteria 1930
353 Ga0207706_10887395 3300025933 Bacteria 754
354 Ga0207686_10143777 3300025934 Bacteria 1652
355 Ga0207709_10247948 3300025935 Bacteria 1299
356 Ga0207709_10304390 3300025935 Bacteria 1187
357 Ga0207709_10413130 3300025935 Bacteria 1035
358 Ga0207670_10539057 3300025936 Bacteria 952
359 Ga0207670_11033401 3300025936 Bacteria 692
360 Ga0207669_10471804 3300025937 Bacteria 998
361 Ga0207704_10393599 3300025938 Bacteria 1091
362 Ga0207691_10126016 3300025940 Bacteria 2266
363 Ga0207691_10149350 3300025940 Bacteria 2055
364 Ga0207711_10063181 3300025941 Bacteria 3196
365 Ga0207711_10245950 3300025941 Bacteria 1641
366 Ga0207711_10463309 3300025941 Bacteria 1180
367 Ga0207711_10707794 3300025941 Bacteria 939
368 Ga0207689_10020050 3300025942 Bacteria 5629
369 Ga0207689_10047569 3300025942 Bacteria 3540
370 Ga0207689_10105485 3300025942 Bacteria 2315
371 Ga0207689_10718830 3300025942 Bacteria 842
372 Ga0207661_10409628 3300025944 Bacteria 1230
373 Ga0207679_10047663 3300025945 Bacteria 3114
374 Ga0207667_10276364 3300025949 Bacteria 1717
375 Ga0207667_10606140 3300025949 Bacteria 1104
376 Ga0207712_10186329 3300025961 Bacteria 1634
377 Ga0207712_10309407 3300025961 Bacteria 1300
378 Ga0207712_10377490 3300025961 Bacteria 1185
379 Ga0207668_10085734 3300025972 Bacteria 2299
380 Ga0207668_10277138 3300025972 Bacteria 1373
381 Ga0207668_10695164 3300025972 Bacteria 893
382 Ga0207658_10264865 3300025986 Bacteria 1466
383 Ga0207658_10357272 3300025986 Bacteria 1274
384 Ga0207677_10036683 3300026023 Bacteria 3197
385 Ga0207677_10226708 3300026023 Bacteria 1502
386 Ga0207677_10691835 3300026023 Bacteria 904
387 Ga0207677_10719657 3300026023 Bacteria 887
388 Ga0207703_10091998 3300026035 Bacteria 2552
389 Ga0207703_10693380 3300026035 Bacteria 968
390 Ga0207639_10102987 3300026041 Bacteria 2312
391 Ga0207639_10108879 3300026041 Bacteria 2253
392 Ga0207639_10158701 3300026041 Bacteria 1903
393 Ga0207639_10357750 3300026041 Bacteria 1306
394 Ga0207678_10008858 3300026067 Bacteria 8861
395 Ga0207678_10015151 3300026067 Bacteria 6782
396 Ga0207678_10111519 3300026067 Bacteria 2334
397 Ga0207708_10235845 3300026075 Bacteria 1470
398 Ga0207708_10336260 3300026075 Bacteria 1235
399 Ga0207702_10057935 3300026078 Bacteria 3295
400 Ga0207702_10100353 3300026078 Bacteria 2554
401 Ga0207641_10293589 3300026088 Bacteria 1533
402 Ga0207648_10095376 3300026089 Bacteria 2602
403 Ga0207648_10158250 3300026089 Bacteria 2000
404 Ga0207648_10243676 3300026089 Bacteria 1601
405 Ga0207676_10142815 3300026095 Bacteria 2051
406 Ga0207676_10382169 3300026095 Bacteria 1311
407 Ga0207674_10032725 3300026116 Bacteria 5451
408 Ga0207674_10123589 3300026116 Bacteria 2554
409 Ga0207674_10199575 3300026116 Bacteria 1950
410 Ga0207674_10353888 3300026116 Bacteria 1420
411 Ga0207674_10609757 3300026116 Bacteria 1054
412 Ga0207675_100279429 3300026118 Bacteria 1622
413 Ga0207675_100481726 3300026118 Bacteria 1233
414 Ga0207675_100597433 3300026118 Bacteria 1106
415 Ga0207683_10007253 3300026121 Bacteria 9501
416 Ga0207683_10090513 3300026121 Bacteria 2725
417 Ga0207683_10337142 3300026121 Bacteria 1382
418 Ga0207683_10463792 3300026121 Bacteria 1168
419 Ga0207698_10007921 3300026142 Bacteria 6692
420 Ga0207698_10245268 3300026142 Bacteria 1635
421 Ga0207698_10336364 3300026142 Bacteria 1420
422 Ga0209389_1000062 3300027296 Bacteria 102842
423 Ga0209389_1000072 3300027296 Bacteria 96795
424 Ga0209371_1019012 3300027312 Bacteria 1728
425 Ga0209589_1000270 3300027357 Bacteria 65577
426 Ga0209489_100160 3300027361 Bacteria 102842
427 Ga0209489_100206 3300027361 Bacteria 96866
428 Ga0209700_101128 3300027363 Bacteria 54168
429 Ga0209813_10266380 3300027866 Bacteria 656
430 Ga0207428_10102978 3300027907 Bacteria 2204
431 Ga0268266_10001098 3300028379 Bacteria 33929
432 Ga0268266_10001919 3300028379 Bacteria 23365
433 Ga0268266_10486100 3300028379 Bacteria 1177
434 Ga0268265_10036180 3300028380 Bacteria 3614
435 Ga0268265_10221601 3300028380 Bacteria 1655
436 Ga0268265_10459711 3300028380 Bacteria 1191
437 Ga0268264_10014095 3300028381 Bacteria 6572
438 Ga0268264_10239379 3300028381 Bacteria 1680
439 Ga0268264_10438915 3300028381 Bacteria 1262
440 Ga0268264_11045418 3300028381 Bacteria 824
441 Ga0307517_10000196 3300028786 Bacteria 102384
442 Ga0307517_10114104 3300028786 Bacteria 2035
443 Ga0307517_10407164 3300028786 Bacteria 718
444 Ga0307515_10019983 3300028794 Bacteria 11996
445 Ga0268256_1021141 3300030500 Bacteria 1738
446 Ga0307513_10141261 3300031456 Bacteria 2334
447 Ga0307509_10197820 3300031507 Bacteria 1851
448 Ga0307508_10052012 3300031616 Bacteria 3640
449 Ga0307516_10353780 3300031730 Bacteria 1134
450 Ga0307516_10431605 3300031730 Bacteria 975
451 Ga0307405_10099014 3300031731 Bacteria 1951
452 Ga0307405_10895696 3300031731 Bacteria 750
453 Ga0307413_10314742 3300031824 Bacteria 1193
454 Ga0307406_10518675 3300031901 Bacteria 969
455 Ga0307406_10801133 3300031901 Bacteria 795
456 Ga0307412_10223506 3300031911 Bacteria 1445
457 Ga0307409_100112259 3300031995 Bacteria 2288
458 Ga0307411_10204501 3300032005 Bacteria 1519
459 Ga0307415_100176875 3300032126 Bacteria 1670
460 Ga0307415_100249504 3300032126 Bacteria 1441
461 Ga0307510_10002425 3300033180 Bacteria 21169
462 Ga0307510_10018360 3300033180 Bacteria 8233
463 Ga0307510_10057078 3300033180 Bacteria 4057
464 Ga0307510_10163534 3300033180 Bacteria 1818
465 Ga0373932_0119323 3300035112 Bacteria 878
466 Ga0373939_0076974 3300035114 Bacteria 1100
467 Ga0373943_0187121 3300035170 Bacteria 1141
468 Ga0373927_0162707 3300035695 Bacteria 1462
469 Ga0395900_0143981 3300037418 Bacteria 2438
470 Ga0395898_0470465 3300037466 Bacteria 1196
471 Ga0395905_0000710 3300037471 Bacteria 44148
472 Ga0395905_0283473 3300037471 Bacteria 1543
473 Ga0436364_0076794 3300037853 Bacteria 1034
474 Ga0436364_0719642 3300037853 Bacteria 10746
475 Ga0436364_0755794 3300037853 Bacteria 2402
476 Ga0436364_1287204 3300037853 Bacteria 8685
477 Ga0395901_0348752 3300038443 Bacteria 1528
478 Ga0395901_0530948 3300038443 Bacteria 1194
479 Ga0436365_0750351 3300039437 Bacteria 31692
480 Ga0436365_1110743 3300039437 Bacteria 2255
481 Ga0436365_1414759 3300039437 Bacteria 4154
482 Ga0436365_1523781 3300039437 Bacteria 719
483 Ga0436365_1562201 3300039437 Bacteria 3252
484 Ga0436360_0952465 3300039438 Bacteria 2123
485 Ga0436361_0083564 3300039447 Bacteria 6115
486 Ga0436361_0573468 3300039447 Bacteria 1131
487 Ga0436362_1274308 3300039453 Bacteria 1010
488 Ga0439436_0014817 3300041404 Bacteria 2348
489 Ga0439439_0005528 3300041406 Bacteria 2889
490 Ga0439465_0069447 3300041413 Bacteria 1179
491 Ga0451791_0118347 3300041451 Bacteria 900
492 Ga0451791_1327348 3300041451 Bacteria 925
493 Ga0451793_0550299 3300041452 Bacteria 803
494 Ga0451800_0369308 3300041459 Bacteria 809
495 Ga0451802_0032404 3300041460 Bacteria 1602
496 Ga0451841_0667089 3300041498 Bacteria 820
497 Ga0451843_1581240 3300041509 Bacteria 676
498 Ga0439449_0000025 3300042007 Bacteria 44502
499 Ga0439457_008775 3300042014 Unclassified 2372
500 Ga0439462_0013810 3300042015 Bacteria 2072
501 Ga0439459_0040149 3300042438 Bacteria 991
502 Ga0466969_0030722 3300044656 Bacteria 2737
503 Ga0466972_0004442 3300044658 Bacteria 7017
504 Ga0466966_0002418 3300044684 Bacteria 12199
505 Ga0466966_0019149 3300044684 Bacteria 4506
506 Ga0466961_0000324 3300044693 Bacteria 31518
507 Ga0466963_0028999 3300044694 Bacteria 3559
508 Ga0466968_0038269 3300044735 Bacteria 2015
509 Ga0466970_0419641 3300044765 Bacteria 765
510 Ga0466960_0030151 3300044901 Bacteria 2494
511 Ga0466960_0088008 3300044901 Bacteria 1578
512 Ga0466959_0157829 3300045049 Bacteria 1595
513 Ga0451576_0507654 3300045051 Bacteria 1267
514 Ga0495592_0206014 3300046454 Bacteria 1324
515 Ga0495592_0230498 3300046454 Bacteria 1233
516 Ga0495592_0396612 3300046454 Bacteria 875
517 Ga0495603_0056082 3300046455 Bacteria 2333
518 Ga0495603_0196008 3300046455 Bacteria 1167
519 Ga0495591_045145 3300046458 Bacteria 1230
520 Ga0495629_0026002 3300046459 Bacteria 4159
521 Ga0495638_0006922 3300046460 Bacteria 8180
522 Ga0495638_0100023 3300046460 Bacteria 1735
523 Ga0495638_0134477 3300046460 Bacteria 1450
524 Ga0495638_0174155 3300046460 Bacteria 1232
525 Ga0495651_0034935 3300046462 Bacteria 3917
526 Ga0495605_0047265 3300046474 Bacteria 2111
527 Ga0495605_0051963 3300046474 Bacteria 1994
528 Ga0495605_0076469 3300046474 Bacteria 1572
529 Ga0495605_0119154 3300046474 Bacteria 1198
530 Ga0495605_0244523 3300046474 Bacteria 769
531 Ga0495584_0249418 3300046491 Bacteria 902
532 Ga0495584_0262191 3300046491 Bacteria 878
533 Ga0495585_0026108 3300046492 Bacteria 3338
534 Ga0495585_0167513 3300046492 Bacteria 1137
535 Ga0495585_0220782 3300046492 Bacteria 956
536 Ga0495585_0245380 3300046492 Bacteria 895
537 Ga0495594_0089994 3300046499 Bacteria 1719
538 Ga0495596_0035379 3300046500 Bacteria 1980
539 Ga0495596_0233987 3300046500 Bacteria 713
540 Ga0495607_0066487 3300046501 Bacteria 2028
541 Ga0495607_0097545 3300046501 Bacteria 1580
542 Ga0495607_0205620 3300046501 Bacteria 972
543 Ga0495583_0050842 3300046506 Bacteria 1892
544 Ga0495606_0048572 3300046507 Bacteria 2789
545 Ga0495606_0069620 3300046507 Bacteria 2221
546 Ga0495606_0308217 3300046507 Bacteria 855
547 Ga0495606_0363317 3300046507 Bacteria 764
548 Ga0495610_0012561 3300046512 Bacteria 5087
549 Ga0495610_0082066 3300046512 Bacteria 1478
550 Ga0495610_0098846 3300046512 Bacteria 1310
551 Ga0495616_0028704 3300046513 Bacteria 2943
552 Ga0495618_0161306 3300046514 Bacteria 1429
553 Ga0495620_0013026 3300046515 Bacteria 4269
554 Ga0495628_0448504 3300046516 Bacteria 937
555 Ga0495631_0037053 3300046518 Bacteria 2174
556 Ga0495632_0069194 3300046519 Bacteria 1700
557 Ga0495632_0132614 3300046519 Bacteria 1158
558 Ga0495632_0244547 3300046519 Bacteria 806
559 Ga0495637_0177699 3300046520 Bacteria 791
560 Ga0495643_0073425 3300046522 Bacteria 1792
561 Ga0495643_0170775 3300046522 Bacteria 1063
562 Ga0495648_0078158 3300046524 Bacteria 1893
563 Ga0495648_0125099 3300046524 Bacteria 1376
564 Ga0495648_0170726 3300046524 Bacteria 1115
565 Ga0495642_0187161 3300046528 Bacteria 902
566 Ga0495652_0027290 3300046529 Bacteria 5032
567 Ga0495652_0299044 3300046529 Bacteria 1171
568 Ga0495654_0018207 3300046530 Bacteria 3684
569 Ga0495587_0047845 3300046536 Bacteria 2535
570 Ga0495598_0041682 3300046537 Bacteria 1344
571 Ga0495609_0068566 3300046538 Bacteria 1560
572 Ga0495609_0095650 3300046538 Bacteria 1289
573 Ga0495597_0072336 3300046542 Bacteria 1483
574 Ga0495597_0089784 3300046542 Bacteria 1306
575 Ga0495597_0305828 3300046542 Bacteria 616
576 Ga0495622_0021059 3300046557 Bacteria 3037
577 Ga0495622_0039845 3300046557 Bacteria 2188
578 Ga0495633_0081329 3300046558 Bacteria 1507
579 Ga0495633_0158827 3300046558 Bacteria 1043
580 Ga0495667_0098051 3300046559 Bacteria 1898
581 Ga0495656_0039635 3300046615 Bacteria 1958
582 Ga0495668_0054485 3300046616 Bacteria 2210
583 Ga0495668_0114275 3300046616 Bacteria 1476
584 Ga0495668_0118375 3300046616 Bacteria 1449
585 Ga0495668_0176269 3300046616 Bacteria 1171
586 Ga0495634_0048467 3300046642 Bacteria 2860
587 Ga0495625_0096038 3300046660 Bacteria 2042
588 Ga0495625_0141186 3300046660 Bacteria 1625
589 Ga0495625_0235325 3300046660 Bacteria 1195
590 Ga0495635_0039556 3300046663 Bacteria 3261
591 Ga0495659_0062482 3300046664 Bacteria 1378
592 Ga0495661_0082112 3300046665 Bacteria 1856
593 Ga0495661_0154702 3300046665 Bacteria 1236
594 Ga0495661_0166016 3300046665 Bacteria 1181
595 Ga0495588_0068955 3300046674 Bacteria 1837
596 Ga0495588_0116574 3300046674 Bacteria 1407
