F490657

General Info

Members Datasets Scaffolds Average Seq Length
1138 391 2276 103

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10004449|Ga0065707_100044492
Length 107
Sequence MAVERAAGGTSLIDVLDRVLDKGIVIDAWVRVSLVGIDLITVEARVVVASIDTYLKYSEAVGQVAPVSRPAELPSHQDLVAENATLRLRAERAEATVAPRRRRTTEG

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
122 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
235 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
241 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
260 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
336 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
337 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
338 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
339 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
340 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
362 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 3.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 3.08
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 23.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10004449 3300005295 Bacteria 5084
2 JGI24746J21847_1034837 3300001977 Bacteria 696
3 JGI24035J26624_1006140 3300002126 Unclassified 1156
4 rootH1_10324608 3300003323 Archaea 2062
5 Ga0058859_11593842 3300004798 Bacteria 668
6 Ga0058863_11689012 3300004799 Bacteria 901
7 Ga0058860_11839132 3300004801 Bacteria 590
8 Ga0058862_10060099 3300004803 Bacteria 550
9 Ga0058862_12082364 3300004803 Bacteria 626
10 Ga0058862_12420475 3300004803 Bacteria 837
11 Ga0058862_12676476 3300004803 Unclassified 1181
12 Ga0058862_12814663 3300004803 Unclassified 635
13 Ga0065704_10117224 3300005289 Bacteria 1838
14 Ga0065712_10075230 3300005290 Bacteria 3904
15 Ga0065712_10149640 3300005290 Bacteria 1380
16 Ga0065715_10003606 3300005293 Bacteria 3933
17 Ga0065715_10009259 3300005293 Bacteria 3675
18 Ga0065715_10090438 3300005293 Bacteria 6995
19 Ga0065715_10092286 3300005293 Bacteria 5198
20 Ga0065715_10100776 3300005293 Bacteria 3270
21 Ga0065715_10152984 3300005293 Bacteria 1708
22 Ga0065707_10087959 3300005295 Bacteria 4829
23 Ga0065707_10288800 3300005295 Bacteria 1030
24 Ga0065707_10403955 3300005295 Unclassified 844
25 Ga0065707_10769020 3300005295 Bacteria 611
26 Ga0070658_10020778 3300005327 Bacteria 5262
27 Ga0070658_10095950 3300005327 Bacteria 2448
28 Ga0070658_11709053 3300005327 Unclassified 545
29 Ga0070676_10005316 3300005328 Bacteria 6852
30 Ga0070676_10022925 3300005328 Bacteria 3505
31 Ga0070676_10041125 3300005328 Bacteria 2679
32 Ga0070676_10055387 3300005328 Bacteria 2340
33 Ga0070683_100001001 3300005329 Bacteria 21162
34 Ga0070683_100055461 3300005329 Bacteria 3678
35 Ga0070683_100074784 3300005329 Bacteria 3164
36 Ga0070683_100130233 3300005329 Unclassified 2381
37 Ga0070683_100291151 3300005329 Bacteria 1553
38 Ga0070683_100435970 3300005329 Unclassified 1250
39 Ga0070683_100486288 3300005329 Bacteria 1179
40 Ga0070690_100026193 3300005330 Bacteria 3595
41 Ga0070690_100043048 3300005330 Bacteria 2862
42 Ga0070690_101034669 3300005330 Bacteria 648
43 Ga0070670_100077944 3300005331 Bacteria 2847
44 Ga0070670_100238355 3300005331 Unclassified 1583
45 Ga0070670_101396870 3300005331 Bacteria 642
46 Ga0070677_10569900 3300005333 Bacteria 623
47 Ga0068869_100006865 3300005334 Bacteria 7240
48 Ga0068869_100013758 3300005334 Bacteria 5390
49 Ga0068869_100047272 3300005334 Bacteria 3107
50 Ga0068869_100265051 3300005334 Bacteria 1376
51 Ga0068869_101834937 3300005334 Unclassified 542
52 Ga0070666_10635465 3300005335 Bacteria 780
53 Ga0070680_100016360 3300005336 Bacteria 5837
54 Ga0070680_100026194 3300005336 Bacteria 4664
55 Ga0070680_100040721 3300005336 Bacteria 3764
56 Ga0070680_100042537 3300005336 Bacteria 3687
57 Ga0070680_100158744 3300005336 Unclassified 1900
58 Ga0070680_101257069 3300005336 Unclassified 641
59 Ga0070682_100004745 3300005337 Bacteria 7553
60 Ga0070682_100008856 3300005337 Bacteria 5682
61 Ga0070682_100031801 3300005337 Bacteria 3194
62 Ga0070682_100052286 3300005337 Bacteria 2556
63 Ga0070682_100125581 3300005337 Bacteria 1729
64 Ga0070682_100189250 3300005337 Bacteria 1444
65 Ga0070682_100508205 3300005337 Unclassified 935
66 Ga0068868_100005912 3300005338 Bacteria 8632
67 Ga0068868_100352704 3300005338 Bacteria 1260
68 Ga0068868_100428035 3300005338 Unclassified 1147
69 Ga0070660_100033047 3300005339 Bacteria 3897
70 Ga0070660_100054390 3300005339 Bacteria 3091
71 Ga0070660_100074516 3300005339 Bacteria 2656
72 Ga0070660_100085221 3300005339 Unclassified 2484
73 Ga0070689_100016781 3300005340 Bacteria 5365
74 Ga0070689_100120118 3300005340 Bacteria 2098
75 Ga0070689_100357944 3300005340 Bacteria 1225
76 Ga0070689_100507415 3300005340 Bacteria 1034
77 Ga0070689_100615612 3300005340 Bacteria 942
78 Ga0070689_100750804 3300005340 Unclassified 855
79 Ga0070691_10033238 3300005341 Bacteria 2426
80 Ga0070687_100000368 3300005343 Bacteria 15404
81 Ga0070687_100487867 3300005343 Unclassified 827
82 Ga0070687_100819376 3300005343 Bacteria 661
83 Ga0070661_100009042 3300005344 Bacteria 6892
84 Ga0070661_100073923 3300005344 Bacteria 2510
85 Ga0070661_100095847 3300005344 Bacteria 2201
86 Ga0070661_100411509 3300005344 Unclassified 1071
87 Ga0070692_10020916 3300005345 Bacteria 3178
88 Ga0070692_10176216 3300005345 Unclassified 1236
89 Ga0070692_10285856 3300005345 Bacteria 1001
90 Ga0070692_10979264 3300005345 Bacteria 590
91 Ga0070692_11286079 3300005345 Bacteria 524
92 Ga0070668_100001645 3300005347 Bacteria 16205
93 Ga0070668_100011398 3300005347 Bacteria 6624
94 Ga0070668_101501937 3300005347 Bacteria 616
95 Ga0070669_100009292 3300005353 Bacteria 7000
96 Ga0070669_100071703 3300005353 Bacteria 2563
97 Ga0070669_100395305 3300005353 Unclassified 1130
98 Ga0070669_100902245 3300005353 Bacteria 755
99 Ga0070669_100958120 3300005353 Unclassified 733
100 Ga0070675_100003756 3300005354 Bacteria 11531
101 Ga0070675_100381958 3300005354 Bacteria 1254
102 Ga0070675_100517735 3300005354 Unclassified 1076
103 Ga0070675_100972539 3300005354 Unclassified 779
104 Ga0070671_100084256 3300005355 Bacteria 2658
105 Ga0070674_100142835 3300005356 Bacteria 1798
106 Ga0070674_100376575 3300005356 Unclassified 1154
107 Ga0070673_100082459 3300005364 Bacteria 2610
108 Ga0070673_100082872 3300005364 Bacteria 2604
109 Ga0070673_100308904 3300005364 Bacteria 1394
110 Ga0070673_100360076 3300005364 Bacteria 1293
111 Ga0070688_100064886 3300005365 Bacteria 2319
112 Ga0070659_100013494 3300005366 Bacteria 6081
113 Ga0070659_100020144 3300005366 Bacteria 5064
114 Ga0070659_100070434 3300005366 Unclassified 2778
115 Ga0070659_100102371 3300005366 Bacteria 2306
116 Ga0070659_100275974 3300005366 Unclassified 1398
117 Ga0070659_101802173 3300005366 Unclassified 548
118 Ga0070659_102073801 3300005366 Unclassified 511
119 Ga0070667_100049715 3300005367 Bacteria 3532
120 Ga0070703_10036935 3300005406 Unclassified 1503
121 Ga0070703_10222637 3300005406 Bacteria 752
122 Ga0070709_10362878 3300005434 Unclassified 1073
123 Ga0070709_11355024 3300005434 Unclassified 575
124 Ga0070714_100177772 3300005435 Unclassified 1935
125 Ga0070714_100252446 3300005435 Unclassified 1631
126 Ga0070714_100259794 3300005435 Unclassified 1608
127 Ga0070714_100361724 3300005435 Unclassified 1364
128 Ga0070714_100715159 3300005435 Unclassified 967
129 Ga0070714_102110000 3300005435 Unclassified 549
130 Ga0070713_101078521 3300005436 Unclassified 776
131 Ga0070713_101699727 3300005436 Unclassified 613
132 Ga0070713_101746841 3300005436 Unclassified 604
133 Ga0070713_102090546 3300005436 Bacteria 549
134 Ga0070710_10009789 3300005437 Bacteria 4696
135 Ga0070710_10330725 3300005437 Bacteria 1003
136 Ga0070701_10001564 3300005438 Bacteria 8500
137 Ga0070701_10019843 3300005438 Bacteria 3181
138 Ga0070701_10170452 3300005438 Bacteria 1267
139 Ga0070711_100181108 3300005439 Bacteria 1613
140 Ga0070711_100302652 3300005439 Unclassified 1272
141 Ga0070705_100133315 3300005440 Unclassified 1624
142 Ga0070705_100855131 3300005440 Bacteria 728
143 Ga0070700_100012352 3300005441 Bacteria 4762
144 Ga0070700_100124570 3300005441 Bacteria 1731
145 Ga0070700_100229910 3300005441 Unclassified 1319
146 Ga0070694_100236501 3300005444 Unclassified 1376
147 Ga0070694_100249310 3300005444 Bacteria 1342
148 Ga0070694_100345354 3300005444 Bacteria 1152
149 Ga0070694_100400654 3300005444 Bacteria 1074
150 Ga0070694_100752172 3300005444 Bacteria 796
151 Ga0070708_100000992 3300005445 Bacteria 21642
152 Ga0070708_100018085 3300005445 Bacteria 5896
153 Ga0070663_100446572 3300005455 Unclassified 1065
154 Ga0070663_100625637 3300005455 Unclassified 908
155 Ga0070663_101383594 3300005455 Bacteria 623
156 Ga0070678_100267209 3300005456 Bacteria 1441
157 Ga0070678_100269029 3300005456 Bacteria 1436
158 Ga0070678_100412998 3300005456 Bacteria 1175
159 Ga0070662_100003845 3300005457 Bacteria 9407
160 Ga0070662_100105365 3300005457 Bacteria 2140
161 Ga0070662_100510040 3300005457 Bacteria 1004
162 Ga0070662_101229940 3300005457 Bacteria 644
163 Ga0070662_101527196 3300005457 Unclassified 576
164 Ga0070662_101819087 3300005457 Bacteria 526
165 Ga0070681_10001020 3300005458 Bacteria 23720
166 Ga0070681_10006836 3300005458 Bacteria 11104
167 Ga0070681_10020849 3300005458 Bacteria 6563
168 Ga0070681_10027196 3300005458 Bacteria 5752
169 Ga0070681_10028740 3300005458 Bacteria 5589
170 Ga0070681_10037930 3300005458 Bacteria 4832
171 Ga0070681_10081881 3300005458 Bacteria 3184
172 Ga0070681_10087357 3300005458 Bacteria 3071
173 Ga0070681_10152444 3300005458 Bacteria 2237
174 Ga0070681_10232036 3300005458 Bacteria 1760
175 Ga0070681_10416740 3300005458 Bacteria 1255
176 Ga0070681_10454018 3300005458 Bacteria 1194
177 Ga0070681_10496673 3300005458 Bacteria 1133
178 Ga0070681_10526099 3300005458 Bacteria 1096
179 Ga0068867_101399553 3300005459 Bacteria 648
180 Ga0070685_10005393 3300005466 Bacteria 6477
181 Ga0070685_10648156 3300005466 Bacteria 765
182 Ga0070706_100143271 3300005467 Unclassified 2231
183 Ga0070706_100491522 3300005467 Unclassified 1142
184 Ga0070706_100581912 3300005467 Bacteria 1041
185 Ga0070706_100971807 3300005467 Unclassified 783
186 Ga0070707_100029559 3300005468 Bacteria 5217
187 Ga0070707_100285110 3300005468 Unclassified 1605
188 Ga0070698_100017160 3300005471 Bacteria 7632
189 Ga0070698_100203509 3300005471 Unclassified 1915
190 Ga0070699_100022156 3300005518 Bacteria 5474
191 Ga0070699_100032942 3300005518 Bacteria 4476
192 Ga0070699_100135710 3300005518 Bacteria 2171
193 Ga0070699_100288229 3300005518 Bacteria 1472
194 Ga0070699_100766608 3300005518 Bacteria 882
