F490657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1138 | 391 | 2276 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10004449|Ga0065707_100044492 |
| Length | 107 |
| Sequence | MAVERAAGGTSLIDVLDRVLDKGIVIDAWVRVSLVGIDLITVEARVVVASIDTYLKYSEAVGQVAPVSRPAELPSHQDLVAENATLRLRAERAEATVAPRRRRTTEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 122 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 255 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 260 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 337 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 338 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 362 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 363 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.66 |
| Metatranscriptomes | 3.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 95.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10004449 | 3300005295 | Bacteria | 5084 |
| 2 | JGI24746J21847_1034837 | 3300001977 | Bacteria | 696 |
| 3 | JGI24035J26624_1006140 | 3300002126 | Unclassified | 1156 |
| 4 | rootH1_10324608 | 3300003323 | Archaea | 2062 |
| 5 | Ga0058859_11593842 | 3300004798 | Bacteria | 668 |
| 6 | Ga0058863_11689012 | 3300004799 | Bacteria | 901 |
| 7 | Ga0058860_11839132 | 3300004801 | Bacteria | 590 |
| 8 | Ga0058862_10060099 | 3300004803 | Bacteria | 550 |
| 9 | Ga0058862_12082364 | 3300004803 | Bacteria | 626 |
| 10 | Ga0058862_12420475 | 3300004803 | Bacteria | 837 |
| 11 | Ga0058862_12676476 | 3300004803 | Unclassified | 1181 |
| 12 | Ga0058862_12814663 | 3300004803 | Unclassified | 635 |
| 13 | Ga0065704_10117224 | 3300005289 | Bacteria | 1838 |
| 14 | Ga0065712_10075230 | 3300005290 | Bacteria | 3904 |
| 15 | Ga0065712_10149640 | 3300005290 | Bacteria | 1380 |
| 16 | Ga0065715_10003606 | 3300005293 | Bacteria | 3933 |
| 17 | Ga0065715_10009259 | 3300005293 | Bacteria | 3675 |
| 18 | Ga0065715_10090438 | 3300005293 | Bacteria | 6995 |
| 19 | Ga0065715_10092286 | 3300005293 | Bacteria | 5198 |
| 20 | Ga0065715_10100776 | 3300005293 | Bacteria | 3270 |
| 21 | Ga0065715_10152984 | 3300005293 | Bacteria | 1708 |
| 22 | Ga0065707_10087959 | 3300005295 | Bacteria | 4829 |
| 23 | Ga0065707_10288800 | 3300005295 | Bacteria | 1030 |
| 24 | Ga0065707_10403955 | 3300005295 | Unclassified | 844 |
| 25 | Ga0065707_10769020 | 3300005295 | Bacteria | 611 |
| 26 | Ga0070658_10020778 | 3300005327 | Bacteria | 5262 |
| 27 | Ga0070658_10095950 | 3300005327 | Bacteria | 2448 |
| 28 | Ga0070658_11709053 | 3300005327 | Unclassified | 545 |
| 29 | Ga0070676_10005316 | 3300005328 | Bacteria | 6852 |
| 30 | Ga0070676_10022925 | 3300005328 | Bacteria | 3505 |
| 31 | Ga0070676_10041125 | 3300005328 | Bacteria | 2679 |
| 32 | Ga0070676_10055387 | 3300005328 | Bacteria | 2340 |
| 33 | Ga0070683_100001001 | 3300005329 | Bacteria | 21162 |
| 34 | Ga0070683_100055461 | 3300005329 | Bacteria | 3678 |
| 35 | Ga0070683_100074784 | 3300005329 | Bacteria | 3164 |
| 36 | Ga0070683_100130233 | 3300005329 | Unclassified | 2381 |
| 37 | Ga0070683_100291151 | 3300005329 | Bacteria | 1553 |
| 38 | Ga0070683_100435970 | 3300005329 | Unclassified | 1250 |
| 39 | Ga0070683_100486288 | 3300005329 | Bacteria | 1179 |
| 40 | Ga0070690_100026193 | 3300005330 | Bacteria | 3595 |
| 41 | Ga0070690_100043048 | 3300005330 | Bacteria | 2862 |
| 42 | Ga0070690_101034669 | 3300005330 | Bacteria | 648 |
| 43 | Ga0070670_100077944 | 3300005331 | Bacteria | 2847 |
| 44 | Ga0070670_100238355 | 3300005331 | Unclassified | 1583 |
| 45 | Ga0070670_101396870 | 3300005331 | Bacteria | 642 |
| 46 | Ga0070677_10569900 | 3300005333 | Bacteria | 623 |
| 47 | Ga0068869_100006865 | 3300005334 | Bacteria | 7240 |
| 48 | Ga0068869_100013758 | 3300005334 | Bacteria | 5390 |
| 49 | Ga0068869_100047272 | 3300005334 | Bacteria | 3107 |
| 50 | Ga0068869_100265051 | 3300005334 | Bacteria | 1376 |
| 51 | Ga0068869_101834937 | 3300005334 | Unclassified | 542 |
| 52 | Ga0070666_10635465 | 3300005335 | Bacteria | 780 |
| 53 | Ga0070680_100016360 | 3300005336 | Bacteria | 5837 |
| 54 | Ga0070680_100026194 | 3300005336 | Bacteria | 4664 |
| 55 | Ga0070680_100040721 | 3300005336 | Bacteria | 3764 |
| 56 | Ga0070680_100042537 | 3300005336 | Bacteria | 3687 |
| 57 | Ga0070680_100158744 | 3300005336 | Unclassified | 1900 |
| 58 | Ga0070680_101257069 | 3300005336 | Unclassified | 641 |
| 59 | Ga0070682_100004745 | 3300005337 | Bacteria | 7553 |
| 60 | Ga0070682_100008856 | 3300005337 | Bacteria | 5682 |
| 61 | Ga0070682_100031801 | 3300005337 | Bacteria | 3194 |
| 62 | Ga0070682_100052286 | 3300005337 | Bacteria | 2556 |
| 63 | Ga0070682_100125581 | 3300005337 | Bacteria | 1729 |
| 64 | Ga0070682_100189250 | 3300005337 | Bacteria | 1444 |
| 65 | Ga0070682_100508205 | 3300005337 | Unclassified | 935 |
| 66 | Ga0068868_100005912 | 3300005338 | Bacteria | 8632 |
| 67 | Ga0068868_100352704 | 3300005338 | Bacteria | 1260 |
| 68 | Ga0068868_100428035 | 3300005338 | Unclassified | 1147 |
| 69 | Ga0070660_100033047 | 3300005339 | Bacteria | 3897 |
| 70 | Ga0070660_100054390 | 3300005339 | Bacteria | 3091 |
| 71 | Ga0070660_100074516 | 3300005339 | Bacteria | 2656 |
| 72 | Ga0070660_100085221 | 3300005339 | Unclassified | 2484 |
| 73 | Ga0070689_100016781 | 3300005340 | Bacteria | 5365 |
| 74 | Ga0070689_100120118 | 3300005340 | Bacteria | 2098 |
| 75 | Ga0070689_100357944 | 3300005340 | Bacteria | 1225 |
| 76 | Ga0070689_100507415 | 3300005340 | Bacteria | 1034 |
| 77 | Ga0070689_100615612 | 3300005340 | Bacteria | 942 |
| 78 | Ga0070689_100750804 | 3300005340 | Unclassified | 855 |
| 79 | Ga0070691_10033238 | 3300005341 | Bacteria | 2426 |
| 80 | Ga0070687_100000368 | 3300005343 | Bacteria | 15404 |
| 81 | Ga0070687_100487867 | 3300005343 | Unclassified | 827 |
| 82 | Ga0070687_100819376 | 3300005343 | Bacteria | 661 |
| 83 | Ga0070661_100009042 | 3300005344 | Bacteria | 6892 |
| 84 | Ga0070661_100073923 | 3300005344 | Bacteria | 2510 |
| 85 | Ga0070661_100095847 | 3300005344 | Bacteria | 2201 |
| 86 | Ga0070661_100411509 | 3300005344 | Unclassified | 1071 |
| 87 | Ga0070692_10020916 | 3300005345 | Bacteria | 3178 |
| 88 | Ga0070692_10176216 | 3300005345 | Unclassified | 1236 |
| 89 | Ga0070692_10285856 | 3300005345 | Bacteria | 1001 |
| 90 | Ga0070692_10979264 | 3300005345 | Bacteria | 590 |
| 91 | Ga0070692_11286079 | 3300005345 | Bacteria | 524 |
| 92 | Ga0070668_100001645 | 3300005347 | Bacteria | 16205 |
| 93 | Ga0070668_100011398 | 3300005347 | Bacteria | 6624 |
| 94 | Ga0070668_101501937 | 3300005347 | Bacteria | 616 |
| 95 | Ga0070669_100009292 | 3300005353 | Bacteria | 7000 |
| 96 | Ga0070669_100071703 | 3300005353 | Bacteria | 2563 |
| 97 | Ga0070669_100395305 | 3300005353 | Unclassified | 1130 |
| 98 | Ga0070669_100902245 | 3300005353 | Bacteria | 755 |
| 99 | Ga0070669_100958120 | 3300005353 | Unclassified | 733 |
| 100 | Ga0070675_100003756 | 3300005354 | Bacteria | 11531 |
| 101 | Ga0070675_100381958 | 3300005354 | Bacteria | 1254 |
| 102 | Ga0070675_100517735 | 3300005354 | Unclassified | 1076 |
| 103 | Ga0070675_100972539 | 3300005354 | Unclassified | 779 |
| 104 | Ga0070671_100084256 | 3300005355 | Bacteria | 2658 |
| 105 | Ga0070674_100142835 | 3300005356 | Bacteria | 1798 |
| 106 | Ga0070674_100376575 | 3300005356 | Unclassified | 1154 |
| 107 | Ga0070673_100082459 | 3300005364 | Bacteria | 2610 |
| 108 | Ga0070673_100082872 | 3300005364 | Bacteria | 2604 |
| 109 | Ga0070673_100308904 | 3300005364 | Bacteria | 1394 |
| 110 | Ga0070673_100360076 | 3300005364 | Bacteria | 1293 |
| 111 | Ga0070688_100064886 | 3300005365 | Bacteria | 2319 |
| 112 | Ga0070659_100013494 | 3300005366 | Bacteria | 6081 |
| 113 | Ga0070659_100020144 | 3300005366 | Bacteria | 5064 |
| 114 | Ga0070659_100070434 | 3300005366 | Unclassified | 2778 |
| 115 | Ga0070659_100102371 | 3300005366 | Bacteria | 2306 |
| 116 | Ga0070659_100275974 | 3300005366 | Unclassified | 1398 |
| 117 | Ga0070659_101802173 | 3300005366 | Unclassified | 548 |
| 118 | Ga0070659_102073801 | 3300005366 | Unclassified | 511 |
| 119 | Ga0070667_100049715 | 3300005367 | Bacteria | 3532 |
| 120 | Ga0070703_10036935 | 3300005406 | Unclassified | 1503 |
| 121 | Ga0070703_10222637 | 3300005406 | Bacteria | 752 |
| 122 | Ga0070709_10362878 | 3300005434 | Unclassified | 1073 |
| 123 | Ga0070709_11355024 | 3300005434 | Unclassified | 575 |
| 124 | Ga0070714_100177772 | 3300005435 | Unclassified | 1935 |
| 125 | Ga0070714_100252446 | 3300005435 | Unclassified | 1631 |
| 126 | Ga0070714_100259794 | 3300005435 | Unclassified | 1608 |
| 127 | Ga0070714_100361724 | 3300005435 | Unclassified | 1364 |
| 128 | Ga0070714_100715159 | 3300005435 | Unclassified | 967 |
| 129 | Ga0070714_102110000 | 3300005435 | Unclassified | 549 |
| 130 | Ga0070713_101078521 | 3300005436 | Unclassified | 776 |
| 131 | Ga0070713_101699727 | 3300005436 | Unclassified | 613 |
| 132 | Ga0070713_101746841 | 3300005436 | Unclassified | 604 |
| 133 | Ga0070713_102090546 | 3300005436 | Bacteria | 549 |
| 134 | Ga0070710_10009789 | 3300005437 | Bacteria | 4696 |
| 135 | Ga0070710_10330725 | 3300005437 | Bacteria | 1003 |
| 136 | Ga0070701_10001564 | 3300005438 | Bacteria | 8500 |
| 137 | Ga0070701_10019843 | 3300005438 | Bacteria | 3181 |
| 138 | Ga0070701_10170452 | 3300005438 | Bacteria | 1267 |
| 139 | Ga0070711_100181108 | 3300005439 | Bacteria | 1613 |
| 140 | Ga0070711_100302652 | 3300005439 | Unclassified | 1272 |
| 141 | Ga0070705_100133315 | 3300005440 | Unclassified | 1624 |
| 142 | Ga0070705_100855131 | 3300005440 | Bacteria | 728 |
| 143 | Ga0070700_100012352 | 3300005441 | Bacteria | 4762 |
| 144 | Ga0070700_100124570 | 3300005441 | Bacteria | 1731 |
| 145 | Ga0070700_100229910 | 3300005441 | Unclassified | 1319 |
| 146 | Ga0070694_100236501 | 3300005444 | Unclassified | 1376 |
| 147 | Ga0070694_100249310 | 3300005444 | Bacteria | 1342 |
| 148 | Ga0070694_100345354 | 3300005444 | Bacteria | 1152 |
| 149 | Ga0070694_100400654 | 3300005444 | Bacteria | 1074 |
| 150 | Ga0070694_100752172 | 3300005444 | Bacteria | 796 |
| 151 | Ga0070708_100000992 | 3300005445 | Bacteria | 21642 |
| 152 | Ga0070708_100018085 | 3300005445 | Bacteria | 5896 |
| 153 | Ga0070663_100446572 | 3300005455 | Unclassified | 1065 |
| 154 | Ga0070663_100625637 | 3300005455 | Unclassified | 908 |
| 155 | Ga0070663_101383594 | 3300005455 | Bacteria | 623 |
| 156 | Ga0070678_100267209 | 3300005456 | Bacteria | 1441 |
| 157 | Ga0070678_100269029 | 3300005456 | Bacteria | 1436 |
| 158 | Ga0070678_100412998 | 3300005456 | Bacteria | 1175 |
| 159 | Ga0070662_100003845 | 3300005457 | Bacteria | 9407 |
| 160 | Ga0070662_100105365 | 3300005457 | Bacteria | 2140 |
| 161 | Ga0070662_100510040 | 3300005457 | Bacteria | 1004 |
| 162 | Ga0070662_101229940 | 3300005457 | Bacteria | 644 |
| 163 | Ga0070662_101527196 | 3300005457 | Unclassified | 576 |
| 164 | Ga0070662_101819087 | 3300005457 | Bacteria | 526 |
| 165 | Ga0070681_10001020 | 3300005458 | Bacteria | 23720 |
| 166 | Ga0070681_10006836 | 3300005458 | Bacteria | 11104 |
| 167 | Ga0070681_10020849 | 3300005458 | Bacteria | 6563 |
| 168 | Ga0070681_10027196 | 3300005458 | Bacteria | 5752 |
| 169 | Ga0070681_10028740 | 3300005458 | Bacteria | 5589 |
| 170 | Ga0070681_10037930 | 3300005458 | Bacteria | 4832 |
| 171 | Ga0070681_10081881 | 3300005458 | Bacteria | 3184 |
| 172 | Ga0070681_10087357 | 3300005458 | Bacteria | 3071 |
| 173 | Ga0070681_10152444 | 3300005458 | Bacteria | 2237 |
| 174 | Ga0070681_10232036 | 3300005458 | Bacteria | 1760 |
| 175 | Ga0070681_10416740 | 3300005458 | Bacteria | 1255 |
| 176 | Ga0070681_10454018 | 3300005458 | Bacteria | 1194 |
| 177 | Ga0070681_10496673 | 3300005458 | Bacteria | 1133 |
| 178 | Ga0070681_10526099 | 3300005458 | Bacteria | 1096 |
| 179 | Ga0068867_101399553 | 3300005459 | Bacteria | 648 |
| 180 | Ga0070685_10005393 | 3300005466 | Bacteria | 6477 |
| 181 | Ga0070685_10648156 | 3300005466 | Bacteria | 765 |
| 182 | Ga0070706_100143271 | 3300005467 | Unclassified | 2231 |
| 183 | Ga0070706_100491522 | 3300005467 | Unclassified | 1142 |
| 184 | Ga0070706_100581912 | 3300005467 | Bacteria | 1041 |
| 185 | Ga0070706_100971807 | 3300005467 | Unclassified | 783 |
| 186 | Ga0070707_100029559 | 3300005468 | Bacteria | 5217 |
| 187 | Ga0070707_100285110 | 3300005468 | Unclassified | 1605 |
| 188 | Ga0070698_100017160 | 3300005471 | Bacteria | 7632 |
| 189 | Ga0070698_100203509 | 3300005471 | Unclassified | 1915 |
| 190 | Ga0070699_100022156 | 3300005518 | Bacteria | 5474 |
| 191 | Ga0070699_100032942 | 3300005518 | Bacteria | 4476 |
| 192 | Ga0070699_100135710 | 3300005518 | Bacteria | 2171 |