597 Ga0495657_0230830 3300046675 Bacteria 1119
598 Ga0495646_0301078 3300046680 Bacteria 848
599 Ga0495647_0010283 3300046681 Bacteria 3184
600 Ga0495669_0045783 3300046684 Bacteria 1951
601 Ga0495669_0163072 3300046684 Bacteria 1058
602 Ga0495624_0186716 3300046690 Bacteria 1261
603 Ga0495671_0151795 3300046692 Bacteria 1128
604 Ga0495671_0155609 3300046692 Bacteria 1112
605 Ga0495649_0108323 3300046694 Bacteria 1474
606 Ga0495589_0143357 3300046794 Bacteria 1143
607 Ga0495600_0103179 3300046809 Bacteria 1858
608 Ga0495581_0225941 3300047315 Bacteria 1095
609 Ga0495604_0115420 3300047317 Bacteria 1951
610 Ga0495604_0419547 3300047317 Bacteria 878
611 Ga0495636_0330569 3300047318 Bacteria 717
612 Ga0495674_0119121 3300047319 Bacteria 2232
613 Ga0495676_0028252 3300047321 Bacteria 4793
614 Ga0495676_0036568 3300047321 Bacteria 4098
615 Ga0495676_0316557 3300047321 Bacteria 1049
616 Ga0495683_0179878 3300047323 Bacteria 966
617 Ga0495687_050286 3300047443 Bacteria 1777
618 Ga0495677_0282310 3300047445 Bacteria 651
619 Ga0495679_034860 3300047446 Bacteria 1599
620 Ga0495685_089361 3300047447 Bacteria 1022
621 Ga0495673_0056106 3300047469 Bacteria 1706
622 Ga0495673_0075947 3300047469 Bacteria 1402
623 Ga0495681_0064641 3300047470 Bacteria 1675
624 Ga0495684_0336736 3300047471 Bacteria 1075
625 Ga0495593_0370936 3300047673 Bacteria 715
626 Ga0495602_0056666 3300048088 Bacteria 3444
627 Ga0496101_0080746 3300048904 Bacteria 2403
628 Ga0496102_0013587 3300048905 Bacteria 7057
629 Ga0496102_0900449 3300048905 Bacteria 806
630 Ga0496104_0031429 3300048907 Bacteria 4937
631 Ga0496104_0059165 3300048907 Bacteria 3627
632 Ga0496105_0019733 3300048908 Bacteria 5438
633 Ga0496105_0027418 3300048908 Bacteria 4653
634 Ga0496105_0236469 3300048908 Bacteria 1483
635 Ga0496106_0032474 3300048909 Bacteria 3892
636 Ga0496106_0185232 3300048909 Bacteria 1654
637 Ga0496106_0228129 3300048909 Bacteria 1486
638 Ga0496106_0433607 3300048909 Bacteria 1056
639 Ga0496106_0521764 3300048909 Bacteria 954
640 Ga0496107_0173292 3300048910 Bacteria 1601
641 Ga0496107_0383552 3300048910 Bacteria 1045
642 Ga0496108_0096731 3300048911 Bacteria 2515
643 Ga0496108_0575578 3300048911 Bacteria 982
644 Ga0496109_0213814 3300048912 Bacteria 1813
645 Ga0496109_0359484 3300048912 Bacteria 1375
646 Ga0496110_0077186 3300048913 Bacteria 2963
647 Ga0496110_0106130 3300048913 Bacteria 2520
648 Ga0496110_0139014 3300048913 Bacteria 2196
649 Ga0496110_0642889 3300048913 Bacteria 960
650 Ga0496110_1013780 3300048913 Bacteria 738
651 Ga0496111_0320510 3300048914 Bacteria 1148
652 Ga0496112_0053052 3300048915 Bacteria 3981
653 Ga0496113_0424221 3300048916 Bacteria 1068
654 Ga0496113_0637739 3300048916 Bacteria 852
655 Ga0496114_0011812 3300048917 Bacteria 6989
656 Ga0496114_0935398 3300048917 Bacteria 749
657 Ga0496115_0182239 3300048918 Unclassified 1736
658 Ga0496116_0011308 3300048919 Bacteria 7405
659 Ga0496116_0022209 3300048919 Bacteria 4761
660 Ga0496116_0045939 3300048919 Bacteria 2951
661 Ga0496116_0061458 3300048919 Bacteria 2432
662 Ga0496116_0101125 3300048919 Bacteria 1722
663 Ga0496116_0116367 3300048919 Bacteria 1558
664 Ga0496116_0127317 3300048919 Bacteria 1460
665 Ga0496116_0319628 3300048919 Unclassified 728
666 Ga0496116_0362387 3300048919 Bacteria 658
667 Ga0496117_0008289 3300048920 Bacteria 9890
668 Ga0496117_0091766 3300048920 Bacteria 1952
669 Ga0496117_0187294 3300048920 Bacteria 1183
670 Ga0496117_0243722 3300048920 Bacteria 985
671 Ga0496118_0011811 3300048921 Bacteria 8476
672 Ga0496118_0026226 3300048921 Bacteria 4971
673 Ga0496118_0038064 3300048921 Bacteria 3860
674 Ga0496118_0066963 3300048921 Bacteria 2619
675 Ga0496118_0081688 3300048921 Bacteria 2268
676 Ga0496118_0138218 3300048921 Bacteria 1550
677 Ga0496118_0149520 3300048921 Bacteria 1464
678 Ga0496118_0161098 3300048921 Bacteria 1387
679 Ga0496119_0011318 3300048922 Bacteria 7407
680 Ga0496119_0019471 3300048922 Bacteria 4997
681 Ga0496119_0053579 3300048922 Bacteria 2463
682 Ga0496119_0087385 3300048922 Bacteria 1779
683 Ga0496119_0100067 3300048922 Bacteria 1629
684 Ga0496119_0247284 3300048922 Bacteria 901
685 Ga0496120_0008182 3300048923 Bacteria 7665
686 Ga0496120_0011217 3300048923 Bacteria 6181
687 Ga0496120_0031156 3300048923 Bacteria 3234
688 Ga0496120_0260218 3300048923 Bacteria 810
689 Ga0496120_0386129 3300048923 Bacteria 621
690 Ga0496121_0000385 3300048924 Bacteria 90105
691 Ga0496121_0019557 3300048924 Bacteria 6763
692 Ga0496121_0020698 3300048924 Bacteria 6491
693 Ga0496121_0052575 3300048924 Bacteria 3419
694 Ga0496121_0059413 3300048924 Bacteria 3153
695 Ga0496121_0061831 3300048924 Bacteria 3070
696 Ga0496121_0115968 3300048924 Bacteria 2032
697 Ga0496121_0171782 3300048924 Unclassified 1574
698 Ga0496121_0189191 3300048924 Bacteria 1477
699 Ga0496121_0230496 3300048924 Bacteria 1297
700 Ga0496121_0306453 3300048924 Bacteria 1075
701 Ga0496122_0020644 3300048925 Bacteria 5936
702 Ga0496122_0034937 3300048925 Bacteria 4103
703 Ga0496122_0049005 3300048925 Bacteria 3242
704 Ga0496122_0119178 3300048925 Bacteria 1707
705 Ga0496122_0162597 3300048925 Bacteria 1359
706 Ga0496122_0268277 3300048925 Bacteria 942
707 Ga0496122_0309747 3300048925 Bacteria 846
708 Ga0496123_0035712 3300048926 Bacteria 3537
709 Ga0496123_0101571 3300048926 Bacteria 1672
710 Ga0496123_0106375 3300048926 Bacteria 1616
711 Ga0496124_0024791 3300048927 Bacteria 5445
712 Ga0496124_0042228 3300048927 Bacteria 3928
713 Ga0496124_0056592 3300048927 Bacteria 3307
714 Ga0496124_0103018 3300048927 Bacteria 2309
715 Ga0496124_0105393 3300048927 Bacteria 2278
716 Ga0496124_0127929 3300048927 Bacteria 2022
717 Ga0496124_0195402 3300048927 Bacteria 1544
718 Ga0496124_0336336 3300048927 Bacteria 1074
719 Ga0496124_0407652 3300048927 Bacteria 941
720 Ga0496125_0001624 3300048928 Bacteria 31668
721 Ga0496125_0009603 3300048928 Bacteria 9897
722 Ga0496125_0011997 3300048928 Bacteria 8629
723 Ga0496125_0073441 3300048928 Bacteria 2659
724 Ga0496125_0168177 3300048928 Bacteria 1478
725 Ga0496125_0174668 3300048928 Bacteria 1439
726 Ga0496125_0187454 3300048928 Bacteria 1370
727 Ga0496126_0005539 3300048929 Bacteria 14372
728 Ga0496126_0012136 3300048929 Bacteria 8844
729 Ga0496126_0046270 3300048929 Bacteria 3993
730 Ga0496126_0054918 3300048929 Bacteria 3605
731 Ga0496126_0058664 3300048929 Bacteria 3468
732 Ga0496126_0101673 3300048929 Bacteria 2514
733 Ga0496126_0189392 3300048929 Bacteria 1743
734 Ga0496126_0191230 3300048929 Bacteria 1733
735 Ga0496126_0290391 3300048929 Bacteria 1352
736 Ga0495682_0082694 3300049460 Bacteria 1155
737 Ga0495682_0160173 3300049460 Bacteria 801
738 Ga0501040_0354214 3300049576 Bacteria 1052
739 Ga0501067_0256727 3300049583 Bacteria 973
740 Ga0501069_0306168 3300049585 Bacteria 932
741 Ga0501072_0005470 3300049588 Bacteria 9672
742 Ga0501076_0200135 3300049592 Bacteria 1631
743 Ga0501083_0017990 3300049744 Bacteria 4929
744 Ga0501083_0104790 3300049744 Bacteria 1863
745 Ga0501044_0060247 3300049823 Bacteria 3887
746 nmdc:mga03683_111095_c1 3300050489 Bacteria 1212
747 nmdc:mga03683_132301_c1 3300050489 Bacteria 1117
748 nmdc:mga03n38_260768_c1 3300050490 Bacteria 919
749 nmdc:mga00v17_119137_c1 3300050491 Bacteria 1680
750 nmdc:mga00v17_40638_c1 3300050491 Bacteria 2790
751 nmdc:mga0yw44_105680_c1 3300050492 Bacteria 1799
752 nmdc:mga0yw44_178244_c1 3300050492 Bacteria 1398
753 nmdc:mga0yw44_179543_c1 3300050492 Bacteria 1393
754 nmdc:mga0yw44_20981_c1 3300050492 Bacteria 3636
755 nmdc:mga0yw44_319521_c1 3300050492 Bacteria 1042
756 nmdc:mga0yw44_51441_c1 3300050492 Bacteria 2494
757 nmdc:mga0yw44_608085_c1 3300050492 Bacteria 743
758 nmdc:mga0yw44_8581_c1 3300050492 Bacteria 5103
759 nmdc:mga0k408_378583_c1 3300050493 Bacteria 843
760 nmdc:mga0k408_5289_c1 3300050493 Bacteria 6853
761 nmdc:mga0k408_74953_c1 3300050493 Bacteria 1977
762 nmdc:mga06z11_21787_c1 3300050494 Bacteria 2983
763 nmdc:mga06z11_303415_c1 3300050494 Bacteria 950
764 nmdc:mga06z11_391985_c1 3300050494 Bacteria 835
765 nmdc:mga06z11_44366_c1 3300050494 Bacteria 2242
766 nmdc:mga04h51_24889_c1 3300050495 Bacteria 1838
767 nmdc:mga07m45_196195_c1 3300050496 Bacteria 1174
768 nmdc:mga07m45_247912_c1 3300050496 Bacteria 1036
769 nmdc:mga07m45_267915_c1 3300050496 Bacteria 994
770 nmdc:mga07m45_435776_c1 3300050496 Bacteria 760
771 nmdc:mga05p37_96999_c1 3300050507 Bacteria 3632
772 nmdc:mga0qj67_634343_c1 3300050509 Bacteria 853
773 nmdc:mga08y16_86315_c1 3300050511 Bacteria 3270
774 nmdc:mga0n895_252685_c1 3300050512 Bacteria 1789
775 nmdc:mga0n895_456065_c1 3300050512 Bacteria 1290
776 nmdc:mga08x19_614961_c1 3300050514 Bacteria 770
777 nmdc:mga0a205_818705_c1 3300050515 Bacteria 779
778 nmdc:mga0a205_836351_c1 3300050515 Bacteria 768
779 nmdc:mga0sz30_121410_c1 3300050516 Bacteria 1148
780 nmdc:mga0sz30_23751_c1 3300050516 Bacteria 2498
781 nmdc:mga0sz30_43538_c1 3300050516 Bacteria 1890
782 nmdc:mga0sz30_85822_c1 3300050516 Bacteria 1366
783 nmdc:mga0sz30_90231_c1 3300050516 Bacteria 1333
784 Ga0500635_0038061 3300053080 Bacteria 1594
785 Ga0500635_0130770 3300053080 Bacteria 946
786 Ga0495655_0074753 3300053083 Bacteria 955
787 Ga0495619_0296383 3300053085 Bacteria 1120
788 Ga0500578_0078489 3300053086 Bacteria 2101
789 Ga0500578_0227404 3300053086 Bacteria 1132
790 Ga0500643_000210 3300053087 Bacteria 55059
791 Ga0500643_027964 3300053087 Bacteria 1747
792 Ga0500643_034542 3300053087 Bacteria 1522
793 Ga0500644_0015890 3300053088 Bacteria 2157
794 Ga0500581_094737 3300053089 Bacteria 1475
795 Ga0500646_0039027 3300053090 Bacteria 1331
796 Ga0500583_0137198 3300053092 Bacteria 1214
797 Ga0500651_0044122 3300053093 Bacteria 2808
798 Ga0500651_0133456 3300053093 Bacteria 1500
799 Ga0500651_0275141 3300053093 Unclassified 973
800 Ga0500566_0005375 3300053094 Bacteria 7616
801 Ga0500566_0016861 3300053094 Bacteria 4287
802 Ga0500640_071568 3300053095 Bacteria 1486
803 Ga0500641_0009642 3300053096 Bacteria 3472
804 Ga0500641_0079733 3300053096 Bacteria 1388
805 Ga0500650_0087386 3300053098 Bacteria 1459
806 Ga0500555_008898 3300053103 Bacteria 2867
807 Ga0500555_022271 3300053103 Bacteria 1821
808 Ga0500555_039334 3300053103 Bacteria 1321
809 Ga0500556_0000012 3300053104 Bacteria 250391
810 Ga0500556_0009402 3300053104 Bacteria 2840
811 Ga0500556_0053913 3300053104 Bacteria 1463
812 Ga0500557_000034 3300053105 Bacteria 71225
813 Ga0500562_013400 3300053108 Bacteria 2093
814 Ga0500562_016909 3300053108 Bacteria 1876
815 Ga0500562_021432 3300053108 Bacteria 1681
816 Ga0500569_008862 3300053109 Bacteria 2315
817 Ga0500569_050540 3300053109 Bacteria 1253
818 Ga0500592_005117 3300053116 Bacteria 2082
819 Ga0500592_011853 3300053116 Bacteria 1394
820 Ga0500593_022884 3300053117 Bacteria 2762
821 Ga0500594_0010902 3300053118 Bacteria 2117
822 Ga0500594_0028708 3300053118 Bacteria 1450
823 Ga0500595_000665 3300053119 Bacteria 20620
824 Ga0500595_002372 3300053119 Bacteria 9413
825 Ga0500595_004206 3300053119 Bacteria 6510
826 Ga0500595_032968 3300053119 Bacteria 1723
827 Ga0500597_043919 3300053120 Bacteria 1888
828 Ga0500608_011645 3300053122 Bacteria 3827
829 Ga0500614_016922 3300053123 Bacteria 1642
830 Ga0500621_208680 3300053126 Bacteria 686
831 Ga0500642_0000053 3300053130 Bacteria 71632
832 Ga0500642_0000167 3300053130 Bacteria 27218
833 Ga0500642_0014576 3300053130 Bacteria 2930
834 Ga0500642_0014948 3300053130 Bacteria 2903
835 Ga0500642_0055120 3300053130 Bacteria 1767
836 Ga0500642_0059513 3300053130 Bacteria 1711
837 Ga0500652_001522 3300053131 Bacteria 7114
838 Ga0500655_075826 3300053133 Bacteria 688