195 Ga0070699_101377123 3300005518 Bacteria 647
196 Ga0070699_101519162 3300005518 Bacteria 614
197 Ga0070679_100001683 3300005530 Bacteria 19888
198 Ga0070679_100010992 3300005530 Bacteria 8604
199 Ga0070679_100016972 3300005530 Bacteria 7037
200 Ga0070679_100040939 3300005530 Bacteria 4611
201 Ga0070679_100048345 3300005530 Bacteria 4238
202 Ga0070679_100080460 3300005530 Bacteria 3247
203 Ga0070679_100179586 3300005530 Bacteria 2089
204 Ga0070679_100219704 3300005530 Bacteria 1861
205 Ga0070679_100345963 3300005530 Bacteria 1435
206 Ga0070679_100878770 3300005530 Bacteria 840
207 Ga0070684_100000670 3300005535 Bacteria 23692
208 Ga0070684_100056959 3300005535 Bacteria 3412
209 Ga0070684_100092117 3300005535 Bacteria 2697
210 Ga0070684_100093280 3300005535 Bacteria 2680
211 Ga0070684_100168095 3300005535 Bacteria 1991
212 Ga0070684_100178914 3300005535 Bacteria 1928
213 Ga0070684_100199202 3300005535 Bacteria 1823
214 Ga0070684_100422106 3300005535 Bacteria 1231
215 Ga0070684_100453578 3300005535 Unclassified 1185
216 Ga0070684_101035866 3300005535 Unclassified 770
217 Ga0070684_101454749 3300005535 Bacteria 645
218 Ga0070697_100382001 3300005536 Bacteria 1220
219 Ga0070697_100812412 3300005536 Unclassified 828
220 Ga0070697_101651987 3300005536 Bacteria 573
221 Ga0068853_100023802 3300005539 Bacteria 5131
222 Ga0068853_100046090 3300005539 Bacteria 3737
223 Ga0068853_100086084 3300005539 Bacteria 2756
224 Ga0068853_100279222 3300005539 Bacteria 1540
225 Ga0068853_100600554 3300005539 Unclassified 1045
226 Ga0068853_100683026 3300005539 Bacteria 979
227 Ga0068853_100995763 3300005539 Bacteria 807
228 Ga0068853_101306846 3300005539 Unclassified 701
229 Ga0070672_100032073 3300005543 Bacteria 3962
230 Ga0070672_100172161 3300005543 Bacteria 1801
231 Ga0070672_100351947 3300005543 Bacteria 1256
232 Ga0070672_100362977 3300005543 Unclassified 1236
233 Ga0070672_102143901 3300005543 Bacteria 504
234 Ga0070686_100099848 3300005544 Bacteria 1958
235 Ga0070686_100857988 3300005544 Unclassified 736
236 Ga0070695_100013101 3300005545 Unclassified 4982
237 Ga0070695_100050117 3300005545 Bacteria 2675
238 Ga0070695_100161310 3300005545 Bacteria 1574
239 Ga0070695_100597798 3300005545 Unclassified 866
240 Ga0070696_100001595 3300005546 Bacteria 14872
241 Ga0070696_100348608 3300005546 Bacteria 1146
242 Ga0070693_100001331 3300005547 Bacteria 11112
243 Ga0070693_100014601 3300005547 Bacteria 4028
244 Ga0070693_100047738 3300005547 Unclassified 2437
245 Ga0070693_100064983 3300005547 Bacteria 2132
246 Ga0070693_100137136 3300005547 Bacteria 1536
247 Ga0070693_100256230 3300005547 Bacteria 1162
248 Ga0070693_100324283 3300005547 Bacteria 1046
249 Ga0070693_100332699 3300005547 Bacteria 1034
250 Ga0070665_100060357 3300005548 Unclassified 3801
251 Ga0070665_100197111 3300005548 Bacteria 2015
252 Ga0070665_101234703 3300005548 Bacteria 758
253 Ga0070665_101279960 3300005548 Bacteria 743
254 Ga0070704_100020545 3300005549 Bacteria 4260
255 Ga0070704_100169632 3300005549 Bacteria 1734
256 Ga0070704_100955979 3300005549 Unclassified 773
257 Ga0070704_101131960 3300005549 Bacteria 712
258 Ga0070704_101677618 3300005549 Bacteria 587
259 Ga0070704_102226325 3300005549 Unclassified 510
260 Ga0068855_100002422 3300005563 Bacteria 23029
261 Ga0068855_100023709 3300005563 Bacteria 7349
262 Ga0068855_100037003 3300005563 Bacteria 5806
263 Ga0068855_100364891 3300005563 Unclassified 1588
264 Ga0070664_100003338 3300005564 Bacteria 12972
265 Ga0070664_100006874 3300005564 Bacteria 9173
266 Ga0070664_100031086 3300005564 Bacteria 4458
267 Ga0070664_100037737 3300005564 Bacteria 4063
268 Ga0070664_102100087 3300005564 Unclassified 536
269 Ga0068857_100013533 3300005577 Bacteria 7107
270 Ga0068857_100166100 3300005577 Unclassified 2004
271 Ga0068857_100297708 3300005577 Unclassified 1487
272 Ga0068857_100978408 3300005577 Bacteria 814
273 Ga0068857_100987339 3300005577 Bacteria 810
274 Ga0068857_101885231 3300005577 Bacteria 585
275 Ga0068854_100022899 3300005578 Bacteria 4261
276 Ga0068854_100158460 3300005578 Bacteria 1751
277 Ga0068854_100191813 3300005578 Unclassified 1601
278 Ga0068854_100355238 3300005578 Unclassified 1201
279 Ga0068854_100761640 3300005578 Unclassified 841
280 Ga0068854_100895652 3300005578 Unclassified 779
281 Ga0068856_100022626 3300005614 Bacteria 6111
282 Ga0068856_100195497 3300005614 Bacteria 2037
283 Ga0068856_100279059 3300005614 Bacteria 1687
284 Ga0068856_100294262 3300005614 Unclassified 1640
285 Ga0068856_100347815 3300005614 Bacteria 1501
286 Ga0068856_101434385 3300005614 Unclassified 704
287 Ga0068856_102084388 3300005614 Unclassified 577
288 Ga0070702_100200979 3300005615 Unclassified 1319
289 Ga0070702_100547309 3300005615 Bacteria 858
290 Ga0068852_100004098 3300005616 Bacteria 10261
291 Ga0068852_100073510 3300005616 Bacteria 3008
292 Ga0068852_100123248 3300005616 Bacteria 2376
293 Ga0068852_101035734 3300005616 Unclassified 840
294 Ga0068852_101551777 3300005616 Bacteria 685
295 Ga0068859_100018990 3300005617 Bacteria 6905
296 Ga0068859_100053826 3300005617 Bacteria 4047
297 Ga0068859_100545487 3300005617 Bacteria 1254
298 Ga0068859_100924274 3300005617 Unclassified 956
299 Ga0068859_101579178 3300005617 Bacteria 724
300 Ga0068859_101680497 3300005617 Unclassified 701
301 Ga0068864_100141246 3300005618 Bacteria 2172
302 Ga0068864_101131147 3300005618 Bacteria 780
303 Ga0068864_101332213 3300005618 Unclassified 719
304 Ga0068864_102703088 3300005618 Bacteria 502
305 Ga0068866_10020746 3300005718 Bacteria 3016
306 Ga0068861_100070300 3300005719 Bacteria 2710
307 Ga0068861_100073535 3300005719 Bacteria 2655
308 Ga0068861_100169775 3300005719 Bacteria 1807
309 Ga0068861_100685236 3300005719 Bacteria 951
310 Ga0068851_10002180 3300005834 Bacteria 8611
311 Ga0068851_10024376 3300005834 Bacteria 2962
312 Ga0068870_10013226 3300005840 Bacteria 3874
313 Ga0068870_10399187 3300005840 Unclassified 894
314 Ga0068863_100004362 3300005841 Bacteria 13945
315 Ga0068863_100076810 3300005841 Bacteria 3160
316 Ga0068863_100347608 3300005841 Bacteria 1443
317 Ga0068863_100700669 3300005841 Bacteria 1007
318 Ga0068858_100008492 3300005842 Bacteria 9870
319 Ga0068858_100050919 3300005842 Bacteria 3832
320 Ga0068860_100017422 3300005843 Bacteria 6999
321 Ga0068860_102006373 3300005843 Unclassified 600
322 Ga0068862_100011187 3300005844 Bacteria 7410
323 Ga0068862_100030225 3300005844 Bacteria 4565
324 Ga0068862_100788174 3300005844 Unclassified 927
325 Ga0081539_10000174 3300005985 Bacteria 151265
326 Ga0081539_10175457 3300005985 Bacteria 1009
327 Ga0070717_10043417 3300006028 Unclassified 3669
328 Ga0070717_10487628 3300006028 Bacteria 1113
329 Ga0075365_10032017 3300006038 Bacteria 3378
330 Ga0070715_10410543 3300006163 Bacteria 755
331 Ga0070715_10464583 3300006163 Unclassified 717
332 Ga0070716_100057749 3300006173 Bacteria 2231
333 Ga0070716_100168471 3300006173 Bacteria 1427
334 Ga0070716_100286959 3300006173 Bacteria 1138
335 Ga0070716_100670384 3300006173 Bacteria 789
336 Ga0070712_100063964 3300006175 Bacteria 2607
337 Ga0070712_101073466 3300006175 Bacteria 698
338 Ga0075427_10034123 3300006194 Bacteria 843
339 Ga0097621_100000672 3300006237 Bacteria 23958
340 Ga0097621_100018046 3300006237 Bacteria 5379
341 Ga0097621_100146095 3300006237 Bacteria 2025
342 Ga0097621_100205657 3300006237 Bacteria 1710
343 Ga0097621_100501893 3300006237 Bacteria 1099
344 Ga0068871_100000199 3300006358 Bacteria 41241
345 Ga0068871_100015194 3300006358 Bacteria 5757
346 Ga0068871_100168173 3300006358 Unclassified 1878
347 Ga0068871_100335062 3300006358 Unclassified 1335
348 Ga0068871_101839880 3300006358 Unclassified 575
349 Ga0075428_100001460 3300006844 Bacteria 25297
350 Ga0075428_100148298 3300006844 Bacteria 2549
351 Ga0075428_100160791 3300006844 Bacteria 2438
352 Ga0075428_100168139 3300006844 Bacteria 2378
353 Ga0075428_100337741 3300006844 Bacteria 1618
354 Ga0075430_100001395 3300006846 Bacteria 19620
355 Ga0075430_100007336 3300006846 Bacteria 9314
356 Ga0075430_100064069 3300006846 Bacteria 3087
357 Ga0075430_100627131 3300006846 Bacteria 887
358 Ga0075431_100011297 3300006847 Bacteria 8995
359 Ga0075431_100034309 3300006847 Bacteria 5228
360 Ga0075431_100085550 3300006847 Bacteria 3255
361 Ga0075431_100139642 3300006847 Bacteria 2498
362 Ga0075431_101761438 3300006847 Bacteria 576
363 Ga0075431_101953955 3300006847 Unclassified 542
364 Ga0075433_10000761 3300006852 Bacteria 22134
365 Ga0075433_10008053 3300006852 Bacteria 8389
366 Ga0075433_10038053 3300006852 Unclassified 4153
367 Ga0075433_10058254 3300006852 Bacteria 3378
368 Ga0075433_11975040 3300006852 Unclassified 500
369 Ga0075434_100000063 3300006871 Bacteria 55215
370 Ga0075434_100013527 3300006871 Bacteria 7771
371 Ga0075434_100039055 3300006871 Bacteria 4704
372 Ga0075434_100059352 3300006871 Bacteria 3803
373 Ga0075434_100224047 3300006871 Bacteria 1900
374 Ga0075434_100245179 3300006871 Bacteria 1811
375 Ga0075434_100258853 3300006871 Bacteria 1759
376 Ga0075434_100309868 3300006871 Bacteria 1599
377 Ga0075434_100585845 3300006871 Bacteria 1135
378 Ga0075434_101208134 3300006871 Bacteria 768
379 Ga0075434_101522905 3300006871 Bacteria 678
380 Ga0075429_100007349 3300006880 Bacteria 9561
381 Ga0075429_100218433 3300006880 Bacteria 1670
382 Ga0075429_100232259 3300006880 Bacteria 1616
383 Ga0075429_100395580 3300006880 Bacteria 1210
384 Ga0075429_100884400 3300006880 Unclassified 782
385 Ga0068865_100007807 3300006881 Bacteria 6600
386 Ga0068865_100136264 3300006881 Bacteria 1846
387 Ga0068865_100312764 3300006881 Bacteria 1261
388 Ga0068865_102146816 3300006881 Unclassified 508
389 Ga0075436_100011890 3300006914 Bacteria 5972
390 Ga0075436_100082780 3300006914 Bacteria 2226
391 Ga0075436_100308098 3300006914 Bacteria 1136
392 Ga0075436_101479007 3300006914 Bacteria 516
393 Ga0097620_100018990 3300006931 Bacteria 6905
394 Ga0097620_100053825 3300006931 Bacteria 4047
395 Ga0097620_100545593 3300006931 Bacteria 1254
396 Ga0097620_100924292 3300006931 Unclassified 956
397 Ga0097620_101579163 3300006931 Bacteria 724
398 Ga0097620_101680518 3300006931 Unclassified 701
399 Ga0075435_100003203 3300007076 Bacteria 11081
400 Ga0075435_100015966 3300007076 Bacteria 5654
401 Ga0075435_100102819 3300007076 Bacteria 2369
402 Ga0075435_100138982 3300007076 Bacteria 2037
403 Ga0075435_100359442 3300007076 Bacteria 1249
404 Ga0075435_100614680 3300007076 Bacteria 943
405 Ga0075435_100710024 3300007076 Bacteria 874
406 Ga0075435_101941705 3300007076 Bacteria 517
407 Ga0099794_10121669 3300007265 Bacteria 1313