| 193 | Ga0070699_100288229 | 3300005518 | Bacteria | 1472 |
| 194 | Ga0070699_100766608 | 3300005518 | Bacteria | 882 |
| 195 | Ga0070699_101377123 | 3300005518 | Bacteria | 647 |
| 196 | Ga0070699_101519162 | 3300005518 | Bacteria | 614 |
| 197 | Ga0070679_100001683 | 3300005530 | Bacteria | 19888 |
| 198 | Ga0070679_100010992 | 3300005530 | Bacteria | 8604 |
| 199 | Ga0070679_100016972 | 3300005530 | Bacteria | 7037 |
| 200 | Ga0070679_100040939 | 3300005530 | Bacteria | 4611 |
| 201 | Ga0070679_100048345 | 3300005530 | Bacteria | 4238 |
| 202 | Ga0070679_100080460 | 3300005530 | Bacteria | 3247 |
| 203 | Ga0070679_100179586 | 3300005530 | Bacteria | 2089 |
| 204 | Ga0070679_100219704 | 3300005530 | Bacteria | 1861 |
| 205 | Ga0070679_100345963 | 3300005530 | Bacteria | 1435 |
| 206 | Ga0070679_100878770 | 3300005530 | Bacteria | 840 |
| 207 | Ga0070684_100000670 | 3300005535 | Bacteria | 23692 |
| 208 | Ga0070684_100056959 | 3300005535 | Bacteria | 3412 |
| 209 | Ga0070684_100092117 | 3300005535 | Bacteria | 2697 |
| 210 | Ga0070684_100093280 | 3300005535 | Bacteria | 2680 |
| 211 | Ga0070684_100168095 | 3300005535 | Bacteria | 1991 |
| 212 | Ga0070684_100178914 | 3300005535 | Bacteria | 1928 |
| 213 | Ga0070684_100199202 | 3300005535 | Bacteria | 1823 |
| 214 | Ga0070684_100422106 | 3300005535 | Bacteria | 1231 |
| 215 | Ga0070684_100453578 | 3300005535 | Unclassified | 1185 |
| 216 | Ga0070684_101035866 | 3300005535 | Unclassified | 770 |
| 217 | Ga0070684_101454749 | 3300005535 | Bacteria | 645 |
| 218 | Ga0070697_100382001 | 3300005536 | Bacteria | 1220 |
| 219 | Ga0070697_100812412 | 3300005536 | Unclassified | 828 |
| 220 | Ga0070697_101651987 | 3300005536 | Bacteria | 573 |
| 221 | Ga0068853_100023802 | 3300005539 | Bacteria | 5131 |
| 222 | Ga0068853_100046090 | 3300005539 | Bacteria | 3737 |
| 223 | Ga0068853_100086084 | 3300005539 | Bacteria | 2756 |
| 224 | Ga0068853_100279222 | 3300005539 | Bacteria | 1540 |
| 225 | Ga0068853_100600554 | 3300005539 | Unclassified | 1045 |
| 226 | Ga0068853_100683026 | 3300005539 | Bacteria | 979 |
| 227 | Ga0068853_100995763 | 3300005539 | Bacteria | 807 |
| 228 | Ga0068853_101306846 | 3300005539 | Unclassified | 701 |
| 229 | Ga0070672_100032073 | 3300005543 | Bacteria | 3962 |
| 230 | Ga0070672_100172161 | 3300005543 | Bacteria | 1801 |
| 231 | Ga0070672_100351947 | 3300005543 | Bacteria | 1256 |
| 232 | Ga0070672_100362977 | 3300005543 | Unclassified | 1236 |
| 233 | Ga0070672_102143901 | 3300005543 | Bacteria | 504 |
| 234 | Ga0070686_100099848 | 3300005544 | Bacteria | 1958 |
| 235 | Ga0070686_100857988 | 3300005544 | Unclassified | 736 |
| 236 | Ga0070695_100013101 | 3300005545 | Unclassified | 4982 |
| 237 | Ga0070695_100050117 | 3300005545 | Bacteria | 2675 |
| 238 | Ga0070695_100161310 | 3300005545 | Bacteria | 1574 |
| 239 | Ga0070695_100597798 | 3300005545 | Unclassified | 866 |
| 240 | Ga0070696_100001595 | 3300005546 | Bacteria | 14872 |
| 241 | Ga0070696_100348608 | 3300005546 | Bacteria | 1146 |
| 242 | Ga0070693_100001331 | 3300005547 | Bacteria | 11112 |
| 243 | Ga0070693_100014601 | 3300005547 | Bacteria | 4028 |
| 244 | Ga0070693_100047738 | 3300005547 | Unclassified | 2437 |
| 245 | Ga0070693_100064983 | 3300005547 | Bacteria | 2132 |
| 246 | Ga0070693_100137136 | 3300005547 | Bacteria | 1536 |
| 247 | Ga0070693_100256230 | 3300005547 | Bacteria | 1162 |
| 248 | Ga0070693_100324283 | 3300005547 | Bacteria | 1046 |
| 249 | Ga0070693_100332699 | 3300005547 | Bacteria | 1034 |
| 250 | Ga0070665_100060357 | 3300005548 | Unclassified | 3801 |
| 251 | Ga0070665_100197111 | 3300005548 | Bacteria | 2015 |
| 252 | Ga0070665_101234703 | 3300005548 | Bacteria | 758 |
| 253 | Ga0070665_101279960 | 3300005548 | Bacteria | 743 |
| 254 | Ga0070704_100020545 | 3300005549 | Bacteria | 4260 |
| 255 | Ga0070704_100169632 | 3300005549 | Bacteria | 1734 |
| 256 | Ga0070704_100955979 | 3300005549 | Unclassified | 773 |
| 257 | Ga0070704_101131960 | 3300005549 | Bacteria | 712 |
| 258 | Ga0070704_101677618 | 3300005549 | Bacteria | 587 |
| 259 | Ga0070704_102226325 | 3300005549 | Unclassified | 510 |
| 260 | Ga0068855_100002422 | 3300005563 | Bacteria | 23029 |
| 261 | Ga0068855_100023709 | 3300005563 | Bacteria | 7349 |
| 262 | Ga0068855_100037003 | 3300005563 | Bacteria | 5806 |
| 263 | Ga0068855_100364891 | 3300005563 | Unclassified | 1588 |
| 264 | Ga0070664_100003338 | 3300005564 | Bacteria | 12972 |
| 265 | Ga0070664_100006874 | 3300005564 | Bacteria | 9173 |
| 266 | Ga0070664_100031086 | 3300005564 | Bacteria | 4458 |
| 267 | Ga0070664_100037737 | 3300005564 | Bacteria | 4063 |
| 268 | Ga0070664_102100087 | 3300005564 | Unclassified | 536 |
| 269 | Ga0068857_100013533 | 3300005577 | Bacteria | 7107 |
| 270 | Ga0068857_100166100 | 3300005577 | Unclassified | 2004 |
| 271 | Ga0068857_100297708 | 3300005577 | Unclassified | 1487 |
| 272 | Ga0068857_100978408 | 3300005577 | Bacteria | 814 |
| 273 | Ga0068857_100987339 | 3300005577 | Bacteria | 810 |
| 274 | Ga0068857_101885231 | 3300005577 | Bacteria | 585 |
| 275 | Ga0068854_100022899 | 3300005578 | Bacteria | 4261 |
| 276 | Ga0068854_100158460 | 3300005578 | Bacteria | 1751 |
| 277 | Ga0068854_100191813 | 3300005578 | Unclassified | 1601 |
| 278 | Ga0068854_100355238 | 3300005578 | Unclassified | 1201 |
| 279 | Ga0068854_100761640 | 3300005578 | Unclassified | 841 |
| 280 | Ga0068854_100895652 | 3300005578 | Unclassified | 779 |
| 281 | Ga0068856_100022626 | 3300005614 | Bacteria | 6111 |
| 282 | Ga0068856_100195497 | 3300005614 | Bacteria | 2037 |
| 283 | Ga0068856_100279059 | 3300005614 | Bacteria | 1687 |
| 284 | Ga0068856_100294262 | 3300005614 | Unclassified | 1640 |
| 285 | Ga0068856_100347815 | 3300005614 | Bacteria | 1501 |
| 286 | Ga0068856_101434385 | 3300005614 | Unclassified | 704 |
| 287 | Ga0068856_102084388 | 3300005614 | Unclassified | 577 |
| 288 | Ga0070702_100200979 | 3300005615 | Unclassified | 1319 |
| 289 | Ga0070702_100547309 | 3300005615 | Bacteria | 858 |
| 290 | Ga0068852_100004098 | 3300005616 | Bacteria | 10261 |
| 291 | Ga0068852_100073510 | 3300005616 | Bacteria | 3008 |
| 292 | Ga0068852_100123248 | 3300005616 | Bacteria | 2376 |
| 293 | Ga0068852_101035734 | 3300005616 | Unclassified | 840 |
| 294 | Ga0068852_101551777 | 3300005616 | Bacteria | 685 |
| 295 | Ga0068859_100018990 | 3300005617 | Bacteria | 6905 |
| 296 | Ga0068859_100053826 | 3300005617 | Bacteria | 4047 |
| 297 | Ga0068859_100545487 | 3300005617 | Bacteria | 1254 |
| 298 | Ga0068859_100924274 | 3300005617 | Unclassified | 956 |
| 299 | Ga0068859_101579178 | 3300005617 | Bacteria | 724 |
| 300 | Ga0068859_101680497 | 3300005617 | Unclassified | 701 |
| 301 | Ga0068864_100141246 | 3300005618 | Bacteria | 2172 |
| 302 | Ga0068864_101131147 | 3300005618 | Bacteria | 780 |
| 303 | Ga0068864_101332213 | 3300005618 | Unclassified | 719 |
| 304 | Ga0068864_102703088 | 3300005618 | Bacteria | 502 |
| 305 | Ga0068866_10020746 | 3300005718 | Bacteria | 3016 |
| 306 | Ga0068861_100070300 | 3300005719 | Bacteria | 2710 |
| 307 | Ga0068861_100073535 | 3300005719 | Bacteria | 2655 |
| 308 | Ga0068861_100169775 | 3300005719 | Bacteria | 1807 |
| 309 | Ga0068861_100685236 | 3300005719 | Bacteria | 951 |
| 310 | Ga0068851_10002180 | 3300005834 | Bacteria | 8611 |
| 311 | Ga0068851_10024376 | 3300005834 | Bacteria | 2962 |
| 312 | Ga0068870_10013226 | 3300005840 | Bacteria | 3874 |
| 313 | Ga0068870_10399187 | 3300005840 | Unclassified | 894 |
| 314 | Ga0068863_100004362 | 3300005841 | Bacteria | 13945 |
| 315 | Ga0068863_100076810 | 3300005841 | Bacteria | 3160 |
| 316 | Ga0068863_100347608 | 3300005841 | Bacteria | 1443 |
| 317 | Ga0068863_100700669 | 3300005841 | Bacteria | 1007 |
| 318 | Ga0068858_100008492 | 3300005842 | Bacteria | 9870 |
| 319 | Ga0068858_100050919 | 3300005842 | Bacteria | 3832 |
| 320 | Ga0068860_100017422 | 3300005843 | Bacteria | 6999 |
| 321 | Ga0068860_102006373 | 3300005843 | Unclassified | 600 |
| 322 | Ga0068862_100011187 | 3300005844 | Bacteria | 7410 |
| 323 | Ga0068862_100030225 | 3300005844 | Bacteria | 4565 |
| 324 | Ga0068862_100788174 | 3300005844 | Unclassified | 927 |
| 325 | Ga0081539_10000174 | 3300005985 | Bacteria | 151265 |
| 326 | Ga0081539_10175457 | 3300005985 | Bacteria | 1009 |
| 327 | Ga0070717_10043417 | 3300006028 | Unclassified | 3669 |
| 328 | Ga0070717_10487628 | 3300006028 | Bacteria | 1113 |
| 329 | Ga0075365_10032017 | 3300006038 | Bacteria | 3378 |
| 330 | Ga0070715_10410543 | 3300006163 | Bacteria | 755 |
| 331 | Ga0070715_10464583 | 3300006163 | Unclassified | 717 |
| 332 | Ga0070716_100057749 | 3300006173 | Bacteria | 2231 |
| 333 | Ga0070716_100168471 | 3300006173 | Bacteria | 1427 |
| 334 | Ga0070716_100286959 | 3300006173 | Bacteria | 1138 |
| 335 | Ga0070716_100670384 | 3300006173 | Bacteria | 789 |
| 336 | Ga0070712_100063964 | 3300006175 | Bacteria | 2607 |
| 337 | Ga0070712_101073466 | 3300006175 | Bacteria | 698 |
| 338 | Ga0075427_10034123 | 3300006194 | Bacteria | 843 |
| 339 | Ga0097621_100000672 | 3300006237 | Bacteria | 23958 |
| 340 | Ga0097621_100018046 | 3300006237 | Bacteria | 5379 |
| 341 | Ga0097621_100146095 | 3300006237 | Bacteria | 2025 |
| 342 | Ga0097621_100205657 | 3300006237 | Bacteria | 1710 |
| 343 | Ga0097621_100501893 | 3300006237 | Bacteria | 1099 |
| 344 | Ga0068871_100000199 | 3300006358 | Bacteria | 41241 |
| 345 | Ga0068871_100015194 | 3300006358 | Bacteria | 5757 |
| 346 | Ga0068871_100168173 | 3300006358 | Unclassified | 1878 |
| 347 | Ga0068871_100335062 | 3300006358 | Unclassified | 1335 |
| 348 | Ga0068871_101839880 | 3300006358 | Unclassified | 575 |
| 349 | Ga0075428_100001460 | 3300006844 | Bacteria | 25297 |
| 350 | Ga0075428_100148298 | 3300006844 | Bacteria | 2549 |
| 351 | Ga0075428_100160791 | 3300006844 | Bacteria | 2438 |
| 352 | Ga0075428_100168139 | 3300006844 | Bacteria | 2378 |
| 353 | Ga0075428_100337741 | 3300006844 | Bacteria | 1618 |
| 354 | Ga0075430_100001395 | 3300006846 | Bacteria | 19620 |
| 355 | Ga0075430_100007336 | 3300006846 | Bacteria | 9314 |
| 356 | Ga0075430_100064069 | 3300006846 | Bacteria | 3087 |
| 357 | Ga0075430_100627131 | 3300006846 | Bacteria | 887 |
| 358 | Ga0075431_100011297 | 3300006847 | Bacteria | 8995 |
| 359 | Ga0075431_100034309 | 3300006847 | Bacteria | 5228 |
| 360 | Ga0075431_100085550 | 3300006847 | Bacteria | 3255 |
| 361 | Ga0075431_100139642 | 3300006847 | Bacteria | 2498 |
| 362 | Ga0075431_101761438 | 3300006847 | Bacteria | 576 |
| 363 | Ga0075431_101953955 | 3300006847 | Unclassified | 542 |
| 364 | Ga0075433_10000761 | 3300006852 | Bacteria | 22134 |
| 365 | Ga0075433_10008053 | 3300006852 | Bacteria | 8389 |
| 366 | Ga0075433_10038053 | 3300006852 | Unclassified | 4153 |
| 367 | Ga0075433_10058254 | 3300006852 | Bacteria | 3378 |
| 368 | Ga0075433_11975040 | 3300006852 | Unclassified | 500 |
| 369 | Ga0075434_100000063 | 3300006871 | Bacteria | 55215 |
| 370 | Ga0075434_100013527 | 3300006871 | Bacteria | 7771 |
| 371 | Ga0075434_100039055 | 3300006871 | Bacteria | 4704 |
| 372 | Ga0075434_100059352 | 3300006871 | Bacteria | 3803 |
| 373 | Ga0075434_100224047 | 3300006871 | Bacteria | 1900 |
| 374 | Ga0075434_100245179 | 3300006871 | Bacteria | 1811 |
| 375 | Ga0075434_100258853 | 3300006871 | Bacteria | 1759 |
| 376 | Ga0075434_100309868 | 3300006871 | Bacteria | 1599 |
| 377 | Ga0075434_100585845 | 3300006871 | Bacteria | 1135 |
| 378 | Ga0075434_101208134 | 3300006871 | Bacteria | 768 |
| 379 | Ga0075434_101522905 | 3300006871 | Bacteria | 678 |
| 380 | Ga0075429_100007349 | 3300006880 | Bacteria | 9561 |
| 381 | Ga0075429_100218433 | 3300006880 | Bacteria | 1670 |
| 382 | Ga0075429_100232259 | 3300006880 | Bacteria | 1616 |
| 383 | Ga0075429_100395580 | 3300006880 | Bacteria | 1210 |
| 384 | Ga0075429_100884400 | 3300006880 | Unclassified | 782 |
| 385 | Ga0068865_100007807 | 3300006881 | Bacteria | 6600 |
| 386 | Ga0068865_100136264 | 3300006881 | Bacteria | 1846 |
| 387 | Ga0068865_100312764 | 3300006881 | Bacteria | 1261 |
| 388 | Ga0068865_102146816 | 3300006881 | Unclassified | 508 |
| 389 | Ga0075436_100011890 | 3300006914 | Bacteria | 5972 |
| 390 | Ga0075436_100082780 | 3300006914 | Bacteria | 2226 |
| 391 | Ga0075436_100308098 | 3300006914 | Bacteria | 1136 |
| 392 | Ga0075436_101479007 | 3300006914 | Bacteria | 516 |
| 393 | Ga0097620_100018990 | 3300006931 | Bacteria | 6905 |
| 394 | Ga0097620_100053825 | 3300006931 | Bacteria | 4047 |
| 395 | Ga0097620_100545593 | 3300006931 | Bacteria | 1254 |
| 396 | Ga0097620_100924292 | 3300006931 | Unclassified | 956 |
| 397 | Ga0097620_101579163 | 3300006931 | Bacteria | 724 |