839 Ga0500658_0032658 3300053134 Bacteria 2042
840 Ga0500559_0177366 3300053136 Bacteria 1003
841 Ga0500568_0059458 3300053139 Bacteria 1483
842 Ga0500577_0032842 3300053142 Bacteria 1829
843 Ga0500577_0065289 3300053142 Bacteria 1412
844 Ga0500577_0157458 3300053142 Bacteria 966
845 Ga0500588_0166240 3300053146 Bacteria 805
846 Ga0500588_0186811 3300053146 Bacteria 763
847 Ga0500588_0191882 3300053146 Bacteria 754
848 Ga0500589_105651 3300053147 Bacteria 1216
849 Ga0500590_138053 3300053148 Bacteria 1118
850 Ga0500604_0004751 3300053151 Bacteria 3599
851 Ga0500604_0073337 3300053151 Bacteria 1095
852 Ga0500604_0110037 3300053151 Bacteria 914
853 Ga0500616_0000035 3300053153 Bacteria 394242
854 Ga0500620_077788 3300053155 Bacteria 1147
855 Ga0500620_117420 3300053155 Bacteria 932
856 Ga0500622_0000826 3300053156 Bacteria 26531
857 Ga0500622_0099540 3300053156 Bacteria 1433
858 Ga0500627_0028603 3300053158 Bacteria 2316
859 Ga0500633_0048037 3300053160 Bacteria 1462
860 Ga0500634_0116844 3300053161 Bacteria 1305
861 Ga0500634_0144840 3300053161 Bacteria 1119
862 Ga0500638_126172 3300053162 Bacteria 1165
863 Ga0500639_177906 3300053163 Bacteria 945
864 Ga0500636_0000033 3300053177 Bacteria 72990
865 Ga0500636_0136147 3300053177 Bacteria 1364
866 Ga0500637_0000356 3300053178 Bacteria 17344
867 Ga0500649_085079 3300053722 Bacteria 1279
868 Ga0500645_005159 3300053730 Bacteria 4867
869 Ga0500645_006872 3300053730 Bacteria 4018
870 Ga0500645_032492 3300053730 Bacteria 1565
871 Ga0500601_000010 3300053737 Bacteria 45442
872 Ga0500661_000328 3300055283 Bacteria 8643
873 Ga0500661_001465 3300055283 Bacteria 4430
874 Ga0587079_055204 3300059647 Bacteria 845
875 Ga0501082_0002219 3300060353 Bacteria 16983
876 Ga0501082_0223448 3300060353 Bacteria 1639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0362387 Ga0496116_0362387_47_562 166
2 3300048923 Ga0496120_0386129 Ga0496120_0386129_82_597 166
3 3300048925 Ga0496122_0268277 Ga0496122_0268277_342_857 166
4 3300046542 Ga0495597_0305828 Ga0495597_0305828_15_539 169
5 iso_pu_bacteria 2857472729 2857479022 193
6 iso_pu_bacteria 2511231119 2511701330 194
7 iso_pu_bacteria 2540341094 2540608528 194
8 iso_pu_bacteria 2545555800 2545557955 194
9 iso_pu_bacteria 2554235283 2555468507 194
10 iso_pu_bacteria 2576861599 2578932351 194
11 iso_pu_bacteria 2599185353 2600199796 194
12 iso_pu_bacteria 2630968484 2631986526 194
13 iso_pu_bacteria 2643221543 2643736499 194
14 iso_pu_bacteria 2643221735 2644738687 194
15 iso_pu_bacteria 2648501850 2651530948 194
16 iso_pu_bacteria 2671180844 2674421812 194
17 iso_pu_bacteria 2684623153 2686998650 194
18 iso_pu_bacteria 2687453109 2687499930 194
19 iso_pu_bacteria 2695420354 2695629285 194
20 iso_pu_bacteria 2716884898 2717915014 194
21 iso_pu_bacteria 2721755693 2723604575 194
22 iso_pu_bacteria 2728369359 2730135216 194
23 iso_pu_bacteria 2751185905 2753809974 194
24 iso_pu_bacteria 2802428803 2802436837 194
25 iso_pu_bacteria 2808606399 2809053668 194
26 iso_pu_bacteria 2818991468 2819722848 194
27 iso_pu_bacteria 2823526263 2823529870 194
28 iso_pu_bacteria 2860837431 2860841337 194
29 iso_pu_bacteria 2864733723 2864739451 194
30 iso_pu_bacteria 2877768649 2877772219 194
31 iso_pu_bacteria 2880169592 2880173058 194
32 iso_pu_bacteria 2889042446 2889045132 194
33 iso_pu_bacteria 2889276214 2889280482 194
34 iso_pu_bacteria 2889295896 2889299995 194
35 iso_pu_bacteria 2897109615 2897113336 194
36 iso_pu_bacteria 2904490793 2904492024 194
37 iso_pu_bacteria 2904560550 2904561659 194
38 iso_pu_bacteria 2904595352 2904595586 194
39 iso_pu_bacteria 2904755435 2904762624 194
40 iso_pu_bacteria 2908665501 2908667126 194
41 iso_pu_bacteria 2919093281 2919094858 194
42 iso_pu_bacteria 2919160200 2919161260 194
43 iso_pu_bacteria 2919726948 2919727434 194
44 iso_pu_bacteria 2929206907 2929207685 194
45 iso_pu_bacteria 2931384279 2931388567 194
46 iso_pu_bacteria 2939702853 2939705340 194
47 iso_pu_bacteria 2945991243 2945992842 194
48 iso_pu_bacteria 2946053406 2946055584 194
49 iso_pu_bacteria 2954773129 2954776699 194
50 iso_pu_bacteria 2962290636 2962294572 194
51 iso_pu_bacteria 2969136845 2969140506 194
52 iso_pu_bacteria 2969141011 2969144776 194
53 iso_pu_bacteria 2969770375 2969771020 194
54 iso_pu_bacteria 2971893375 2971896901 194
55 iso_pu_bacteria 2980492589 2980496334 194
56 iso_pu_bacteria 2981284811 2981286915 194
57 iso_pu_bacteria 2981289755 2981291866 194
58 iso_pu_bacteria 2981980479 2981982553 194
59 iso_pu_bacteria 2981985349 2981987661 194
60 iso_pu_bacteria 2984527788 2984529331 194
61 iso_pu_bacteria 2984532647 2984535437 194
62 iso_pu_bacteria 3006879489 3006883040 194
63 iso_pu_bacteria 648028048 648170616 194
64 iso_pu_bacteria 8002317523 8002319449 194
65 iso_pu_bacteria 8022630665 8022632436 194
66 iso_pu_bacteria 8022653035 8022656789 194
67 iso_pu_bacteria 8046991243 8046992928 194
68 iso_pu_bacteria 8051952484 8051954167 194
69 iso_pu_bacteria 8052174270 8052175748 194
70 3300003187 JGI25151J46595_10022130 JGI25151J46595_100221303 195
71 3300003761 Ga0055535_1005445 Ga0055535_10054453 195
72 3300025242 Ga0209258_101224 Ga0209258_1012243 195
73 3300025294 Ga0209025_1007977 Ga0209025_10079777 195
74 iso_pu_bacteria 2821111986 2821113318 195
75 iso_pu_bacteria 2885526491 2885526587 195
76 iso_pu_bacteria 2904162308 2904165136 195
77 iso_pu_bacteria 2907202186 2907204819 195
78 iso_pu_bacteria 2643221676 2644426134 196
79 3300003187 JGI25151J46595_10000092 JGI25151J46595_1000009248 197
80 3300003578 Ga0006562J51391_1001650 Ga0006562J51391_10016508 197
81 3300003841 Ga0055541_1001604 Ga0055541_10016045 197
82 3300003841 Ga0055541_1004867 Ga0055541_10048673 197
83 3300009011 Ga0105251_10078838 Ga0105251_100788382 197
84 3300009036 Ga0105244_10007742 Ga0105244_100077425 197
85 3300009036 Ga0105244_10039646 Ga0105244_100396462 197
86 3300011119 Ga0105246_10044778 Ga0105246_100447783 197
87 3300025224 Ga0209784_101922 Ga0209784_1019222 197
88 3300025225 Ga0209566_100035 Ga0209566_100035175 197
89 3300025225 Ga0209566_100086 Ga0209566_100086130 197
90 3300025229 Ga0209147_108509 Ga0209147_1085092 197
91 3300025233 Ga0209437_100938 Ga0209437_1009382 197
92 3300025242 Ga0209258_104743 Ga0209258_1047433 197
93 3300025294 Ga0209025_1000011 Ga0209025_1000011484 197
94 3300025294 Ga0209025_1028047 Ga0209025_10280473 197
95 3300025294 Ga0209025_1068651 Ga0209025_10686511 197
96 3300027312 Ga0209371_1019012 Ga0209371_10190123 197
97 3300030500 Ga0268256_1021141 Ga0268256_10211413 197
98 3300041404 Ga0439436_0014817 Ga0439436_0014817_1038_1679 197
99 3300041406 Ga0439439_0005528 Ga0439439_0005528_1747_2388 197
100 3300042007 Ga0439449_0000025 Ga0439449_0000025_22627_23268 197
101 3300042014 Ga0439457_008775 Ga0439457_008775_1413_2054 197
102 3300042015 Ga0439462_0013810 Ga0439462_0013810_919_1560 197
103 3300046665 Ga0495661_0166016 Ga0495661_0166016_303_917 197
104 3300048919 Ga0496116_0011308 Ga0496116_0011308_4177_4788 197
105 3300048919 Ga0496116_0022209 Ga0496116_0022209_1219_1839 197
106 3300048919 Ga0496116_0061458 Ga0496116_0061458_221_841 197
107 3300048919 Ga0496116_0319628 Ga0496116_0319628_97_708 197
108 3300048920 Ga0496117_0008289 Ga0496117_0008289_5478_6089 197
109 3300048921 Ga0496118_0011811 Ga0496118_0011811_2373_2984 197
110 3300048922 Ga0496119_0011318 Ga0496119_0011318_1137_1748 197
111 3300048923 Ga0496120_0008182 Ga0496120_0008182_5208_5819 197
112 3300048924 Ga0496121_0052575 Ga0496121_0052575_1434_2045 197
113 3300048924 Ga0496121_0059413 Ga0496121_0059413_1840_2460 197
114 3300048924 Ga0496121_0061831 Ga0496121_0061831_731_1342 197
115 3300048924 Ga0496121_0171782 Ga0496121_0171782_49_669 197
116 3300048925 Ga0496122_0020644 Ga0496122_0020644_666_1277 197
117 3300048925 Ga0496122_0034937 Ga0496122_0034937_237_920 197
118 3300048925 Ga0496122_0049005 Ga0496122_0049005_1468_2079 197
119 3300048925 Ga0496122_0162597 Ga0496122_0162597_333_953 197
120 3300048925 Ga0496122_0309747 Ga0496122_0309747_117_737 197
121 3300048926 Ga0496123_0035712 Ga0496123_0035712_1343_1954 197
122 3300048926 Ga0496123_0101571 Ga0496123_0101571_108_791 197
123 3300048927 Ga0496124_0042228 Ga0496124_0042228_1327_1947 197
124 3300048927 Ga0496124_0056592 Ga0496124_0056592_430_1050 197
125 3300048927 Ga0496124_0105393 Ga0496124_0105393_417_1028 197
126 3300048927 Ga0496124_0336336 Ga0496124_0336336_442_1053 197
127 3300048928 Ga0496125_0001624 Ga0496125_0001624_29698_30309 197
128 3300048928 Ga0496125_0009603 Ga0496125_0009603_419_1039 197
129 3300048929 Ga0496126_0054918 Ga0496126_0054918_48_659 197
130 3300059647 Ga0587079_055204 Ga0587079_055204_101_715 197
131 iso_pu_bacteria 2811994870 2812313840 197
132 iso_pu_bacteria 2939679117 2939682680 197
133 iso_pu_bacteria 2602042107 2603857907 198
134 iso_pu_bacteria 2857524615 2857527281 198
135 iso_pu_bacteria 2919073203 2919078396 198
136 iso_pu_bacteria 2828305725 2828307161 199
137 iso_pu_bacteria 2507262055 2507504586 201
138 iso_pu_bacteria 2508501009 2508546014 201
139 iso_pu_bacteria 2508501042 2508694861 201
140 iso_pu_bacteria 2511231028 2511393398 201
141 iso_pu_bacteria 2513237092 2513626549 201
142 iso_pu_bacteria 2513237094 2513638454 201
143 iso_pu_bacteria 2513237095 2513649366 201
144 iso_pu_bacteria 2513237098 2513671656 201
145 iso_pu_bacteria 2513237102 2513699381 201
146 iso_pu_bacteria 2513237139 2513875563 201
147 iso_pu_bacteria 2513237161 2514011046 201
148 iso_pu_bacteria 2515154112 2515624206 201
149 iso_pu_bacteria 2517093001 2517102911 201
150 iso_pu_bacteria 2524023205 2524438726 201
151 iso_pu_bacteria 2528768022 2528854444 201
152 iso_pu_bacteria 2617270735 2617347590 201
153 iso_pu_bacteria 2617270741 2617376998 201
154 iso_pu_bacteria 2721755755 2723845158 201
155 iso_pu_bacteria 2728368998 2728748007 201
156 iso_pu_bacteria 2744054633 2745080486 201
157 iso_pu_bacteria 2791355196 2793063568 201
158 iso_pu_bacteria 2791355199 2793080921 201
159 iso_pu_bacteria 2802429603 2805921082 201
160 iso_pu_bacteria 2816332527 2818237046 201
161 iso_pu_bacteria 2824600985 2824606344 201
162 iso_pu_bacteria 2824609381 2824612081 201
163 iso_pu_bacteria 2824617872 2824619220 201
164 iso_pu_bacteria 2824626560 2824628131 201
165 iso_pu_bacteria 2824635225 2824636907 201
166 iso_pu_bacteria 2824644064 2824645709 201
167 iso_pu_bacteria 2824653114 2824658468 201
168 iso_pu_bacteria 2824661429 2824668034 201
169 iso_pu_bacteria 2824671348 2824676764 201
170 iso_pu_bacteria 2824679649 2824683241 201
171 iso_pu_bacteria 2824687955 2824694044 201
172 iso_pu_bacteria 2824696289 2824701597 201
173 iso_pu_bacteria 2824704595 2824710293 201
174 iso_pu_bacteria 2824714736 2824715888 201
175 iso_pu_bacteria 2824723954 2824725370 201
176 iso_pu_bacteria 2824732956 2824736866 201
177 iso_pu_bacteria 2824746037 2824747593 201
178 iso_pu_bacteria 2824753945 2824760913 201
179 iso_pu_bacteria 2824763712 2824767678 201
180 iso_pu_bacteria 2824773399 2824777069 201
181 iso_pu_bacteria 2838122688 2838129182 201
182 iso_pu_bacteria 2841941048 2841944190 201
183 iso_pu_bacteria 2841949485 2841954635 201
184 iso_pu_bacteria 2841957949 2841963068 201
185 iso_pu_bacteria 2841966195 2841968972 201
186 iso_pu_bacteria 2841974524 2841979746 201
187 iso_pu_bacteria 2841983080 2841989658 201
188 iso_pu_bacteria 2842038055 2842044175 201
189 iso_pu_bacteria 2842045827 2842051836 201
190 iso_pu_bacteria 2847930680 2847931827 201
191 iso_pu_bacteria 2847939898 2847941488 201
192 iso_pu_bacteria 2849076700 2849082399 201
193 iso_pu_bacteria 2857509624 2857516533 201
194 iso_pu_bacteria 2874590934 2874595508 201