408 Ga0099794_10192774 3300007265 Bacteria 1042
409 Ga0099794_10332955 3300007265 Unclassified 788
410 Ga0099794_10560497 3300007265 Unclassified 603
411 Ga0105240_10038477 3300009093 Bacteria 6136
412 Ga0105240_10044099 3300009093 Bacteria 5671
413 Ga0105240_10093062 3300009093 Bacteria 3680
414 Ga0105240_10169288 3300009093 Unclassified 2589
415 Ga0105240_10194956 3300009093 Bacteria 2379
416 Ga0105240_10250041 3300009093 Unclassified 2051
417 Ga0105240_10408175 3300009093 Bacteria 1528
418 Ga0111539_10023324 3300009094 Bacteria 7603
419 Ga0111539_10330925 3300009094 Bacteria 1773
420 Ga0111539_10957283 3300009094 Bacteria 995
421 Ga0111539_11126948 3300009094 Archaea 912
422 Ga0111539_11419754 3300009094 Bacteria 805
423 Ga0111539_11779063 3300009094 Bacteria 714
424 Ga0105245_10042291 3300009098 Bacteria 4065
425 Ga0105245_10482079 3300009098 Unclassified 1254
426 Ga0105245_11018195 3300009098 Unclassified 873
427 Ga0105245_11823006 3300009098 Unclassified 661
428 Ga0105247_10364739 3300009101 Bacteria 1020
429 Ga0114129_10013088 3300009147 Bacteria 11817
430 Ga0114129_10016474 3300009147 Bacteria 10521
431 Ga0114129_10255779 3300009147 Bacteria 2349
432 Ga0114129_10578572 3300009147 Unclassified 1457
433 Ga0114129_10864832 3300009147 Bacteria 1148
434 Ga0114129_11407280 3300009147 Bacteria 860
435 Ga0114129_12619227 3300009147 Bacteria 602
436 Ga0105241_10074874 3300009174 Bacteria 2637
437 Ga0105241_10620087 3300009174 Unclassified 979
438 Ga0105241_12014430 3300009174 Unclassified 569
439 Ga0105242_10062689 3300009176 Bacteria 3060
440 Ga0105242_11298561 3300009176 Unclassified 751
441 Ga0105242_13289845 3300009176 Archaea 502
442 Ga0105248_10032604 3300009177 Bacteria 5820
443 Ga0105248_10074841 3300009177 Bacteria 3806
444 Ga0105248_10311421 3300009177 Bacteria 1773
445 Ga0105248_10498537 3300009177 Bacteria 1373
446 Ga0105248_10614282 3300009177 Bacteria 1226
447 Ga0105237_10019127 3300009545 Bacteria 7077
448 Ga0105237_10467570 3300009545 Unclassified 1267
449 Ga0105237_10659648 3300009545 Unclassified 1053
450 Ga0105237_11164876 3300009545 Bacteria 777
451 Ga0105238_10008500 3300009551 Bacteria 10273
452 Ga0105238_10009654 3300009551 Bacteria 9658
453 Ga0105238_10043056 3300009551 Bacteria 4569
454 Ga0105249_10001072 3300009553 Bacteria 24276
455 Ga0105249_10005273 3300009553 Bacteria 11157
456 Ga0105249_10008847 3300009553 Bacteria 8793
457 Ga0105249_10238037 3300009553 Bacteria 1798
458 Ga0105249_10529400 3300009553 Unclassified 1227
459 Ga0099796_10152604 3300010159 Bacteria 910
460 Ga0105239_10004401 3300010375 Bacteria 16869
461 Ga0105239_10018805 3300010375 Bacteria 7632
462 Ga0105239_10350498 3300010375 Bacteria 1667
463 Ga0105239_13023558 3300010375 Archaea 548
464 Ga0105239_13217647 3300010375 Unclassified 532
465 Ga0105246_10364642 3300011119 Bacteria 1188
466 Ga0105246_10548139 3300011119 Bacteria 991
467 Ga0157317_1020129 3300012475 Bacteria 588
468 Ga0157313_1004160 3300012503 Unclassified 979
469 Ga0157373_10067261 3300013100 Bacteria 2534
470 Ga0157373_10242987 3300013100 Bacteria 1273
471 Ga0157373_10279528 3300013100 Bacteria 1183
472 Ga0157371_10012161 3300013102 Bacteria 6594
473 Ga0157371_10049859 3300013102 Bacteria 2973
474 Ga0157371_10271982 3300013102 Bacteria 1223
475 Ga0157371_10440100 3300013102 Unclassified 957
476 Ga0157370_10023999 3300013104 Bacteria 6046
477 Ga0157370_10525185 3300013104 Unclassified 1086
478 Ga0157370_11159112 3300013104 Bacteria 698
479 Ga0157370_12074910 3300013104 Unclassified 509
480 Ga0157369_10025059 3300013105 Bacteria 6625
481 Ga0157369_10038214 3300013105 Bacteria 5249
482 Ga0157369_10045712 3300013105 Bacteria 4760
483 Ga0157369_10117485 3300013105 Bacteria 2823
484 Ga0157369_10288710 3300013105 Bacteria 1708
485 Ga0157369_12301865 3300013105 Archaea 546
486 Ga0157374_10024671 3300013296 Bacteria 5391
487 Ga0157374_10076870 3300013296 Bacteria 3157
488 Ga0157374_10112106 3300013296 Bacteria 2624
489 Ga0157378_10010809 3300013297 Bacteria 7979
490 Ga0157378_10505797 3300013297 Unclassified 1207
491 Ga0157378_12994579 3300013297 Bacteria 524
492 Ga0163162_10015582 3300013306 Bacteria 7429
493 Ga0163162_10016923 3300013306 Bacteria 7131
494 Ga0163162_10423188 3300013306 Bacteria 1464
495 Ga0163162_10622852 3300013306 Bacteria 1204
496 Ga0157372_10001413 3300013307 Bacteria 25883
497 Ga0157372_10013669 3300013307 Bacteria 8675
498 Ga0157372_10020331 3300013307 Bacteria 7160
499 Ga0157372_10073677 3300013307 Bacteria 3849
500 Ga0157372_10085246 3300013307 Bacteria 3583
501 Ga0157372_10222101 3300013307 Bacteria 2190
502 Ga0157372_10358624 3300013307 Bacteria 1699
503 Ga0157372_10896520 3300013307 Bacteria 1029
504 Ga0157372_12017461 3300013307 Unclassified 663
505 Ga0157372_12795212 3300013307 Unclassified 560
506 Ga0157375_10040044 3300013308 Bacteria 4514
507 Ga0157375_10066129 3300013308 Bacteria 3607
508 Ga0157375_10146904 3300013308 Bacteria 2489
509 Ga0157375_10705364 3300013308 Bacteria 1162
510 Ga0157375_10730143 3300013308 Bacteria 1143
511 Ga0157375_13555019 3300013308 Bacteria 519
512 Ga0163163_10130752 3300014325 Bacteria 2551
513 Ga0163163_10801155 3300014325 Unclassified 1005
514 Ga0163163_10904052 3300014325 Bacteria 946
515 Ga0163163_11197560 3300014325 Bacteria 822
516 Ga0163163_11484380 3300014325 Bacteria 739
517 Ga0163163_12649033 3300014325 Unclassified 559
518 Ga0157380_10067582 3300014326 Bacteria 2878
519 Ga0157380_10080058 3300014326 Bacteria 2669
520 Ga0157380_10784163 3300014326 Bacteria 968
521 Ga0157380_11255725 3300014326 Unclassified 786
522 Ga0182008_10005300 3300014497 Bacteria 7366
523 Ga0182008_10036968 3300014497 Bacteria 2443
524 Ga0157377_10000701 3300014745 Bacteria 13807
525 Ga0157377_10357216 3300014745 Bacteria 982
526 Ga0157379_10042159 3300014968 Unclassified 4074
527 Ga0157376_10337542 3300014969 Unclassified 1438
528 Ga0157376_11030550 3300014969 Bacteria 846
529 Ga0157376_11568764 3300014969 Bacteria 692
530 Ga0157376_12040057 3300014969 Bacteria 611
531 Ga0157376_12412937 3300014969 Unclassified 565
532 Ga0157376_12567983 3300014969 Unclassified 549
533 Ga0182006_1038915 3300015261 Bacteria 1879
534 Ga0182007_10004976 3300015262 Bacteria 5918
535 Ga0182007_10095243 3300015262 Bacteria 982
536 Ga0163161_10038775 3300017792 Bacteria 3418
537 Ga0206356_11439665 3300020070 Unclassified 831
538 Ga0206356_11691036 3300020070 Unclassified 923
539 Ga0213873_10019893 3300021358 Bacteria 1562
540 Ga0213876_10331192 3300021384 Unclassified 810
541 Ga0224712_10374815 3300022467 Unclassified 675
542 Ga0207673_1052659 3300025290 Unclassified 577
543 Ga0207697_10004407 3300025315 Bacteria 6729
544 Ga0207697_10016356 3300025315 Bacteria 3055
545 Ga0207656_10004964 3300025321 Bacteria 4673
546 Ga0207656_10022029 3300025321 Bacteria 2552
547 Ga0207653_10026783 3300025885 Bacteria 1850
548 Ga0207682_10005888 3300025893 Bacteria 4968
549 Ga0207682_10058810 3300025893 Bacteria 1605
550 Ga0207682_10426728 3300025893 Bacteria 627
551 Ga0207692_10052520 3300025898 Unclassified 2072
552 Ga0207692_10243399 3300025898 Bacteria 1075
553 Ga0207642_10091701 3300025899 Bacteria 1502
554 Ga0207710_10219062 3300025900 Bacteria 944
555 Ga0207688_10013310 3300025901 Bacteria 4470
556 Ga0207688_10111816 3300025901 Unclassified 1586
557 Ga0207688_10558706 3300025901 Unclassified 719
558 Ga0207647_10043905 3300025904 Unclassified 2795
559 Ga0207685_10823780 3300025905 Unclassified 512
560 Ga0207699_10014666 3300025906 Bacteria 4048
561 Ga0207699_10029591 3300025906 Bacteria 3056
562 Ga0207699_10503002 3300025906 Bacteria 875
563 Ga0207645_10003398 3300025907 Bacteria 12106
564 Ga0207645_10011314 3300025907 Bacteria 6098
565 Ga0207645_10048478 3300025907 Bacteria 2713
566 Ga0207643_10008827 3300025908 Bacteria 5410
567 Ga0207643_10399373 3300025908 Unclassified 869
568 Ga0207705_10169488 3300025909 Bacteria 1643
569 Ga0207705_10409977 3300025909 Archaea 1048
570 Ga0207684_10014240 3300025910 Bacteria 6862
571 Ga0207684_10070132 3300025910 Unclassified 2979
572 Ga0207684_10490603 3300025910 Unclassified 1053
573 Ga0207654_10065768 3300025911 Bacteria 2136
574 Ga0207654_11363879 3300025911 Unclassified 517
575 Ga0207707_10001403 3300025912 Bacteria 22328
576 Ga0207707_10004017 3300025912 Bacteria 13060
577 Ga0207707_10008110 3300025912 Bacteria 9118
578 Ga0207707_10009793 3300025912 Bacteria 8311
579 Ga0207707_10013883 3300025912 Bacteria 7023
580 Ga0207707_10043159 3300025912 Bacteria 3934
581 Ga0207707_10064410 3300025912 Unclassified 3191
582 Ga0207707_10083176 3300025912 Unclassified 2795
583 Ga0207707_10222277 3300025912 Bacteria 1644
584 Ga0207707_10298054 3300025912 Bacteria 1394
585 Ga0207707_10300153 3300025912 Bacteria 1389
586 Ga0207707_10558024 3300025912 Bacteria 972
587 Ga0207707_10891414 3300025912 Unclassified 736
588 Ga0207695_10006370 3300025913 Bacteria 15353
589 Ga0207695_10091977 3300025913 Bacteria 3046
590 Ga0207695_10107984 3300025913 Bacteria 2768
591 Ga0207695_10121200 3300025913 Bacteria 2583
592 Ga0207695_10223178 3300025913 Bacteria 1791
593 Ga0207671_10044113 3300025914 Bacteria 3297
594 Ga0207671_10092878 3300025914 Unclassified 2275
595 Ga0207671_10522934 3300025914 Unclassified 946
596 Ga0207671_11240056 3300025914 Bacteria 582
597 Ga0207671_11460972 3300025914 Bacteria 529
598 Ga0207693_10857158 3300025915 Bacteria 698
599 Ga0207663_10251947 3300025916 Unclassified 1300
600 Ga0207663_10717192 3300025916 Unclassified 793
601 Ga0207660_10004449 3300025917 Bacteria 9130
602 Ga0207660_10012020 3300025917 Bacteria 5655
603 Ga0207660_10044500 3300025917 Bacteria 3123
604 Ga0207660_10087591 3300025917 Bacteria 2301
605 Ga0207660_10177597 3300025917 Bacteria 1652
606 Ga0207660_10186450 3300025917 Unclassified 1614
607 Ga0207660_10963204 3300025917 Bacteria 696
608 Ga0207662_10002435 3300025918 Bacteria 9329
609 Ga0207662_10041968 3300025918 Bacteria 2695
610 Ga0207662_10816928 3300025918 Bacteria 658
611 Ga0207662_10961207 3300025918 Bacteria 606
612 Ga0207662_11069990 3300025918 Bacteria 573
613 Ga0207657_10001956 3300025919 Bacteria 22232
614 Ga0207657_10011536 3300025919 Bacteria 8771
615 Ga0207657_10024337 3300025919 Bacteria 5612
616 Ga0207657_10198706 3300025919 Bacteria 1614
617 Ga0207657_10686756 3300025919 Unclassified 796
618 Ga0207649_10021789 3300025920 Bacteria 3696
619 Ga0207649_10028642 3300025920 Bacteria 3280
620 Ga0207649_10032394 3300025920 Bacteria 3116
621 Ga0207649_10216756 3300025920 Unclassified 1361
622 Ga0207652_10005957 3300025921 Bacteria 9864
623 Ga0207652_10007070 3300025921 Bacteria 9045
624 Ga0207652_10032484 3300025921 Bacteria 4389
625 Ga0207652_10061851 3300025921 Bacteria 3234