| 398 | Ga0097620_101680518 | 3300006931 | Unclassified | 701 |
| 399 | Ga0075435_100003203 | 3300007076 | Bacteria | 11081 |
| 400 | Ga0075435_100015966 | 3300007076 | Bacteria | 5654 |
| 401 | Ga0075435_100102819 | 3300007076 | Bacteria | 2369 |
| 402 | Ga0075435_100138982 | 3300007076 | Bacteria | 2037 |
| 403 | Ga0075435_100359442 | 3300007076 | Bacteria | 1249 |
| 404 | Ga0075435_100614680 | 3300007076 | Bacteria | 943 |
| 405 | Ga0075435_100710024 | 3300007076 | Bacteria | 874 |
| 406 | Ga0075435_101941705 | 3300007076 | Bacteria | 517 |
| 407 | Ga0099794_10121669 | 3300007265 | Bacteria | 1313 |
| 408 | Ga0099794_10192774 | 3300007265 | Bacteria | 1042 |
| 409 | Ga0099794_10332955 | 3300007265 | Unclassified | 788 |
| 410 | Ga0099794_10560497 | 3300007265 | Unclassified | 603 |
| 411 | Ga0105240_10038477 | 3300009093 | Bacteria | 6136 |
| 412 | Ga0105240_10044099 | 3300009093 | Bacteria | 5671 |
| 413 | Ga0105240_10093062 | 3300009093 | Bacteria | 3680 |
| 414 | Ga0105240_10169288 | 3300009093 | Unclassified | 2589 |
| 415 | Ga0105240_10194956 | 3300009093 | Bacteria | 2379 |
| 416 | Ga0105240_10250041 | 3300009093 | Unclassified | 2051 |
| 417 | Ga0105240_10408175 | 3300009093 | Bacteria | 1528 |
| 418 | Ga0111539_10023324 | 3300009094 | Bacteria | 7603 |
| 419 | Ga0111539_10330925 | 3300009094 | Bacteria | 1773 |
| 420 | Ga0111539_10957283 | 3300009094 | Bacteria | 995 |
| 421 | Ga0111539_11126948 | 3300009094 | Archaea | 912 |
| 422 | Ga0111539_11419754 | 3300009094 | Bacteria | 805 |
| 423 | Ga0111539_11779063 | 3300009094 | Bacteria | 714 |
| 424 | Ga0105245_10042291 | 3300009098 | Bacteria | 4065 |
| 425 | Ga0105245_10482079 | 3300009098 | Unclassified | 1254 |
| 426 | Ga0105245_11018195 | 3300009098 | Unclassified | 873 |
| 427 | Ga0105245_11823006 | 3300009098 | Unclassified | 661 |
| 428 | Ga0105247_10364739 | 3300009101 | Bacteria | 1020 |
| 429 | Ga0114129_10013088 | 3300009147 | Bacteria | 11817 |
| 430 | Ga0114129_10016474 | 3300009147 | Bacteria | 10521 |
| 431 | Ga0114129_10255779 | 3300009147 | Bacteria | 2349 |
| 432 | Ga0114129_10578572 | 3300009147 | Unclassified | 1457 |
| 433 | Ga0114129_10864832 | 3300009147 | Bacteria | 1148 |
| 434 | Ga0114129_11407280 | 3300009147 | Bacteria | 860 |
| 435 | Ga0114129_12619227 | 3300009147 | Bacteria | 602 |
| 436 | Ga0105241_10074874 | 3300009174 | Bacteria | 2637 |
| 437 | Ga0105241_10620087 | 3300009174 | Unclassified | 979 |
| 438 | Ga0105241_12014430 | 3300009174 | Unclassified | 569 |
| 439 | Ga0105242_10062689 | 3300009176 | Bacteria | 3060 |
| 440 | Ga0105242_11298561 | 3300009176 | Unclassified | 751 |
| 441 | Ga0105242_13289845 | 3300009176 | Archaea | 502 |
| 442 | Ga0105248_10032604 | 3300009177 | Bacteria | 5820 |
| 443 | Ga0105248_10074841 | 3300009177 | Bacteria | 3806 |
| 444 | Ga0105248_10311421 | 3300009177 | Bacteria | 1773 |
| 445 | Ga0105248_10498537 | 3300009177 | Bacteria | 1373 |
| 446 | Ga0105248_10614282 | 3300009177 | Bacteria | 1226 |
| 447 | Ga0105237_10019127 | 3300009545 | Bacteria | 7077 |
| 448 | Ga0105237_10467570 | 3300009545 | Unclassified | 1267 |
| 449 | Ga0105237_10659648 | 3300009545 | Unclassified | 1053 |
| 450 | Ga0105237_11164876 | 3300009545 | Bacteria | 777 |
| 451 | Ga0105238_10008500 | 3300009551 | Bacteria | 10273 |
| 452 | Ga0105238_10009654 | 3300009551 | Bacteria | 9658 |
| 453 | Ga0105238_10043056 | 3300009551 | Bacteria | 4569 |
| 454 | Ga0105249_10001072 | 3300009553 | Bacteria | 24276 |
| 455 | Ga0105249_10005273 | 3300009553 | Bacteria | 11157 |
| 456 | Ga0105249_10008847 | 3300009553 | Bacteria | 8793 |
| 457 | Ga0105249_10238037 | 3300009553 | Bacteria | 1798 |
| 458 | Ga0105249_10529400 | 3300009553 | Unclassified | 1227 |
| 459 | Ga0099796_10152604 | 3300010159 | Bacteria | 910 |
| 460 | Ga0105239_10004401 | 3300010375 | Bacteria | 16869 |
| 461 | Ga0105239_10018805 | 3300010375 | Bacteria | 7632 |
| 462 | Ga0105239_10350498 | 3300010375 | Bacteria | 1667 |
| 463 | Ga0105239_13023558 | 3300010375 | Archaea | 548 |
| 464 | Ga0105239_13217647 | 3300010375 | Unclassified | 532 |
| 465 | Ga0105246_10364642 | 3300011119 | Bacteria | 1188 |
| 466 | Ga0105246_10548139 | 3300011119 | Bacteria | 991 |
| 467 | Ga0157317_1020129 | 3300012475 | Bacteria | 588 |
| 468 | Ga0157313_1004160 | 3300012503 | Unclassified | 979 |
| 469 | Ga0157373_10067261 | 3300013100 | Bacteria | 2534 |
| 470 | Ga0157373_10242987 | 3300013100 | Bacteria | 1273 |
| 471 | Ga0157373_10279528 | 3300013100 | Bacteria | 1183 |
| 472 | Ga0157371_10012161 | 3300013102 | Bacteria | 6594 |
| 473 | Ga0157371_10049859 | 3300013102 | Bacteria | 2973 |
| 474 | Ga0157371_10271982 | 3300013102 | Bacteria | 1223 |
| 475 | Ga0157371_10440100 | 3300013102 | Unclassified | 957 |
| 476 | Ga0157370_10023999 | 3300013104 | Bacteria | 6046 |
| 477 | Ga0157370_10525185 | 3300013104 | Unclassified | 1086 |
| 478 | Ga0157370_11159112 | 3300013104 | Bacteria | 698 |
| 479 | Ga0157370_12074910 | 3300013104 | Unclassified | 509 |
| 480 | Ga0157369_10025059 | 3300013105 | Bacteria | 6625 |
| 481 | Ga0157369_10038214 | 3300013105 | Bacteria | 5249 |
| 482 | Ga0157369_10045712 | 3300013105 | Bacteria | 4760 |
| 483 | Ga0157369_10117485 | 3300013105 | Bacteria | 2823 |
| 484 | Ga0157369_10288710 | 3300013105 | Bacteria | 1708 |
| 485 | Ga0157369_12301865 | 3300013105 | Archaea | 546 |
| 486 | Ga0157374_10024671 | 3300013296 | Bacteria | 5391 |
| 487 | Ga0157374_10076870 | 3300013296 | Bacteria | 3157 |
| 488 | Ga0157374_10112106 | 3300013296 | Bacteria | 2624 |
| 489 | Ga0157378_10010809 | 3300013297 | Bacteria | 7979 |
| 490 | Ga0157378_10505797 | 3300013297 | Unclassified | 1207 |
| 491 | Ga0157378_12994579 | 3300013297 | Bacteria | 524 |
| 492 | Ga0163162_10015582 | 3300013306 | Bacteria | 7429 |
| 493 | Ga0163162_10016923 | 3300013306 | Bacteria | 7131 |
| 494 | Ga0163162_10423188 | 3300013306 | Bacteria | 1464 |
| 495 | Ga0163162_10622852 | 3300013306 | Bacteria | 1204 |
| 496 | Ga0157372_10001413 | 3300013307 | Bacteria | 25883 |
| 497 | Ga0157372_10013669 | 3300013307 | Bacteria | 8675 |
| 498 | Ga0157372_10020331 | 3300013307 | Bacteria | 7160 |
| 499 | Ga0157372_10073677 | 3300013307 | Bacteria | 3849 |
| 500 | Ga0157372_10085246 | 3300013307 | Bacteria | 3583 |
| 501 | Ga0157372_10222101 | 3300013307 | Bacteria | 2190 |
| 502 | Ga0157372_10358624 | 3300013307 | Bacteria | 1699 |
| 503 | Ga0157372_10896520 | 3300013307 | Bacteria | 1029 |
| 504 | Ga0157372_12017461 | 3300013307 | Unclassified | 663 |
| 505 | Ga0157372_12795212 | 3300013307 | Unclassified | 560 |
| 506 | Ga0157375_10040044 | 3300013308 | Bacteria | 4514 |
| 507 | Ga0157375_10066129 | 3300013308 | Bacteria | 3607 |
| 508 | Ga0157375_10146904 | 3300013308 | Bacteria | 2489 |
| 509 | Ga0157375_10705364 | 3300013308 | Bacteria | 1162 |
| 510 | Ga0157375_10730143 | 3300013308 | Bacteria | 1143 |
| 511 | Ga0157375_13555019 | 3300013308 | Bacteria | 519 |
| 512 | Ga0163163_10130752 | 3300014325 | Bacteria | 2551 |
| 513 | Ga0163163_10801155 | 3300014325 | Unclassified | 1005 |
| 514 | Ga0163163_10904052 | 3300014325 | Bacteria | 946 |
| 515 | Ga0163163_11197560 | 3300014325 | Bacteria | 822 |
| 516 | Ga0163163_11484380 | 3300014325 | Bacteria | 739 |
| 517 | Ga0163163_12649033 | 3300014325 | Unclassified | 559 |
| 518 | Ga0157380_10067582 | 3300014326 | Bacteria | 2878 |
| 519 | Ga0157380_10080058 | 3300014326 | Bacteria | 2669 |
| 520 | Ga0157380_10784163 | 3300014326 | Bacteria | 968 |
| 521 | Ga0157380_11255725 | 3300014326 | Unclassified | 786 |
| 522 | Ga0182008_10005300 | 3300014497 | Bacteria | 7366 |
| 523 | Ga0182008_10036968 | 3300014497 | Bacteria | 2443 |
| 524 | Ga0157377_10000701 | 3300014745 | Bacteria | 13807 |
| 525 | Ga0157377_10357216 | 3300014745 | Bacteria | 982 |
| 526 | Ga0157379_10042159 | 3300014968 | Unclassified | 4074 |
| 527 | Ga0157376_10337542 | 3300014969 | Unclassified | 1438 |
| 528 | Ga0157376_11030550 | 3300014969 | Bacteria | 846 |
| 529 | Ga0157376_11568764 | 3300014969 | Bacteria | 692 |
| 530 | Ga0157376_12040057 | 3300014969 | Bacteria | 611 |
| 531 | Ga0157376_12412937 | 3300014969 | Unclassified | 565 |
| 532 | Ga0157376_12567983 | 3300014969 | Unclassified | 549 |
| 533 | Ga0182006_1038915 | 3300015261 | Bacteria | 1879 |
| 534 | Ga0182007_10004976 | 3300015262 | Bacteria | 5918 |
| 535 | Ga0182007_10095243 | 3300015262 | Bacteria | 982 |
| 536 | Ga0163161_10038775 | 3300017792 | Bacteria | 3418 |
| 537 | Ga0206356_11439665 | 3300020070 | Unclassified | 831 |
| 538 | Ga0206356_11691036 | 3300020070 | Unclassified | 923 |
| 539 | Ga0213873_10019893 | 3300021358 | Bacteria | 1562 |
| 540 | Ga0213876_10331192 | 3300021384 | Unclassified | 810 |
| 541 | Ga0224712_10374815 | 3300022467 | Unclassified | 675 |
| 542 | Ga0207673_1052659 | 3300025290 | Unclassified | 577 |
| 543 | Ga0207697_10004407 | 3300025315 | Bacteria | 6729 |
| 544 | Ga0207697_10016356 | 3300025315 | Bacteria | 3055 |
| 545 | Ga0207656_10004964 | 3300025321 | Bacteria | 4673 |
| 546 | Ga0207656_10022029 | 3300025321 | Bacteria | 2552 |
| 547 | Ga0207653_10026783 | 3300025885 | Bacteria | 1850 |
| 548 | Ga0207682_10005888 | 3300025893 | Bacteria | 4968 |
| 549 | Ga0207682_10058810 | 3300025893 | Bacteria | 1605 |
| 550 | Ga0207682_10426728 | 3300025893 | Bacteria | 627 |
| 551 | Ga0207692_10052520 | 3300025898 | Unclassified | 2072 |
| 552 | Ga0207692_10243399 | 3300025898 | Bacteria | 1075 |
| 553 | Ga0207642_10091701 | 3300025899 | Bacteria | 1502 |
| 554 | Ga0207710_10219062 | 3300025900 | Bacteria | 944 |
| 555 | Ga0207688_10013310 | 3300025901 | Bacteria | 4470 |
| 556 | Ga0207688_10111816 | 3300025901 | Unclassified | 1586 |
| 557 | Ga0207688_10558706 | 3300025901 | Unclassified | 719 |
| 558 | Ga0207647_10043905 | 3300025904 | Unclassified | 2795 |
| 559 | Ga0207685_10823780 | 3300025905 | Unclassified | 512 |
| 560 | Ga0207699_10014666 | 3300025906 | Bacteria | 4048 |
| 561 | Ga0207699_10029591 | 3300025906 | Bacteria | 3056 |
| 562 | Ga0207699_10503002 | 3300025906 | Bacteria | 875 |
| 563 | Ga0207645_10003398 | 3300025907 | Bacteria | 12106 |
| 564 | Ga0207645_10011314 | 3300025907 | Bacteria | 6098 |
| 565 | Ga0207645_10048478 | 3300025907 | Bacteria | 2713 |
| 566 | Ga0207643_10008827 | 3300025908 | Bacteria | 5410 |
| 567 | Ga0207643_10399373 | 3300025908 | Unclassified | 869 |
| 568 | Ga0207705_10169488 | 3300025909 | Bacteria | 1643 |
| 569 | Ga0207705_10409977 | 3300025909 | Archaea | 1048 |
| 570 | Ga0207684_10014240 | 3300025910 | Bacteria | 6862 |
| 571 | Ga0207684_10070132 | 3300025910 | Unclassified | 2979 |
| 572 | Ga0207684_10490603 | 3300025910 | Unclassified | 1053 |
| 573 | Ga0207654_10065768 | 3300025911 | Bacteria | 2136 |
| 574 | Ga0207654_11363879 | 3300025911 | Unclassified | 517 |
| 575 | Ga0207707_10001403 | 3300025912 | Bacteria | 22328 |
| 576 | Ga0207707_10004017 | 3300025912 | Bacteria | 13060 |
| 577 | Ga0207707_10008110 | 3300025912 | Bacteria | 9118 |
| 578 | Ga0207707_10009793 | 3300025912 | Bacteria | 8311 |
| 579 | Ga0207707_10013883 | 3300025912 | Bacteria | 7023 |
| 580 | Ga0207707_10043159 | 3300025912 | Bacteria | 3934 |
| 581 | Ga0207707_10064410 | 3300025912 | Unclassified | 3191 |
| 582 | Ga0207707_10083176 | 3300025912 | Unclassified | 2795 |
| 583 | Ga0207707_10222277 | 3300025912 | Bacteria | 1644 |
| 584 | Ga0207707_10298054 | 3300025912 | Bacteria | 1394 |
| 585 | Ga0207707_10300153 | 3300025912 | Bacteria | 1389 |
| 586 | Ga0207707_10558024 | 3300025912 | Bacteria | 972 |
| 587 | Ga0207707_10891414 | 3300025912 | Unclassified | 736 |
| 588 | Ga0207695_10006370 | 3300025913 | Bacteria | 15353 |
| 589 | Ga0207695_10091977 | 3300025913 | Bacteria | 3046 |
| 590 | Ga0207695_10107984 | 3300025913 | Bacteria | 2768 |
| 591 | Ga0207695_10121200 | 3300025913 | Bacteria | 2583 |
| 592 | Ga0207695_10223178 | 3300025913 | Bacteria | 1791 |
| 593 | Ga0207671_10044113 | 3300025914 | Bacteria | 3297 |
| 594 | Ga0207671_10092878 | 3300025914 | Unclassified | 2275 |
| 595 | Ga0207671_10522934 | 3300025914 | Unclassified | 946 |
| 596 | Ga0207671_11240056 | 3300025914 | Bacteria | 582 |
| 597 | Ga0207671_11460972 | 3300025914 | Bacteria | 529 |
| 598 | Ga0207693_10857158 | 3300025915 | Bacteria | 698 |
| 599 | Ga0207663_10251947 | 3300025916 | Unclassified | 1300 |
| 600 | Ga0207663_10717192 | 3300025916 | Unclassified | 793 |
| 601 | Ga0207660_10004449 | 3300025917 | Bacteria | 9130 |
| 602 | Ga0207660_10012020 | 3300025917 | Bacteria | 5655 |
| 603 | Ga0207660_10044500 | 3300025917 | Bacteria | 3123 |
| 604 | Ga0207660_10087591 | 3300025917 | Bacteria | 2301 |
| 605 | Ga0207660_10177597 | 3300025917 | Bacteria | 1652 |