195 iso_pu_bacteria 2874604998 2874605127 201
196 iso_pu_bacteria 2874612657 2874615902 201
197 iso_pu_bacteria 2874620515 2874621517 201
198 iso_pu_bacteria 2874628541 2874629453 201
199 iso_pu_bacteria 2874645413 2874647053 201
200 iso_pu_bacteria 2876761206 2876765881 201
201 iso_pu_bacteria 2876771140 2876775702 201
202 iso_pu_bacteria 2876808645 2876813287 201
203 iso_pu_bacteria 2876818435 2876823694 201
204 iso_pu_bacteria 2879074833 2879079793 201
205 iso_pu_bacteria 2879083081 2879091263 201
206 iso_pu_bacteria 2879099564 2879103071 201
207 iso_pu_bacteria 2879110137 2879113631 201
208 iso_pu_bacteria 2879127579 2879131128 201
209 iso_pu_bacteria 2879142872 2879150334 201
210 iso_pu_bacteria 2881364244 2881369805 201
211 iso_pu_bacteria 2881665667 2881668646 201
212 iso_pu_bacteria 2885366525 2885368265 201
213 iso_pu_bacteria 2885383462 2885385128 201
214 iso_pu_bacteria 2888378607 2888380246 201
215 iso_pu_bacteria 2888388044 2888391277 201
216 iso_pu_bacteria 2888419890 2888427159 201
217 iso_pu_bacteria 2889033259 2889039901 201
218 iso_pu_bacteria 2903768456 2903769513 201
219 iso_pu_bacteria 2904666416 2904668186 201
220 iso_pu_bacteria 2904711408 2904719971 201
221 iso_pu_bacteria 2906626472 2906634554 201
222 iso_pu_bacteria 2908775508 2908782904 201
223 iso_pu_bacteria 2922361189 2922365293 201
224 iso_pu_bacteria 2922368715 2922369813 201
225 iso_pu_bacteria 2922386360 2922390915 201
226 iso_pu_bacteria 2922393267 2922398764 201
227 iso_pu_bacteria 2929615660 2929622828 201
228 iso_pu_bacteria 2929624759 2929632068 201
229 iso_pu_bacteria 2932794094 2932796192 201
230 iso_pu_bacteria 2932801729 2932807766 201
231 iso_pu_bacteria 2932809354 2932815408 201
232 iso_pu_bacteria 2932818245 2932825153 201
233 iso_pu_bacteria 2932828146 2932829321 201
234 iso_pu_bacteria 2933577622 2933584540 201
235 iso_pu_bacteria 2935608549 2935614215 201
236 iso_pu_bacteria 2935616580 2935617754 201
237 iso_pu_bacteria 2935638405 2935643799 201
238 iso_pu_bacteria 2935648319 2935651416 201
239 iso_pu_bacteria 2935656913 2935659816 201
240 iso_pu_bacteria 2935665750 2935670891 201
241 iso_pu_bacteria 2935675223 2935681511 201
242 iso_pu_bacteria 2935684952 2935692512 201
243 iso_pu_bacteria 2935694250 2935699274 201
244 iso_pu_bacteria 2935703347 2935710081 201
245 iso_pu_bacteria 2935713505 2935721130 201
246 iso_pu_bacteria 2935722832 2935730877 201
247 iso_pu_bacteria 2935732158 2935739819 201
248 iso_pu_bacteria 2935741537 2935748857 201
249 iso_pu_bacteria 2935750917 2935758727 201
250 iso_pu_bacteria 2935760218 2935767789 201
251 iso_pu_bacteria 2935769743 2935775585 201
252 iso_pu_bacteria 2935777560 2935779843 201
253 iso_pu_bacteria 2935785616 2935790113 201
254 iso_pu_bacteria 2935793552 2935798548 201
255 iso_pu_bacteria 2935801545 2935806755 201
256 iso_pu_bacteria 2935810662 2935817918 201
257 iso_pu_bacteria 2935819856 2935826466 201
258 iso_pu_bacteria 2935827899 2935834484 201
259 iso_pu_bacteria 2935837841 2935843791 201
260 iso_pu_bacteria 2935847175 2935851339 201
261 iso_pu_bacteria 2935855204 2935856747 201
262 iso_pu_bacteria 2935864058 2935868226 201
263 iso_pu_bacteria 2935873716 2935879584 201
264 iso_pu_bacteria 2935883170 2935887474 201
265 iso_pu_bacteria 2935908558 2935913303 201
266 iso_pu_bacteria 2935916978 2935922707 201
267 iso_pu_bacteria 2935926038 2935930772 201
268 iso_pu_bacteria 2935934488 2935939894 201
269 iso_pu_bacteria 2935942939 2935946843 201
270 iso_pu_bacteria 2935951376 2935955956 201
271 iso_pu_bacteria 2935959822 2935966253 201
272 iso_pu_bacteria 2935967501 2935972749 201
273 iso_pu_bacteria 2935975950 2935982540 201
274 iso_pu_bacteria 2935984226 2935984518 201
275 iso_pu_bacteria 2935992306 2935997090 201
276 iso_pu_bacteria 2936002035 2936009798 201
277 iso_pu_bacteria 2936011229 2936014232 201
278 iso_pu_bacteria 2936019824 2936022859 201
279 iso_pu_bacteria 2936028420 2936030996 201
280 iso_pu_bacteria 2936037263 2936044684 201
281 iso_pu_bacteria 2936046547 2936049117 201
282 iso_pu_bacteria 2936055302 2936055562 201
283 iso_pu_bacteria 2940556831 2940564683 201
284 iso_pu_bacteria 2941538514 2941545039 201
285 iso_pu_bacteria 3005483717 3005490389 201
286 iso_pu_bacteria 3005506211 3005509805 201
287 iso_pu_bacteria 3005587118 3005591091 201
288 iso_pu_bacteria 3005594810 3005595718 201
289 iso_pu_bacteria 8006984368 8006987117 201
290 iso_pu_bacteria 8006994254 8006998794 201
291 iso_pu_bacteria 8016522445 8016525537 201
292 iso_pu_bacteria 8016530956 8016539130 201
293 iso_pu_bacteria 8016539877 8016543417 201
294 iso_pu_bacteria 8016548790 8016549879 201
295 iso_pu_bacteria 8016557553 8016558291 201
296 iso_pu_bacteria 8016566248 8016568820 201
297 iso_pu_bacteria 8016575299 8016581464 201
298 iso_pu_bacteria 8016583857 8016587195 201
299 iso_pu_bacteria 8016595262 8016596288 201
300 iso_pu_bacteria 8016603502 8016607198 201
301 iso_pu_bacteria 8016613128 8016619098 201
302 iso_pu_bacteria 8016622563 8016630488 201
303 iso_pu_bacteria 8016630954 8016636594 201
304 iso_pu_bacteria 8017057580 8017057763 201
305 iso_pu_bacteria 8019530166 8019538799 201
306 iso_pu_bacteria 8019538911 8019541184 201
307 iso_pu_bacteria 8019547302 8019549433 201
308 iso_pu_bacteria 8019586578 8019596073 201
309 iso_pu_bacteria 8019597564 8019605641 201
310 iso_pu_bacteria 8019608314 8019612894 201
311 iso_pu_bacteria 8019619141 8019623578 201
312 iso_pu_bacteria 8019629233 8019638574 201
313 iso_pu_bacteria 8019638758 8019641170 201
314 iso_pu_bacteria 8019648815 8019653303 201
315 iso_pu_bacteria 8019659431 8019666375 201
316 iso_pu_bacteria 8019668869 8019676037 201
317 iso_pu_bacteria 8019678201 8019680108 201
318 iso_pu_bacteria 8019687851 8019693415 201
319 iso_pu_bacteria 8055742211 8055750731 201
320 iso_pu_bacteria 8056673599 8056673930 201
321 iso_pu_bacteria 8056967851 8056970561 201
322 3300003214 JGI25165J46597_1012920 JGI25165J46597_10129202 202
323 3300005455 Ga0070663_100038701 Ga0070663_1000387013 202
324 3300005548 Ga0070665_100308833 Ga0070665_1003088332 202
325 3300006051 Ga0075364_10194845 Ga0075364_101948452 202
326 3300006186 Ga0075369_10034442 Ga0075369_100344422 202
327 3300021384 Ga0213876_10019228 Ga0213876_100192284 202
328 3300021388 Ga0213875_10009576 Ga0213875_100095765 202
329 3300025253 Ga0209677_103983 Ga0209677_1039833 202
330 3300025261 Ga0209233_1012199 Ga0209233_10121992 202
331 3300025295 Ga0209564_1013127 Ga0209564_10131274 202
332 3300026067 Ga0207678_10008858 Ga0207678_1000885811 202
333 3300031731 Ga0307405_10099014 Ga0307405_100990142 202
334 3300037853 Ga0436364_0719642 Ga0436364_0719642_707_1324 202
335 3300037853 Ga0436364_0755794 Ga0436364_0755794_409_1020 202
336 3300039437 Ga0436365_1414759 Ga0436365_1414759_3494_4105 202
337 3300039437 Ga0436365_1523781 Ga0436365_1523781_14_625 202
338 3300039438 Ga0436360_0952465 Ga0436360_0952465_715_1323 202
339 3300044765 Ga0466970_0419641 Ga0466970_0419641_36_647 202
340 3300046474 Ga0495605_0051963 Ga0495605_0051963_95_703 202
341 3300046492 Ga0495585_0167513 Ga0495585_0167513_82_690 202
342 3300046500 Ga0495596_0233987 Ga0495596_0233987_11_619 202
343 3300046501 Ga0495607_0066487 Ga0495607_0066487_727_1335 202
344 3300046506 Ga0495583_0050842 Ga0495583_0050842_1104_1712 202
345 3300046507 Ga0495606_0308217 Ga0495606_0308217_180_788 202
346 3300046512 Ga0495610_0012561 Ga0495610_0012561_95_703 202
347 3300046513 Ga0495616_0028704 Ga0495616_0028704_894_1502 202
348 3300046515 Ga0495620_0013026 Ga0495620_0013026_2276_2884 202
349 3300046518 Ga0495631_0037053 Ga0495631_0037053_859_1467 202
350 3300046519 Ga0495632_0069194 Ga0495632_0069194_943_1551 202
351 3300046524 Ga0495648_0078158 Ga0495648_0078158_446_1054 202
352 3300046530 Ga0495654_0018207 Ga0495654_0018207_2112_2720 202
353 3300046538 Ga0495609_0095650 Ga0495609_0095650_171_779 202
354 3300046542 Ga0495597_0089784 Ga0495597_0089784_348_956 202
355 3300046616 Ga0495668_0114275 Ga0495668_0114275_89_697 202
356 3300048919 Ga0496116_0045939 Ga0496116_0045939_1581_2189 202
357 3300048919 Ga0496116_0101125 Ga0496116_0101125_576_1184 202
358 3300048920 Ga0496117_0091766 Ga0496117_0091766_409_1017 202
359 3300048920 Ga0496117_0187294 Ga0496117_0187294_263_874 202
360 3300048921 Ga0496118_0038064 Ga0496118_0038064_2581_3189 202
361 3300048921 Ga0496118_0066963 Ga0496118_0066963_559_1170 202
362 3300048921 Ga0496118_0138218 Ga0496118_0138218_431_1039 202
363 3300048922 Ga0496119_0087385 Ga0496119_0087385_960_1568 202
364 3300048924 Ga0496121_0115968 Ga0496121_0115968_737_1348 202
365 3300048924 Ga0496121_0189191 Ga0496121_0189191_553_1161 202
366 3300048925 Ga0496122_0119178 Ga0496122_0119178_392_1000 202
367 3300048926 Ga0496123_0106375 Ga0496123_0106375_951_1559 202
368 3300048928 Ga0496125_0011997 Ga0496125_0011997_2546_3154 202
369 3300050491 nmdc:mga00v17_40638_c1 nmdc:mga00v17_40638_c1_1969_2577 202
370 3300050492 nmdc:mga0yw44_179543_c1 nmdc:mga0yw44_179543_c1_444_1052 202
371 3300050494 nmdc:mga06z11_391985_c1 nmdc:mga06z11_391985_c1_30_638 202
372 3300050496 nmdc:mga07m45_435776_c1 nmdc:mga07m45_435776_c1_73_681 202
373 3300050516 nmdc:mga0sz30_90231_c1 nmdc:mga0sz30_90231_c1_41_649 202
374 3300053087 Ga0500643_027964 Ga0500643_027964_707_1315 202
375 3300053088 Ga0500644_0015890 Ga0500644_0015890_546_1154 202
376 3300053089 Ga0500581_094737 Ga0500581_094737_644_1252 202
377 3300053093 Ga0500651_0133456 Ga0500651_0133456_387_995 202
378 3300053096 Ga0500641_0009642 Ga0500641_0009642_984_1592 202
379 3300053103 Ga0500555_039334 Ga0500555_039334_274_885 202
380 3300053104 Ga0500556_0000012 Ga0500556_0000012_244003_244611 202
381 3300053108 Ga0500562_021432 Ga0500562_021432_580_1188 202
382 3300053109 Ga0500569_008862 Ga0500569_008862_387_995 202
383 3300053116 Ga0500592_005117 Ga0500592_005117_415_1023 202
384 3300053117 Ga0500593_022884 Ga0500593_022884_1212_1820 202
385 3300053130 Ga0500642_0000167 Ga0500642_0000167_23_631 202
386 3300053131 Ga0500652_001522 Ga0500652_001522_3188_3796 202
387 3300053151 Ga0500604_0004751 Ga0500604_0004751_349_957 202
388 3300053153 Ga0500616_0000035 Ga0500616_0000035_139086_139694 202
389 3300053156 Ga0500622_0000826 Ga0500622_0000826_8492_9100 202
390 3300053158 Ga0500627_0028603 Ga0500627_0028603_1033_1641 202
391 3300053160 Ga0500633_0048037 Ga0500633_0048037_411_1019 202
392 3300053730 Ga0500645_006872 Ga0500645_006872_2245_2853 202
393 3300003659 JGI25404J52841_10008233 JGI25404J52841_100082332 203
394 3300005983 Ga0081540_1000390 Ga0081540_100039014 203
395 3300006048 Ga0075363_100261271 Ga0075363_1002612712 203
396 3300006186 Ga0075369_10133778 Ga0075369_101337782 203
397 3300037853 Ga0436364_0076794 Ga0436364_0076794_278_889 203
398 3300048918 Ga0496115_0182239 Ga0496115_0182239_714_1439 203
399 3300050492 nmdc:mga0yw44_319521_c1 nmdc:mga0yw44_319521_c1_71_694 203
400 3300050516 nmdc:mga0sz30_121410_c1 nmdc:mga0sz30_121410_c1_287_898 203
401 3300003320 rootH2_10092218 rootH2_100922181 204
402 3300003323 rootH1_10048035 rootH1_100480352 204
403 3300005355 Ga0070671_100962965 Ga0070671_1009629651 204
404 3300009177 Ga0105248_10063571 Ga0105248_100635715 204
405 3300025941 Ga0207711_10063181 Ga0207711_100631812 204
406 3300002459 JGI24751J29686_10006535 JGI24751J29686_100065353 205
407 3300003203 JGI25406J46586_10008340 JGI25406J46586_100083404 205
408 3300003215 JGI25153J46596_10001467 JGI25153J46596_1000146711 205
409 3300003320 rootH2_10141663 rootH2_101416632 205
410 3300005262 Ga0065165_1000721 Ga0065165_100072119 205
411 3300005262 Ga0065165_1002559 Ga0065165_10025598 205