626 Ga0207652_10131203 3300025921 Bacteria 2235
627 Ga0207652_10138078 3300025921 Unclassified 2178
628 Ga0207652_10153637 3300025921 Bacteria 2061
629 Ga0207652_10198007 3300025921 Unclassified 1808
630 Ga0207652_10454145 3300025921 Unclassified 1155
631 Ga0207652_10740145 3300025921 Unclassified 876
632 Ga0207652_10784823 3300025921 Bacteria 846
633 Ga0207646_10065705 3300025922 Bacteria 3239
634 Ga0207646_10175134 3300025922 Unclassified 1937
635 Ga0207646_10471940 3300025922 Bacteria 1131
636 Ga0207646_10840054 3300025922 Bacteria 817
637 Ga0207646_10995945 3300025922 Bacteria 741
638 Ga0207646_11804982 3300025922 Unclassified 523
639 Ga0207681_10041546 3300025923 Bacteria 3066
640 Ga0207681_10051813 3300025923 Bacteria 2781
641 Ga0207681_10412423 3300025923 Unclassified 1093
642 Ga0207681_11305030 3300025923 Unclassified 610
643 Ga0207694_10074644 3300025924 Bacteria 2654
644 Ga0207694_10296931 3300025924 Unclassified 1330
645 Ga0207694_10345844 3300025924 Bacteria 1230
646 Ga0207650_10121510 3300025925 Bacteria 2034
647 Ga0207650_10856752 3300025925 Bacteria 771
648 Ga0207650_11468075 3300025925 Unclassified 580
649 Ga0207650_11599237 3300025925 Bacteria 553
650 Ga0207659_10023471 3300025926 Bacteria 4117
651 Ga0207659_10122098 3300025926 Bacteria 1997
652 Ga0207659_11294792 3300025926 Unclassified 626
653 Ga0207687_10071472 3300025927 Bacteria 2479
654 Ga0207687_10281225 3300025927 Unclassified 1334
655 Ga0207700_10016602 3300025928 Unclassified 4896
656 Ga0207700_10629751 3300025928 Unclassified 956
657 Ga0207700_11006970 3300025928 Unclassified 746
658 Ga0207700_11350214 3300025928 Unclassified 634
659 Ga0207700_11700968 3300025928 Bacteria 556
660 Ga0207664_10025220 3300025929 Unclassified 4475
661 Ga0207664_10159679 3300025929 Unclassified 1922
662 Ga0207664_10253311 3300025929 Unclassified 1537
663 Ga0207664_10587393 3300025929 Bacteria 1000
664 Ga0207664_10674991 3300025929 Unclassified 929
665 Ga0207644_10081083 3300025931 Bacteria 2397
666 Ga0207644_10098590 3300025931 Bacteria 2191
667 Ga0207644_10652861 3300025931 Bacteria 876
668 Ga0207644_10890288 3300025931 Bacteria 746
669 Ga0207644_11685449 3300025931 Bacteria 531
670 Ga0207690_10005865 3300025932 Bacteria 7271
671 Ga0207690_10045406 3300025932 Bacteria 2902
672 Ga0207690_10082265 3300025932 Bacteria 2252
673 Ga0207690_10091184 3300025932 Bacteria 2154
674 Ga0207690_10232919 3300025932 Unclassified 1415
675 Ga0207690_10956964 3300025932 Unclassified 711
676 Ga0207706_10001234 3300025933 Bacteria 25749
677 Ga0207706_10041286 3300025933 Bacteria 4090
678 Ga0207706_10074133 3300025933 Bacteria 2993
679 Ga0207706_10344050 3300025933 Bacteria 1297
680 Ga0207706_10432329 3300025933 Bacteria 1140
681 Ga0207706_10580180 3300025933 Bacteria 964
682 Ga0207706_10660352 3300025933 Bacteria 895
683 Ga0207706_11294328 3300025933 Bacteria 602
684 Ga0207686_10375141 3300025934 Bacteria 1077
685 Ga0207670_10028957 3300025936 Bacteria 3522
686 Ga0207670_10416574 3300025936 Bacteria 1077
687 Ga0207670_10605558 3300025936 Unclassified 900
688 Ga0207669_10210000 3300025937 Bacteria 1420
689 Ga0207669_10420706 3300025937 Bacteria 1051
690 Ga0207704_10250527 3300025938 Unclassified 1329
691 Ga0207704_10265805 3300025938 Bacteria 1296
692 Ga0207665_10004800 3300025939 Bacteria 9002
693 Ga0207665_10147209 3300025939 Bacteria 1684
694 Ga0207665_10222964 3300025939 Bacteria 1382
695 Ga0207665_10506943 3300025939 Bacteria 933
696 Ga0207665_11401934 3300025939 Bacteria 556
697 Ga0207691_10002084 3300025940 Bacteria 19520
698 Ga0207691_10002362 3300025940 Bacteria 18483
699 Ga0207691_10040033 3300025940 Bacteria 4333
700 Ga0207691_10323363 3300025940 Bacteria 1322
701 Ga0207711_10124431 3300025941 Bacteria 2305
702 Ga0207711_10928490 3300025941 Bacteria 809
703 Ga0207689_10008560 3300025942 Bacteria 8918
704 Ga0207689_10011347 3300025942 Bacteria 7642
705 Ga0207689_10067141 3300025942 Bacteria 2948
706 Ga0207689_10282539 3300025942 Bacteria 1374
707 Ga0207661_10003424 3300025944 Bacteria 11007
708 Ga0207661_10015101 3300025944 Bacteria 5675
709 Ga0207661_10154824 3300025944 Unclassified 1984
710 Ga0207661_10163820 3300025944 Bacteria 1931
711 Ga0207661_10184645 3300025944 Unclassified 1824
712 Ga0207661_10257237 3300025944 Bacteria 1554
713 Ga0207661_10266976 3300025944 Unclassified 1526
714 Ga0207661_10303926 3300025944 Bacteria 1431
715 Ga0207661_10508958 3300025944 Unclassified 1100
716 Ga0207679_10006782 3300025945 Bacteria 7254
717 Ga0207679_10011838 3300025945 Bacteria 5670
718 Ga0207679_10216758 3300025945 Bacteria 1608
719 Ga0207679_10313510 3300025945 Unclassified 1356
720 Ga0207679_10844355 3300025945 Unclassified 836
721 Ga0207679_11137489 3300025945 Bacteria 716
722 Ga0207679_11926695 3300025945 Unclassified 539
723 Ga0207667_10037065 3300025949 Bacteria 5216
724 Ga0207667_10079106 3300025949 Bacteria 3407
725 Ga0207667_10112569 3300025949 Bacteria 2806
726 Ga0207667_10211207 3300025949 Unclassified 1989
727 Ga0207651_10735450 3300025960 Bacteria 871
728 Ga0207651_11253997 3300025960 Bacteria 666
729 Ga0207651_11456953 3300025960 Unclassified 616
730 Ga0207712_10002781 3300025961 Bacteria 11191
731 Ga0207712_10004441 3300025961 Bacteria 8860
732 Ga0207712_10222552 3300025961 Bacteria 1510
733 Ga0207668_10008817 3300025972 Bacteria 6027
734 Ga0207668_10354205 3300025972 Bacteria 1228
735 Ga0207668_11084489 3300025972 Bacteria 717
736 Ga0207640_10026013 3300025981 Bacteria 3549
737 Ga0207640_10081626 3300025981 Bacteria 2211
738 Ga0207640_10168061 3300025981 Bacteria 1631
739 Ga0207640_10169561 3300025981 Bacteria 1625
740 Ga0207640_10369609 3300025981 Unclassified 1158
741 Ga0207640_10440375 3300025981 Unclassified 1071
742 Ga0207640_11205539 3300025981 Unclassified 673
743 Ga0207658_10081317 3300025986 Bacteria 2484
744 Ga0207677_10060362 3300026023 Bacteria 2620
745 Ga0207677_10117250 3300026023 Bacteria 1995
746 Ga0207677_10691559 3300026023 Unclassified 904
747 Ga0207677_11183576 3300026023 Bacteria 699
748 Ga0207703_10023328 3300026035 Bacteria 4859
749 Ga0207703_10086971 3300026035 Bacteria 2619
750 Ga0207703_10928983 3300026035 Unclassified 833
751 Ga0207639_10044759 3300026041 Bacteria 3330
752 Ga0207639_10077624 3300026041 Bacteria 2618
753 Ga0207639_10081177 3300026041 Bacteria 2568
754 Ga0207639_10106710 3300026041 Bacteria 2274
755 Ga0207639_10493101 3300026041 Bacteria 1118
756 Ga0207639_11406372 3300026041 Bacteria 655
757 Ga0207678_10089128 3300026067 Bacteria 2637
758 Ga0207678_10108073 3300026067 Bacteria 2373
759 Ga0207678_10299400 3300026067 Bacteria 1382
760 Ga0207678_11088519 3300026067 Bacteria 708
761 Ga0207678_11276649 3300026067 Archaea 650
762 Ga0207708_10012277 3300026075 Bacteria 6385
763 Ga0207708_10154609 3300026075 Bacteria 1808
764 Ga0207702_10006267 3300026078 Bacteria 10280
765 Ga0207702_10132534 3300026078 Bacteria 2244
766 Ga0207702_10144212 3300026078 Bacteria 2159
767 Ga0207702_10278638 3300026078 Bacteria 1580
768 Ga0207702_10587193 3300026078 Unclassified 1092
769 Ga0207702_11259226 3300026078 Unclassified 734
770 Ga0207702_11421411 3300026078 Bacteria 687
771 Ga0207641_10117324 3300026088 Bacteria 2370
772 Ga0207641_10853692 3300026088 Unclassified 902
773 Ga0207641_10901825 3300026088 Bacteria 878
774 Ga0207641_11341203 3300026088 Bacteria 716
775 Ga0207648_10051406 3300026089 Bacteria 3602
776 Ga0207648_10446224 3300026089 Bacteria 1177
777 Ga0207676_10389198 3300026095 Unclassified 1300
778 Ga0207676_10619714 3300026095 Bacteria 1041
779 Ga0207674_10005589 3300026116 Bacteria 14904
780 Ga0207674_10020917 3300026116 Bacteria 7060
781 Ga0207674_10031246 3300026116 Bacteria 5594
782 Ga0207674_10416926 3300026116 Unclassified 1297
783 Ga0207674_10603017 3300026116 Bacteria 1061
784 Ga0207674_11110774 3300026116 Unclassified 760
785 Ga0207675_100000194 3300026118 Bacteria 55678
786 Ga0207675_100011701 3300026118 Bacteria 8205
787 Ga0207675_100032337 3300026118 Bacteria 4873
788 Ga0207675_100391415 3300026118 Bacteria 1368
789 Ga0207683_10243751 3300026121 Bacteria 1640
790 Ga0207683_10260582 3300026121 Bacteria 1583
791 Ga0207683_10469974 3300026121 Bacteria 1160
792 Ga0207698_10021480 3300026142 Bacteria 4465
793 Ga0207698_10122838 3300026142 Bacteria 2201
794 Ga0207698_10283573 3300026142 Unclassified 1533
795 Ga0207698_10328431 3300026142 Bacteria 1436
796 Ga0207698_10979604 3300026142 Bacteria 856
797 Ga0207698_11481105 3300026142 Unclassified 694
798 Ga0210000_1002326 3300027462 Bacteria 2704
799 Ga0209968_1004746 3300027526 Bacteria 2037
800 Ga0209999_1010313 3300027543 Bacteria 1688
801 Ga0209588_1101790 3300027671 Bacteria 924
802 Ga0209998_10061686 3300027717 Archaea 884
803 Ga0209974_10448333 3300027876 Unclassified 512
804 Ga0207428_10025733 3300027907 Bacteria 4922
805 Ga0268266_10061223 3300028379 Bacteria 3246
806 Ga0268265_10014944 3300028380 Bacteria 5300
807 Ga0268265_10116687 3300028380 Bacteria 2191
808 Ga0268265_10194003 3300028380 Bacteria 1756
809 Ga0268265_11205977 3300028380 Unclassified 754
810 Ga0268265_11893698 3300028380 Unclassified 603
811 Ga0268264_10003664 3300028381 Bacteria 13204
812 Ga0268264_10006548 3300028381 Bacteria 9806
813 Ga0268264_10226967 3300028381 Bacteria 1722
814 Ga0307408_100057947 3300031548 Bacteria 2814
815 Ga0307408_100258176 3300031548 Unclassified 1441
816 Ga0307408_100295159 3300031548 Bacteria 1355
817 Ga0307408_100740832 3300031548 Bacteria 887
818 Ga0307408_101263041 3300031548 Bacteria 691
819 Ga0307408_102048427 3300031548 Bacteria 551
820 Ga0307405_10171668 3300031731 Bacteria 1547
821 Ga0307405_10195955 3300031731 Bacteria 1463
822 Ga0307405_10502758 3300031731 Bacteria 972
823 Ga0307413_10006005 3300031824 Bacteria 5496
824 Ga0307413_10092855 3300031824 Archaea 1971
825 Ga0307413_10151497 3300031824 Bacteria 1617
826 Ga0307410_10003046 3300031852 Bacteria 8289
827 Ga0307410_10085555 3300031852 Bacteria 2225
828 Ga0307410_11778498 3300031852 Bacteria 547
829 Ga0307406_10006327 3300031901 Bacteria 6533
830 Ga0307406_10870388 3300031901 Bacteria 765
831 Ga0307406_11033597 3300031901 Bacteria 706
832 Ga0307407_10001735 3300031903 Bacteria 8131
833 Ga0307407_10141928 3300031903 Bacteria 1550
834 Ga0307407_11138756 3300031903 Bacteria 608
835 Ga0307412_10172975 3300031911 Bacteria 1616
836 Ga0307412_11152004 3300031911 Bacteria 692
837 Ga0307412_11156818 3300031911 Bacteria 691
838 Ga0307409_100010703 3300031995 Bacteria 5725
839 Ga0307409_100259903 3300031995 Archaea 1593
840 Ga0307416_100033490 3300032002 Bacteria 3895
841 Ga0307416_100133137 3300032002 Bacteria 2243
842 Ga0307416_100153652 3300032002 Bacteria 2115