| 606 | Ga0207660_10186450 | 3300025917 | Unclassified | 1614 |
| 607 | Ga0207660_10963204 | 3300025917 | Bacteria | 696 |
| 608 | Ga0207662_10002435 | 3300025918 | Bacteria | 9329 |
| 609 | Ga0207662_10041968 | 3300025918 | Bacteria | 2695 |
| 610 | Ga0207662_10816928 | 3300025918 | Bacteria | 658 |
| 611 | Ga0207662_10961207 | 3300025918 | Bacteria | 606 |
| 612 | Ga0207662_11069990 | 3300025918 | Bacteria | 573 |
| 613 | Ga0207657_10001956 | 3300025919 | Bacteria | 22232 |
| 614 | Ga0207657_10011536 | 3300025919 | Bacteria | 8771 |
| 615 | Ga0207657_10024337 | 3300025919 | Bacteria | 5612 |
| 616 | Ga0207657_10198706 | 3300025919 | Bacteria | 1614 |
| 617 | Ga0207657_10686756 | 3300025919 | Unclassified | 796 |
| 618 | Ga0207649_10021789 | 3300025920 | Bacteria | 3696 |
| 619 | Ga0207649_10028642 | 3300025920 | Bacteria | 3280 |
| 620 | Ga0207649_10032394 | 3300025920 | Bacteria | 3116 |
| 621 | Ga0207649_10216756 | 3300025920 | Unclassified | 1361 |
| 622 | Ga0207652_10005957 | 3300025921 | Bacteria | 9864 |
| 623 | Ga0207652_10007070 | 3300025921 | Bacteria | 9045 |
| 624 | Ga0207652_10032484 | 3300025921 | Bacteria | 4389 |
| 625 | Ga0207652_10061851 | 3300025921 | Bacteria | 3234 |
| 626 | Ga0207652_10131203 | 3300025921 | Bacteria | 2235 |
| 627 | Ga0207652_10138078 | 3300025921 | Unclassified | 2178 |
| 628 | Ga0207652_10153637 | 3300025921 | Bacteria | 2061 |
| 629 | Ga0207652_10198007 | 3300025921 | Unclassified | 1808 |
| 630 | Ga0207652_10454145 | 3300025921 | Unclassified | 1155 |
| 631 | Ga0207652_10740145 | 3300025921 | Unclassified | 876 |
| 632 | Ga0207652_10784823 | 3300025921 | Bacteria | 846 |
| 633 | Ga0207646_10065705 | 3300025922 | Bacteria | 3239 |
| 634 | Ga0207646_10175134 | 3300025922 | Unclassified | 1937 |
| 635 | Ga0207646_10471940 | 3300025922 | Bacteria | 1131 |
| 636 | Ga0207646_10840054 | 3300025922 | Bacteria | 817 |
| 637 | Ga0207646_10995945 | 3300025922 | Bacteria | 741 |
| 638 | Ga0207646_11804982 | 3300025922 | Unclassified | 523 |
| 639 | Ga0207681_10041546 | 3300025923 | Bacteria | 3066 |
| 640 | Ga0207681_10051813 | 3300025923 | Bacteria | 2781 |
| 641 | Ga0207681_10412423 | 3300025923 | Unclassified | 1093 |
| 642 | Ga0207681_11305030 | 3300025923 | Unclassified | 610 |
| 643 | Ga0207694_10074644 | 3300025924 | Bacteria | 2654 |
| 644 | Ga0207694_10296931 | 3300025924 | Unclassified | 1330 |
| 645 | Ga0207694_10345844 | 3300025924 | Bacteria | 1230 |
| 646 | Ga0207650_10121510 | 3300025925 | Bacteria | 2034 |
| 647 | Ga0207650_10856752 | 3300025925 | Bacteria | 771 |
| 648 | Ga0207650_11468075 | 3300025925 | Unclassified | 580 |
| 649 | Ga0207650_11599237 | 3300025925 | Bacteria | 553 |
| 650 | Ga0207659_10023471 | 3300025926 | Bacteria | 4117 |
| 651 | Ga0207659_10122098 | 3300025926 | Bacteria | 1997 |
| 652 | Ga0207659_11294792 | 3300025926 | Unclassified | 626 |
| 653 | Ga0207687_10071472 | 3300025927 | Bacteria | 2479 |
| 654 | Ga0207687_10281225 | 3300025927 | Unclassified | 1334 |
| 655 | Ga0207700_10016602 | 3300025928 | Unclassified | 4896 |
| 656 | Ga0207700_10629751 | 3300025928 | Unclassified | 956 |
| 657 | Ga0207700_11006970 | 3300025928 | Unclassified | 746 |
| 658 | Ga0207700_11350214 | 3300025928 | Unclassified | 634 |
| 659 | Ga0207700_11700968 | 3300025928 | Bacteria | 556 |
| 660 | Ga0207664_10025220 | 3300025929 | Unclassified | 4475 |
| 661 | Ga0207664_10159679 | 3300025929 | Unclassified | 1922 |
| 662 | Ga0207664_10253311 | 3300025929 | Unclassified | 1537 |
| 663 | Ga0207664_10587393 | 3300025929 | Bacteria | 1000 |
| 664 | Ga0207664_10674991 | 3300025929 | Unclassified | 929 |
| 665 | Ga0207644_10081083 | 3300025931 | Bacteria | 2397 |
| 666 | Ga0207644_10098590 | 3300025931 | Bacteria | 2191 |
| 667 | Ga0207644_10652861 | 3300025931 | Bacteria | 876 |
| 668 | Ga0207644_10890288 | 3300025931 | Bacteria | 746 |
| 669 | Ga0207644_11685449 | 3300025931 | Bacteria | 531 |
| 670 | Ga0207690_10005865 | 3300025932 | Bacteria | 7271 |
| 671 | Ga0207690_10045406 | 3300025932 | Bacteria | 2902 |
| 672 | Ga0207690_10082265 | 3300025932 | Bacteria | 2252 |
| 673 | Ga0207690_10091184 | 3300025932 | Bacteria | 2154 |
| 674 | Ga0207690_10232919 | 3300025932 | Unclassified | 1415 |
| 675 | Ga0207690_10956964 | 3300025932 | Unclassified | 711 |
| 676 | Ga0207706_10001234 | 3300025933 | Bacteria | 25749 |
| 677 | Ga0207706_10041286 | 3300025933 | Bacteria | 4090 |
| 678 | Ga0207706_10074133 | 3300025933 | Bacteria | 2993 |
| 679 | Ga0207706_10344050 | 3300025933 | Bacteria | 1297 |
| 680 | Ga0207706_10432329 | 3300025933 | Bacteria | 1140 |
| 681 | Ga0207706_10580180 | 3300025933 | Bacteria | 964 |
| 682 | Ga0207706_10660352 | 3300025933 | Bacteria | 895 |
| 683 | Ga0207706_11294328 | 3300025933 | Bacteria | 602 |
| 684 | Ga0207686_10375141 | 3300025934 | Bacteria | 1077 |
| 685 | Ga0207670_10028957 | 3300025936 | Bacteria | 3522 |
| 686 | Ga0207670_10416574 | 3300025936 | Bacteria | 1077 |
| 687 | Ga0207670_10605558 | 3300025936 | Unclassified | 900 |
| 688 | Ga0207669_10210000 | 3300025937 | Bacteria | 1420 |
| 689 | Ga0207669_10420706 | 3300025937 | Bacteria | 1051 |
| 690 | Ga0207704_10250527 | 3300025938 | Unclassified | 1329 |
| 691 | Ga0207704_10265805 | 3300025938 | Bacteria | 1296 |
| 692 | Ga0207665_10004800 | 3300025939 | Bacteria | 9002 |
| 693 | Ga0207665_10147209 | 3300025939 | Bacteria | 1684 |
| 694 | Ga0207665_10222964 | 3300025939 | Bacteria | 1382 |
| 695 | Ga0207665_10506943 | 3300025939 | Bacteria | 933 |
| 696 | Ga0207665_11401934 | 3300025939 | Bacteria | 556 |
| 697 | Ga0207691_10002084 | 3300025940 | Bacteria | 19520 |
| 698 | Ga0207691_10002362 | 3300025940 | Bacteria | 18483 |
| 699 | Ga0207691_10040033 | 3300025940 | Bacteria | 4333 |
| 700 | Ga0207691_10323363 | 3300025940 | Bacteria | 1322 |
| 701 | Ga0207711_10124431 | 3300025941 | Bacteria | 2305 |
| 702 | Ga0207711_10928490 | 3300025941 | Bacteria | 809 |
| 703 | Ga0207689_10008560 | 3300025942 | Bacteria | 8918 |
| 704 | Ga0207689_10011347 | 3300025942 | Bacteria | 7642 |
| 705 | Ga0207689_10067141 | 3300025942 | Bacteria | 2948 |
| 706 | Ga0207689_10282539 | 3300025942 | Bacteria | 1374 |
| 707 | Ga0207661_10003424 | 3300025944 | Bacteria | 11007 |
| 708 | Ga0207661_10015101 | 3300025944 | Bacteria | 5675 |
| 709 | Ga0207661_10154824 | 3300025944 | Unclassified | 1984 |
| 710 | Ga0207661_10163820 | 3300025944 | Bacteria | 1931 |
| 711 | Ga0207661_10184645 | 3300025944 | Unclassified | 1824 |
| 712 | Ga0207661_10257237 | 3300025944 | Bacteria | 1554 |
| 713 | Ga0207661_10266976 | 3300025944 | Unclassified | 1526 |
| 714 | Ga0207661_10303926 | 3300025944 | Bacteria | 1431 |
| 715 | Ga0207661_10508958 | 3300025944 | Unclassified | 1100 |
| 716 | Ga0207679_10006782 | 3300025945 | Bacteria | 7254 |
| 717 | Ga0207679_10011838 | 3300025945 | Bacteria | 5670 |
| 718 | Ga0207679_10216758 | 3300025945 | Bacteria | 1608 |
| 719 | Ga0207679_10313510 | 3300025945 | Unclassified | 1356 |
| 720 | Ga0207679_10844355 | 3300025945 | Unclassified | 836 |
| 721 | Ga0207679_11137489 | 3300025945 | Bacteria | 716 |
| 722 | Ga0207679_11926695 | 3300025945 | Unclassified | 539 |
| 723 | Ga0207667_10037065 | 3300025949 | Bacteria | 5216 |
| 724 | Ga0207667_10079106 | 3300025949 | Bacteria | 3407 |
| 725 | Ga0207667_10112569 | 3300025949 | Bacteria | 2806 |
| 726 | Ga0207667_10211207 | 3300025949 | Unclassified | 1989 |
| 727 | Ga0207651_10735450 | 3300025960 | Bacteria | 871 |
| 728 | Ga0207651_11253997 | 3300025960 | Bacteria | 666 |
| 729 | Ga0207651_11456953 | 3300025960 | Unclassified | 616 |
| 730 | Ga0207712_10002781 | 3300025961 | Bacteria | 11191 |
| 731 | Ga0207712_10004441 | 3300025961 | Bacteria | 8860 |
| 732 | Ga0207712_10222552 | 3300025961 | Bacteria | 1510 |
| 733 | Ga0207668_10008817 | 3300025972 | Bacteria | 6027 |
| 734 | Ga0207668_10354205 | 3300025972 | Bacteria | 1228 |
| 735 | Ga0207668_11084489 | 3300025972 | Bacteria | 717 |
| 736 | Ga0207640_10026013 | 3300025981 | Bacteria | 3549 |
| 737 | Ga0207640_10081626 | 3300025981 | Bacteria | 2211 |
| 738 | Ga0207640_10168061 | 3300025981 | Bacteria | 1631 |
| 739 | Ga0207640_10169561 | 3300025981 | Bacteria | 1625 |
| 740 | Ga0207640_10369609 | 3300025981 | Unclassified | 1158 |
| 741 | Ga0207640_10440375 | 3300025981 | Unclassified | 1071 |
| 742 | Ga0207640_11205539 | 3300025981 | Unclassified | 673 |
| 743 | Ga0207658_10081317 | 3300025986 | Bacteria | 2484 |
| 744 | Ga0207677_10060362 | 3300026023 | Bacteria | 2620 |
| 745 | Ga0207677_10117250 | 3300026023 | Bacteria | 1995 |
| 746 | Ga0207677_10691559 | 3300026023 | Unclassified | 904 |
| 747 | Ga0207677_11183576 | 3300026023 | Bacteria | 699 |
| 748 | Ga0207703_10023328 | 3300026035 | Bacteria | 4859 |
| 749 | Ga0207703_10086971 | 3300026035 | Bacteria | 2619 |
| 750 | Ga0207703_10928983 | 3300026035 | Unclassified | 833 |
| 751 | Ga0207639_10044759 | 3300026041 | Bacteria | 3330 |
| 752 | Ga0207639_10077624 | 3300026041 | Bacteria | 2618 |
| 753 | Ga0207639_10081177 | 3300026041 | Bacteria | 2568 |
| 754 | Ga0207639_10106710 | 3300026041 | Bacteria | 2274 |
| 755 | Ga0207639_10493101 | 3300026041 | Bacteria | 1118 |
| 756 | Ga0207639_11406372 | 3300026041 | Bacteria | 655 |
| 757 | Ga0207678_10089128 | 3300026067 | Bacteria | 2637 |
| 758 | Ga0207678_10108073 | 3300026067 | Bacteria | 2373 |
| 759 | Ga0207678_10299400 | 3300026067 | Bacteria | 1382 |
| 760 | Ga0207678_11088519 | 3300026067 | Bacteria | 708 |
| 761 | Ga0207678_11276649 | 3300026067 | Archaea | 650 |
| 762 | Ga0207708_10012277 | 3300026075 | Bacteria | 6385 |
| 763 | Ga0207708_10154609 | 3300026075 | Bacteria | 1808 |
| 764 | Ga0207702_10006267 | 3300026078 | Bacteria | 10280 |
| 765 | Ga0207702_10132534 | 3300026078 | Bacteria | 2244 |
| 766 | Ga0207702_10144212 | 3300026078 | Bacteria | 2159 |
| 767 | Ga0207702_10278638 | 3300026078 | Bacteria | 1580 |
| 768 | Ga0207702_10587193 | 3300026078 | Unclassified | 1092 |
| 769 | Ga0207702_11259226 | 3300026078 | Unclassified | 734 |
| 770 | Ga0207702_11421411 | 3300026078 | Bacteria | 687 |
| 771 | Ga0207641_10117324 | 3300026088 | Bacteria | 2370 |
| 772 | Ga0207641_10853692 | 3300026088 | Unclassified | 902 |
| 773 | Ga0207641_10901825 | 3300026088 | Bacteria | 878 |
| 774 | Ga0207641_11341203 | 3300026088 | Bacteria | 716 |
| 775 | Ga0207648_10051406 | 3300026089 | Bacteria | 3602 |
| 776 | Ga0207648_10446224 | 3300026089 | Bacteria | 1177 |
| 777 | Ga0207676_10389198 | 3300026095 | Unclassified | 1300 |
| 778 | Ga0207676_10619714 | 3300026095 | Bacteria | 1041 |
| 779 | Ga0207674_10005589 | 3300026116 | Bacteria | 14904 |
| 780 | Ga0207674_10020917 | 3300026116 | Bacteria | 7060 |
| 781 | Ga0207674_10031246 | 3300026116 | Bacteria | 5594 |
| 782 | Ga0207674_10416926 | 3300026116 | Unclassified | 1297 |
| 783 | Ga0207674_10603017 | 3300026116 | Bacteria | 1061 |
| 784 | Ga0207674_11110774 | 3300026116 | Unclassified | 760 |
| 785 | Ga0207675_100000194 | 3300026118 | Bacteria | 55678 |
| 786 | Ga0207675_100011701 | 3300026118 | Bacteria | 8205 |
| 787 | Ga0207675_100032337 | 3300026118 | Bacteria | 4873 |
| 788 | Ga0207675_100391415 | 3300026118 | Bacteria | 1368 |
| 789 | Ga0207683_10243751 | 3300026121 | Bacteria | 1640 |
| 790 | Ga0207683_10260582 | 3300026121 | Bacteria | 1583 |
| 791 | Ga0207683_10469974 | 3300026121 | Bacteria | 1160 |
| 792 | Ga0207698_10021480 | 3300026142 | Bacteria | 4465 |
| 793 | Ga0207698_10122838 | 3300026142 | Bacteria | 2201 |
| 794 | Ga0207698_10283573 | 3300026142 | Unclassified | 1533 |
| 795 | Ga0207698_10328431 | 3300026142 | Bacteria | 1436 |
| 796 | Ga0207698_10979604 | 3300026142 | Bacteria | 856 |
| 797 | Ga0207698_11481105 | 3300026142 | Unclassified | 694 |
| 798 | Ga0210000_1002326 | 3300027462 | Bacteria | 2704 |
| 799 | Ga0209968_1004746 | 3300027526 | Bacteria | 2037 |
| 800 | Ga0209999_1010313 | 3300027543 | Bacteria | 1688 |
| 801 | Ga0209588_1101790 | 3300027671 | Bacteria | 924 |
| 802 | Ga0209998_10061686 | 3300027717 | Archaea | 884 |
| 803 | Ga0209974_10448333 | 3300027876 | Unclassified | 512 |
| 804 | Ga0207428_10025733 | 3300027907 | Bacteria | 4922 |
| 805 | Ga0268266_10061223 | 3300028379 | Bacteria | 3246 |
| 806 | Ga0268265_10014944 | 3300028380 | Bacteria | 5300 |
| 807 | Ga0268265_10116687 | 3300028380 | Bacteria | 2191 |
| 808 | Ga0268265_10194003 | 3300028380 | Bacteria | 1756 |
| 809 | Ga0268265_11205977 | 3300028380 | Unclassified | 754 |
| 810 | Ga0268265_11893698 | 3300028380 | Unclassified | 603 |
| 811 | Ga0268264_10003664 | 3300028381 | Bacteria | 13204 |
| 812 | Ga0268264_10006548 | 3300028381 | Bacteria | 9806 |