412 3300005262 Ga0065165_1004090 Ga0065165_10040907 205
413 3300005262 Ga0065165_1080195 Ga0065165_10801952 205
414 3300005262 Ga0065165_1106275 Ga0065165_11062751 205
415 3300005331 Ga0070670_100269477 Ga0070670_1002694772 205
416 3300005331 Ga0070670_100279772 Ga0070670_1002797722 205
417 3300005331 Ga0070670_100321528 Ga0070670_1003215282 205
418 3300005331 Ga0070670_100402324 Ga0070670_1004023242 205
419 3300005334 Ga0068869_100012248 Ga0068869_1000122487 205
420 3300005334 Ga0068869_100014751 Ga0068869_1000147513 205
421 3300005335 Ga0070666_10206179 Ga0070666_102061792 205
422 3300005335 Ga0070666_10229163 Ga0070666_102291631 205
423 3300005337 Ga0070682_100319110 Ga0070682_1003191102 205
424 3300005338 Ga0068868_100022444 Ga0068868_1000224443 205
425 3300005338 Ga0068868_100228403 Ga0068868_1002284032 205
426 3300005338 Ga0068868_100384969 Ga0068868_1003849692 205
427 3300005339 Ga0070660_100276476 Ga0070660_1002764762 205
428 3300005339 Ga0070660_100602404 Ga0070660_1006024042 205
429 3300005340 Ga0070689_100371420 Ga0070689_1003714202 205
430 3300005341 Ga0070691_10228147 Ga0070691_102281472 205
431 3300005341 Ga0070691_10320120 Ga0070691_103201202 205
432 3300005343 Ga0070687_100320587 Ga0070687_1003205872 205
433 3300005347 Ga0070668_100172968 Ga0070668_1001729682 205
434 3300005347 Ga0070668_100193104 Ga0070668_1001931042 205
435 3300005347 Ga0070668_100282209 Ga0070668_1002822092 205
436 3300005353 Ga0070669_100157870 Ga0070669_1001578702 205
437 3300005353 Ga0070669_100190525 Ga0070669_1001905251 205
438 3300005353 Ga0070669_100220429 Ga0070669_1002204292 205
439 3300005353 Ga0070669_100678368 Ga0070669_1006783681 205
440 3300005355 Ga0070671_100034394 Ga0070671_1000343943 205
441 3300005356 Ga0070674_100519460 Ga0070674_1005194602 205
442 3300005364 Ga0070673_100130100 Ga0070673_1001301002 205
443 3300005364 Ga0070673_100149449 Ga0070673_1001494492 205
444 3300005365 Ga0070688_100160624 Ga0070688_1001606243 205
445 3300005365 Ga0070688_100265915 Ga0070688_1002659152 205
446 3300005367 Ga0070667_100317446 Ga0070667_1003174462 205
447 3300005367 Ga0070667_100804449 Ga0070667_1008044492 205
448 3300005435 Ga0070714_100035957 Ga0070714_1000359576 205
449 3300005436 Ga0070713_100038145 Ga0070713_1000381455 205
450 3300005438 Ga0070701_10304046 Ga0070701_103040461 205
451 3300005441 Ga0070700_100521815 Ga0070700_1005218151 205
452 3300005441 Ga0070700_100526974 Ga0070700_1005269741 205
453 3300005444 Ga0070694_100707468 Ga0070694_1007074681 205
454 3300005455 Ga0070663_100046883 Ga0070663_1000468832 205
455 3300005455 Ga0070663_100196110 Ga0070663_1001961102 205
456 3300005455 Ga0070663_100496606 Ga0070663_1004966061 205
457 3300005456 Ga0070678_100026848 Ga0070678_1000268482 205
458 3300005456 Ga0070678_100108538 Ga0070678_1001085382 205
459 3300005456 Ga0070678_100438800 Ga0070678_1004388002 205
460 3300005456 Ga0070678_100628095 Ga0070678_1006280952 205
461 3300005457 Ga0070662_100260563 Ga0070662_1002605632 205
462 3300005457 Ga0070662_100287269 Ga0070662_1002872692 205
463 3300005459 Ga0068867_100034759 Ga0068867_1000347594 205
464 3300005459 Ga0068867_100589833 Ga0068867_1005898331 205
465 3300005459 Ga0068867_100660086 Ga0068867_1006600862 205
466 3300005466 Ga0070685_10052113 Ga0070685_100521132 205
467 3300005466 Ga0070685_10641289 Ga0070685_106412891 205
468 3300005467 Ga0070706_100640543 Ga0070706_1006405432 205
469 3300005468 Ga0070707_100605017 Ga0070707_1006050171 205
470 3300005471 Ga0070698_100420106 Ga0070698_1004201062 205
471 3300005518 Ga0070699_100170101 Ga0070699_1001701012 205
472 3300005539 Ga0068853_100476971 Ga0068853_1004769712 205
473 3300005539 Ga0068853_101068800 Ga0068853_1010688001 205
474 3300005543 Ga0070672_100109865 Ga0070672_1001098651 205
475 3300005543 Ga0070672_100322472 Ga0070672_1003224722 205
476 3300005544 Ga0070686_100624003 Ga0070686_1006240032 205
477 3300005545 Ga0070695_100693265 Ga0070695_1006932651 205
478 3300005546 Ga0070696_100143541 Ga0070696_1001435411 205
479 3300005547 Ga0070693_100040234 Ga0070693_1000402343 205
480 3300005548 Ga0070665_100041904 Ga0070665_1000419044 205
481 3300005548 Ga0070665_100453634 Ga0070665_1004536342 205
482 3300005548 Ga0070665_101188277 Ga0070665_1011882771 205
483 3300005563 Ga0068855_100540447 Ga0068855_1005404472 205
484 3300005564 Ga0070664_100266933 Ga0070664_1002669332 205
485 3300005577 Ga0068857_100022482 Ga0068857_1000224822 205
486 3300005577 Ga0068857_100342759 Ga0068857_1003427592 205
487 3300005578 Ga0068854_100289266 Ga0068854_1002892662 205
488 3300005578 Ga0068854_100314427 Ga0068854_1003144272 205
489 3300005614 Ga0068856_100022223 Ga0068856_1000222236 205
490 3300005614 Ga0068856_100160011 Ga0068856_1001600113 205
491 3300005615 Ga0070702_100175176 Ga0070702_1001751762 205
492 3300005616 Ga0068852_100278498 Ga0068852_1002784982 205
493 3300005616 Ga0068852_100509469 Ga0068852_1005094692 205
494 3300005617 Ga0068859_100073186 Ga0068859_1000731863 205
495 3300005617 Ga0068859_100125968 Ga0068859_1001259684 205
496 3300005617 Ga0068859_100151529 Ga0068859_1001515293 205
497 3300005617 Ga0068859_100351684 Ga0068859_1003516842 205
498 3300005617 Ga0068859_101463494 Ga0068859_1014634941 205
499 3300005618 Ga0068864_100047670 Ga0068864_1000476705 205
500 3300005618 Ga0068864_100088380 Ga0068864_1000883802 205
501 3300005618 Ga0068864_100386862 Ga0068864_1003868622 205
502 3300005618 Ga0068864_100475491 Ga0068864_1004754912 205
503 3300005719 Ga0068861_100117358 Ga0068861_1001173582 205
504 3300005719 Ga0068861_101100548 Ga0068861_1011005482 205
505 3300005834 Ga0068851_10289365 Ga0068851_102893652 205
506 3300005840 Ga0068870_10088970 Ga0068870_100889702 205
507 3300005840 Ga0068870_10253870 Ga0068870_102538702 205
508 3300005841 Ga0068863_100397335 Ga0068863_1003973351 205
509 3300005841 Ga0068863_100959968 Ga0068863_1009599681 205
510 3300005842 Ga0068858_100387714 Ga0068858_1003877141 205
511 3300005842 Ga0068858_100483855 Ga0068858_1004838552 205
512 3300005844 Ga0068862_100364573 Ga0068862_1003645732 205
513 3300005844 Ga0068862_100493951 Ga0068862_1004939511 205
514 3300005844 Ga0068862_100637640 Ga0068862_1006376402 205
515 3300005844 Ga0068862_100793781 Ga0068862_1007937811 205
516 3300005844 Ga0068862_101103713 Ga0068862_1011037132 205
517 3300005937 Ga0081455_10037279 Ga0081455_100372792 205
518 3300005937 Ga0081455_10063826 Ga0081455_100638262 205
519 3300005937 Ga0081455_10190092 Ga0081455_101900922 205
520 3300005937 Ga0081455_10280756 Ga0081455_102807561 205
521 3300005981 Ga0081538_10071091 Ga0081538_100710912 205
522 3300005983 Ga0081540_1002694 Ga0081540_10026943 205
523 3300005983 Ga0081540_1003284 Ga0081540_100328413 205
524 3300005983 Ga0081540_1003420 Ga0081540_10034207 205
525 3300005983 Ga0081540_1015811 Ga0081540_10158115 205
526 3300005983 Ga0081540_1029232 Ga0081540_10292321 205
527 3300005985 Ga0081539_10003489 Ga0081539_100034895 205
528 3300005985 Ga0081539_10047799 Ga0081539_100477992 205
529 3300006028 Ga0070717_10280534 Ga0070717_102805342 205
530 3300006038 Ga0075365_10017375 Ga0075365_100173755 205
531 3300006038 Ga0075365_10092377 Ga0075365_100923772 205
532 3300006038 Ga0075365_10397627 Ga0075365_103976271 205
533 3300006038 Ga0075365_10442097 Ga0075365_104420972 205
534 3300006042 Ga0075368_10092045 Ga0075368_100920452 205
535 3300006042 Ga0075368_10103329 Ga0075368_101033292 205
536 3300006048 Ga0075363_100033572 Ga0075363_1000335723 205
537 3300006048 Ga0075363_100153111 Ga0075363_1001531112 205
538 3300006048 Ga0075363_100194318 Ga0075363_1001943182 205
539 3300006051 Ga0075364_10086883 Ga0075364_100868831 205
540 3300006051 Ga0075364_10128578 Ga0075364_101285782 205
541 3300006051 Ga0075364_10189803 Ga0075364_101898032 205
542 3300006177 Ga0075362_10019947 Ga0075362_100199472 205
543 3300006177 Ga0075362_10035162 Ga0075362_100351623 205
544 3300006177 Ga0075362_10168065 Ga0075362_101680652 205
545 3300006178 Ga0075367_10091224 Ga0075367_100912242 205
546 3300006178 Ga0075367_10479403 Ga0075367_104794031 205
547 3300006186 Ga0075369_10002966 Ga0075369_100029662 205
548 3300006186 Ga0075369_10054941 Ga0075369_100549411 205
549 3300006195 Ga0075366_10044839 Ga0075366_100448393 205
550 3300006195 Ga0075366_10045750 Ga0075366_100457503 205
551 3300006237 Ga0097621_100302485 Ga0097621_1003024852 205
552 3300006237 Ga0097621_100312723 Ga0097621_1003127232 205
553 3300006237 Ga0097621_100973438 Ga0097621_1009734382 205
554 3300006353 Ga0075370_10058180 Ga0075370_100581802 205
555 3300006353 Ga0075370_10116718 Ga0075370_101167182 205
556 3300006358 Ga0068871_100079482 Ga0068871_1000794822 205
557 3300006358 Ga0068871_100687026 Ga0068871_1006870262 205
558 3300006844 Ga0075428_100070070 Ga0075428_1000700704 205
559 3300006846 Ga0075430_100674779 Ga0075430_1006747792 205
560 3300006852 Ga0075433_11067386 Ga0075433_110673861 205
561 3300006871 Ga0075434_100158304 Ga0075434_1001583042 205
562 3300006881 Ga0068865_100863473 Ga0068865_1008634731 205
563 3300006931 Ga0097620_100073191 Ga0097620_1000731913 205
564 3300006931 Ga0097620_100125976 Ga0097620_1001259764 205
565 3300006931 Ga0097620_100151527 Ga0097620_1001515272 205
566 3300006931 Ga0097620_100351653 Ga0097620_1003516532 205
567 3300006931 Ga0097620_101463484 Ga0097620_1014634841 205
568 3300006941 Ga0099825_1045808 Ga0099825_10458082 205
569 3300006942 Ga0099824_1018090 Ga0099824_10180905 205
570 3300007076 Ga0075435_100362370 Ga0075435_1003623702 205
571 3300009092 Ga0105250_10032667 Ga0105250_100326672 205
572 3300009092 Ga0105250_10181026 Ga0105250_101810261 205
573 3300009093 Ga0105240_10005052 Ga0105240_1000505216 205
574 3300009093 Ga0105240_10019107 Ga0105240_100191073 205
575 3300009093 Ga0105240_10876793 Ga0105240_108767931 205
576 3300009093 Ga0105240_11013165 Ga0105240_110131652 205
577 3300009094 Ga0111539_10393326 Ga0111539_103933262 205
578 3300009098 Ga0105245_10033284 Ga0105245_100332845 205
579 3300009098 Ga0105245_10034208 Ga0105245_100342083 205
580 3300009098 Ga0105245_10256255 Ga0105245_102562552 205
581 3300009098 Ga0105245_10671872 Ga0105245_106718722 205
582 3300009101 Ga0105247_10022331 Ga0105247_100223312 205
583 3300009101 Ga0105247_10040222 Ga0105247_100402223 205
584 3300009101 Ga0105247_10304604 Ga0105247_103046041 205
585 3300009147 Ga0114129_10118949 Ga0114129_101189494 205
586 3300009148 Ga0105243_10169476 Ga0105243_101694762 205
587 3300009148 Ga0105243_10642790 Ga0105243_106427902 205
588 3300009148 Ga0105243_10803084 Ga0105243_108030842 205
589 3300009174 Ga0105241_10120387 Ga0105241_101203873 205
590 3300009174 Ga0105241_10121698 Ga0105241_101216981 205
591 3300009174 Ga0105241_10158637 Ga0105241_101586372 205
592 3300009176 Ga0105242_10317343 Ga0105242_103173432 205
593 3300009176 Ga0105242_10730025 Ga0105242_107300252 205
594 3300009177 Ga0105248_10073791 Ga0105248_100737912 205
595 3300009177 Ga0105248_10084328 Ga0105248_100843282 205
596 3300009177 Ga0105248_10278611 Ga0105248_102786112 205
597 3300009545 Ga0105237_10001825 Ga0105237_1000182524 205
598 3300009545 Ga0105237_10273975 Ga0105237_102739752 205
599 3300009545 Ga0105237_10480836 Ga0105237_104808362 205
600 3300009545 Ga0105237_10492313 Ga0105237_104923132 205
601 3300009545 Ga0105237_10666050 Ga0105237_106660502 205
602 3300009551 Ga0105238_10056920 Ga0105238_100569202 205
603 3300009551 Ga0105238_10146838 Ga0105238_101468383 205
604 3300009551 Ga0105238_10150526 Ga0105238_101505262 205
605 3300009551 Ga0105238_10184001 Ga0105238_101840012 205
606 3300009553 Ga0105249_10707211 Ga0105249_107072112 205
607 3300010375 Ga0105239_10031864 Ga0105239_100318645 205