843 Ga0307416_100502827 3300032002 Archaea 1277
844 Ga0307416_100680077 3300032002 Bacteria 1116
845 Ga0307416_101176896 3300032002 Archaea 872
846 Ga0307416_101818082 3300032002 Unclassified 713
847 Ga0307416_101999763 3300032002 Bacteria 682
848 Ga0307416_102115028 3300032002 Bacteria 665
849 Ga0307416_102750567 3300032002 Bacteria 588
850 Ga0307414_10075039 3300032004 Bacteria 2453
851 Ga0307414_10112967 3300032004 Bacteria 2072
852 Ga0307411_10007654 3300032005 Bacteria 5526
853 Ga0307411_10013915 3300032005 Bacteria 4459
854 Ga0307411_10728189 3300032005 Bacteria 867
855 Ga0307415_100006566 3300032126 Bacteria 6288
856 Ga0373930_0028802 3300034816 Bacteria 1132
857 Ga0373958_0059949 3300034819 Bacteria 822
858 Ga0373949_0168596 3300035090 Unclassified 642
859 Ga0373932_0217142 3300035112 Unclassified 686
860 Ga0373941_0125364 3300035115 Bacteria 920
861 Ga0373941_0188603 3300035115 Bacteria 778
862 Ga0373941_0310210 3300035115 Bacteria 632
863 Ga0373943_0052857 3300035170 Bacteria 2004
864 Ga0373942_0007156 3300035207 Bacteria 2583
865 Ga0373961_0067883 3300035241 Bacteria 1097
866 Ga0373961_0357386 3300035241 Bacteria 552
867 Ga0373924_0181190 3300035410 Bacteria 927
868 Ga0373931_0181281 3300035691 Bacteria 1247
869 Ga0373937_0589309 3300036401 Bacteria 1056
870 Ga0373925_1107769 3300037068 Bacteria 651
871 Ga0395899_0010240 3300037312 Bacteria 7185
872 Ga0395900_0258692 3300037418 Bacteria 1739
873 Ga0395900_0534580 3300037418 Bacteria 1119
874 Ga0395898_0501550 3300037466 Bacteria 1154
875 Ga0395905_0277044 3300037471 Bacteria 1563
876 Ga0395901_0025926 3300038443 Bacteria 6019
877 Ga0436365_0377439 3300039437 Bacteria 1630
878 Ga0436365_0407684 3300039437 Bacteria 1140
879 Ga0436365_0457255 3300039437 Bacteria 1037
880 Ga0436365_0640950 3300039437 Bacteria 1154
881 Ga0436365_1901778 3300039437 Bacteria 832
882 Ga0436361_0682070 3300039447 Unclassified 622
883 Ga0436363_0678176 3300039450 Bacteria 644
884 Ga0436363_1612508 3300039450 Bacteria 892
885 Ga0436363_1614456 3300039450 Bacteria 607
886 Ga0436362_0047691 3300039453 Unclassified 953
887 Ga0436362_0495570 3300039453 Bacteria 4908
888 Ga0451804_0077813 3300041463 Unclassified 514
889 Ga0451853_1915692 3300041512 Bacteria 1095
890 Ga0439433_0061906 3300041999 Unclassified 893
891 Ga0439448_0217146 3300042005 Unclassified 672
892 Ga0439462_0190014 3300042015 Bacteria 583
893 Ga0439459_0034449 3300042438 Bacteria 1047
894 Ga0439464_0260829 3300042439 Bacteria 561
895 Ga0453683_0237773 3300044673 Bacteria 1160
896 Ga0466966_0006428 3300044684 Bacteria 7774
897 Ga0466961_0353716 3300044693 Unclassified 894
898 Ga0466963_0763584 3300044694 Bacteria 682
899 Ga0466968_0131366 3300044735 Unclassified 1140
900 Ga0466959_0138828 3300045049 Unclassified 1719
901 Ga0466959_0245932 3300045049 Unclassified 1234
902 Ga0451576_0096283 3300045051 Bacteria 3079
903 Ga0451576_0324089 3300045051 Bacteria 1612
904 Ga0451576_1938275 3300045051 Bacteria 607
905 Ga0466958_0149700 3300045836 Bacteria 1472
906 Ga0466967_0051428 3300045976 Unclassified 3611
907 Ga0466967_0053164 3300045976 Bacteria 3559
908 Ga0466967_1753547 3300045976 Bacteria 618
909 Ga0495603_0148904 3300046455 Bacteria 1360
910 Ga0495603_0259261 3300046455 Bacteria 1001
911 Ga0495651_0095791 3300046462 Unclassified 2219
912 Ga0495653_0446460 3300046463 Unclassified 814
913 Ga0495580_0241862 3300046472 Unclassified 1237
914 Ga0495580_0274356 3300046472 Bacteria 1151
915 Ga0495582_0051938 3300046473 Bacteria 2261
916 Ga0495639_0035601 3300046475 Unclassified 2227
917 Ga0495639_0341240 3300046475 Unclassified 751
918 Ga0495585_0519111 3300046492 Unclassified 565
919 Ga0495594_0003903 3300046499 Bacteria 7674
920 Ga0495630_0406727 3300046517 Unclassified 1043
921 Ga0495642_0237170 3300046528 Unclassified 797
922 Ga0495642_0283222 3300046528 Unclassified 726
923 Ga0495665_0220187 3300046531 Unclassified 981
924 Ga0495586_0414389 3300046535 Unclassified 776
925 Ga0495586_0718783 3300046535 Archaea 577
926 Ga0495645_0791700 3300046543 Unclassified 569
927 Ga0495635_0269359 3300046663 Unclassified 1146
928 Ga0495588_0106648 3300046674 Unclassified 1475
929 Ga0495657_0099611 3300046675 Unclassified 1853
930 Ga0495623_0072686 3300046679 Bacteria 2138
931 Ga0495646_0282306 3300046680 Unclassified 882
932 Ga0495658_0367988 3300046683 Bacteria 914
933 Ga0495669_0081314 3300046684 Bacteria 1487
934 Ga0495669_0449071 3300046684 Unclassified 626
935 Ga0495613_0213966 3300046689 Bacteria 1355
936 Ga0495624_0913584 3300046690 Bacteria 516
937 Ga0495670_0158102 3300046691 Bacteria 1190
938 Ga0495604_0069017 3300047317 Bacteria 2680
939 Ga0495636_0368365 3300047318 Unclassified 680
940 Ga0495636_0455311 3300047318 Bacteria 615
941 Ga0495675_0031867 3300047444 Bacteria 3366
942 Ga0495684_0580651 3300047471 Bacteria 759
943 Ga0495602_0616594 3300048088 Unclassified 744
944 Ga0496100_0028486 3300048903 Bacteria 3446
945 Ga0496101_0070446 3300048904 Bacteria 2561
946 Ga0496102_0048752 3300048905 Bacteria 3851
947 Ga0496102_0828054 3300048905 Bacteria 848
948 Ga0496103_0153546 3300048906 Bacteria 1475
949 Ga0496104_0230390 3300048907 Bacteria 1764
950 Ga0496104_0379434 3300048907 Bacteria 1326
951 Ga0496105_0019048 3300048908 Bacteria 5531
952 Ga0496105_0311419 3300048908 Bacteria 1264
953 Ga0496106_0008590 3300048909 Bacteria 7557
954 Ga0496106_0176096 3300048909 Bacteria 1697
955 Ga0496106_0239834 3300048909 Bacteria 1449
956 Ga0496106_0483409 3300048909 Bacteria 995
957 Ga0496106_0662024 3300048909 Bacteria 834
958 Ga0496106_1186282 3300048909 Bacteria 596
959 Ga0496107_0140925 3300048910 Bacteria 1782
960 Ga0496107_0398852 3300048910 Bacteria 1023
961 Ga0496107_0939054 3300048910 Unclassified 629
962 Ga0496108_0033441 3300048911 Bacteria 4272
963 Ga0496108_0299849 3300048911 Unclassified 1400
964 Ga0496109_0029870 3300048912 Bacteria 4884
965 Ga0496109_0053468 3300048912 Unclassified 3683
966 Ga0496109_0064850 3300048912 Bacteria 3343
967 Ga0496109_1499451 3300048912 Unclassified 609
968 Ga0496109_1603004 3300048912 Unclassified 585
969 Ga0496110_0268084 3300048913 Bacteria 1554
970 Ga0496111_0014025 3300048914 Bacteria 5466
971 Ga0496112_0190729 3300048915 Bacteria 2011
972 Ga0496112_0276708 3300048915 Bacteria 1626
973 Ga0496112_0339114 3300048915 Bacteria 1447
974 Ga0496112_0381989 3300048915 Bacteria 1349
975 Ga0496113_0041989 3300048916 Bacteria 3377
976 Ga0496113_0268583 3300048916 Unclassified 1363
977 Ga0496114_0677657 3300048917 Unclassified 905
978 Ga0501032_0113263 3300049569 Bacteria 1794
979 Ga0501033_0211316 3300049570 Bacteria 1383
980 Ga0501034_0328126 3300049571 Bacteria 1462
981 Ga0501034_0352675 3300049571 Bacteria 1399
982 Ga0501036_0606533 3300049572 Bacteria 908
983 Ga0501037_0046794 3300049573 Bacteria 3172
984 Ga0501038_0081827 3300049574 Bacteria 2720
985 Ga0501040_0032134 3300049576 Bacteria 3551
986 Ga0501040_0120637 3300049576 Bacteria 1839
987 Ga0501040_0484720 3300049576 Unclassified 891
988 Ga0501041_0863071 3300049577 Unclassified 581
989 Ga0501043_0254745 3300049579 Bacteria 1351
990 Ga0501046_0310997 3300049580 Unclassified 1149
991 Ga0501046_1016568 3300049580 Unclassified 575
992 Ga0501047_0000979 3300049581 Bacteria 28768
993 Ga0501047_0247130 3300049581 Bacteria 1633
994 Ga0501067_0023038 3300049583 Bacteria 3449
995 Ga0501068_0072868 3300049584 Unclassified 2098
996 Ga0501069_0064247 3300049585 Bacteria 2051
997 Ga0501069_0164608 3300049585 Bacteria 1278
998 Ga0501069_0518313 3300049585 Bacteria 712
999 Ga0501070_1315712 3300049586 Unclassified 551
1000 Ga0501071_0122283 3300049587 Unclassified 1930
1001 Ga0501071_0193741 3300049587 Unclassified 1525
1002 Ga0501071_0739627 3300049587 Bacteria 758
1003 Ga0501071_1104195 3300049587 Unclassified 613
1004 Ga0501072_0082776 3300049588 Unclassified 2544
1005 Ga0501072_0198809 3300049588 Unclassified 1598
1006 Ga0501072_0388201 3300049588 Bacteria 1108
1007 Ga0501072_0405816 3300049588 Bacteria 1081
1008 Ga0501072_0633988 3300049588 Bacteria 842
1009 Ga0501074_0435276 3300049590 Archaea 930
1010 Ga0501075_0021755 3300049591 Bacteria 4678
1011 Ga0501075_0261350 3300049591 Bacteria 1320
1012 Ga0501075_0315612 3300049591 Bacteria 1191
1013 Ga0501075_0957784 3300049591 Archaea 650
1014 Ga0501076_0019506 3300049592 Bacteria 5184
1015 Ga0501076_0021161 3300049592 Bacteria 4986
1016 Ga0501076_0921892 3300049592 Unclassified 720
1017 Ga0501077_0026472 3300049593 Bacteria 3681
1018 Ga0501199_066168 3300049650 Unclassified 512
1019 Ga0501216_039772 3300049660 Unclassified 896
1020 Ga0501217_050861 3300049661 Unclassified 1083
1021 Ga0501227_070079 3300049665 Unclassified 909
1022 Ga0501259_101386 3300049688 Unclassified 661
1023 Ga0501225_0276707 3300049705 Archaea 561
1024 Ga0501079_0119386 3300049741 Unclassified 2050
1025 Ga0501079_0169622 3300049741 Bacteria 1702
1026 Ga0501079_0815631 3300049741 Bacteria 735
1027 Ga0501080_0121210 3300049742 Bacteria 2423
1028 Ga0501080_0143109 3300049742 Bacteria 2211
1029 Ga0501081_0271178 3300049743 Bacteria 1241
1030 Ga0501083_0103351 3300049744 Bacteria 1878
1031 Ga0501268_080393 3300049765 Bacteria 672
1032 Ga0501035_0004340 3300049822 Bacteria 13456
1033 Ga0501044_0002943 3300049823 Bacteria 19370
1034 Ga0501045_0006609 3300049824 Bacteria 8035
1035 Ga0501045_0044272 3300049824 Bacteria 3242
1036 Ga0501045_0684710 3300049824 Bacteria 757
1037 nmdc:mga0yw44_216611_c1 3300050492 Bacteria 1268
1038 nmdc:mga05p37_1273889_c1 3300050507 Unclassified 752
1039 nmdc:mga05p37_22632_c1 3300050507 Bacteria 7620
1040 nmdc:mga05p37_253245_c1 3300050507 Bacteria 2111
1041 nmdc:mga05p37_39672_c1 3300050507 Bacteria 5782
1042 nmdc:mga05p37_491275_c1 3300050507 Bacteria 1411
1043 nmdc:mga05p37_666526_c1 3300050507 Bacteria 1162
1044 nmdc:mga05p37_716832_c1 3300050507 Bacteria 1108
1045 nmdc:mga05p37_89760_c1 3300050507 Bacteria 3787
1046 nmdc:mga09592_195714_c1 3300050508 Bacteria 1750
1047 nmdc:mga09592_2664_c1 3300050508 Bacteria 14437
1048 nmdc:mga09592_277949_c1 3300050508 Bacteria 1452
1049 nmdc:mga09592_40263_c1 3300050508 Bacteria 3925
1050 nmdc:mga0qj67_15386_c1 3300050509 Bacteria 5792
1051 nmdc:mga0qj67_37542_c1 3300050509 Bacteria 3796
1052 nmdc:mga0qj67_545440_c1 3300050509 Bacteria 930
1053 nmdc:mga0qj67_995_c1 3300050509 Bacteria 19545
1054 nmdc:mga06r32_1867410_c1 3300050510 Bacteria 536
1055 nmdc:mga06r32_224086_c1 3300050510 Bacteria 1869
1056 nmdc:mga06r32_2309_c1 3300050510 Bacteria 17069
1057 nmdc:mga06r32_35779_c1 3300050510 Bacteria 4686
1058 nmdc:mga06r32_484149_c1 3300050510 Unclassified 1215
1059 nmdc:mga06r32_51372_c1 3300050510 Bacteria 3945