| 813 | Ga0268264_10226967 | 3300028381 | Bacteria | 1722 |
| 814 | Ga0307408_100057947 | 3300031548 | Bacteria | 2814 |
| 815 | Ga0307408_100258176 | 3300031548 | Unclassified | 1441 |
| 816 | Ga0307408_100295159 | 3300031548 | Bacteria | 1355 |
| 817 | Ga0307408_100740832 | 3300031548 | Bacteria | 887 |
| 818 | Ga0307408_101263041 | 3300031548 | Bacteria | 691 |
| 819 | Ga0307408_102048427 | 3300031548 | Bacteria | 551 |
| 820 | Ga0307405_10171668 | 3300031731 | Bacteria | 1547 |
| 821 | Ga0307405_10195955 | 3300031731 | Bacteria | 1463 |
| 822 | Ga0307405_10502758 | 3300031731 | Bacteria | 972 |
| 823 | Ga0307413_10006005 | 3300031824 | Bacteria | 5496 |
| 824 | Ga0307413_10092855 | 3300031824 | Archaea | 1971 |
| 825 | Ga0307413_10151497 | 3300031824 | Bacteria | 1617 |
| 826 | Ga0307410_10003046 | 3300031852 | Bacteria | 8289 |
| 827 | Ga0307410_10085555 | 3300031852 | Bacteria | 2225 |
| 828 | Ga0307410_11778498 | 3300031852 | Bacteria | 547 |
| 829 | Ga0307406_10006327 | 3300031901 | Bacteria | 6533 |
| 830 | Ga0307406_10870388 | 3300031901 | Bacteria | 765 |
| 831 | Ga0307406_11033597 | 3300031901 | Bacteria | 706 |
| 832 | Ga0307407_10001735 | 3300031903 | Bacteria | 8131 |
| 833 | Ga0307407_10141928 | 3300031903 | Bacteria | 1550 |
| 834 | Ga0307407_11138756 | 3300031903 | Bacteria | 608 |
| 835 | Ga0307412_10172975 | 3300031911 | Bacteria | 1616 |
| 836 | Ga0307412_11152004 | 3300031911 | Bacteria | 692 |
| 837 | Ga0307412_11156818 | 3300031911 | Bacteria | 691 |
| 838 | Ga0307409_100010703 | 3300031995 | Bacteria | 5725 |
| 839 | Ga0307409_100259903 | 3300031995 | Archaea | 1593 |
| 840 | Ga0307416_100033490 | 3300032002 | Bacteria | 3895 |
| 841 | Ga0307416_100133137 | 3300032002 | Bacteria | 2243 |
| 842 | Ga0307416_100153652 | 3300032002 | Bacteria | 2115 |
| 843 | Ga0307416_100502827 | 3300032002 | Archaea | 1277 |
| 844 | Ga0307416_100680077 | 3300032002 | Bacteria | 1116 |
| 845 | Ga0307416_101176896 | 3300032002 | Archaea | 872 |
| 846 | Ga0307416_101818082 | 3300032002 | Unclassified | 713 |
| 847 | Ga0307416_101999763 | 3300032002 | Bacteria | 682 |
| 848 | Ga0307416_102115028 | 3300032002 | Bacteria | 665 |
| 849 | Ga0307416_102750567 | 3300032002 | Bacteria | 588 |
| 850 | Ga0307414_10075039 | 3300032004 | Bacteria | 2453 |
| 851 | Ga0307414_10112967 | 3300032004 | Bacteria | 2072 |
| 852 | Ga0307411_10007654 | 3300032005 | Bacteria | 5526 |
| 853 | Ga0307411_10013915 | 3300032005 | Bacteria | 4459 |
| 854 | Ga0307411_10728189 | 3300032005 | Bacteria | 867 |
| 855 | Ga0307415_100006566 | 3300032126 | Bacteria | 6288 |
| 856 | Ga0373930_0028802 | 3300034816 | Bacteria | 1132 |
| 857 | Ga0373958_0059949 | 3300034819 | Bacteria | 822 |
| 858 | Ga0373949_0168596 | 3300035090 | Unclassified | 642 |
| 859 | Ga0373932_0217142 | 3300035112 | Unclassified | 686 |
| 860 | Ga0373941_0125364 | 3300035115 | Bacteria | 920 |
| 861 | Ga0373941_0188603 | 3300035115 | Bacteria | 778 |
| 862 | Ga0373941_0310210 | 3300035115 | Bacteria | 632 |
| 863 | Ga0373943_0052857 | 3300035170 | Bacteria | 2004 |
| 864 | Ga0373942_0007156 | 3300035207 | Bacteria | 2583 |
| 865 | Ga0373961_0067883 | 3300035241 | Bacteria | 1097 |
| 866 | Ga0373961_0357386 | 3300035241 | Bacteria | 552 |
| 867 | Ga0373924_0181190 | 3300035410 | Bacteria | 927 |
| 868 | Ga0373931_0181281 | 3300035691 | Bacteria | 1247 |
| 869 | Ga0373937_0589309 | 3300036401 | Bacteria | 1056 |
| 870 | Ga0373925_1107769 | 3300037068 | Bacteria | 651 |
| 871 | Ga0395899_0010240 | 3300037312 | Bacteria | 7185 |
| 872 | Ga0395900_0258692 | 3300037418 | Bacteria | 1739 |
| 873 | Ga0395900_0534580 | 3300037418 | Bacteria | 1119 |
| 874 | Ga0395898_0501550 | 3300037466 | Bacteria | 1154 |
| 875 | Ga0395905_0277044 | 3300037471 | Bacteria | 1563 |
| 876 | Ga0395901_0025926 | 3300038443 | Bacteria | 6019 |
| 877 | Ga0436365_0377439 | 3300039437 | Bacteria | 1630 |
| 878 | Ga0436365_0407684 | 3300039437 | Bacteria | 1140 |
| 879 | Ga0436365_0457255 | 3300039437 | Bacteria | 1037 |
| 880 | Ga0436365_0640950 | 3300039437 | Bacteria | 1154 |
| 881 | Ga0436365_1901778 | 3300039437 | Bacteria | 832 |
| 882 | Ga0436361_0682070 | 3300039447 | Unclassified | 622 |
| 883 | Ga0436363_0678176 | 3300039450 | Bacteria | 644 |
| 884 | Ga0436363_1612508 | 3300039450 | Bacteria | 892 |
| 885 | Ga0436363_1614456 | 3300039450 | Bacteria | 607 |
| 886 | Ga0436362_0047691 | 3300039453 | Unclassified | 953 |
| 887 | Ga0436362_0495570 | 3300039453 | Bacteria | 4908 |
| 888 | Ga0451804_0077813 | 3300041463 | Unclassified | 514 |
| 889 | Ga0451853_1915692 | 3300041512 | Bacteria | 1095 |
| 890 | Ga0439433_0061906 | 3300041999 | Unclassified | 893 |
| 891 | Ga0439448_0217146 | 3300042005 | Unclassified | 672 |
| 892 | Ga0439462_0190014 | 3300042015 | Bacteria | 583 |
| 893 | Ga0439459_0034449 | 3300042438 | Bacteria | 1047 |
| 894 | Ga0439464_0260829 | 3300042439 | Bacteria | 561 |
| 895 | Ga0453683_0237773 | 3300044673 | Bacteria | 1160 |
| 896 | Ga0466966_0006428 | 3300044684 | Bacteria | 7774 |
| 897 | Ga0466961_0353716 | 3300044693 | Unclassified | 894 |
| 898 | Ga0466963_0763584 | 3300044694 | Bacteria | 682 |
| 899 | Ga0466968_0131366 | 3300044735 | Unclassified | 1140 |
| 900 | Ga0466959_0138828 | 3300045049 | Unclassified | 1719 |
| 901 | Ga0466959_0245932 | 3300045049 | Unclassified | 1234 |
| 902 | Ga0451576_0096283 | 3300045051 | Bacteria | 3079 |
| 903 | Ga0451576_0324089 | 3300045051 | Bacteria | 1612 |
| 904 | Ga0451576_1938275 | 3300045051 | Bacteria | 607 |
| 905 | Ga0466958_0149700 | 3300045836 | Bacteria | 1472 |
| 906 | Ga0466967_0051428 | 3300045976 | Unclassified | 3611 |
| 907 | Ga0466967_0053164 | 3300045976 | Bacteria | 3559 |
| 908 | Ga0466967_1753547 | 3300045976 | Bacteria | 618 |
| 909 | Ga0495603_0148904 | 3300046455 | Bacteria | 1360 |
| 910 | Ga0495603_0259261 | 3300046455 | Bacteria | 1001 |
| 911 | Ga0495651_0095791 | 3300046462 | Unclassified | 2219 |
| 912 | Ga0495653_0446460 | 3300046463 | Unclassified | 814 |
| 913 | Ga0495580_0241862 | 3300046472 | Unclassified | 1237 |
| 914 | Ga0495580_0274356 | 3300046472 | Bacteria | 1151 |
| 915 | Ga0495582_0051938 | 3300046473 | Bacteria | 2261 |
| 916 | Ga0495639_0035601 | 3300046475 | Unclassified | 2227 |
| 917 | Ga0495639_0341240 | 3300046475 | Unclassified | 751 |
| 918 | Ga0495585_0519111 | 3300046492 | Unclassified | 565 |
| 919 | Ga0495594_0003903 | 3300046499 | Bacteria | 7674 |
| 920 | Ga0495630_0406727 | 3300046517 | Unclassified | 1043 |
| 921 | Ga0495642_0237170 | 3300046528 | Unclassified | 797 |
| 922 | Ga0495642_0283222 | 3300046528 | Unclassified | 726 |
| 923 | Ga0495665_0220187 | 3300046531 | Unclassified | 981 |
| 924 | Ga0495586_0414389 | 3300046535 | Unclassified | 776 |
| 925 | Ga0495586_0718783 | 3300046535 | Archaea | 577 |
| 926 | Ga0495645_0791700 | 3300046543 | Unclassified | 569 |
| 927 | Ga0495635_0269359 | 3300046663 | Unclassified | 1146 |
| 928 | Ga0495588_0106648 | 3300046674 | Unclassified | 1475 |
| 929 | Ga0495657_0099611 | 3300046675 | Unclassified | 1853 |
| 930 | Ga0495623_0072686 | 3300046679 | Bacteria | 2138 |
| 931 | Ga0495646_0282306 | 3300046680 | Unclassified | 882 |
| 932 | Ga0495658_0367988 | 3300046683 | Bacteria | 914 |
| 933 | Ga0495669_0081314 | 3300046684 | Bacteria | 1487 |
| 934 | Ga0495669_0449071 | 3300046684 | Unclassified | 626 |
| 935 | Ga0495613_0213966 | 3300046689 | Bacteria | 1355 |
| 936 | Ga0495624_0913584 | 3300046690 | Bacteria | 516 |
| 937 | Ga0495670_0158102 | 3300046691 | Bacteria | 1190 |
| 938 | Ga0495604_0069017 | 3300047317 | Bacteria | 2680 |
| 939 | Ga0495636_0368365 | 3300047318 | Unclassified | 680 |
| 940 | Ga0495636_0455311 | 3300047318 | Bacteria | 615 |
| 941 | Ga0495675_0031867 | 3300047444 | Bacteria | 3366 |
| 942 | Ga0495684_0580651 | 3300047471 | Bacteria | 759 |
| 943 | Ga0495602_0616594 | 3300048088 | Unclassified | 744 |
| 944 | Ga0496100_0028486 | 3300048903 | Bacteria | 3446 |
| 945 | Ga0496101_0070446 | 3300048904 | Bacteria | 2561 |
| 946 | Ga0496102_0048752 | 3300048905 | Bacteria | 3851 |
| 947 | Ga0496102_0828054 | 3300048905 | Bacteria | 848 |
| 948 | Ga0496103_0153546 | 3300048906 | Bacteria | 1475 |
| 949 | Ga0496104_0230390 | 3300048907 | Bacteria | 1764 |
| 950 | Ga0496104_0379434 | 3300048907 | Bacteria | 1326 |
| 951 | Ga0496105_0019048 | 3300048908 | Bacteria | 5531 |
| 952 | Ga0496105_0311419 | 3300048908 | Bacteria | 1264 |
| 953 | Ga0496106_0008590 | 3300048909 | Bacteria | 7557 |
| 954 | Ga0496106_0176096 | 3300048909 | Bacteria | 1697 |
| 955 | Ga0496106_0239834 | 3300048909 | Bacteria | 1449 |
| 956 | Ga0496106_0483409 | 3300048909 | Bacteria | 995 |
| 957 | Ga0496106_0662024 | 3300048909 | Bacteria | 834 |
| 958 | Ga0496106_1186282 | 3300048909 | Bacteria | 596 |
| 959 | Ga0496107_0140925 | 3300048910 | Bacteria | 1782 |
| 960 | Ga0496107_0398852 | 3300048910 | Bacteria | 1023 |
| 961 | Ga0496107_0939054 | 3300048910 | Unclassified | 629 |
| 962 | Ga0496108_0033441 | 3300048911 | Bacteria | 4272 |
| 963 | Ga0496108_0299849 | 3300048911 | Unclassified | 1400 |
| 964 | Ga0496109_0029870 | 3300048912 | Bacteria | 4884 |
| 965 | Ga0496109_0053468 | 3300048912 | Unclassified | 3683 |
| 966 | Ga0496109_0064850 | 3300048912 | Bacteria | 3343 |
| 967 | Ga0496109_1499451 | 3300048912 | Unclassified | 609 |
| 968 | Ga0496109_1603004 | 3300048912 | Unclassified | 585 |
| 969 | Ga0496110_0268084 | 3300048913 | Bacteria | 1554 |
| 970 | Ga0496111_0014025 | 3300048914 | Bacteria | 5466 |
| 971 | Ga0496112_0190729 | 3300048915 | Bacteria | 2011 |
| 972 | Ga0496112_0276708 | 3300048915 | Bacteria | 1626 |
| 973 | Ga0496112_0339114 | 3300048915 | Bacteria | 1447 |
| 974 | Ga0496112_0381989 | 3300048915 | Bacteria | 1349 |
| 975 | Ga0496113_0041989 | 3300048916 | Bacteria | 3377 |
| 976 | Ga0496113_0268583 | 3300048916 | Unclassified | 1363 |
| 977 | Ga0496114_0677657 | 3300048917 | Unclassified | 905 |
| 978 | Ga0501032_0113263 | 3300049569 | Bacteria | 1794 |
| 979 | Ga0501033_0211316 | 3300049570 | Bacteria | 1383 |
| 980 | Ga0501034_0328126 | 3300049571 | Bacteria | 1462 |
| 981 | Ga0501034_0352675 | 3300049571 | Bacteria | 1399 |
| 982 | Ga0501036_0606533 | 3300049572 | Bacteria | 908 |
| 983 | Ga0501037_0046794 | 3300049573 | Bacteria | 3172 |
| 984 | Ga0501038_0081827 | 3300049574 | Bacteria | 2720 |
| 985 | Ga0501040_0032134 | 3300049576 | Bacteria | 3551 |
| 986 | Ga0501040_0120637 | 3300049576 | Bacteria | 1839 |
| 987 | Ga0501040_0484720 | 3300049576 | Unclassified | 891 |
| 988 | Ga0501041_0863071 | 3300049577 | Unclassified | 581 |
| 989 | Ga0501043_0254745 | 3300049579 | Bacteria | 1351 |
| 990 | Ga0501046_0310997 | 3300049580 | Unclassified | 1149 |
| 991 | Ga0501046_1016568 | 3300049580 | Unclassified | 575 |
| 992 | Ga0501047_0000979 | 3300049581 | Bacteria | 28768 |
| 993 | Ga0501047_0247130 | 3300049581 | Bacteria | 1633 |
| 994 | Ga0501067_0023038 | 3300049583 | Bacteria | 3449 |
| 995 | Ga0501068_0072868 | 3300049584 | Unclassified | 2098 |
| 996 | Ga0501069_0064247 | 3300049585 | Bacteria | 2051 |
| 997 | Ga0501069_0164608 | 3300049585 | Bacteria | 1278 |
| 998 | Ga0501069_0518313 | 3300049585 | Bacteria | 712 |
| 999 | Ga0501070_1315712 | 3300049586 | Unclassified | 551 |
| 1000 | Ga0501071_0122283 | 3300049587 | Unclassified | 1930 |
| 1001 | Ga0501071_0193741 | 3300049587 | Unclassified | 1525 |
| 1002 | Ga0501071_0739627 | 3300049587 | Bacteria | 758 |
| 1003 | Ga0501071_1104195 | 3300049587 | Unclassified | 613 |
| 1004 | Ga0501072_0082776 | 3300049588 | Unclassified | 2544 |
| 1005 | Ga0501072_0198809 | 3300049588 | Unclassified | 1598 |
| 1006 | Ga0501072_0388201 | 3300049588 | Bacteria | 1108 |
| 1007 | Ga0501072_0405816 | 3300049588 | Bacteria | 1081 |
| 1008 | Ga0501072_0633988 | 3300049588 | Bacteria | 842 |
| 1009 | Ga0501074_0435276 | 3300049590 | Archaea | 930 |
| 1010 | Ga0501075_0021755 | 3300049591 | Bacteria | 4678 |
| 1011 | Ga0501075_0261350 | 3300049591 | Bacteria | 1320 |
| 1012 | Ga0501075_0315612 | 3300049591 | Bacteria | 1191 |
| 1013 | Ga0501075_0957784 | 3300049591 | Archaea | 650 |
| 1014 | Ga0501076_0019506 | 3300049592 | Bacteria | 5184 |
| 1015 | Ga0501076_0021161 | 3300049592 | Bacteria | 4986 |
| 1016 | Ga0501076_0921892 | 3300049592 | Unclassified | 720 |
| 1017 | Ga0501077_0026472 | 3300049593 | Bacteria | 3681 |
| 1018 | Ga0501199_066168 | 3300049650 | Unclassified | 512 |
| 1019 | Ga0501216_039772 | 3300049660 | Unclassified | 896 |
| 1020 | Ga0501217_050861 | 3300049661 | Unclassified | 1083 |
| 1021 | Ga0501227_070079 | 3300049665 | Unclassified | 909 |
| 1022 | Ga0501259_101386 | 3300049688 | Unclassified | 661 |