608 3300010375 Ga0105239_10100812 Ga0105239_101008122 205
609 3300010375 Ga0105239_10259769 Ga0105239_102597692 205
610 3300010375 Ga0105239_10410759 Ga0105239_104107592 205
611 3300011119 Ga0105246_10011457 Ga0105246_100114573 205
612 3300011119 Ga0105246_10061328 Ga0105246_100613283 205
613 3300011119 Ga0105246_10064157 Ga0105246_100641572 205
614 3300011119 Ga0105246_10189572 Ga0105246_101895722 205
615 3300013102 Ga0157371_10385093 Ga0157371_103850931 205
616 3300013105 Ga0157369_10040360 Ga0157369_100403606 205
617 3300013105 Ga0157369_10068769 Ga0157369_100687695 205
618 3300013296 Ga0157374_10070147 Ga0157374_100701474 205
619 3300013297 Ga0157378_10105000 Ga0157378_101050002 205
620 3300013297 Ga0157378_10113876 Ga0157378_101138764 205
621 3300013297 Ga0157378_10532100 Ga0157378_105321002 205
622 3300013297 Ga0157378_11479224 Ga0157378_114792241 205
623 3300013306 Ga0163162_10856109 Ga0163162_108561092 205
624 3300013307 Ga0157372_10247662 Ga0157372_102476622 205
625 3300013307 Ga0157372_10862475 Ga0157372_108624751 205
626 3300013308 Ga0157375_10280354 Ga0157375_102803542 205
627 3300013308 Ga0157375_10336382 Ga0157375_103363822 205
628 3300013308 Ga0157375_10624976 Ga0157375_106249761 205
629 3300013308 Ga0157375_10726359 Ga0157375_107263592 205
630 3300014325 Ga0163163_10061762 Ga0163163_100617623 205
631 3300014325 Ga0163163_10366073 Ga0163163_103660732 205
632 3300014325 Ga0163163_10596850 Ga0163163_105968502 205
633 3300014325 Ga0163163_11053803 Ga0163163_110538032 205
634 3300014325 Ga0163163_11592971 Ga0163163_115929711 205
635 3300014326 Ga0157380_10357302 Ga0157380_103573022 205
636 3300014745 Ga0157377_10177955 Ga0157377_101779552 205
637 3300014968 Ga0157379_10330879 Ga0157379_103308792 205
638 3300014969 Ga0157376_10234717 Ga0157376_102347172 205
639 3300014969 Ga0157376_10441547 Ga0157376_104415472 205
640 3300014969 Ga0157376_10457076 Ga0157376_104570762 205
641 3300017792 Ga0163161_10315342 Ga0163161_103153422 205
642 3300021320 Ga0214544_1000007 Ga0214544_1000007238 205
643 3300021320 Ga0214544_1041736 Ga0214544_10417362 205
644 3300021321 Ga0214542_1000007 Ga0214542_1000007144 205
645 3300021321 Ga0214542_1027972 Ga0214542_10279722 205
646 3300021324 Ga0214545_1000006 Ga0214545_1000006149 205
647 3300021324 Ga0214545_1018297 Ga0214545_10182976 205
648 3300021327 Ga0214543_1000009 Ga0214543_1000009238 205
649 3300021327 Ga0214543_1024430 Ga0214543_10244303 205
650 3300021358 Ga0213873_10071207 Ga0213873_100712072 205
651 3300021361 Ga0213872_10010153 Ga0213872_100101533 205
652 3300021441 Ga0213871_10043735 Ga0213871_100437352 205
653 3300025230 Ga0209563_102773 Ga0209563_1027733 205
654 3300025245 Ga0207425_1011699 Ga0207425_10116993 205
655 3300025253 Ga0209677_101607 Ga0209677_10160710 205
656 3300025254 Ga0209148_1000216 Ga0209148_100021657 205
657 3300025272 Ga0209455_1001447 Ga0209455_100144713 205
658 3300025297 Ga0209758_1000015 Ga0209758_1000015601 205
659 3300025297 Ga0209758_1000161 Ga0209758_100016166 205
660 3300025297 Ga0209758_1000673 Ga0209758_10006734 205
661 3300025297 Ga0209758_1004929 Ga0209758_10049298 205
662 3300025297 Ga0209758_1019668 Ga0209758_10196682 205
663 3300025297 Ga0209758_1021569 Ga0209758_10215692 205
664 3300025297 Ga0209758_1035445 Ga0209758_10354452 205
665 3300025297 Ga0209758_1035446 Ga0209758_10354462 205
666 3300025299 Ga0209256_1004892 Ga0209256_10048923 205
667 3300025302 Ga0207426_1000186 Ga0207426_1000186124 205
668 3300025302 Ga0207426_1001742 Ga0207426_10017429 205
669 3300025302 Ga0207426_1006201 Ga0207426_10062012 205
670 3300025303 Ga0209051_1018369 Ga0209051_10183692 205
671 3300025304 Ga0209257_1006231 Ga0209257_10062312 205
672 3300025321 Ga0207656_10267260 Ga0207656_102672602 205
673 3300025885 Ga0207653_10015012 Ga0207653_100150122 205
674 3300025893 Ga0207682_10008049 Ga0207682_100080495 205
675 3300025899 Ga0207642_10140995 Ga0207642_101409952 205
676 3300025901 Ga0207688_10057659 Ga0207688_100576592 205
677 3300025901 Ga0207688_10101989 Ga0207688_101019892 205
678 3300025901 Ga0207688_10212039 Ga0207688_102120391 205
679 3300025903 Ga0207680_10452540 Ga0207680_104525402 205
680 3300025904 Ga0207647_10004864 Ga0207647_100048644 205
681 3300025906 Ga0207699_10021493 Ga0207699_100214932 205
682 3300025907 Ga0207645_10047946 Ga0207645_100479462 205
683 3300025907 Ga0207645_10294922 Ga0207645_102949221 205
684 3300025908 Ga0207643_10088900 Ga0207643_100889002 205
685 3300025908 Ga0207643_10359630 Ga0207643_103596301 205
686 3300025909 Ga0207705_10038556 Ga0207705_100385563 205
687 3300025911 Ga0207654_10034330 Ga0207654_100343303 205
688 3300025911 Ga0207654_10050460 Ga0207654_100504602 205
689 3300025913 Ga0207695_10000006 Ga0207695_10000006227 205
690 3300025914 Ga0207671_10047393 Ga0207671_100473932 205
691 3300025914 Ga0207671_10383348 Ga0207671_103833482 205
692 3300025918 Ga0207662_10124668 Ga0207662_101246681 205
693 3300025918 Ga0207662_10432304 Ga0207662_104323042 205
694 3300025919 Ga0207657_10209135 Ga0207657_102091352 205
695 3300025922 Ga0207646_10822493 Ga0207646_108224932 205
696 3300025923 Ga0207681_10167225 Ga0207681_101672252 205
697 3300025923 Ga0207681_10248139 Ga0207681_102481392 205
698 3300025924 Ga0207694_10035608 Ga0207694_100356081 205
699 3300025924 Ga0207694_10098536 Ga0207694_100985362 205
700 3300025924 Ga0207694_10266496 Ga0207694_102664962 205
701 3300025924 Ga0207694_10484105 Ga0207694_104841052 205
702 3300025925 Ga0207650_10197201 Ga0207650_101972012 205
703 3300025927 Ga0207687_10030856 Ga0207687_100308564 205
704 3300025927 Ga0207687_10167310 Ga0207687_101673102 205
705 3300025928 Ga0207700_10007619 Ga0207700_100076193 205
706 3300025931 Ga0207644_10022449 Ga0207644_100224496 205
707 3300025931 Ga0207644_10620338 Ga0207644_106203382 205
708 3300025931 Ga0207644_10729388 Ga0207644_107293882 205
709 3300025931 Ga0207644_10828581 Ga0207644_108285811 205
710 3300025932 Ga0207690_10445071 Ga0207690_104450711 205
711 3300025933 Ga0207706_10123452 Ga0207706_101234522 205
712 3300025933 Ga0207706_10167711 Ga0207706_101677112 205
713 3300025933 Ga0207706_10887395 Ga0207706_108873951 205
714 3300025934 Ga0207686_10143777 Ga0207686_101437772 205
715 3300025935 Ga0207709_10247948 Ga0207709_102479482 205
716 3300025935 Ga0207709_10304390 Ga0207709_103043902 205
717 3300025935 Ga0207709_10413130 Ga0207709_104131301 205
718 3300025936 Ga0207670_10539057 Ga0207670_105390572 205
719 3300025936 Ga0207670_11033401 Ga0207670_110334011 205
720 3300025937 Ga0207669_10471804 Ga0207669_104718042 205
721 3300025938 Ga0207704_10393599 Ga0207704_103935992 205
722 3300025940 Ga0207691_10126016 Ga0207691_101260162 205
723 3300025940 Ga0207691_10149350 Ga0207691_101493502 205
724 3300025941 Ga0207711_10245950 Ga0207711_102459502 205
725 3300025941 Ga0207711_10463309 Ga0207711_104633092 205
726 3300025941 Ga0207711_10707794 Ga0207711_107077942 205
727 3300025942 Ga0207689_10020050 Ga0207689_100200502 205
728 3300025942 Ga0207689_10047569 Ga0207689_100475692 205
729 3300025942 Ga0207689_10105485 Ga0207689_101054853 205
730 3300025942 Ga0207689_10718830 Ga0207689_107188301 205
731 3300025944 Ga0207661_10409628 Ga0207661_104096282 205
732 3300025945 Ga0207679_10047663 Ga0207679_100476632 205
733 3300025949 Ga0207667_10276364 Ga0207667_102763642 205
734 3300025949 Ga0207667_10606140 Ga0207667_106061402 205
735 3300025961 Ga0207712_10186329 Ga0207712_101863293 205
736 3300025961 Ga0207712_10309407 Ga0207712_103094072 205
737 3300025961 Ga0207712_10377490 Ga0207712_103774901 205
738 3300025972 Ga0207668_10085734 Ga0207668_100857342 205
739 3300025972 Ga0207668_10277138 Ga0207668_102771381 205
740 3300025972 Ga0207668_10695164 Ga0207668_106951642 205
741 3300025986 Ga0207658_10264865 Ga0207658_102648652 205
742 3300025986 Ga0207658_10357272 Ga0207658_103572722 205
743 3300026023 Ga0207677_10036683 Ga0207677_100366835 205
744 3300026023 Ga0207677_10226708 Ga0207677_102267082 205
745 3300026023 Ga0207677_10691835 Ga0207677_106918351 205
746 3300026023 Ga0207677_10719657 Ga0207677_107196572 205
747 3300026035 Ga0207703_10091998 Ga0207703_100919984 205
748 3300026035 Ga0207703_10693380 Ga0207703_106933801 205
749 3300026041 Ga0207639_10102987 Ga0207639_101029873 205
750 3300026041 Ga0207639_10108879 Ga0207639_101088794 205
751 3300026041 Ga0207639_10158701 Ga0207639_101587012 205
752 3300026041 Ga0207639_10357750 Ga0207639_103577502 205
753 3300026067 Ga0207678_10015151 Ga0207678_100151513 205
754 3300026067 Ga0207678_10111519 Ga0207678_101115192 205
755 3300026075 Ga0207708_10235845 Ga0207708_102358452 205
756 3300026075 Ga0207708_10336260 Ga0207708_103362602 205
757 3300026078 Ga0207702_10057935 Ga0207702_100579354 205
758 3300026078 Ga0207702_10100353 Ga0207702_101003532 205
759 3300026088 Ga0207641_10293589 Ga0207641_102935892 205
760 3300026089 Ga0207648_10095376 Ga0207648_100953762 205
761 3300026089 Ga0207648_10158250 Ga0207648_101582502 205
762 3300026089 Ga0207648_10243676 Ga0207648_102436762 205
763 3300026095 Ga0207676_10142815 Ga0207676_101428153 205
764 3300026095 Ga0207676_10382169 Ga0207676_103821692 205
765 3300026116 Ga0207674_10032725 Ga0207674_100327252 205
766 3300026116 Ga0207674_10123589 Ga0207674_101235892 205
767 3300026116 Ga0207674_10199575 Ga0207674_101995751 205
768 3300026116 Ga0207674_10353888 Ga0207674_103538882 205
769 3300026116 Ga0207674_10609757 Ga0207674_106097572 205
770 3300026118 Ga0207675_100279429 Ga0207675_1002794292 205
771 3300026118 Ga0207675_100481726 Ga0207675_1004817262 205
772 3300026118 Ga0207675_100597433 Ga0207675_1005974332 205
773 3300026121 Ga0207683_10007253 Ga0207683_100072533 205
774 3300026121 Ga0207683_10090513 Ga0207683_100905133 205
775 3300026121 Ga0207683_10337142 Ga0207683_103371422 205
776 3300026121 Ga0207683_10463792 Ga0207683_104637922 205
777 3300026142 Ga0207698_10007921 Ga0207698_100079214 205
778 3300026142 Ga0207698_10245268 Ga0207698_102452682 205
779 3300026142 Ga0207698_10336364 Ga0207698_103363642 205
780 3300027296 Ga0209389_1000062 Ga0209389_100006263 205
781 3300027296 Ga0209389_1000072 Ga0209389_10000729 205
782 3300027357 Ga0209589_1000270 Ga0209589_100027059 205
783 3300027361 Ga0209489_100160 Ga0209489_10016063 205
784 3300027361 Ga0209489_100206 Ga0209489_1002069 205
785 3300027363 Ga0209700_101128 Ga0209700_10112848 205
786 3300027866 Ga0209813_10266380 Ga0209813_102663801 205
787 3300027907 Ga0207428_10102978 Ga0207428_101029782 205
788 3300028379 Ga0268266_10001098 Ga0268266_100010987 205
789 3300028379 Ga0268266_10001919 Ga0268266_1000191916 205
790 3300028379 Ga0268266_10486100 Ga0268266_104861002 205
791 3300028380 Ga0268265_10036180 Ga0268265_100361804 205
792 3300028380 Ga0268265_10221601 Ga0268265_102216012 205
793 3300028380 Ga0268265_10459711 Ga0268265_104597112 205
794 3300028381 Ga0268264_10014095 Ga0268264_100140954 205
795 3300028381 Ga0268264_10239379 Ga0268264_102393791 205
796 3300028381 Ga0268264_10438915 Ga0268264_104389152 205
797 3300028381 Ga0268264_11045418 Ga0268264_110454182 205
798 3300028786 Ga0307517_10000196 Ga0307517_1000019670 205
799 3300028786 Ga0307517_10114104 Ga0307517_101141042 205
800 3300028786 Ga0307517_10407164 Ga0307517_104071641 205
801 3300028794 Ga0307515_10019983 Ga0307515_100199833 205
802 3300031456 Ga0307513_10141261 Ga0307513_101412613 205
803 3300031507 Ga0307509_10197820 Ga0307509_101978203 205
804 3300031616 Ga0307508_10052012 Ga0307508_100520122 205
805 3300031730 Ga0307516_10353780 Ga0307516_103537802 205
806 3300031730 Ga0307516_10431605 Ga0307516_104316052 205