1060 nmdc:mga06r32_593383_c1 3300050510 Bacteria 1079
1061 nmdc:mga08y16_1540852_c1 3300050511 Bacteria 624
1062 nmdc:mga08y16_1972981_c1 3300050511 Bacteria 533
1063 nmdc:mga08y16_22767_c1 3300050511 Bacteria 6614
1064 nmdc:mga08y16_679165_c1 3300050511 Bacteria 1031
1065 nmdc:mga08y16_743619_c1 3300050511 Bacteria 977
1066 nmdc:mga0n895_106107_c1 3300050512 Bacteria 2822
1067 nmdc:mga0n895_1079505_c1 3300050512 Bacteria 781
1068 nmdc:mga0n895_1163127_c1 3300050512 Bacteria 747
1069 nmdc:mga0n895_1232050_c1 3300050512 Bacteria 721
1070 nmdc:mga0n895_129_c1 3300050512 Bacteria 44904
1071 nmdc:mga0n895_130368_c1 3300050512 Bacteria 2539
1072 nmdc:mga0n895_204376_c1 3300050512 Bacteria 2006
1073 nmdc:mga0n895_218348_c1 3300050512 Bacteria 1936
1074 nmdc:mga0n895_320380_c2 3300050512 Bacteria 997
1075 nmdc:mga0n895_458958_c1 3300050512 Bacteria 1286
1076 nmdc:mga0n895_4920_c1 3300050512 Bacteria 11077
1077 nmdc:mga0n895_53532_c1 3300050512 Bacteria 3966
1078 nmdc:mga0n895_79202_c1 3300050512 Bacteria 3272
1079 nmdc:mga0rr50_125372_c1 3300050513 Bacteria 2050
1080 nmdc:mga0rr50_13917_c1 3300050513 Bacteria 5256
1081 nmdc:mga0rr50_155_c1 3300050513 Bacteria 37210
1082 nmdc:mga0rr50_1891035_c1 3300050513 Unclassified 502
1083 nmdc:mga0rr50_346524_c1 3300050513 Bacteria 1249
1084 nmdc:mga0rr50_49369_c1 3300050513 Bacteria 3115
1085 nmdc:mga0rr50_801452_c1 3300050513 Bacteria 804
1086 nmdc:mga08x19_1230161_c1 3300050514 Bacteria 531
1087 nmdc:mga08x19_14843_c1 3300050514 Bacteria 4730
1088 nmdc:mga08x19_182375_c1 3300050514 Bacteria 1433
1089 nmdc:mga08x19_3644_c1 3300050514 Bacteria 9167
1090 nmdc:mga08x19_42637_c1 3300050514 Bacteria 2894
1091 nmdc:mga0a205_112269_c1 3300050515 Bacteria 2625
1092 nmdc:mga0a205_123436_c1 3300050515 Bacteria 2489
1093 nmdc:mga0a205_2838_c1 3300050515 Bacteria 15323
1094 nmdc:mga0a205_296616_c1 3300050515 Bacteria 1490
1095 nmdc:mga0a205_3385_c1 3300050515 Bacteria 14215
1096 nmdc:mga0a205_44168_c1 3300050515 Bacteria 4295
1097 Ga0500628_174500 3300053129 Bacteria 611
1098 Ga0501084_0253369 3300054114 Bacteria 1486
1099 Ga0501084_0409829 3300054114 Unclassified 1145
1100 Ga0501084_1797871 3300054114 Unclassified 512
1101 Ga0590071_033599 3300059421 Bacteria 1226
1102 Ga0590071_158989 3300059421 Archaea 588
1103 Ga0590075_072288 3300059424 Bacteria 892
1104 Ga0590075_218473 3300059424 Unclassified 505
1105 Ga0590077_036050 3300059426 Unclassified 1090
1106 Ga0587066_031592 3300059490 Bacteria 947
1107 Ga0587077_031191 3300059493 Bacteria 1016
1108 Ga0587077_050222 3300059493 Unclassified 870
1109 Ga0587080_010219 3300059503 Bacteria 1380
1110 Ga0587082_038097 3300059504 Bacteria 870
1111 Ga0587083_0075366 3300059505 Bacteria 792
1112 Ga0587086_029037 3300059507 Bacteria 803
1113 Ga0587088_054997 3300059508 Bacteria 791
1114 Ga0587090_021374 3300059510 Bacteria 1015
1115 Ga0587092_023781 3300059512 Bacteria 968
1116 Ga0587094_021924 3300059513 Bacteria 934
1117 Ga0587106_038924 3300059605 Bacteria 799
1118 Ga0587099_058534 3300059622 Bacteria 527
1119 Ga0587101_019847 3300059623 Bacteria 956
1120 Ga0587109_043788 3300059624 Bacteria 896
1121 Ga0587115_030278 3300059626 Bacteria 801
1122 Ga0587062_126179 3300059639 Bacteria 522
1123 Ga0587067_010700 3300059640 Bacteria 1397
1124 Ga0587069_026614 3300059642 Bacteria 907
1125 Ga0587072_056000 3300059643 Bacteria 802
1126 Ga0587075_105819 3300059644 Bacteria 567
1127 Ga0587076_049422 3300059645 Bacteria 815
1128 Ga0587078_011385 3300059646 Bacteria 1032
1129 Ga0587079_059078 3300059647 Bacteria 826
1130 Ga0587107_028879 3300059652 Bacteria 831
1131 Ga0587071_025597 3300060344 Bacteria 1108
1132 Ga0587111_0037261 3300060346 Bacteria 1022
1133 Ga0501082_0474716 3300060353 Unclassified 1093
1134 Ga0501082_0567013 3300060353 Bacteria 993
1135 Ga0501082_0633379 3300060353 Bacteria 936
1136 Ga0530510_0463737 3300061734 Bacteria 959
1137 Ga0530510_0617024 3300061734 Unclassified 825
1138 Ga0530510_1463336 3300061734 Unclassified 524
1139 Ga0065707_10004449
1140 JGI24746J21847_1034837
1141 JGI24035J26624_1006140
1142 rootH1_10324608
1143 Ga0058859_11593842
1144 Ga0058863_11689012
1145 Ga0058860_11839132
1146 Ga0058862_10060099
1147 Ga0058862_12082364
1148 Ga0058862_12420475
1149 Ga0058862_12676476
1150 Ga0058862_12814663
1151 Ga0065704_10117224
1152 Ga0065712_10075230
1153 Ga0065712_10149640
1154 Ga0065715_10003606
1155 Ga0065715_10009259
1156 Ga0065715_10090438
1157 Ga0065715_10092286
1158 Ga0065715_10100776
1159 Ga0065715_10152984
1160 Ga0065707_10087959
1161 Ga0065707_10288800
1162 Ga0065707_10403955
1163 Ga0065707_10769020
1164 Ga0070658_10020778
1165 Ga0070658_10095950
1166 Ga0070658_11709053
1167 Ga0070676_10005316
1168 Ga0070676_10022925
1169 Ga0070676_10041125
1170 Ga0070676_10055387
1171 Ga0070683_100001001
1172 Ga0070683_100055461
1173 Ga0070683_100074784
1174 Ga0070683_100130233
1175 Ga0070683_100291151
1176 Ga0070683_100435970
1177 Ga0070683_100486288
1178 Ga0070690_100026193
1179 Ga0070690_100043048
1180 Ga0070690_101034669
1181 Ga0070670_100077944
1182 Ga0070670_100238355
1183 Ga0070670_101396870
1184 Ga0070677_10569900
1185 Ga0068869_100006865
1186 Ga0068869_100013758
1187 Ga0068869_100047272
1188 Ga0068869_100265051
1189 Ga0068869_101834937
1190 Ga0070666_10635465
1191 Ga0070680_100016360
1192 Ga0070680_100026194
1193 Ga0070680_100040721
1194 Ga0070680_100042537
1195 Ga0070680_100158744
1196 Ga0070680_101257069
1197 Ga0070682_100004745
1198 Ga0070682_100008856
1199 Ga0070682_100031801
1200 Ga0070682_100052286
1201 Ga0070682_100125581
1202 Ga0070682_100189250
1203 Ga0070682_100508205
1204 Ga0068868_100005912
1205 Ga0068868_100352704
1206 Ga0068868_100428035
1207 Ga0070660_100033047
1208 Ga0070660_100054390
1209 Ga0070660_100074516
1210 Ga0070660_100085221
1211 Ga0070689_100016781
1212 Ga0070689_100120118
1213 Ga0070689_100357944
1214 Ga0070689_100507415
1215 Ga0070689_100615612
1216 Ga0070689_100750804
1217 Ga0070691_10033238
1218 Ga0070687_100000368
1219 Ga0070687_100487867
1220 Ga0070687_100819376
1221 Ga0070661_100009042
1222 Ga0070661_100073923
1223 Ga0070661_100095847
1224 Ga0070661_100411509
1225 Ga0070692_10020916
1226 Ga0070692_10176216
1227 Ga0070692_10285856
1228 Ga0070692_10979264
1229 Ga0070692_11286079
1230 Ga0070668_100001645
1231 Ga0070668_100011398
1232 Ga0070668_101501937
1233 Ga0070669_100009292
1234 Ga0070669_100071703
1235 Ga0070669_100395305
1236 Ga0070669_100902245
1237 Ga0070669_100958120
1238 Ga0070675_100003756
1239 Ga0070675_100381958
1240 Ga0070675_100517735
1241 Ga0070675_100972539
1242 Ga0070671_100084256
1243 Ga0070674_100142835
1244 Ga0070674_100376575
1245 Ga0070673_100082459
1246 Ga0070673_100082872
1247 Ga0070673_100308904
1248 Ga0070673_100360076
1249 Ga0070688_100064886
1250 Ga0070659_100013494
1251 Ga0070659_100020144
1252 Ga0070659_100070434
1253 Ga0070659_100102371
1254 Ga0070659_100275974
1255 Ga0070659_101802173
1256 Ga0070659_102073801
1257 Ga0070667_100049715
1258 Ga0070703_10036935
1259 Ga0070703_10222637
1260 Ga0070709_10362878
1261 Ga0070709_11355024
1262 Ga0070714_100177772
1263 Ga0070714_100252446
1264 Ga0070714_100259794
1265 Ga0070714_100361724
1266 Ga0070714_100715159
1267 Ga0070714_102110000
1268 Ga0070713_101078521
1269 Ga0070713_101699727
1270 Ga0070713_101746841
1271 Ga0070713_102090546
1272 Ga0070710_10009789
1273 Ga0070710_10330725
1274 Ga0070701_10001564
1275 Ga0070701_10019843
1276 Ga0070701_10170452
1277 Ga0070711_100181108
1278 Ga0070711_100302652
1279 Ga0070705_100133315
1280 Ga0070705_100855131
1281 Ga0070700_100012352
1282 Ga0070700_100124570
1283 Ga0070700_100229910
1284 Ga0070694_100236501
1285 Ga0070694_100249310
1286 Ga0070694_100345354
1287 Ga0070694_100400654
1288 Ga0070694_100752172
1289 Ga0070708_100000992
1290 Ga0070708_100018085
1291 Ga0070663_100446572
1292 Ga0070663_100625637
1293 Ga0070663_101383594
1294 Ga0070678_100267209
1295 Ga0070678_100269029
1296 Ga0070678_100412998
1297 Ga0070662_100003845
1298 Ga0070662_100105365
1299 Ga0070662_100510040
1300 Ga0070662_101229940
1301 Ga0070662_101527196
1302 Ga0070662_101819087
1303 Ga0070681_10001020
1304 Ga0070681_10006836
1305 Ga0070681_10020849
1306 Ga0070681_10027196
1307 Ga0070681_10028740
1308 Ga0070681_10037930
1309 Ga0070681_10081881
1310 Ga0070681_10087357
1311 Ga0070681_10152444
1312 Ga0070681_10232036
1313 Ga0070681_10416740
1314 Ga0070681_10454018
1315 Ga0070681_10496673
1316 Ga0070681_10526099
1317 Ga0068867_101399553
1318 Ga0070685_10005393
1319 Ga0070685_10648156
1320 Ga0070706_100143271
1321 Ga0070706_100491522
1322 Ga0070706_100581912
1323 Ga0070706_100971807
1324 Ga0070707_100029559
1325 Ga0070707_100285110
1326 Ga0070698_100017160
1327 Ga0070698_100203509
1328 Ga0070699_100022156
1329 Ga0070699_100032942
1330 Ga0070699_100135710
1331 Ga0070699_100288229
1332 Ga0070699_100766608
1333 Ga0070699_101377123
1334 Ga0070699_101519162
1335 Ga0070679_100001683
1336 Ga0070679_100010992
1337 Ga0070679_100016972
1338 Ga0070679_100040939
1339 Ga0070679_100048345
1340 Ga0070679_100080460
1341 Ga0070679_100179586
1342 Ga0070679_100219704
1343 Ga0070679_100345963
1344 Ga0070679_100878770
1345 Ga0070684_100000670
1346 Ga0070684_100056959
1347 Ga0070684_100092117
1348 Ga0070684_100093280
1349 Ga0070684_100168095
1350 Ga0070684_100178914
1351 Ga0070684_100199202
1352 Ga0070684_100422106
1353 Ga0070684_100453578
1354 Ga0070684_101035866
1355 Ga0070684_101454749
1356 Ga0070697_100382001
1357 Ga0070697_100812412
1358 Ga0070697_101651987
1359 Ga0068853_100023802
1360 Ga0068853_100046090
1361 Ga0068853_100086084
1362 Ga0068853_100279222
1363 Ga0068853_100600554
1364 Ga0068853_100683026
1365 Ga0068853_100995763
1366 Ga0068853_101306846
1367 Ga0070672_100032073
1368 Ga0070672_100172161
1369 Ga0070672_100351947
1370 Ga0070672_100362977
1371 Ga0070672_102143901
1372 Ga0070686_100099848
1373 Ga0070686_100857988
1374 Ga0070695_100013101
1375 Ga0070695_100050117
1376 Ga0070695_100161310
1377 Ga0070695_100597798
1378 Ga0070696_100001595
1379 Ga0070696_100348608
1380 Ga0070693_100001331
1381 Ga0070693_100014601
1382 Ga0070693_100047738
1383 Ga0070693_100064983
1384 Ga0070693_100137136
1385 Ga0070693_100256230
1386 Ga0070693_100324283
1387 Ga0070693_100332699
1388 Ga0070665_100060357
1389 Ga0070665_100197111
1390 Ga0070665_101234703
1391 Ga0070665_101279960
1392 Ga0070704_100020545
1393 Ga0070704_100169632
1394 Ga0070704_100955979
1395 Ga0070704_101131960
1396 Ga0070704_101677618
1397 Ga0070704_102226325
1398 Ga0068855_100002422
1399 Ga0068855_100023709
1400 Ga0068855_100037003
1401 Ga0068855_100364891
1402 Ga0070664_100003338
1403 Ga0070664_100006874
1404 Ga0070664_100031086
1405 Ga0070664_100037737