| 1023 | Ga0501225_0276707 | 3300049705 | Archaea | 561 |
| 1024 | Ga0501079_0119386 | 3300049741 | Unclassified | 2050 |
| 1025 | Ga0501079_0169622 | 3300049741 | Bacteria | 1702 |
| 1026 | Ga0501079_0815631 | 3300049741 | Bacteria | 735 |
| 1027 | Ga0501080_0121210 | 3300049742 | Bacteria | 2423 |
| 1028 | Ga0501080_0143109 | 3300049742 | Bacteria | 2211 |
| 1029 | Ga0501081_0271178 | 3300049743 | Bacteria | 1241 |
| 1030 | Ga0501083_0103351 | 3300049744 | Bacteria | 1878 |
| 1031 | Ga0501268_080393 | 3300049765 | Bacteria | 672 |
| 1032 | Ga0501035_0004340 | 3300049822 | Bacteria | 13456 |
| 1033 | Ga0501044_0002943 | 3300049823 | Bacteria | 19370 |
| 1034 | Ga0501045_0006609 | 3300049824 | Bacteria | 8035 |
| 1035 | Ga0501045_0044272 | 3300049824 | Bacteria | 3242 |
| 1036 | Ga0501045_0684710 | 3300049824 | Bacteria | 757 |
| 1037 | nmdc:mga0yw44_216611_c1 | 3300050492 | Bacteria | 1268 |
| 1038 | nmdc:mga05p37_1273889_c1 | 3300050507 | Unclassified | 752 |
| 1039 | nmdc:mga05p37_22632_c1 | 3300050507 | Bacteria | 7620 |
| 1040 | nmdc:mga05p37_253245_c1 | 3300050507 | Bacteria | 2111 |
| 1041 | nmdc:mga05p37_39672_c1 | 3300050507 | Bacteria | 5782 |
| 1042 | nmdc:mga05p37_491275_c1 | 3300050507 | Bacteria | 1411 |
| 1043 | nmdc:mga05p37_666526_c1 | 3300050507 | Bacteria | 1162 |
| 1044 | nmdc:mga05p37_716832_c1 | 3300050507 | Bacteria | 1108 |
| 1045 | nmdc:mga05p37_89760_c1 | 3300050507 | Bacteria | 3787 |
| 1046 | nmdc:mga09592_195714_c1 | 3300050508 | Bacteria | 1750 |
| 1047 | nmdc:mga09592_2664_c1 | 3300050508 | Bacteria | 14437 |
| 1048 | nmdc:mga09592_277949_c1 | 3300050508 | Bacteria | 1452 |
| 1049 | nmdc:mga09592_40263_c1 | 3300050508 | Bacteria | 3925 |
| 1050 | nmdc:mga0qj67_15386_c1 | 3300050509 | Bacteria | 5792 |
| 1051 | nmdc:mga0qj67_37542_c1 | 3300050509 | Bacteria | 3796 |
| 1052 | nmdc:mga0qj67_545440_c1 | 3300050509 | Bacteria | 930 |
| 1053 | nmdc:mga0qj67_995_c1 | 3300050509 | Bacteria | 19545 |
| 1054 | nmdc:mga06r32_1867410_c1 | 3300050510 | Bacteria | 536 |
| 1055 | nmdc:mga06r32_224086_c1 | 3300050510 | Bacteria | 1869 |
| 1056 | nmdc:mga06r32_2309_c1 | 3300050510 | Bacteria | 17069 |
| 1057 | nmdc:mga06r32_35779_c1 | 3300050510 | Bacteria | 4686 |
| 1058 | nmdc:mga06r32_484149_c1 | 3300050510 | Unclassified | 1215 |
| 1059 | nmdc:mga06r32_51372_c1 | 3300050510 | Bacteria | 3945 |
| 1060 | nmdc:mga06r32_593383_c1 | 3300050510 | Bacteria | 1079 |
| 1061 | nmdc:mga08y16_1540852_c1 | 3300050511 | Bacteria | 624 |
| 1062 | nmdc:mga08y16_1972981_c1 | 3300050511 | Bacteria | 533 |
| 1063 | nmdc:mga08y16_22767_c1 | 3300050511 | Bacteria | 6614 |
| 1064 | nmdc:mga08y16_679165_c1 | 3300050511 | Bacteria | 1031 |
| 1065 | nmdc:mga08y16_743619_c1 | 3300050511 | Bacteria | 977 |
| 1066 | nmdc:mga0n895_106107_c1 | 3300050512 | Bacteria | 2822 |
| 1067 | nmdc:mga0n895_1079505_c1 | 3300050512 | Bacteria | 781 |
| 1068 | nmdc:mga0n895_1163127_c1 | 3300050512 | Bacteria | 747 |
| 1069 | nmdc:mga0n895_1232050_c1 | 3300050512 | Bacteria | 721 |
| 1070 | nmdc:mga0n895_129_c1 | 3300050512 | Bacteria | 44904 |
| 1071 | nmdc:mga0n895_130368_c1 | 3300050512 | Bacteria | 2539 |
| 1072 | nmdc:mga0n895_204376_c1 | 3300050512 | Bacteria | 2006 |
| 1073 | nmdc:mga0n895_218348_c1 | 3300050512 | Bacteria | 1936 |
| 1074 | nmdc:mga0n895_320380_c2 | 3300050512 | Bacteria | 997 |
| 1075 | nmdc:mga0n895_458958_c1 | 3300050512 | Bacteria | 1286 |
| 1076 | nmdc:mga0n895_4920_c1 | 3300050512 | Bacteria | 11077 |
| 1077 | nmdc:mga0n895_53532_c1 | 3300050512 | Bacteria | 3966 |
| 1078 | nmdc:mga0n895_79202_c1 | 3300050512 | Bacteria | 3272 |
| 1079 | nmdc:mga0rr50_125372_c1 | 3300050513 | Bacteria | 2050 |
| 1080 | nmdc:mga0rr50_13917_c1 | 3300050513 | Bacteria | 5256 |
| 1081 | nmdc:mga0rr50_155_c1 | 3300050513 | Bacteria | 37210 |
| 1082 | nmdc:mga0rr50_1891035_c1 | 3300050513 | Unclassified | 502 |
| 1083 | nmdc:mga0rr50_346524_c1 | 3300050513 | Bacteria | 1249 |
| 1084 | nmdc:mga0rr50_49369_c1 | 3300050513 | Bacteria | 3115 |
| 1085 | nmdc:mga0rr50_801452_c1 | 3300050513 | Bacteria | 804 |
| 1086 | nmdc:mga08x19_1230161_c1 | 3300050514 | Bacteria | 531 |
| 1087 | nmdc:mga08x19_14843_c1 | 3300050514 | Bacteria | 4730 |
| 1088 | nmdc:mga08x19_182375_c1 | 3300050514 | Bacteria | 1433 |
| 1089 | nmdc:mga08x19_3644_c1 | 3300050514 | Bacteria | 9167 |
| 1090 | nmdc:mga08x19_42637_c1 | 3300050514 | Bacteria | 2894 |
| 1091 | nmdc:mga0a205_112269_c1 | 3300050515 | Bacteria | 2625 |
| 1092 | nmdc:mga0a205_123436_c1 | 3300050515 | Bacteria | 2489 |
| 1093 | nmdc:mga0a205_2838_c1 | 3300050515 | Bacteria | 15323 |
| 1094 | nmdc:mga0a205_296616_c1 | 3300050515 | Bacteria | 1490 |
| 1095 | nmdc:mga0a205_3385_c1 | 3300050515 | Bacteria | 14215 |
| 1096 | nmdc:mga0a205_44168_c1 | 3300050515 | Bacteria | 4295 |
| 1097 | Ga0500628_174500 | 3300053129 | Bacteria | 611 |
| 1098 | Ga0501084_0253369 | 3300054114 | Bacteria | 1486 |
| 1099 | Ga0501084_0409829 | 3300054114 | Unclassified | 1145 |
| 1100 | Ga0501084_1797871 | 3300054114 | Unclassified | 512 |
| 1101 | Ga0590071_033599 | 3300059421 | Bacteria | 1226 |
| 1102 | Ga0590071_158989 | 3300059421 | Archaea | 588 |
| 1103 | Ga0590075_072288 | 3300059424 | Bacteria | 892 |
| 1104 | Ga0590075_218473 | 3300059424 | Unclassified | 505 |
| 1105 | Ga0590077_036050 | 3300059426 | Unclassified | 1090 |
| 1106 | Ga0587066_031592 | 3300059490 | Bacteria | 947 |
| 1107 | Ga0587077_031191 | 3300059493 | Bacteria | 1016 |
| 1108 | Ga0587077_050222 | 3300059493 | Unclassified | 870 |
| 1109 | Ga0587080_010219 | 3300059503 | Bacteria | 1380 |
| 1110 | Ga0587082_038097 | 3300059504 | Bacteria | 870 |
| 1111 | Ga0587083_0075366 | 3300059505 | Bacteria | 792 |
| 1112 | Ga0587086_029037 | 3300059507 | Bacteria | 803 |
| 1113 | Ga0587088_054997 | 3300059508 | Bacteria | 791 |
| 1114 | Ga0587090_021374 | 3300059510 | Bacteria | 1015 |
| 1115 | Ga0587092_023781 | 3300059512 | Bacteria | 968 |
| 1116 | Ga0587094_021924 | 3300059513 | Bacteria | 934 |
| 1117 | Ga0587106_038924 | 3300059605 | Bacteria | 799 |
| 1118 | Ga0587099_058534 | 3300059622 | Bacteria | 527 |
| 1119 | Ga0587101_019847 | 3300059623 | Bacteria | 956 |
| 1120 | Ga0587109_043788 | 3300059624 | Bacteria | 896 |
| 1121 | Ga0587115_030278 | 3300059626 | Bacteria | 801 |
| 1122 | Ga0587062_126179 | 3300059639 | Bacteria | 522 |
| 1123 | Ga0587067_010700 | 3300059640 | Bacteria | 1397 |
| 1124 | Ga0587069_026614 | 3300059642 | Bacteria | 907 |
| 1125 | Ga0587072_056000 | 3300059643 | Bacteria | 802 |
| 1126 | Ga0587075_105819 | 3300059644 | Bacteria | 567 |
| 1127 | Ga0587076_049422 | 3300059645 | Bacteria | 815 |
| 1128 | Ga0587078_011385 | 3300059646 | Bacteria | 1032 |
| 1129 | Ga0587079_059078 | 3300059647 | Bacteria | 826 |
| 1130 | Ga0587107_028879 | 3300059652 | Bacteria | 831 |
| 1131 | Ga0587071_025597 | 3300060344 | Bacteria | 1108 |
| 1132 | Ga0587111_0037261 | 3300060346 | Bacteria | 1022 |
| 1133 | Ga0501082_0474716 | 3300060353 | Unclassified | 1093 |
| 1134 | Ga0501082_0567013 | 3300060353 | Bacteria | 993 |
| 1135 | Ga0501082_0633379 | 3300060353 | Bacteria | 936 |
| 1136 | Ga0530510_0463737 | 3300061734 | Bacteria | 959 |
| 1137 | Ga0530510_0617024 | 3300061734 | Unclassified | 825 |
| 1138 | Ga0530510_1463336 | 3300061734 | Unclassified | 524 |
| 1139 | Ga0065707_10004449 | |||
| 1140 | JGI24746J21847_1034837 | |||
| 1141 | JGI24035J26624_1006140 | |||
| 1142 | rootH1_10324608 | |||
| 1143 | Ga0058859_11593842 | |||
| 1144 | Ga0058863_11689012 | |||
| 1145 | Ga0058860_11839132 | |||
| 1146 | Ga0058862_10060099 | |||
| 1147 | Ga0058862_12082364 | |||
| 1148 | Ga0058862_12420475 | |||
| 1149 | Ga0058862_12676476 | |||
| 1150 | Ga0058862_12814663 | |||
| 1151 | Ga0065704_10117224 | |||
| 1152 | Ga0065712_10075230 | |||
| 1153 | Ga0065712_10149640 | |||
| 1154 | Ga0065715_10003606 | |||
| 1155 | Ga0065715_10009259 | |||
| 1156 | Ga0065715_10090438 | |||
| 1157 | Ga0065715_10092286 | |||
| 1158 | Ga0065715_10100776 | |||
| 1159 | Ga0065715_10152984 | |||
| 1160 | Ga0065707_10087959 | |||
| 1161 | Ga0065707_10288800 | |||
| 1162 | Ga0065707_10403955 | |||
| 1163 | Ga0065707_10769020 | |||
| 1164 | Ga0070658_10020778 | |||
| 1165 | Ga0070658_10095950 | |||
| 1166 | Ga0070658_11709053 | |||
| 1167 | Ga0070676_10005316 | |||
| 1168 | Ga0070676_10022925 | |||
| 1169 | Ga0070676_10041125 | |||
| 1170 | Ga0070676_10055387 | |||
| 1171 | Ga0070683_100001001 | |||
| 1172 | Ga0070683_100055461 | |||
| 1173 | Ga0070683_100074784 | |||
| 1174 | Ga0070683_100130233 | |||
| 1175 | Ga0070683_100291151 | |||
| 1176 | Ga0070683_100435970 | |||
| 1177 | Ga0070683_100486288 | |||
| 1178 | Ga0070690_100026193 | |||
| 1179 | Ga0070690_100043048 | |||
| 1180 | Ga0070690_101034669 | |||
| 1181 | Ga0070670_100077944 | |||
| 1182 | Ga0070670_100238355 | |||
| 1183 | Ga0070670_101396870 | |||
| 1184 | Ga0070677_10569900 | |||
| 1185 | Ga0068869_100006865 | |||
| 1186 | Ga0068869_100013758 | |||
| 1187 | Ga0068869_100047272 | |||
| 1188 | Ga0068869_100265051 | |||
| 1189 | Ga0068869_101834937 | |||
| 1190 | Ga0070666_10635465 | |||
| 1191 | Ga0070680_100016360 | |||
| 1192 | Ga0070680_100026194 | |||
| 1193 | Ga0070680_100040721 | |||
| 1194 | Ga0070680_100042537 | |||
| 1195 | Ga0070680_100158744 | |||
| 1196 | Ga0070680_101257069 | |||
| 1197 | Ga0070682_100004745 | |||
| 1198 | Ga0070682_100008856 | |||
| 1199 | Ga0070682_100031801 | |||
| 1200 | Ga0070682_100052286 | |||
| 1201 | Ga0070682_100125581 | |||
| 1202 | Ga0070682_100189250 | |||
| 1203 | Ga0070682_100508205 | |||
| 1204 | Ga0068868_100005912 | |||
| 1205 | Ga0068868_100352704 | |||
| 1206 | Ga0068868_100428035 | |||
| 1207 | Ga0070660_100033047 | |||
| 1208 | Ga0070660_100054390 | |||
| 1209 | Ga0070660_100074516 | |||
| 1210 | Ga0070660_100085221 | |||
| 1211 | Ga0070689_100016781 | |||
| 1212 | Ga0070689_100120118 | |||
| 1213 | Ga0070689_100357944 | |||
| 1214 | Ga0070689_100507415 | |||
| 1215 | Ga0070689_100615612 | |||
| 1216 | Ga0070689_100750804 | |||
| 1217 | Ga0070691_10033238 | |||
| 1218 | Ga0070687_100000368 | |||
| 1219 | Ga0070687_100487867 | |||
| 1220 | Ga0070687_100819376 | |||
| 1221 | Ga0070661_100009042 | |||
| 1222 | Ga0070661_100073923 | |||
| 1223 | Ga0070661_100095847 | |||
| 1224 | Ga0070661_100411509 | |||
| 1225 | Ga0070692_10020916 | |||
| 1226 | Ga0070692_10176216 | |||
| 1227 | Ga0070692_10285856 | |||
| 1228 | Ga0070692_10979264 | |||
| 1229 | Ga0070692_11286079 | |||
| 1230 | Ga0070668_100001645 | |||
| 1231 | Ga0070668_100011398 | |||
| 1232 | Ga0070668_101501937 | |||
| 1233 | Ga0070669_100009292 | |||
| 1234 | Ga0070669_100071703 | |||
| 1235 | Ga0070669_100395305 | |||
| 1236 | Ga0070669_100902245 | |||
| 1237 | Ga0070669_100958120 | |||
| 1238 | Ga0070675_100003756 | |||
| 1239 | Ga0070675_100381958 | |||
| 1240 | Ga0070675_100517735 | |||
| 1241 | Ga0070675_100972539 | |||
| 1242 | Ga0070671_100084256 | |||
| 1243 | Ga0070674_100142835 | |||
| 1244 | Ga0070674_100376575 | |||
| 1245 | Ga0070673_100082459 | |||
| 1246 | Ga0070673_100082872 | |||
| 1247 | Ga0070673_100308904 | |||
| 1248 | Ga0070673_100360076 | |||
| 1249 | Ga0070688_100064886 | |||
| 1250 | Ga0070659_100013494 | |||
| 1251 | Ga0070659_100020144 | |||
| 1252 | Ga0070659_100070434 | |||
| 1253 | Ga0070659_100102371 | |||
| 1254 | Ga0070659_100275974 | |||
| 1255 | Ga0070659_101802173 | |||
| 1256 | Ga0070659_102073801 | |||
| 1257 | Ga0070667_100049715 | |||
| 1258 | Ga0070703_10036935 | |||
| 1259 | Ga0070703_10222637 | |||
| 1260 | Ga0070709_10362878 | |||
| 1261 | Ga0070709_11355024 | |||
| 1262 | Ga0070714_100177772 | |||
| 1263 | Ga0070714_100252446 | |||
| 1264 | Ga0070714_100259794 | |||
| 1265 | Ga0070714_100361724 | |||
| 1266 | Ga0070714_100715159 | |||
| 1267 | Ga0070714_102110000 | |||
| 1268 | Ga0070713_101078521 | |||
| 1269 | Ga0070713_101699727 | |||
| 1270 | Ga0070713_101746841 | |||
| 1271 | Ga0070713_102090546 | |||
| 1272 | Ga0070710_10009789 | |||
| 1273 | Ga0070710_10330725 | |||
| 1274 | Ga0070701_10001564 | |||
| 1275 | Ga0070701_10019843 | |||
| 1276 | Ga0070701_10170452 | |||
| 1277 | Ga0070711_100181108 | |||
| 1278 | Ga0070711_100302652 | |||
| 1279 | Ga0070705_100133315 | |||
| 1280 | Ga0070705_100855131 | |||
| 1281 | Ga0070700_100012352 | |||
| 1282 | Ga0070700_100124570 | |||
| 1283 | Ga0070700_100229910 | |||
| 1284 | Ga0070694_100236501 | |||
| 1285 | Ga0070694_100249310 | |||
| 1286 | Ga0070694_100345354 | |||
| 1287 | Ga0070694_100400654 | |||
| 1288 | Ga0070694_100752172 | |||
| 1289 | Ga0070708_100000992 | |||
| 1290 | Ga0070708_100018085 | |||
| 1291 | Ga0070663_100446572 | |||
| 1292 | Ga0070663_100625637 | |||