807 3300031731 Ga0307405_10895696 Ga0307405_108956961 205
808 3300031824 Ga0307413_10314742 Ga0307413_103147422 205
809 3300031901 Ga0307406_10518675 Ga0307406_105186752 205
810 3300031901 Ga0307406_10801133 Ga0307406_108011331 205
811 3300031911 Ga0307412_10223506 Ga0307412_102235062 205
812 3300031995 Ga0307409_100112259 Ga0307409_1001122592 205
813 3300032005 Ga0307411_10204501 Ga0307411_102045012 205
814 3300032126 Ga0307415_100176875 Ga0307415_1001768752 205
815 3300032126 Ga0307415_100249504 Ga0307415_1002495042 205
816 3300033180 Ga0307510_10002425 Ga0307510_1000242524 205
817 3300033180 Ga0307510_10018360 Ga0307510_100183606 205
818 3300033180 Ga0307510_10057078 Ga0307510_100570782 205
819 3300033180 Ga0307510_10163534 Ga0307510_101635342 205
820 3300035114 Ga0373939_0076974 Ga0373939_0076974_460_1077 205
821 3300035170 Ga0373943_0187121 Ga0373943_0187121_88_705 205
822 3300035695 Ga0373927_0162707 Ga0373927_0162707_829_1446 205
823 3300037466 Ga0395898_0470465 Ga0395898_0470465_67_684 205
824 3300037471 Ga0395905_0000710 Ga0395905_0000710_38597_39214 205
825 3300037471 Ga0395905_0283473 Ga0395905_0283473_258_875 205
826 3300037853 Ga0436364_1287204 Ga0436364_1287204_6124_6753 205
827 3300038443 Ga0395901_0530948 Ga0395901_0530948_449_1066 205
828 3300039437 Ga0436365_1110743 Ga0436365_1110743_586_1278 205
829 3300039437 Ga0436365_1562201 Ga0436365_1562201_138_833 205
830 3300039447 Ga0436361_0083564 Ga0436361_0083564_4506_5123 205
831 3300039447 Ga0436361_0573468 Ga0436361_0573468_398_1015 205
832 3300039453 Ga0436362_1274308 Ga0436362_1274308_224_841 205
833 3300041413 Ga0439465_0069447 Ga0439465_0069447_294_911 205
834 3300041451 Ga0451791_0118347 Ga0451791_0118347_193_810 205
835 3300041451 Ga0451791_1327348 Ga0451791_1327348_124_741 205
836 3300041452 Ga0451793_0550299 Ga0451793_0550299_109_726 205
837 3300041459 Ga0451800_0369308 Ga0451800_0369308_136_753 205
838 3300041460 Ga0451802_0032404 Ga0451802_0032404_879_1496 205
839 3300041498 Ga0451841_0667089 Ga0451841_0667089_79_696 205
840 3300041509 Ga0451843_1581240 Ga0451843_1581240_18_635 205
841 3300042438 Ga0439459_0040149 Ga0439459_0040149_101_718 205
842 3300044656 Ga0466969_0030722 Ga0466969_0030722_1080_1697 205
843 3300044658 Ga0466972_0004442 Ga0466972_0004442_3561_4178 205
844 3300044684 Ga0466966_0002418 Ga0466966_0002418_758_1375 205
845 3300044684 Ga0466966_0019149 Ga0466966_0019149_1566_2183 205
846 3300044693 Ga0466961_0000324 Ga0466961_0000324_13520_14137 205
847 3300044694 Ga0466963_0028999 Ga0466963_0028999_1048_1665 205
848 3300044735 Ga0466968_0038269 Ga0466968_0038269_586_1203 205
849 3300044901 Ga0466960_0030151 Ga0466960_0030151_758_1375 205
850 3300044901 Ga0466960_0088008 Ga0466960_0088008_328_945 205
851 3300045049 Ga0466959_0157829 Ga0466959_0157829_309_926 205
852 3300045051 Ga0451576_0507654 Ga0451576_0507654_430_1047 205
853 3300046454 Ga0495592_0206014 Ga0495592_0206014_549_1166 205
854 3300046454 Ga0495592_0230498 Ga0495592_0230498_74_691 205
855 3300046454 Ga0495592_0396612 Ga0495592_0396612_153_770 205
856 3300046455 Ga0495603_0056082 Ga0495603_0056082_1008_1625 205
857 3300046455 Ga0495603_0196008 Ga0495603_0196008_404_1021 205
858 3300046458 Ga0495591_045145 Ga0495591_045145_162_779 205
859 3300046459 Ga0495629_0026002 Ga0495629_0026002_158_775 205
860 3300046460 Ga0495638_0006922 Ga0495638_0006922_5339_5956 205
861 3300046460 Ga0495638_0100023 Ga0495638_0100023_965_1582 205
862 3300046460 Ga0495638_0174155 Ga0495638_0174155_27_647 205
863 3300046462 Ga0495651_0034935 Ga0495651_0034935_138_755 205
864 3300046474 Ga0495605_0047265 Ga0495605_0047265_722_1339 205
865 3300046474 Ga0495605_0076469 Ga0495605_0076469_626_1243 205
866 3300046474 Ga0495605_0119154 Ga0495605_0119154_239_856 205
867 3300046474 Ga0495605_0244523 Ga0495605_0244523_113_730 205
868 3300046491 Ga0495584_0249418 Ga0495584_0249418_219_836 205
869 3300046491 Ga0495584_0262191 Ga0495584_0262191_239_856 205
870 3300046492 Ga0495585_0026108 Ga0495585_0026108_315_932 205
871 3300046492 Ga0495585_0220782 Ga0495585_0220782_218_835 205
872 3300046492 Ga0495585_0245380 Ga0495585_0245380_178_795 205
873 3300046499 Ga0495594_0089994 Ga0495594_0089994_19_636 205
874 3300046500 Ga0495596_0035379 Ga0495596_0035379_713_1330 205
875 3300046501 Ga0495607_0097545 Ga0495607_0097545_548_1165 205
876 3300046501 Ga0495607_0205620 Ga0495607_0205620_79_696 205
877 3300046507 Ga0495606_0048572 Ga0495606_0048572_1945_2562 205
878 3300046507 Ga0495606_0069620 Ga0495606_0069620_1555_2172 205
879 3300046507 Ga0495606_0363317 Ga0495606_0363317_37_654 205
880 3300046512 Ga0495610_0082066 Ga0495610_0082066_304_921 205
881 3300046512 Ga0495610_0098846 Ga0495610_0098846_58_675 205
882 3300046514 Ga0495618_0161306 Ga0495618_0161306_713_1330 205
883 3300046516 Ga0495628_0448504 Ga0495628_0448504_103_720 205
884 3300046519 Ga0495632_0132614 Ga0495632_0132614_283_900 205
885 3300046520 Ga0495637_0177699 Ga0495637_0177699_61_678 205
886 3300046522 Ga0495643_0073425 Ga0495643_0073425_338_955 205
887 3300046522 Ga0495643_0170775 Ga0495643_0170775_359_976 205
888 3300046524 Ga0495648_0125099 Ga0495648_0125099_735_1355 205
889 3300046524 Ga0495648_0170726 Ga0495648_0170726_355_972 205
890 3300046528 Ga0495642_0187161 Ga0495642_0187161_176_793 205
891 3300046529 Ga0495652_0027290 Ga0495652_0027290_3314_3931 205
892 3300046529 Ga0495652_0299044 Ga0495652_0299044_287_904 205
893 3300046536 Ga0495587_0047845 Ga0495587_0047845_86_703 205
894 3300046537 Ga0495598_0041682 Ga0495598_0041682_104_721 205
895 3300046538 Ga0495609_0068566 Ga0495609_0068566_374_991 205
896 3300046542 Ga0495597_0072336 Ga0495597_0072336_528_1145 205
897 3300046557 Ga0495622_0021059 Ga0495622_0021059_296_913 205
898 3300046557 Ga0495622_0039845 Ga0495622_0039845_1473_2090 205
899 3300046558 Ga0495633_0081329 Ga0495633_0081329_214_831 205
900 3300046558 Ga0495633_0158827 Ga0495633_0158827_196_813 205
901 3300046559 Ga0495667_0098051 Ga0495667_0098051_107_724 205
902 3300046615 Ga0495656_0039635 Ga0495656_0039635_1266_1883 205
903 3300046616 Ga0495668_0054485 Ga0495668_0054485_1290_1907 205
904 3300046616 Ga0495668_0118375 Ga0495668_0118375_711_1328 205
905 3300046616 Ga0495668_0176269 Ga0495668_0176269_323_940 205
906 3300046642 Ga0495634_0048467 Ga0495634_0048467_146_763 205
907 3300046660 Ga0495625_0096038 Ga0495625_0096038_1266_1883 205
908 3300046660 Ga0495625_0141186 Ga0495625_0141186_697_1314 205
909 3300046660 Ga0495625_0235325 Ga0495625_0235325_194_811 205
910 3300046663 Ga0495635_0039556 Ga0495635_0039556_2133_2750 205
911 3300046664 Ga0495659_0062482 Ga0495659_0062482_726_1343 205
912 3300046665 Ga0495661_0082112 Ga0495661_0082112_91_708 205
913 3300046665 Ga0495661_0154702 Ga0495661_0154702_239_856 205
914 3300046674 Ga0495588_0068955 Ga0495588_0068955_130_747 205
915 3300046674 Ga0495588_0116574 Ga0495588_0116574_338_955 205
916 3300046675 Ga0495657_0230830 Ga0495657_0230830_416_1033 205
917 3300046680 Ga0495646_0301078 Ga0495646_0301078_82_699 205
918 3300046681 Ga0495647_0010283 Ga0495647_0010283_832_1449 205
919 3300046684 Ga0495669_0045783 Ga0495669_0045783_595_1212 205
920 3300046684 Ga0495669_0163072 Ga0495669_0163072_343_960 205
921 3300046690 Ga0495624_0186716 Ga0495624_0186716_38_655 205
922 3300046692 Ga0495671_0155609 Ga0495671_0155609_401_1018 205
923 3300046694 Ga0495649_0108323 Ga0495649_0108323_351_968 205
924 3300046794 Ga0495589_0143357 Ga0495589_0143357_274_891 205
925 3300046809 Ga0495600_0103179 Ga0495600_0103179_29_646 205
926 3300047315 Ga0495581_0225941 Ga0495581_0225941_307_924 205
927 3300047317 Ga0495604_0115420 Ga0495604_0115420_616_1233 205
928 3300047317 Ga0495604_0419547 Ga0495604_0419547_20_637 205
929 3300047318 Ga0495636_0330569 Ga0495636_0330569_55_672 205
930 3300047319 Ga0495674_0119121 Ga0495674_0119121_760_1377 205
931 3300047321 Ga0495676_0028252 Ga0495676_0028252_3385_4002 205
932 3300047321 Ga0495676_0036568 Ga0495676_0036568_3291_3908 205
933 3300047321 Ga0495676_0316557 Ga0495676_0316557_324_941 205
934 3300047323 Ga0495683_0179878 Ga0495683_0179878_277_894 205
935 3300047443 Ga0495687_050286 Ga0495687_050286_507_1124 205
936 3300047445 Ga0495677_0282310 Ga0495677_0282310_10_627 205
937 3300047446 Ga0495679_034860 Ga0495679_034860_130_747 205
938 3300047447 Ga0495685_089361 Ga0495685_089361_384_1001 205
939 3300047469 Ga0495673_0056106 Ga0495673_0056106_674_1291 205
940 3300047469 Ga0495673_0075947 Ga0495673_0075947_379_996 205
941 3300047470 Ga0495681_0064641 Ga0495681_0064641_69_686 205
942 3300047471 Ga0495684_0336736 Ga0495684_0336736_71_688 205
943 3300047673 Ga0495593_0370936 Ga0495593_0370936_51_668 205
944 3300048088 Ga0495602_0056666 Ga0495602_0056666_2461_3078 205
945 3300048904 Ga0496101_0080746 Ga0496101_0080746_77_694 205
946 3300048905 Ga0496102_0013587 Ga0496102_0013587_5773_6390 205
947 3300048905 Ga0496102_0900449 Ga0496102_0900449_34_651 205
948 3300048907 Ga0496104_0031429 Ga0496104_0031429_4027_4644 205
949 3300048907 Ga0496104_0059165 Ga0496104_0059165_442_1059 205
950 3300048908 Ga0496105_0019733 Ga0496105_0019733_2125_2742 205
951 3300048908 Ga0496105_0027418 Ga0496105_0027418_359_976 205
952 3300048908 Ga0496105_0236469 Ga0496105_0236469_746_1363 205
953 3300048909 Ga0496106_0032474 Ga0496106_0032474_2406_3023 205
954 3300048909 Ga0496106_0185232 Ga0496106_0185232_826_1443 205
955 3300048909 Ga0496106_0228129 Ga0496106_0228129_543_1160 205
956 3300048909 Ga0496106_0433607 Ga0496106_0433607_158_775 205
957 3300048909 Ga0496106_0521764 Ga0496106_0521764_262_879 205
958 3300048910 Ga0496107_0173292 Ga0496107_0173292_232_849 205
959 3300048910 Ga0496107_0383552 Ga0496107_0383552_342_959 205
960 3300048911 Ga0496108_0096731 Ga0496108_0096731_1328_1945 205
961 3300048911 Ga0496108_0575578 Ga0496108_0575578_345_962 205
962 3300048912 Ga0496109_0213814 Ga0496109_0213814_15_632 205
963 3300048912 Ga0496109_0359484 Ga0496109_0359484_243_860 205
964 3300048913 Ga0496110_0077186 Ga0496110_0077186_1544_2161 205
965 3300048913 Ga0496110_0106130 Ga0496110_0106130_1676_2293 205
966 3300048913 Ga0496110_0139014 Ga0496110_0139014_861_1478 205
967 3300048913 Ga0496110_0642889 Ga0496110_0642889_283_900 205
968 3300048913 Ga0496110_1013780 Ga0496110_1013780_32_649 205
969 3300048914 Ga0496111_0320510 Ga0496111_0320510_348_965 205
970 3300048915 Ga0496112_0053052 Ga0496112_0053052_643_1260 205
971 3300048916 Ga0496113_0424221 Ga0496113_0424221_429_1046 205
972 3300048916 Ga0496113_0637739 Ga0496113_0637739_35_652 205
973 3300048917 Ga0496114_0011812 Ga0496114_0011812_3324_3941 205
974 3300048919 Ga0496116_0116367 Ga0496116_0116367_56_673 205
975 3300048919 Ga0496116_0127317 Ga0496116_0127317_623_1240 205
976 3300048920 Ga0496117_0243722 Ga0496117_0243722_11_628 205
977 3300048921 Ga0496118_0026226 Ga0496118_0026226_4342_4959 205
978 3300048921 Ga0496118_0081688 Ga0496118_0081688_373_990 205
979 3300048921 Ga0496118_0149520 Ga0496118_0149520_730_1347 205
980 3300048921 Ga0496118_0161098 Ga0496118_0161098_444_1061 205
981 3300048922 Ga0496119_0019471 Ga0496119_0019471_2866_3483 205
982 3300048922 Ga0496119_0053579 Ga0496119_0053579_652_1269 205
983 3300048922 Ga0496119_0100067 Ga0496119_0100067_457_1074 205
984 3300048922 Ga0496119_0247284 Ga0496119_0247284_34_651 205
985 3300048923 Ga0496120_0011217 Ga0496120_0011217_2263_2880 205
986 3300048923 Ga0496120_0031156 Ga0496120_0031156_422_1039 205
987 3300048923 Ga0496120_0260218 Ga0496120_0260218_87_704 205
988 3300048924 Ga0496121_0000385 Ga0496121_0000385_39107_39724 205
989 3300048924 Ga0496121_0019557 Ga0496121_0019557_4797_5414 205