1406 Ga0070664_102100087
1407 Ga0068857_100013533
1408 Ga0068857_100166100
1409 Ga0068857_100297708
1410 Ga0068857_100978408
1411 Ga0068857_100987339
1412 Ga0068857_101885231
1413 Ga0068854_100022899
1414 Ga0068854_100158460
1415 Ga0068854_100191813
1416 Ga0068854_100355238
1417 Ga0068854_100761640
1418 Ga0068854_100895652
1419 Ga0068856_100022626
1420 Ga0068856_100195497
1421 Ga0068856_100279059
1422 Ga0068856_100294262
1423 Ga0068856_100347815
1424 Ga0068856_101434385
1425 Ga0068856_102084388
1426 Ga0070702_100200979
1427 Ga0070702_100547309
1428 Ga0068852_100004098
1429 Ga0068852_100073510
1430 Ga0068852_100123248
1431 Ga0068852_101035734
1432 Ga0068852_101551777
1433 Ga0068859_100018990
1434 Ga0068859_100053826
1435 Ga0068859_100545487
1436 Ga0068859_100924274
1437 Ga0068859_101579178
1438 Ga0068859_101680497
1439 Ga0068864_100141246
1440 Ga0068864_101131147
1441 Ga0068864_101332213
1442 Ga0068864_102703088
1443 Ga0068866_10020746
1444 Ga0068861_100070300
1445 Ga0068861_100073535
1446 Ga0068861_100169775
1447 Ga0068861_100685236
1448 Ga0068851_10002180
1449 Ga0068851_10024376
1450 Ga0068870_10013226
1451 Ga0068870_10399187
1452 Ga0068863_100004362
1453 Ga0068863_100076810
1454 Ga0068863_100347608
1455 Ga0068863_100700669
1456 Ga0068858_100008492
1457 Ga0068858_100050919
1458 Ga0068860_100017422
1459 Ga0068860_102006373
1460 Ga0068862_100011187
1461 Ga0068862_100030225
1462 Ga0068862_100788174
1463 Ga0081539_10000174
1464 Ga0081539_10175457
1465 Ga0070717_10043417
1466 Ga0070717_10487628
1467 Ga0075365_10032017
1468 Ga0070715_10410543
1469 Ga0070715_10464583
1470 Ga0070716_100057749
1471 Ga0070716_100168471
1472 Ga0070716_100286959
1473 Ga0070716_100670384
1474 Ga0070712_100063964
1475 Ga0070712_101073466
1476 Ga0075427_10034123
1477 Ga0097621_100000672
1478 Ga0097621_100018046
1479 Ga0097621_100146095
1480 Ga0097621_100205657
1481 Ga0097621_100501893
1482 Ga0068871_100000199
1483 Ga0068871_100015194
1484 Ga0068871_100168173
1485 Ga0068871_100335062
1486 Ga0068871_101839880
1487 Ga0075428_100001460
1488 Ga0075428_100148298
1489 Ga0075428_100160791
1490 Ga0075428_100168139
1491 Ga0075428_100337741
1492 Ga0075430_100001395
1493 Ga0075430_100007336
1494 Ga0075430_100064069
1495 Ga0075430_100627131
1496 Ga0075431_100011297
1497 Ga0075431_100034309
1498 Ga0075431_100085550
1499 Ga0075431_100139642
1500 Ga0075431_101761438
1501 Ga0075431_101953955
1502 Ga0075433_10000761
1503 Ga0075433_10008053
1504 Ga0075433_10038053
1505 Ga0075433_10058254
1506 Ga0075433_11975040
1507 Ga0075434_100000063
1508 Ga0075434_100013527
1509 Ga0075434_100039055
1510 Ga0075434_100059352
1511 Ga0075434_100224047
1512 Ga0075434_100245179
1513 Ga0075434_100258853
1514 Ga0075434_100309868
1515 Ga0075434_100585845
1516 Ga0075434_101208134
1517 Ga0075434_101522905
1518 Ga0075429_100007349
1519 Ga0075429_100218433
1520 Ga0075429_100232259
1521 Ga0075429_100395580
1522 Ga0075429_100884400
1523 Ga0068865_100007807
1524 Ga0068865_100136264
1525 Ga0068865_100312764
1526 Ga0068865_102146816
1527 Ga0075436_100011890
1528 Ga0075436_100082780
1529 Ga0075436_100308098
1530 Ga0075436_101479007
1531 Ga0097620_100018990
1532 Ga0097620_100053825
1533 Ga0097620_100545593
1534 Ga0097620_100924292
1535 Ga0097620_101579163
1536 Ga0097620_101680518
1537 Ga0075435_100003203
1538 Ga0075435_100015966
1539 Ga0075435_100102819
1540 Ga0075435_100138982
1541 Ga0075435_100359442
1542 Ga0075435_100614680
1543 Ga0075435_100710024
1544 Ga0075435_101941705
1545 Ga0099794_10121669
1546 Ga0099794_10192774
1547 Ga0099794_10332955
1548 Ga0099794_10560497
1549 Ga0105240_10038477
1550 Ga0105240_10044099
1551 Ga0105240_10093062
1552 Ga0105240_10169288
1553 Ga0105240_10194956
1554 Ga0105240_10250041
1555 Ga0105240_10408175
1556 Ga0111539_10023324
1557 Ga0111539_10330925
1558 Ga0111539_10957283
1559 Ga0111539_11126948
1560 Ga0111539_11419754
1561 Ga0111539_11779063
1562 Ga0105245_10042291
1563 Ga0105245_10482079
1564 Ga0105245_11018195
1565 Ga0105245_11823006
1566 Ga0105247_10364739
1567 Ga0114129_10013088
1568 Ga0114129_10016474
1569 Ga0114129_10255779
1570 Ga0114129_10578572
1571 Ga0114129_10864832
1572 Ga0114129_11407280
1573 Ga0114129_12619227
1574 Ga0105241_10074874
1575 Ga0105241_10620087
1576 Ga0105241_12014430
1577 Ga0105242_10062689
1578 Ga0105242_11298561
1579 Ga0105242_13289845
1580 Ga0105248_10032604
1581 Ga0105248_10074841
1582 Ga0105248_10311421
1583 Ga0105248_10498537
1584 Ga0105248_10614282
1585 Ga0105237_10019127
1586 Ga0105237_10467570
1587 Ga0105237_10659648
1588 Ga0105237_11164876
1589 Ga0105238_10008500
1590 Ga0105238_10009654
1591 Ga0105238_10043056
1592 Ga0105249_10001072
1593 Ga0105249_10005273
1594 Ga0105249_10008847
1595 Ga0105249_10238037
1596 Ga0105249_10529400
1597 Ga0099796_10152604
1598 Ga0105239_10004401
1599 Ga0105239_10018805
1600 Ga0105239_10350498
1601 Ga0105239_13023558
1602 Ga0105239_13217647
1603 Ga0105246_10364642
1604 Ga0105246_10548139
1605 Ga0157317_1020129
1606 Ga0157313_1004160
1607 Ga0157373_10067261
1608 Ga0157373_10242987
1609 Ga0157373_10279528
1610 Ga0157371_10012161
1611 Ga0157371_10049859
1612 Ga0157371_10271982
1613 Ga0157371_10440100
1614 Ga0157370_10023999
1615 Ga0157370_10525185
1616 Ga0157370_11159112
1617 Ga0157370_12074910
1618 Ga0157369_10025059
1619 Ga0157369_10038214
1620 Ga0157369_10045712
1621 Ga0157369_10117485
1622 Ga0157369_10288710
1623 Ga0157369_12301865
1624 Ga0157374_10024671
1625 Ga0157374_10076870
1626 Ga0157374_10112106
1627 Ga0157378_10010809
1628 Ga0157378_10505797
1629 Ga0157378_12994579
1630 Ga0163162_10015582
1631 Ga0163162_10016923
1632 Ga0163162_10423188
1633 Ga0163162_10622852
1634 Ga0157372_10001413
1635 Ga0157372_10013669
1636 Ga0157372_10020331
1637 Ga0157372_10073677
1638 Ga0157372_10085246
1639 Ga0157372_10222101
1640 Ga0157372_10358624
1641 Ga0157372_10896520
1642 Ga0157372_12017461
1643 Ga0157372_12795212
1644 Ga0157375_10040044
1645 Ga0157375_10066129
1646 Ga0157375_10146904
1647 Ga0157375_10705364
1648 Ga0157375_10730143
1649 Ga0157375_13555019
1650 Ga0163163_10130752
1651 Ga0163163_10801155
1652 Ga0163163_10904052
1653 Ga0163163_11197560
1654 Ga0163163_11484380
1655 Ga0163163_12649033
1656 Ga0157380_10067582
1657 Ga0157380_10080058
1658 Ga0157380_10784163
1659 Ga0157380_11255725
1660 Ga0182008_10005300
1661 Ga0182008_10036968
1662 Ga0157377_10000701
1663 Ga0157377_10357216
1664 Ga0157379_10042159
1665 Ga0157376_10337542
1666 Ga0157376_11030550
1667 Ga0157376_11568764
1668 Ga0157376_12040057
1669 Ga0157376_12412937
1670 Ga0157376_12567983
1671 Ga0182006_1038915
1672 Ga0182007_10004976
1673 Ga0182007_10095243
1674 Ga0163161_10038775
1675 Ga0206356_11439665
1676 Ga0206356_11691036
1677 Ga0213873_10019893
1678 Ga0213876_10331192
1679 Ga0224712_10374815
1680 Ga0207673_1052659
1681 Ga0207697_10004407
1682 Ga0207697_10016356
1683 Ga0207656_10004964
1684 Ga0207656_10022029
1685 Ga0207653_10026783
1686 Ga0207682_10005888
1687 Ga0207682_10058810
1688 Ga0207682_10426728
1689 Ga0207692_10052520
1690 Ga0207692_10243399
1691 Ga0207642_10091701
1692 Ga0207710_10219062
1693 Ga0207688_10013310
1694 Ga0207688_10111816
1695 Ga0207688_10558706
1696 Ga0207647_10043905
1697 Ga0207685_10823780
1698 Ga0207699_10014666
1699 Ga0207699_10029591
1700 Ga0207699_10503002
1701 Ga0207645_10003398
1702 Ga0207645_10011314
1703 Ga0207645_10048478
1704 Ga0207643_10008827
1705 Ga0207643_10399373
1706 Ga0207705_10169488
1707 Ga0207705_10409977
1708 Ga0207684_10014240
1709 Ga0207684_10070132
1710 Ga0207684_10490603
1711 Ga0207654_10065768
1712 Ga0207654_11363879
1713 Ga0207707_10001403
1714 Ga0207707_10004017
1715 Ga0207707_10008110
1716 Ga0207707_10009793
1717 Ga0207707_10013883
1718 Ga0207707_10043159
1719 Ga0207707_10064410
1720 Ga0207707_10083176
1721 Ga0207707_10222277
1722 Ga0207707_10298054
1723 Ga0207707_10300153
1724 Ga0207707_10558024
1725 Ga0207707_10891414
1726 Ga0207695_10006370
1727 Ga0207695_10091977
1728 Ga0207695_10107984
1729 Ga0207695_10121200
1730 Ga0207695_10223178
1731 Ga0207671_10044113
1732 Ga0207671_10092878
1733 Ga0207671_10522934
1734 Ga0207671_11240056
1735 Ga0207671_11460972
1736 Ga0207693_10857158
1737 Ga0207663_10251947
1738 Ga0207663_10717192
1739 Ga0207660_10004449
1740 Ga0207660_10012020
1741 Ga0207660_10044500
1742 Ga0207660_10087591
1743 Ga0207660_10177597
1744 Ga0207660_10186450
1745 Ga0207660_10963204
1746 Ga0207662_10002435
1747 Ga0207662_10041968
1748 Ga0207662_10816928
1749 Ga0207662_10961207
1750 Ga0207662_11069990
1751 Ga0207657_10001956
1752 Ga0207657_10011536
1753 Ga0207657_10024337
1754 Ga0207657_10198706
1755 Ga0207657_10686756
1756 Ga0207649_10021789
1757 Ga0207649_10028642
1758 Ga0207649_10032394
1759 Ga0207649_10216756
1760 Ga0207652_10005957
1761 Ga0207652_10007070
1762 Ga0207652_10032484
1763 Ga0207652_10061851
1764 Ga0207652_10131203
1765 Ga0207652_10138078
1766 Ga0207652_10153637
1767 Ga0207652_10198007
1768 Ga0207652_10454145
1769 Ga0207652_10740145
1770 Ga0207652_10784823
1771 Ga0207646_10065705
1772 Ga0207646_10175134
1773 Ga0207646_10471940
1774 Ga0207646_10840054
1775 Ga0207646_10995945
1776 Ga0207646_11804982
1777 Ga0207681_10041546
1778 Ga0207681_10051813
1779 Ga0207681_10412423
1780 Ga0207681_11305030
1781 Ga0207694_10074644
1782 Ga0207694_10296931
1783 Ga0207694_10345844
1784 Ga0207650_10121510
1785 Ga0207650_10856752
1786 Ga0207650_11468075
1787 Ga0207650_11599237
1788 Ga0207659_10023471
1789 Ga0207659_10122098
1790 Ga0207659_11294792
1791 Ga0207687_10071472
1792 Ga0207687_10281225
1793 Ga0207700_10016602
1794 Ga0207700_10629751
1795 Ga0207700_11006970
1796 Ga0207700_11350214
1797 Ga0207700_11700968
1798 Ga0207664_10025220
1799 Ga0207664_10159679
1800 Ga0207664_10253311
1801 Ga0207664_10587393
1802 Ga0207664_10674991
1803 Ga0207644_10081083
1804 Ga0207644_10098590
1805 Ga0207644_10652861
1806 Ga0207644_10890288
1807 Ga0207644_11685449
1808 Ga0207690_10005865
1809 Ga0207690_10045406
1810 Ga0207690_10082265
1811 Ga0207690_10091184
1812 Ga0207690_10232919
1813 Ga0207690_10956964
1814 Ga0207706_10001234
1815 Ga0207706_10041286
1816 Ga0207706_10074133
1817 Ga0207706_10344050
1818 Ga0207706_10432329
1819 Ga0207706_10580180
1820 Ga0207706_10660352
1821 Ga0207706_11294328
1822 Ga0207686_10375141
1823 Ga0207670_10028957
1824 Ga0207670_10416574
1825 Ga0207670_10605558
1826 Ga0207669_10210000
1827 Ga0207669_10420706
1828 Ga0207704_10250527
1829 Ga0207704_10265805
1830 Ga0207665_10004800
1831 Ga0207665_10147209
1832 Ga0207665_10222964
1833 Ga0207665_10506943
1834 Ga0207665_11401934
1835 Ga0207691_10002084
1836 Ga0207691_10002362
1837 Ga0207691_10040033
1838 Ga0207691_10323363
1839 Ga0207711_10124431
1840 Ga0207711_10928490
1841 Ga0207689_10008560