| 1293 | Ga0070663_101383594 | |||
| 1294 | Ga0070678_100267209 | |||
| 1295 | Ga0070678_100269029 | |||
| 1296 | Ga0070678_100412998 | |||
| 1297 | Ga0070662_100003845 | |||
| 1298 | Ga0070662_100105365 | |||
| 1299 | Ga0070662_100510040 | |||
| 1300 | Ga0070662_101229940 | |||
| 1301 | Ga0070662_101527196 | |||
| 1302 | Ga0070662_101819087 | |||
| 1303 | Ga0070681_10001020 | |||
| 1304 | Ga0070681_10006836 | |||
| 1305 | Ga0070681_10020849 | |||
| 1306 | Ga0070681_10027196 | |||
| 1307 | Ga0070681_10028740 | |||
| 1308 | Ga0070681_10037930 | |||
| 1309 | Ga0070681_10081881 | |||
| 1310 | Ga0070681_10087357 | |||
| 1311 | Ga0070681_10152444 | |||
| 1312 | Ga0070681_10232036 | |||
| 1313 | Ga0070681_10416740 | |||
| 1314 | Ga0070681_10454018 | |||
| 1315 | Ga0070681_10496673 | |||
| 1316 | Ga0070681_10526099 | |||
| 1317 | Ga0068867_101399553 | |||
| 1318 | Ga0070685_10005393 | |||
| 1319 | Ga0070685_10648156 | |||
| 1320 | Ga0070706_100143271 | |||
| 1321 | Ga0070706_100491522 | |||
| 1322 | Ga0070706_100581912 | |||
| 1323 | Ga0070706_100971807 | |||
| 1324 | Ga0070707_100029559 | |||
| 1325 | Ga0070707_100285110 | |||
| 1326 | Ga0070698_100017160 | |||
| 1327 | Ga0070698_100203509 | |||
| 1328 | Ga0070699_100022156 | |||
| 1329 | Ga0070699_100032942 | |||
| 1330 | Ga0070699_100135710 | |||
| 1331 | Ga0070699_100288229 | |||
| 1332 | Ga0070699_100766608 | |||
| 1333 | Ga0070699_101377123 | |||
| 1334 | Ga0070699_101519162 | |||
| 1335 | Ga0070679_100001683 | |||
| 1336 | Ga0070679_100010992 | |||
| 1337 | Ga0070679_100016972 | |||
| 1338 | Ga0070679_100040939 | |||
| 1339 | Ga0070679_100048345 | |||
| 1340 | Ga0070679_100080460 | |||
| 1341 | Ga0070679_100179586 | |||
| 1342 | Ga0070679_100219704 | |||
| 1343 | Ga0070679_100345963 | |||
| 1344 | Ga0070679_100878770 | |||
| 1345 | Ga0070684_100000670 | |||
| 1346 | Ga0070684_100056959 | |||
| 1347 | Ga0070684_100092117 | |||
| 1348 | Ga0070684_100093280 | |||
| 1349 | Ga0070684_100168095 | |||
| 1350 | Ga0070684_100178914 | |||
| 1351 | Ga0070684_100199202 | |||
| 1352 | Ga0070684_100422106 | |||
| 1353 | Ga0070684_100453578 | |||
| 1354 | Ga0070684_101035866 | |||
| 1355 | Ga0070684_101454749 | |||
| 1356 | Ga0070697_100382001 | |||
| 1357 | Ga0070697_100812412 | |||
| 1358 | Ga0070697_101651987 | |||
| 1359 | Ga0068853_100023802 | |||
| 1360 | Ga0068853_100046090 | |||
| 1361 | Ga0068853_100086084 | |||
| 1362 | Ga0068853_100279222 | |||
| 1363 | Ga0068853_100600554 | |||
| 1364 | Ga0068853_100683026 | |||
| 1365 | Ga0068853_100995763 | |||
| 1366 | Ga0068853_101306846 | |||
| 1367 | Ga0070672_100032073 | |||
| 1368 | Ga0070672_100172161 | |||
| 1369 | Ga0070672_100351947 | |||
| 1370 | Ga0070672_100362977 | |||
| 1371 | Ga0070672_102143901 | |||
| 1372 | Ga0070686_100099848 | |||
| 1373 | Ga0070686_100857988 | |||
| 1374 | Ga0070695_100013101 | |||
| 1375 | Ga0070695_100050117 | |||
| 1376 | Ga0070695_100161310 | |||
| 1377 | Ga0070695_100597798 | |||
| 1378 | Ga0070696_100001595 | |||
| 1379 | Ga0070696_100348608 | |||
| 1380 | Ga0070693_100001331 | |||
| 1381 | Ga0070693_100014601 | |||
| 1382 | Ga0070693_100047738 | |||
| 1383 | Ga0070693_100064983 | |||
| 1384 | Ga0070693_100137136 | |||
| 1385 | Ga0070693_100256230 | |||
| 1386 | Ga0070693_100324283 | |||
| 1387 | Ga0070693_100332699 | |||
| 1388 | Ga0070665_100060357 | |||
| 1389 | Ga0070665_100197111 | |||
| 1390 | Ga0070665_101234703 | |||
| 1391 | Ga0070665_101279960 | |||
| 1392 | Ga0070704_100020545 | |||
| 1393 | Ga0070704_100169632 | |||
| 1394 | Ga0070704_100955979 | |||
| 1395 | Ga0070704_101131960 | |||
| 1396 | Ga0070704_101677618 | |||
| 1397 | Ga0070704_102226325 | |||
| 1398 | Ga0068855_100002422 | |||
| 1399 | Ga0068855_100023709 | |||
| 1400 | Ga0068855_100037003 | |||
| 1401 | Ga0068855_100364891 | |||
| 1402 | Ga0070664_100003338 | |||
| 1403 | Ga0070664_100006874 | |||
| 1404 | Ga0070664_100031086 | |||
| 1405 | Ga0070664_100037737 | |||
| 1406 | Ga0070664_102100087 | |||
| 1407 | Ga0068857_100013533 | |||
| 1408 | Ga0068857_100166100 | |||
| 1409 | Ga0068857_100297708 | |||
| 1410 | Ga0068857_100978408 | |||
| 1411 | Ga0068857_100987339 | |||
| 1412 | Ga0068857_101885231 | |||
| 1413 | Ga0068854_100022899 | |||
| 1414 | Ga0068854_100158460 | |||
| 1415 | Ga0068854_100191813 | |||
| 1416 | Ga0068854_100355238 | |||
| 1417 | Ga0068854_100761640 | |||
| 1418 | Ga0068854_100895652 | |||
| 1419 | Ga0068856_100022626 | |||
| 1420 | Ga0068856_100195497 | |||
| 1421 | Ga0068856_100279059 | |||
| 1422 | Ga0068856_100294262 | |||
| 1423 | Ga0068856_100347815 | |||
| 1424 | Ga0068856_101434385 | |||
| 1425 | Ga0068856_102084388 | |||
| 1426 | Ga0070702_100200979 | |||
| 1427 | Ga0070702_100547309 | |||
| 1428 | Ga0068852_100004098 | |||
| 1429 | Ga0068852_100073510 | |||
| 1430 | Ga0068852_100123248 | |||
| 1431 | Ga0068852_101035734 | |||
| 1432 | Ga0068852_101551777 | |||
| 1433 | Ga0068859_100018990 | |||
| 1434 | Ga0068859_100053826 | |||
| 1435 | Ga0068859_100545487 | |||
| 1436 | Ga0068859_100924274 | |||
| 1437 | Ga0068859_101579178 | |||
| 1438 | Ga0068859_101680497 | |||
| 1439 | Ga0068864_100141246 | |||
| 1440 | Ga0068864_101131147 | |||
| 1441 | Ga0068864_101332213 | |||
| 1442 | Ga0068864_102703088 | |||
| 1443 | Ga0068866_10020746 | |||
| 1444 | Ga0068861_100070300 | |||
| 1445 | Ga0068861_100073535 | |||
| 1446 | Ga0068861_100169775 | |||
| 1447 | Ga0068861_100685236 | |||
| 1448 | Ga0068851_10002180 | |||
| 1449 | Ga0068851_10024376 | |||
| 1450 | Ga0068870_10013226 | |||
| 1451 | Ga0068870_10399187 | |||
| 1452 | Ga0068863_100004362 | |||
| 1453 | Ga0068863_100076810 | |||
| 1454 | Ga0068863_100347608 | |||
| 1455 | Ga0068863_100700669 | |||
| 1456 | Ga0068858_100008492 | |||
| 1457 | Ga0068858_100050919 | |||
| 1458 | Ga0068860_100017422 | |||
| 1459 | Ga0068860_102006373 | |||
| 1460 | Ga0068862_100011187 | |||
| 1461 | Ga0068862_100030225 | |||
| 1462 | Ga0068862_100788174 | |||
| 1463 | Ga0081539_10000174 | |||
| 1464 | Ga0081539_10175457 | |||
| 1465 | Ga0070717_10043417 | |||
| 1466 | Ga0070717_10487628 | |||
| 1467 | Ga0075365_10032017 | |||
| 1468 | Ga0070715_10410543 | |||
| 1469 | Ga0070715_10464583 | |||
| 1470 | Ga0070716_100057749 | |||
| 1471 | Ga0070716_100168471 | |||
| 1472 | Ga0070716_100286959 | |||
| 1473 | Ga0070716_100670384 | |||
| 1474 | Ga0070712_100063964 | |||
| 1475 | Ga0070712_101073466 | |||
| 1476 | Ga0075427_10034123 | |||
| 1477 | Ga0097621_100000672 | |||
| 1478 | Ga0097621_100018046 | |||
| 1479 | Ga0097621_100146095 | |||
| 1480 | Ga0097621_100205657 | |||
| 1481 | Ga0097621_100501893 | |||
| 1482 | Ga0068871_100000199 | |||
| 1483 | Ga0068871_100015194 | |||
| 1484 | Ga0068871_100168173 | |||
| 1485 | Ga0068871_100335062 | |||
| 1486 | Ga0068871_101839880 | |||
| 1487 | Ga0075428_100001460 | |||
| 1488 | Ga0075428_100148298 | |||
| 1489 | Ga0075428_100160791 | |||
| 1490 | Ga0075428_100168139 | |||
| 1491 | Ga0075428_100337741 | |||
| 1492 | Ga0075430_100001395 | |||
| 1493 | Ga0075430_100007336 | |||
| 1494 | Ga0075430_100064069 | |||
| 1495 | Ga0075430_100627131 | |||
| 1496 | Ga0075431_100011297 | |||
| 1497 | Ga0075431_100034309 | |||
| 1498 | Ga0075431_100085550 | |||
| 1499 | Ga0075431_100139642 | |||
| 1500 | Ga0075431_101761438 | |||
| 1501 | Ga0075431_101953955 | |||
| 1502 | Ga0075433_10000761 | |||
| 1503 | Ga0075433_10008053 | |||
| 1504 | Ga0075433_10038053 | |||
| 1505 | Ga0075433_10058254 | |||
| 1506 | Ga0075433_11975040 | |||
| 1507 | Ga0075434_100000063 | |||
| 1508 | Ga0075434_100013527 | |||
| 1509 | Ga0075434_100039055 | |||
| 1510 | Ga0075434_100059352 | |||
| 1511 | Ga0075434_100224047 | |||
| 1512 | Ga0075434_100245179 | |||
| 1513 | Ga0075434_100258853 | |||
| 1514 | Ga0075434_100309868 | |||
| 1515 | Ga0075434_100585845 | |||
| 1516 | Ga0075434_101208134 | |||
| 1517 | Ga0075434_101522905 | |||
| 1518 | Ga0075429_100007349 | |||
| 1519 | Ga0075429_100218433 | |||
| 1520 | Ga0075429_100232259 | |||
| 1521 | Ga0075429_100395580 | |||
| 1522 | Ga0075429_100884400 | |||
| 1523 | Ga0068865_100007807 | |||
| 1524 | Ga0068865_100136264 | |||
| 1525 | Ga0068865_100312764 | |||
| 1526 | Ga0068865_102146816 | |||
| 1527 | Ga0075436_100011890 | |||
| 1528 | Ga0075436_100082780 | |||
| 1529 | Ga0075436_100308098 | |||
| 1530 | Ga0075436_101479007 | |||
| 1531 | Ga0097620_100018990 | |||
| 1532 | Ga0097620_100053825 | |||
| 1533 | Ga0097620_100545593 | |||
| 1534 | Ga0097620_100924292 | |||
| 1535 | Ga0097620_101579163 | |||
| 1536 | Ga0097620_101680518 | |||
| 1537 | Ga0075435_100003203 | |||
| 1538 | Ga0075435_100015966 | |||
| 1539 | Ga0075435_100102819 | |||
| 1540 | Ga0075435_100138982 | |||
| 1541 | Ga0075435_100359442 | |||
| 1542 | Ga0075435_100614680 | |||
| 1543 | Ga0075435_100710024 | |||
| 1544 | Ga0075435_101941705 | |||
| 1545 | Ga0099794_10121669 | |||
| 1546 | Ga0099794_10192774 | |||
| 1547 | Ga0099794_10332955 | |||
| 1548 | Ga0099794_10560497 | |||
| 1549 | Ga0105240_10038477 | |||
| 1550 | Ga0105240_10044099 | |||
| 1551 | Ga0105240_10093062 | |||
| 1552 | Ga0105240_10169288 | |||
| 1553 | Ga0105240_10194956 | |||
| 1554 | Ga0105240_10250041 | |||
| 1555 | Ga0105240_10408175 | |||
| 1556 | Ga0111539_10023324 | |||
| 1557 | Ga0111539_10330925 | |||
| 1558 | Ga0111539_10957283 | |||
| 1559 | Ga0111539_11126948 | |||
| 1560 | Ga0111539_11419754 | |||
| 1561 | Ga0111539_11779063 | |||
| 1562 | Ga0105245_10042291 | |||
| 1563 | Ga0105245_10482079 | |||
| 1564 | Ga0105245_11018195 | |||
| 1565 | Ga0105245_11823006 | |||
| 1566 | Ga0105247_10364739 | |||
| 1567 | Ga0114129_10013088 | |||
| 1568 | Ga0114129_10016474 | |||
| 1569 | Ga0114129_10255779 | |||
| 1570 | Ga0114129_10578572 | |||
| 1571 | Ga0114129_10864832 | |||
| 1572 | Ga0114129_11407280 | |||
| 1573 | Ga0114129_12619227 | |||
| 1574 | Ga0105241_10074874 | |||
| 1575 | Ga0105241_10620087 | |||
| 1576 | Ga0105241_12014430 | |||
| 1577 | Ga0105242_10062689 | |||
| 1578 | Ga0105242_11298561 | |||
| 1579 | Ga0105242_13289845 | |||
| 1580 | Ga0105248_10032604 | |||
| 1581 | Ga0105248_10074841 | |||
| 1582 | Ga0105248_10311421 | |||
| 1583 | Ga0105248_10498537 | |||
| 1584 | Ga0105248_10614282 | |||
| 1585 | Ga0105237_10019127 | |||
| 1586 | Ga0105237_10467570 | |||
| 1587 | Ga0105237_10659648 | |||
| 1588 | Ga0105237_11164876 | |||
| 1589 | Ga0105238_10008500 | |||
| 1590 | Ga0105238_10009654 | |||
| 1591 | Ga0105238_10043056 | |||
| 1592 | Ga0105249_10001072 | |||
| 1593 | Ga0105249_10005273 | |||
| 1594 | Ga0105249_10008847 | |||
| 1595 | Ga0105249_10238037 | |||
| 1596 | Ga0105249_10529400 | |||
| 1597 | Ga0099796_10152604 | |||
| 1598 | Ga0105239_10004401 | |||
| 1599 | Ga0105239_10018805 | |||
| 1600 | Ga0105239_10350498 | |||
| 1601 | Ga0105239_13023558 | |||
| 1602 | Ga0105239_13217647 | |||
| 1603 | Ga0105246_10364642 | |||
| 1604 | Ga0105246_10548139 | |||
| 1605 | Ga0157317_1020129 | |||
| 1606 | Ga0157313_1004160 | |||
| 1607 | Ga0157373_10067261 | |||
| 1608 | Ga0157373_10242987 | |||
| 1609 | Ga0157373_10279528 | |||
| 1610 | Ga0157371_10012161 | |||
| 1611 | Ga0157371_10049859 | |||
| 1612 | Ga0157371_10271982 | |||
| 1613 | Ga0157371_10440100 | |||
| 1614 | Ga0157370_10023999 | |||
| 1615 | Ga0157370_10525185 | |||
| 1616 | Ga0157370_11159112 | |||
| 1617 | Ga0157370_12074910 | |||
| 1618 | Ga0157369_10025059 | |||
| 1619 | Ga0157369_10038214 | |||
| 1620 | Ga0157369_10045712 | |||
| 1621 | Ga0157369_10117485 | |||
| 1622 | Ga0157369_10288710 | |||
| 1623 | Ga0157369_12301865 | |||
| 1624 | Ga0157374_10024671 | |||
| 1625 | Ga0157374_10076870 | |||
| 1626 | Ga0157374_10112106 | |||
| 1627 | Ga0157378_10010809 | |||
| 1628 | Ga0157378_10505797 | |||
| 1629 | Ga0157378_12994579 | |||
| 1630 | Ga0163162_10015582 | |||
| 1631 | Ga0163162_10016923 | |||
| 1632 | Ga0163162_10423188 | |||
| 1633 | Ga0163162_10622852 | |||
| 1634 | Ga0157372_10001413 | |||
| 1635 | Ga0157372_10013669 | |||
| 1636 | Ga0157372_10020331 | |||
| 1637 | Ga0157372_10073677 | |||
| 1638 | Ga0157372_10085246 | |||
| 1639 | Ga0157372_10222101 | |||
| 1640 | Ga0157372_10358624 | |||
| 1641 | Ga0157372_10896520 | |||
| 1642 | Ga0157372_12017461 | |||
| 1643 | Ga0157372_12795212 | |||
| 1644 | Ga0157375_10040044 | |||
| 1645 | Ga0157375_10066129 | |||
| 1646 | Ga0157375_10146904 | |||
| 1647 | Ga0157375_10705364 | |||
| 1648 | Ga0157375_10730143 | |||
| 1649 | Ga0157375_13555019 | |||
| 1650 | Ga0163163_10130752 | |||
| 1651 | Ga0163163_10801155 | |||
| 1652 | Ga0163163_10904052 | |||
| 1653 | Ga0163163_11197560 | |||
| 1654 | Ga0163163_11484380 | |||
| 1655 | Ga0163163_12649033 | |||
| 1656 | Ga0157380_10067582 | |||
| 1657 | Ga0157380_10080058 | |||