990 3300048924 Ga0496121_0020698 Ga0496121_0020698_5202_5819 205
991 3300048924 Ga0496121_0230496 Ga0496121_0230496_533_1150 205
992 3300048924 Ga0496121_0306453 Ga0496121_0306453_87_704 205
993 3300048927 Ga0496124_0024791 Ga0496124_0024791_4460_5077 205
994 3300048927 Ga0496124_0103018 Ga0496124_0103018_197_814 205
995 3300048927 Ga0496124_0127929 Ga0496124_0127929_49_666 205
996 3300048927 Ga0496124_0195402 Ga0496124_0195402_34_651 205
997 3300048927 Ga0496124_0407652 Ga0496124_0407652_226_843 205
998 3300048928 Ga0496125_0073441 Ga0496125_0073441_1598_2215 205
999 3300048928 Ga0496125_0168177 Ga0496125_0168177_52_669 205
1000 3300048928 Ga0496125_0174668 Ga0496125_0174668_580_1197 205
1001 3300048928 Ga0496125_0187454 Ga0496125_0187454_394_1011 205
1002 3300048929 Ga0496126_0005539 Ga0496126_0005539_10752_11369 205
1003 3300048929 Ga0496126_0012136 Ga0496126_0012136_6533_7150 205
1004 3300048929 Ga0496126_0046270 Ga0496126_0046270_362_985 205
1005 3300048929 Ga0496126_0058664 Ga0496126_0058664_2251_2868 205
1006 3300048929 Ga0496126_0101673 Ga0496126_0101673_1021_1638 205
1007 3300048929 Ga0496126_0189392 Ga0496126_0189392_926_1543 205
1008 3300048929 Ga0496126_0191230 Ga0496126_0191230_150_767 205
1009 3300048929 Ga0496126_0290391 Ga0496126_0290391_282_899 205
1010 3300049460 Ga0495682_0160173 Ga0495682_0160173_159_776 205
1011 3300049576 Ga0501040_0354214 Ga0501040_0354214_345_962 205
1012 3300049583 Ga0501067_0256727 Ga0501067_0256727_261_878 205
1013 3300049585 Ga0501069_0306168 Ga0501069_0306168_265_882 205
1014 3300049588 Ga0501072_0005470 Ga0501072_0005470_3538_4158 205
1015 3300049592 Ga0501076_0200135 Ga0501076_0200135_960_1577 205
1016 3300049744 Ga0501083_0017990 Ga0501083_0017990_70_687 205
1017 3300049744 Ga0501083_0104790 Ga0501083_0104790_500_1120 205
1018 3300049823 Ga0501044_0060247 Ga0501044_0060247_2000_2623 205
1019 3300050489 nmdc:mga03683_111095_c1 nmdc:mga03683_111095_c1_420_1040 205
1020 3300050489 nmdc:mga03683_132301_c1 nmdc:mga03683_132301_c1_482_1099 205
1021 3300050490 nmdc:mga03n38_260768_c1 nmdc:mga03n38_260768_c1_178_795 205
1022 3300050491 nmdc:mga00v17_119137_c1 nmdc:mga00v17_119137_c1_213_830 205
1023 3300050492 nmdc:mga0yw44_105680_c1 nmdc:mga0yw44_105680_c1_235_852 205
1024 3300050492 nmdc:mga0yw44_178244_c1 nmdc:mga0yw44_178244_c1_613_1230 205
1025 3300050492 nmdc:mga0yw44_20981_c1 nmdc:mga0yw44_20981_c1_2037_2654 205
1026 3300050492 nmdc:mga0yw44_51441_c1 nmdc:mga0yw44_51441_c1_1571_2188 205
1027 3300050492 nmdc:mga0yw44_608085_c1 nmdc:mga0yw44_608085_c1_29_646 205
1028 3300050492 nmdc:mga0yw44_8581_c1 nmdc:mga0yw44_8581_c1_1113_1730 205
1029 3300050493 nmdc:mga0k408_378583_c1 nmdc:mga0k408_378583_c1_46_663 205
1030 3300050493 nmdc:mga0k408_5289_c1 nmdc:mga0k408_5289_c1_5583_6200 205
1031 3300050493 nmdc:mga0k408_74953_c1 nmdc:mga0k408_74953_c1_1181_1798 205
1032 3300050494 nmdc:mga06z11_21787_c1 nmdc:mga06z11_21787_c1_69_686 205
1033 3300050494 nmdc:mga06z11_303415_c1 nmdc:mga06z11_303415_c1_132_749 205
1034 3300050494 nmdc:mga06z11_44366_c1 nmdc:mga06z11_44366_c1_767_1384 205
1035 3300050495 nmdc:mga04h51_24889_c1 nmdc:mga04h51_24889_c1_1202_1819 205
1036 3300050496 nmdc:mga07m45_196195_c1 nmdc:mga07m45_196195_c1_29_646 205
1037 3300050496 nmdc:mga07m45_247912_c1 nmdc:mga07m45_247912_c1_11_631 205
1038 3300050496 nmdc:mga07m45_267915_c1 nmdc:mga07m45_267915_c1_295_912 205
1039 3300050507 nmdc:mga05p37_96999_c1 nmdc:mga05p37_96999_c1_2818_3435 205
1040 3300050509 nmdc:mga0qj67_634343_c1 nmdc:mga0qj67_634343_c1_118_735 205
1041 3300050511 nmdc:mga08y16_86315_c1 nmdc:mga08y16_86315_c1_2342_2959 205
1042 3300050512 nmdc:mga0n895_252685_c1 nmdc:mga0n895_252685_c1_730_1347 205
1043 3300050514 nmdc:mga08x19_614961_c1 nmdc:mga08x19_614961_c1_96_713 205
1044 3300050515 nmdc:mga0a205_818705_c1 nmdc:mga0a205_818705_c1_83_700 205
1045 3300050515 nmdc:mga0a205_836351_c1 nmdc:mga0a205_836351_c1_93_710 205
1046 3300050516 nmdc:mga0sz30_23751_c1 nmdc:mga0sz30_23751_c1_1693_2310 205
1047 3300050516 nmdc:mga0sz30_43538_c1 nmdc:mga0sz30_43538_c1_328_945 205
1048 3300050516 nmdc:mga0sz30_85822_c1 nmdc:mga0sz30_85822_c1_372_989 205
1049 3300053080 Ga0500635_0038061 Ga0500635_0038061_827_1444 205
1050 3300053080 Ga0500635_0130770 Ga0500635_0130770_196_813 205
1051 3300053083 Ga0495655_0074753 Ga0495655_0074753_177_794 205
1052 3300053085 Ga0495619_0296383 Ga0495619_0296383_393_1010 205
1053 3300053086 Ga0500578_0078489 Ga0500578_0078489_1128_1745 205
1054 3300053086 Ga0500578_0227404 Ga0500578_0227404_313_933 205
1055 3300053087 Ga0500643_000210 Ga0500643_000210_53199_53816 205
1056 3300053087 Ga0500643_034542 Ga0500643_034542_515_1132 205
1057 3300053090 Ga0500646_0039027 Ga0500646_0039027_206_823 205
1058 3300053092 Ga0500583_0137198 Ga0500583_0137198_291_908 205
1059 3300053093 Ga0500651_0275141 Ga0500651_0275141_43_663 205
1060 3300053094 Ga0500566_0005375 Ga0500566_0005375_3651_4268 205
1061 3300053094 Ga0500566_0016861 Ga0500566_0016861_205_822 205
1062 3300053095 Ga0500640_071568 Ga0500640_071568_673_1290 205
1063 3300053096 Ga0500641_0079733 Ga0500641_0079733_144_761 205
1064 3300053098 Ga0500650_0087386 Ga0500650_0087386_360_977 205
1065 3300053103 Ga0500555_008898 Ga0500555_008898_355_972 205
1066 3300053103 Ga0500555_022271 Ga0500555_022271_664_1281 205
1067 3300053104 Ga0500556_0009402 Ga0500556_0009402_79_696 205
1068 3300053104 Ga0500556_0053913 Ga0500556_0053913_517_1134 205
1069 3300053105 Ga0500557_000034 Ga0500557_000034_62631_63248 205
1070 3300053108 Ga0500562_013400 Ga0500562_013400_707_1324 205
1071 3300053108 Ga0500562_016909 Ga0500562_016909_782_1399 205
1072 3300053109 Ga0500569_050540 Ga0500569_050540_390_1007 205
1073 3300053116 Ga0500592_011853 Ga0500592_011853_132_749 205
1074 3300053118 Ga0500594_0028708 Ga0500594_0028708_719_1336 205
1075 3300053119 Ga0500595_000665 Ga0500595_000665_12722_13342 205
1076 3300053119 Ga0500595_002372 Ga0500595_002372_2954_3571 205
1077 3300053119 Ga0500595_004206 Ga0500595_004206_5091_5708 205
1078 3300053119 Ga0500595_032968 Ga0500595_032968_703_1320 205
1079 3300053120 Ga0500597_043919 Ga0500597_043919_796_1413 205
1080 3300053122 Ga0500608_011645 Ga0500608_011645_1232_1849 205
1081 3300053123 Ga0500614_016922 Ga0500614_016922_156_773 205
1082 3300053126 Ga0500621_208680 Ga0500621_208680_47_664 205
1083 3300053130 Ga0500642_0000053 Ga0500642_0000053_15374_15991 205
1084 3300053130 Ga0500642_0014576 Ga0500642_0014576_289_906 205
1085 3300053130 Ga0500642_0055120 Ga0500642_0055120_393_1010 205
1086 3300053130 Ga0500642_0059513 Ga0500642_0059513_443_1060 205
1087 3300053133 Ga0500655_075826 Ga0500655_075826_52_669 205
1088 3300053134 Ga0500658_0032658 Ga0500658_0032658_420_1037 205
1089 3300053136 Ga0500559_0177366 Ga0500559_0177366_70_687 205
1090 3300053139 Ga0500568_0059458 Ga0500568_0059458_278_895 205
1091 3300053142 Ga0500577_0032842 Ga0500577_0032842_20_637 205
1092 3300053142 Ga0500577_0065289 Ga0500577_0065289_722_1339 205
1093 3300053142 Ga0500577_0157458 Ga0500577_0157458_27_644 205
1094 3300053146 Ga0500588_0186811 Ga0500588_0186811_59_676 205
1095 3300053146 Ga0500588_0191882 Ga0500588_0191882_59_676 205
1096 3300053147 Ga0500589_105651 Ga0500589_105651_553_1170 205
1097 3300053148 Ga0500590_138053 Ga0500590_138053_79_696 205
1098 3300053151 Ga0500604_0073337 Ga0500604_0073337_442_1059 205
1099 3300053151 Ga0500604_0110037 Ga0500604_0110037_272_889 205
1100 3300053155 Ga0500620_077788 Ga0500620_077788_485_1105 205
1101 3300053155 Ga0500620_117420 Ga0500620_117420_292_909 205
1102 3300053156 Ga0500622_0099540 Ga0500622_0099540_463_1080 205
1103 3300053161 Ga0500634_0116844 Ga0500634_0116844_518_1135 205
1104 3300053161 Ga0500634_0144840 Ga0500634_0144840_462_1079 205
1105 3300053162 Ga0500638_126172 Ga0500638_126172_125_742 205
1106 3300053163 Ga0500639_177906 Ga0500639_177906_183_800 205
1107 3300053177 Ga0500636_0000033 Ga0500636_0000033_65383_66000 205
1108 3300053177 Ga0500636_0136147 Ga0500636_0136147_653_1270 205
1109 3300053178 Ga0500637_0000356 Ga0500637_0000356_4434_5051 205
1110 3300053722 Ga0500649_085079 Ga0500649_085079_380_997 205
1111 3300053730 Ga0500645_005159 Ga0500645_005159_3740_4357 205
1112 3300053730 Ga0500645_032492 Ga0500645_032492_501_1121 205
1113 3300053737 Ga0500601_000010 Ga0500601_000010_35121_35738 205
1114 3300055283 Ga0500661_000328 Ga0500661_000328_3219_3836 205
1115 3300055283 Ga0500661_001465 Ga0500661_001465_3058_3675 205
1116 3300060353 Ga0501082_0002219 Ga0501082_0002219_16345_16962 205
1117 3300060353 Ga0501082_0223448 Ga0501082_0223448_431_1048 205
1118 iso_pu_bacteria 2508501128 2509149948 205
1119 iso_pu_bacteria 8006964411 8006965672 205
1120 3300005331 Ga0070670_100076296 Ga0070670_1000762964 206
1121 3300025925 Ga0207650_10354181 Ga0207650_103541812 206
1122 3300046460 Ga0495638_0134477 Ga0495638_0134477_685_1311 206
1123 3300048917 Ga0496114_0935398 Ga0496114_0935398_77_703 206
1124 3300049460 Ga0495682_0082694 Ga0495682_0082694_434_1060 206
1125 3300053093 Ga0500651_0044122 Ga0500651_0044122_1487_2113 206
1126 3300053118 Ga0500594_0010902 Ga0500594_0010902_812_1438 206
1127 3300053130 Ga0500642_0014948 Ga0500642_0014948_966_1592 206
1128 3300053146 Ga0500588_0166240 Ga0500588_0166240_27_653 206
1129 3300005937 Ga0081455_10004734 Ga0081455_100047346 207
1130 3300006871 Ga0075434_100435588 Ga0075434_1004355882 207
1131 3300035112 Ga0373932_0119323 Ga0373932_0119323_122_751 207
1132 3300046519 Ga0495632_0244547 Ga0495632_0244547_28_657 207
1133 3300046692 Ga0495671_0151795 Ga0495671_0151795_235_864 207
1134 3300050512 nmdc:mga0n895_456065_c1 nmdc:mga0n895_456065_c1_347_976 207
1135 3300000546 LJNas_1005977 LJNas_10059771 208
1136 3300025913 Ga0207695_10106220 Ga0207695_101062204 208
1137 3300037418 Ga0395900_0143981 Ga0395900_0143981_453_1106 208
1138 3300038443 Ga0395901_0348752 Ga0395901_0348752_235_888 208
1139 3300039437 Ga0436365_0750351 Ga0436365_0750351_7862_8521 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

39

201

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hx6-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9067 24 162
4r82-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 in complex with nad and fad fragments 0.9056 24 162
3rh7-assembly3.cif.gz_F crystal structure of a putative oxidoreductase (sma0793) from sinorhizobium meliloti 1021 at 3.00 a resolution 0.9044 24 161
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.884 25 195
4hx6-assembly4.cif.gz_H streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.88 24 190
ID Description Score Start End Superfamily
3fgeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9208 24 186 2.30.110.10
2r6vA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9166 25 185 2.30.110.10
3rh7E01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8903 24 161 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.884 25 195 2.30.110.10
3bpkA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8639 9 186 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A317Z3M1-F1-model_v4 Flavin reductase like domain-containing protein 0.943 53 163 GO:0010181
GO:0016646
AF-A0A4R3LUW8-F1-model_v4 Flavin reductase like protein 0.9392 57 195 GO:0010181
GO:0016646
AF-A0A7V4W772-F1-model_v4 Flavin reductase family protein 0.9346 24 162 GO:0010181
GO:0016646
AF-A0A1F9DK23-F1-model_v4 Flavin reductase like domain-containing protein 0.9315 25 159 GO:0010181
GO:0016646
AF-A0A524N1W7-F1-model_v4 Flavin reductase family protein 0.9297 24 188 GO:0010181

Feature Viewer

pLDDT pTM Quality
91.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map