1842 Ga0207689_10011347
1843 Ga0207689_10067141
1844 Ga0207689_10282539
1845 Ga0207661_10003424
1846 Ga0207661_10015101
1847 Ga0207661_10154824
1848 Ga0207661_10163820
1849 Ga0207661_10184645
1850 Ga0207661_10257237
1851 Ga0207661_10266976
1852 Ga0207661_10303926
1853 Ga0207661_10508958
1854 Ga0207679_10006782
1855 Ga0207679_10011838
1856 Ga0207679_10216758
1857 Ga0207679_10313510
1858 Ga0207679_10844355
1859 Ga0207679_11137489
1860 Ga0207679_11926695
1861 Ga0207667_10037065
1862 Ga0207667_10079106
1863 Ga0207667_10112569
1864 Ga0207667_10211207
1865 Ga0207651_10735450
1866 Ga0207651_11253997
1867 Ga0207651_11456953
1868 Ga0207712_10002781
1869 Ga0207712_10004441
1870 Ga0207712_10222552
1871 Ga0207668_10008817
1872 Ga0207668_10354205
1873 Ga0207668_11084489
1874 Ga0207640_10026013
1875 Ga0207640_10081626
1876 Ga0207640_10168061
1877 Ga0207640_10169561
1878 Ga0207640_10369609
1879 Ga0207640_10440375
1880 Ga0207640_11205539
1881 Ga0207658_10081317
1882 Ga0207677_10060362
1883 Ga0207677_10117250
1884 Ga0207677_10691559
1885 Ga0207677_11183576
1886 Ga0207703_10023328
1887 Ga0207703_10086971
1888 Ga0207703_10928983
1889 Ga0207639_10044759
1890 Ga0207639_10077624
1891 Ga0207639_10081177
1892 Ga0207639_10106710
1893 Ga0207639_10493101
1894 Ga0207639_11406372
1895 Ga0207678_10089128
1896 Ga0207678_10108073
1897 Ga0207678_10299400
1898 Ga0207678_11088519
1899 Ga0207678_11276649
1900 Ga0207708_10012277
1901 Ga0207708_10154609
1902 Ga0207702_10006267
1903 Ga0207702_10132534
1904 Ga0207702_10144212
1905 Ga0207702_10278638
1906 Ga0207702_10587193
1907 Ga0207702_11259226
1908 Ga0207702_11421411
1909 Ga0207641_10117324
1910 Ga0207641_10853692
1911 Ga0207641_10901825
1912 Ga0207641_11341203
1913 Ga0207648_10051406
1914 Ga0207648_10446224
1915 Ga0207676_10389198
1916 Ga0207676_10619714
1917 Ga0207674_10005589
1918 Ga0207674_10020917
1919 Ga0207674_10031246
1920 Ga0207674_10416926
1921 Ga0207674_10603017
1922 Ga0207674_11110774
1923 Ga0207675_100000194
1924 Ga0207675_100011701
1925 Ga0207675_100032337
1926 Ga0207675_100391415
1927 Ga0207683_10243751
1928 Ga0207683_10260582
1929 Ga0207683_10469974
1930 Ga0207698_10021480
1931 Ga0207698_10122838
1932 Ga0207698_10283573
1933 Ga0207698_10328431
1934 Ga0207698_10979604
1935 Ga0207698_11481105
1936 Ga0210000_1002326
1937 Ga0209968_1004746
1938 Ga0209999_1010313
1939 Ga0209588_1101790
1940 Ga0209998_10061686
1941 Ga0209974_10448333
1942 Ga0207428_10025733
1943 Ga0268266_10061223
1944 Ga0268265_10014944
1945 Ga0268265_10116687
1946 Ga0268265_10194003
1947 Ga0268265_11205977
1948 Ga0268265_11893698
1949 Ga0268264_10003664
1950 Ga0268264_10006548
1951 Ga0268264_10226967
1952 Ga0307408_100057947
1953 Ga0307408_100258176
1954 Ga0307408_100295159
1955 Ga0307408_100740832
1956 Ga0307408_101263041
1957 Ga0307408_102048427
1958 Ga0307405_10171668
1959 Ga0307405_10195955
1960 Ga0307405_10502758
1961 Ga0307413_10006005
1962 Ga0307413_10092855
1963 Ga0307413_10151497
1964 Ga0307410_10003046
1965 Ga0307410_10085555
1966 Ga0307410_11778498
1967 Ga0307406_10006327
1968 Ga0307406_10870388
1969 Ga0307406_11033597
1970 Ga0307407_10001735
1971 Ga0307407_10141928
1972 Ga0307407_11138756
1973 Ga0307412_10172975
1974 Ga0307412_11152004
1975 Ga0307412_11156818
1976 Ga0307409_100010703
1977 Ga0307409_100259903
1978 Ga0307416_100033490
1979 Ga0307416_100133137
1980 Ga0307416_100153652
1981 Ga0307416_100502827
1982 Ga0307416_100680077
1983 Ga0307416_101176896
1984 Ga0307416_101818082
1985 Ga0307416_101999763
1986 Ga0307416_102115028
1987 Ga0307416_102750567
1988 Ga0307414_10075039
1989 Ga0307414_10112967
1990 Ga0307411_10007654
1991 Ga0307411_10013915
1992 Ga0307411_10728189
1993 Ga0307415_100006566
1994 Ga0373930_0028802
1995 Ga0373958_0059949
1996 Ga0373949_0168596
1997 Ga0373932_0217142
1998 Ga0373941_0125364
1999 Ga0373941_0188603
2000 Ga0373941_0310210
2001 Ga0373943_0052857
2002 Ga0373942_0007156
2003 Ga0373961_0067883
2004 Ga0373961_0357386
2005 Ga0373924_0181190
2006 Ga0373931_0181281
2007 Ga0373937_0589309
2008 Ga0373925_1107769
2009 Ga0395899_0010240
2010 Ga0395900_0258692
2011 Ga0395900_0534580
2012 Ga0395898_0501550
2013 Ga0395905_0277044
2014 Ga0395901_0025926
2015 Ga0436365_0377439
2016 Ga0436365_0407684
2017 Ga0436365_0457255
2018 Ga0436365_0640950
2019 Ga0436365_1901778
2020 Ga0436361_0682070
2021 Ga0436363_0678176
2022 Ga0436363_1612508
2023 Ga0436363_1614456
2024 Ga0436362_0047691
2025 Ga0436362_0495570
2026 Ga0451804_0077813
2027 Ga0451853_1915692
2028 Ga0439433_0061906
2029 Ga0439448_0217146
2030 Ga0439462_0190014
2031 Ga0439459_0034449
2032 Ga0439464_0260829
2033 Ga0453683_0237773
2034 Ga0466966_0006428
2035 Ga0466961_0353716
2036 Ga0466963_0763584
2037 Ga0466968_0131366
2038 Ga0466959_0138828
2039 Ga0466959_0245932
2040 Ga0451576_0096283
2041 Ga0451576_0324089
2042 Ga0451576_1938275
2043 Ga0466958_0149700
2044 Ga0466967_0051428
2045 Ga0466967_0053164
2046 Ga0466967_1753547
2047 Ga0495603_0148904
2048 Ga0495603_0259261
2049 Ga0495651_0095791
2050 Ga0495653_0446460
2051 Ga0495580_0241862
2052 Ga0495580_0274356
2053 Ga0495582_0051938
2054 Ga0495639_0035601
2055 Ga0495639_0341240
2056 Ga0495585_0519111
2057 Ga0495594_0003903
2058 Ga0495630_0406727
2059 Ga0495642_0237170
2060 Ga0495642_0283222
2061 Ga0495665_0220187
2062 Ga0495586_0414389
2063 Ga0495586_0718783
2064 Ga0495645_0791700
2065 Ga0495635_0269359
2066 Ga0495588_0106648
2067 Ga0495657_0099611
2068 Ga0495623_0072686
2069 Ga0495646_0282306
2070 Ga0495658_0367988
2071 Ga0495669_0081314
2072 Ga0495669_0449071
2073 Ga0495613_0213966
2074 Ga0495624_0913584
2075 Ga0495670_0158102
2076 Ga0495604_0069017
2077 Ga0495636_0368365
2078 Ga0495636_0455311
2079 Ga0495675_0031867
2080 Ga0495684_0580651
2081 Ga0495602_0616594
2082 Ga0496100_0028486
2083 Ga0496101_0070446
2084 Ga0496102_0048752
2085 Ga0496102_0828054
2086 Ga0496103_0153546
2087 Ga0496104_0230390
2088 Ga0496104_0379434
2089 Ga0496105_0019048
2090 Ga0496105_0311419
2091 Ga0496106_0008590
2092 Ga0496106_0176096
2093 Ga0496106_0239834
2094 Ga0496106_0483409
2095 Ga0496106_0662024
2096 Ga0496106_1186282
2097 Ga0496107_0140925
2098 Ga0496107_0398852
2099 Ga0496107_0939054
2100 Ga0496108_0033441
2101 Ga0496108_0299849
2102 Ga0496109_0029870
2103 Ga0496109_0053468
2104 Ga0496109_0064850
2105 Ga0496109_1499451
2106 Ga0496109_1603004
2107 Ga0496110_0268084
2108 Ga0496111_0014025
2109 Ga0496112_0190729
2110 Ga0496112_0276708
2111 Ga0496112_0339114
2112 Ga0496112_0381989
2113 Ga0496113_0041989
2114 Ga0496113_0268583
2115 Ga0496114_0677657
2116 Ga0501032_0113263
2117 Ga0501033_0211316
2118 Ga0501034_0328126
2119 Ga0501034_0352675
2120 Ga0501036_0606533
2121 Ga0501037_0046794
2122 Ga0501038_0081827
2123 Ga0501040_0032134
2124 Ga0501040_0120637
2125 Ga0501040_0484720
2126 Ga0501041_0863071
2127 Ga0501043_0254745
2128 Ga0501046_0310997
2129 Ga0501046_1016568
2130 Ga0501047_0000979
2131 Ga0501047_0247130
2132 Ga0501067_0023038
2133 Ga0501068_0072868
2134 Ga0501069_0064247
2135 Ga0501069_0164608
2136 Ga0501069_0518313
2137 Ga0501070_1315712
2138 Ga0501071_0122283
2139 Ga0501071_0193741
2140 Ga0501071_0739627
2141 Ga0501071_1104195
2142 Ga0501072_0082776
2143 Ga0501072_0198809
2144 Ga0501072_0388201
2145 Ga0501072_0405816
2146 Ga0501072_0633988
2147 Ga0501074_0435276
2148 Ga0501075_0021755
2149 Ga0501075_0261350
2150 Ga0501075_0315612
2151 Ga0501075_0957784
2152 Ga0501076_0019506
2153 Ga0501076_0021161
2154 Ga0501076_0921892
2155 Ga0501077_0026472
2156 Ga0501199_066168
2157 Ga0501216_039772
2158 Ga0501217_050861
2159 Ga0501227_070079
2160 Ga0501259_101386
2161 Ga0501225_0276707
2162 Ga0501079_0119386
2163 Ga0501079_0169622
2164 Ga0501079_0815631
2165 Ga0501080_0121210
2166 Ga0501080_0143109
2167 Ga0501081_0271178
2168 Ga0501083_0103351
2169 Ga0501268_080393
2170 Ga0501035_0004340
2171 Ga0501044_0002943
2172 Ga0501045_0006609
2173 Ga0501045_0044272
2174 Ga0501045_0684710
2175 nmdc:mga0yw44_216611_c1
2176 nmdc:mga05p37_1273889_c1
2177 nmdc:mga05p37_22632_c1
2178 nmdc:mga05p37_253245_c1
2179 nmdc:mga05p37_39672_c1
2180 nmdc:mga05p37_491275_c1
2181 nmdc:mga05p37_666526_c1
2182 nmdc:mga05p37_716832_c1
2183 nmdc:mga05p37_89760_c1
2184 nmdc:mga09592_195714_c1
2185 nmdc:mga09592_2664_c1
2186 nmdc:mga09592_277949_c1
2187 nmdc:mga09592_40263_c1
2188 nmdc:mga0qj67_15386_c1
2189 nmdc:mga0qj67_37542_c1
2190 nmdc:mga0qj67_545440_c1
2191 nmdc:mga0qj67_995_c1
2192 nmdc:mga06r32_1867410_c1
2193 nmdc:mga06r32_224086_c1
2194 nmdc:mga06r32_2309_c1
2195 nmdc:mga06r32_35779_c1
2196 nmdc:mga06r32_484149_c1
2197 nmdc:mga06r32_51372_c1
2198 nmdc:mga06r32_593383_c1
2199 nmdc:mga08y16_1540852_c1
2200 nmdc:mga08y16_1972981_c1
2201 nmdc:mga08y16_22767_c1
2202 nmdc:mga08y16_679165_c1
2203 nmdc:mga08y16_743619_c1
2204 nmdc:mga0n895_106107_c1
2205 nmdc:mga0n895_1079505_c1
2206 nmdc:mga0n895_1163127_c1
2207 nmdc:mga0n895_1232050_c1
2208 nmdc:mga0n895_129_c1
2209 nmdc:mga0n895_130368_c1
2210 nmdc:mga0n895_204376_c1
2211 nmdc:mga0n895_218348_c1
2212 nmdc:mga0n895_320380_c2
2213 nmdc:mga0n895_458958_c1
2214 nmdc:mga0n895_4920_c1
2215 nmdc:mga0n895_53532_c1
2216 nmdc:mga0n895_79202_c1
2217 nmdc:mga0rr50_125372_c1
2218 nmdc:mga0rr50_13917_c1
2219 nmdc:mga0rr50_155_c1
2220 nmdc:mga0rr50_1891035_c1
2221 nmdc:mga0rr50_346524_c1
2222 nmdc:mga0rr50_49369_c1
2223 nmdc:mga0rr50_801452_c1
2224 nmdc:mga08x19_1230161_c1
2225 nmdc:mga08x19_14843_c1
2226 nmdc:mga08x19_182375_c1
2227 nmdc:mga08x19_3644_c1
2228 nmdc:mga08x19_42637_c1
2229 nmdc:mga0a205_112269_c1
2230 nmdc:mga0a205_123436_c1
2231 nmdc:mga0a205_2838_c1
2232 nmdc:mga0a205_296616_c1
2233 nmdc:mga0a205_3385_c1
2234 nmdc:mga0a205_44168_c1
2235 Ga0500628_174500
2236 Ga0501084_0253369
2237 Ga0501084_0409829
2238 Ga0501084_1797871
2239 Ga0590071_033599
2240 Ga0590071_158989
2241 Ga0590075_072288
2242 Ga0590075_218473
2243 Ga0590077_036050
2244 Ga0587066_031592
2245 Ga0587077_031191
2246 Ga0587077_050222
2247 Ga0587080_010219
2248 Ga0587082_038097
2249 Ga0587083_0075366
2250 Ga0587086_029037
2251 Ga0587088_054997
2252 Ga0587090_021374
2253 Ga0587092_023781
2254 Ga0587094_021924
2255 Ga0587106_038924
2256 Ga0587099_058534
2257 Ga0587101_019847
2258 Ga0587109_043788
2259 Ga0587115_030278
2260 Ga0587062_126179
2261 Ga0587067_010700
2262 Ga0587069_026614
2263 Ga0587072_056000
2264 Ga0587075_105819
2265 Ga0587076_049422
2266 Ga0587078_011385
2267 Ga0587079_059078
2268 Ga0587107_028879
2269 Ga0587071_025597
2270 Ga0587111_0037261
2271 Ga0501082_0474716
2272 Ga0501082_0567013
2273 Ga0501082_0633379
2274 Ga0530510_0463737
2275 Ga0530510_0617024
2276 Ga0530510_1463336

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00741

Gas_vesicle

Gas vesicle protein

11

49

0.99

Map