| 1658 | Ga0157380_10784163 | |||
| 1659 | Ga0157380_11255725 | |||
| 1660 | Ga0182008_10005300 | |||
| 1661 | Ga0182008_10036968 | |||
| 1662 | Ga0157377_10000701 | |||
| 1663 | Ga0157377_10357216 | |||
| 1664 | Ga0157379_10042159 | |||
| 1665 | Ga0157376_10337542 | |||
| 1666 | Ga0157376_11030550 | |||
| 1667 | Ga0157376_11568764 | |||
| 1668 | Ga0157376_12040057 | |||
| 1669 | Ga0157376_12412937 | |||
| 1670 | Ga0157376_12567983 | |||
| 1671 | Ga0182006_1038915 | |||
| 1672 | Ga0182007_10004976 | |||
| 1673 | Ga0182007_10095243 | |||
| 1674 | Ga0163161_10038775 | |||
| 1675 | Ga0206356_11439665 | |||
| 1676 | Ga0206356_11691036 | |||
| 1677 | Ga0213873_10019893 | |||
| 1678 | Ga0213876_10331192 | |||
| 1679 | Ga0224712_10374815 | |||
| 1680 | Ga0207673_1052659 | |||
| 1681 | Ga0207697_10004407 | |||
| 1682 | Ga0207697_10016356 | |||
| 1683 | Ga0207656_10004964 | |||
| 1684 | Ga0207656_10022029 | |||
| 1685 | Ga0207653_10026783 | |||
| 1686 | Ga0207682_10005888 | |||
| 1687 | Ga0207682_10058810 | |||
| 1688 | Ga0207682_10426728 | |||
| 1689 | Ga0207692_10052520 | |||
| 1690 | Ga0207692_10243399 | |||
| 1691 | Ga0207642_10091701 | |||
| 1692 | Ga0207710_10219062 | |||
| 1693 | Ga0207688_10013310 | |||
| 1694 | Ga0207688_10111816 | |||
| 1695 | Ga0207688_10558706 | |||
| 1696 | Ga0207647_10043905 | |||
| 1697 | Ga0207685_10823780 | |||
| 1698 | Ga0207699_10014666 | |||
| 1699 | Ga0207699_10029591 | |||
| 1700 | Ga0207699_10503002 | |||
| 1701 | Ga0207645_10003398 | |||
| 1702 | Ga0207645_10011314 | |||
| 1703 | Ga0207645_10048478 | |||
| 1704 | Ga0207643_10008827 | |||
| 1705 | Ga0207643_10399373 | |||
| 1706 | Ga0207705_10169488 | |||
| 1707 | Ga0207705_10409977 | |||
| 1708 | Ga0207684_10014240 | |||
| 1709 | Ga0207684_10070132 | |||
| 1710 | Ga0207684_10490603 | |||
| 1711 | Ga0207654_10065768 | |||
| 1712 | Ga0207654_11363879 | |||
| 1713 | Ga0207707_10001403 | |||
| 1714 | Ga0207707_10004017 | |||
| 1715 | Ga0207707_10008110 | |||
| 1716 | Ga0207707_10009793 | |||
| 1717 | Ga0207707_10013883 | |||
| 1718 | Ga0207707_10043159 | |||
| 1719 | Ga0207707_10064410 | |||
| 1720 | Ga0207707_10083176 | |||
| 1721 | Ga0207707_10222277 | |||
| 1722 | Ga0207707_10298054 | |||
| 1723 | Ga0207707_10300153 | |||
| 1724 | Ga0207707_10558024 | |||
| 1725 | Ga0207707_10891414 | |||
| 1726 | Ga0207695_10006370 | |||
| 1727 | Ga0207695_10091977 | |||
| 1728 | Ga0207695_10107984 | |||
| 1729 | Ga0207695_10121200 | |||
| 1730 | Ga0207695_10223178 | |||
| 1731 | Ga0207671_10044113 | |||
| 1732 | Ga0207671_10092878 | |||
| 1733 | Ga0207671_10522934 | |||
| 1734 | Ga0207671_11240056 | |||
| 1735 | Ga0207671_11460972 | |||
| 1736 | Ga0207693_10857158 | |||
| 1737 | Ga0207663_10251947 | |||
| 1738 | Ga0207663_10717192 | |||
| 1739 | Ga0207660_10004449 | |||
| 1740 | Ga0207660_10012020 | |||
| 1741 | Ga0207660_10044500 | |||
| 1742 | Ga0207660_10087591 | |||
| 1743 | Ga0207660_10177597 | |||
| 1744 | Ga0207660_10186450 | |||
| 1745 | Ga0207660_10963204 | |||
| 1746 | Ga0207662_10002435 | |||
| 1747 | Ga0207662_10041968 | |||
| 1748 | Ga0207662_10816928 | |||
| 1749 | Ga0207662_10961207 | |||
| 1750 | Ga0207662_11069990 | |||
| 1751 | Ga0207657_10001956 | |||
| 1752 | Ga0207657_10011536 | |||
| 1753 | Ga0207657_10024337 | |||
| 1754 | Ga0207657_10198706 | |||
| 1755 | Ga0207657_10686756 | |||
| 1756 | Ga0207649_10021789 | |||
| 1757 | Ga0207649_10028642 | |||
| 1758 | Ga0207649_10032394 | |||
| 1759 | Ga0207649_10216756 | |||
| 1760 | Ga0207652_10005957 | |||
| 1761 | Ga0207652_10007070 | |||
| 1762 | Ga0207652_10032484 | |||
| 1763 | Ga0207652_10061851 | |||
| 1764 | Ga0207652_10131203 | |||
| 1765 | Ga0207652_10138078 | |||
| 1766 | Ga0207652_10153637 | |||
| 1767 | Ga0207652_10198007 | |||
| 1768 | Ga0207652_10454145 | |||
| 1769 | Ga0207652_10740145 | |||
| 1770 | Ga0207652_10784823 | |||
| 1771 | Ga0207646_10065705 | |||
| 1772 | Ga0207646_10175134 | |||
| 1773 | Ga0207646_10471940 | |||
| 1774 | Ga0207646_10840054 | |||
| 1775 | Ga0207646_10995945 | |||
| 1776 | Ga0207646_11804982 | |||
| 1777 | Ga0207681_10041546 | |||
| 1778 | Ga0207681_10051813 | |||
| 1779 | Ga0207681_10412423 | |||
| 1780 | Ga0207681_11305030 | |||
| 1781 | Ga0207694_10074644 | |||
| 1782 | Ga0207694_10296931 | |||
| 1783 | Ga0207694_10345844 | |||
| 1784 | Ga0207650_10121510 | |||
| 1785 | Ga0207650_10856752 | |||
| 1786 | Ga0207650_11468075 | |||
| 1787 | Ga0207650_11599237 | |||
| 1788 | Ga0207659_10023471 | |||
| 1789 | Ga0207659_10122098 | |||
| 1790 | Ga0207659_11294792 | |||
| 1791 | Ga0207687_10071472 | |||
| 1792 | Ga0207687_10281225 | |||
| 1793 | Ga0207700_10016602 | |||
| 1794 | Ga0207700_10629751 | |||
| 1795 | Ga0207700_11006970 | |||
| 1796 | Ga0207700_11350214 | |||
| 1797 | Ga0207700_11700968 | |||
| 1798 | Ga0207664_10025220 | |||
| 1799 | Ga0207664_10159679 | |||
| 1800 | Ga0207664_10253311 | |||
| 1801 | Ga0207664_10587393 | |||
| 1802 | Ga0207664_10674991 | |||
| 1803 | Ga0207644_10081083 | |||
| 1804 | Ga0207644_10098590 | |||
| 1805 | Ga0207644_10652861 | |||
| 1806 | Ga0207644_10890288 | |||
| 1807 | Ga0207644_11685449 | |||
| 1808 | Ga0207690_10005865 | |||
| 1809 | Ga0207690_10045406 | |||
| 1810 | Ga0207690_10082265 | |||
| 1811 | Ga0207690_10091184 | |||
| 1812 | Ga0207690_10232919 | |||
| 1813 | Ga0207690_10956964 | |||
| 1814 | Ga0207706_10001234 | |||
| 1815 | Ga0207706_10041286 | |||
| 1816 | Ga0207706_10074133 | |||
| 1817 | Ga0207706_10344050 | |||
| 1818 | Ga0207706_10432329 | |||
| 1819 | Ga0207706_10580180 | |||
| 1820 | Ga0207706_10660352 | |||
| 1821 | Ga0207706_11294328 | |||
| 1822 | Ga0207686_10375141 | |||
| 1823 | Ga0207670_10028957 | |||
| 1824 | Ga0207670_10416574 | |||
| 1825 | Ga0207670_10605558 | |||
| 1826 | Ga0207669_10210000 | |||
| 1827 | Ga0207669_10420706 | |||
| 1828 | Ga0207704_10250527 | |||
| 1829 | Ga0207704_10265805 | |||
| 1830 | Ga0207665_10004800 | |||
| 1831 | Ga0207665_10147209 | |||
| 1832 | Ga0207665_10222964 | |||
| 1833 | Ga0207665_10506943 | |||
| 1834 | Ga0207665_11401934 | |||
| 1835 | Ga0207691_10002084 | |||
| 1836 | Ga0207691_10002362 | |||
| 1837 | Ga0207691_10040033 | |||
| 1838 | Ga0207691_10323363 | |||
| 1839 | Ga0207711_10124431 | |||
| 1840 | Ga0207711_10928490 | |||
| 1841 | Ga0207689_10008560 | |||
| 1842 | Ga0207689_10011347 | |||
| 1843 | Ga0207689_10067141 | |||
| 1844 | Ga0207689_10282539 | |||
| 1845 | Ga0207661_10003424 | |||
| 1846 | Ga0207661_10015101 | |||
| 1847 | Ga0207661_10154824 | |||
| 1848 | Ga0207661_10163820 | |||
| 1849 | Ga0207661_10184645 | |||
| 1850 | Ga0207661_10257237 | |||
| 1851 | Ga0207661_10266976 | |||
| 1852 | Ga0207661_10303926 | |||
| 1853 | Ga0207661_10508958 | |||
| 1854 | Ga0207679_10006782 | |||
| 1855 | Ga0207679_10011838 | |||
| 1856 | Ga0207679_10216758 | |||
| 1857 | Ga0207679_10313510 | |||
| 1858 | Ga0207679_10844355 | |||
| 1859 | Ga0207679_11137489 | |||
| 1860 | Ga0207679_11926695 | |||
| 1861 | Ga0207667_10037065 | |||
| 1862 | Ga0207667_10079106 | |||
| 1863 | Ga0207667_10112569 | |||
| 1864 | Ga0207667_10211207 | |||
| 1865 | Ga0207651_10735450 | |||
| 1866 | Ga0207651_11253997 | |||
| 1867 | Ga0207651_11456953 | |||
| 1868 | Ga0207712_10002781 | |||
| 1869 | Ga0207712_10004441 | |||
| 1870 | Ga0207712_10222552 | |||
| 1871 | Ga0207668_10008817 | |||
| 1872 | Ga0207668_10354205 | |||
| 1873 | Ga0207668_11084489 | |||
| 1874 | Ga0207640_10026013 | |||
| 1875 | Ga0207640_10081626 | |||
| 1876 | Ga0207640_10168061 | |||
| 1877 | Ga0207640_10169561 | |||
| 1878 | Ga0207640_10369609 | |||
| 1879 | Ga0207640_10440375 | |||
| 1880 | Ga0207640_11205539 | |||
| 1881 | Ga0207658_10081317 | |||
| 1882 | Ga0207677_10060362 | |||
| 1883 | Ga0207677_10117250 | |||
| 1884 | Ga0207677_10691559 | |||
| 1885 | Ga0207677_11183576 | |||
| 1886 | Ga0207703_10023328 | |||
| 1887 | Ga0207703_10086971 | |||
| 1888 | Ga0207703_10928983 | |||
| 1889 | Ga0207639_10044759 | |||
| 1890 | Ga0207639_10077624 | |||
| 1891 | Ga0207639_10081177 | |||
| 1892 | Ga0207639_10106710 | |||
| 1893 | Ga0207639_10493101 | |||
| 1894 | Ga0207639_11406372 | |||
| 1895 | Ga0207678_10089128 | |||
| 1896 | Ga0207678_10108073 | |||
| 1897 | Ga0207678_10299400 | |||
| 1898 | Ga0207678_11088519 | |||
| 1899 | Ga0207678_11276649 | |||
| 1900 | Ga0207708_10012277 | |||
| 1901 | Ga0207708_10154609 | |||
| 1902 | Ga0207702_10006267 | |||
| 1903 | Ga0207702_10132534 | |||
| 1904 | Ga0207702_10144212 | |||
| 1905 | Ga0207702_10278638 | |||
| 1906 | Ga0207702_10587193 | |||
| 1907 | Ga0207702_11259226 | |||
| 1908 | Ga0207702_11421411 | |||
| 1909 | Ga0207641_10117324 | |||
| 1910 | Ga0207641_10853692 | |||
| 1911 | Ga0207641_10901825 | |||
| 1912 | Ga0207641_11341203 | |||
| 1913 | Ga0207648_10051406 | |||
| 1914 | Ga0207648_10446224 | |||
| 1915 | Ga0207676_10389198 | |||
| 1916 | Ga0207676_10619714 | |||
| 1917 | Ga0207674_10005589 | |||
| 1918 | Ga0207674_10020917 | |||
| 1919 | Ga0207674_10031246 | |||
| 1920 | Ga0207674_10416926 | |||
| 1921 | Ga0207674_10603017 | |||
| 1922 | Ga0207674_11110774 | |||
| 1923 | Ga0207675_100000194 | |||
| 1924 | Ga0207675_100011701 | |||
| 1925 | Ga0207675_100032337 | |||
| 1926 | Ga0207675_100391415 | |||
| 1927 | Ga0207683_10243751 | |||
| 1928 | Ga0207683_10260582 | |||
| 1929 | Ga0207683_10469974 | |||
| 1930 | Ga0207698_10021480 | |||
| 1931 | Ga0207698_10122838 | |||
| 1932 | Ga0207698_10283573 | |||
| 1933 | Ga0207698_10328431 | |||
| 1934 | Ga0207698_10979604 | |||
| 1935 | Ga0207698_11481105 | |||
| 1936 | Ga0210000_1002326 | |||
| 1937 | Ga0209968_1004746 | |||
| 1938 | Ga0209999_1010313 | |||
| 1939 | Ga0209588_1101790 | |||
| 1940 | Ga0209998_10061686 | |||
| 1941 | Ga0209974_10448333 | |||
| 1942 | Ga0207428_10025733 | |||
| 1943 | Ga0268266_10061223 | |||
| 1944 | Ga0268265_10014944 | |||
| 1945 | Ga0268265_10116687 | |||
| 1946 | Ga0268265_10194003 | |||
| 1947 | Ga0268265_11205977 | |||
| 1948 | Ga0268265_11893698 | |||
| 1949 | Ga0268264_10003664 | |||
| 1950 | Ga0268264_10006548 | |||
| 1951 | Ga0268264_10226967 | |||
| 1952 | Ga0307408_100057947 | |||
| 1953 | Ga0307408_100258176 | |||
| 1954 | Ga0307408_100295159 | |||
| 1955 | Ga0307408_100740832 | |||
| 1956 | Ga0307408_101263041 | |||
| 1957 | Ga0307408_102048427 | |||
| 1958 | Ga0307405_10171668 | |||
| 1959 | Ga0307405_10195955 | |||
| 1960 | Ga0307405_10502758 | |||
| 1961 | Ga0307413_10006005 | |||
| 1962 | Ga0307413_10092855 | |||
| 1963 | Ga0307413_10151497 | |||
| 1964 | Ga0307410_10003046 | |||
| 1965 | Ga0307410_10085555 | |||
| 1966 | Ga0307410_11778498 | |||
| 1967 | Ga0307406_10006327 | |||
| 1968 | Ga0307406_10870388 | |||
| 1969 | Ga0307406_11033597 | |||
| 1970 | Ga0307407_10001735 | |||
| 1971 | Ga0307407_10141928 | |||
| 1972 | Ga0307407_11138756 | |||
| 1973 | Ga0307412_10172975 | |||
| 1974 | Ga0307412_11152004 | |||
| 1975 | Ga0307412_11156818 | |||
| 1976 | Ga0307409_100010703 | |||
| 1977 | Ga0307409_100259903 | |||
| 1978 | Ga0307416_100033490 | |||
| 1979 | Ga0307416_100133137 | |||
| 1980 | Ga0307416_100153652 | |||
| 1981 | Ga0307416_100502827 | |||
| 1982 | Ga0307416_100680077 | |||
| 1983 | Ga0307416_101176896 | |||
| 1984 | Ga0307416_101818082 | |||
| 1985 | Ga0307416_101999763 | |||
| 1986 | Ga0307416_102115028 | |||
| 1987 | Ga0307416_102750567 | |||
| 1988 | Ga0307414_10075039 | |||
| 1989 | Ga0307414_10112967 | |||
| 1990 | Ga0307411_10007654 | |||
| 1991 | Ga0307411_10013915 | |||
| 1992 | Ga0307411_10728189 | |||
| 1993 | Ga0307415_100006566 | |||
| 1994 | Ga0373930_0028802 | |||
| 1995 | Ga0373958_0059949 | |||
| 1996 | Ga0373949_0168596 | |||
| 1997 | Ga0373932_0217142 | |||
| 1998 | Ga0373941_0125364 | |||
| 1999 | Ga0373941_0188603 | |||
| 2000 | Ga0373941_0310210 | |||
| 2001 | Ga0373943_0052857 | |||
| 2002 | Ga0373942_0007156 | |||
| 2003 | Ga0373961_0067883 | |||
| 2004 | Ga0373961_0357386 | |||
| 2005 | Ga0373924_0181190 | |||
| 2006 | Ga0373931_0181281 | |||
| 2007 | Ga0373937_0589309 | |||
| 2008 | Ga0373925_1107769 | |||
| 2009 | Ga0395899_0010240 | |||
| 2010 | Ga0395900_0258692 | |||
| 2011 | Ga0395900_0534580 | |||
| 2012 | Ga0395898_0501550 | |||
| 2013 | Ga0395905_0277044 | |||
| 2014 | Ga0395901_0025926 | |||
| 2015 | Ga0436365_0377439 | |||
| 2016 | Ga0436365_0407684 | |||
| 2017 | Ga0436365_0457255 | |||
| 2018 | Ga0436365_0640950 | |||
| 2019 | Ga0436365_1901778 | |||
| 2020 | Ga0436361_0682070 | |||
| 2021 | Ga0436363_0678176 | |||
| 2022 | Ga0436363_1612508 | |||
| 2023 | Ga0436363_1614456 | |||
| 2024 | Ga0436362_0047691 | |||
| 2025 | Ga0436362_0495570 | |||
| 2026 | Ga0451804_0077813 | |||
| 2027 | Ga0451853_1915692 | |||
| 2028 | Ga0439433_0061906 | |||
| 2029 | Ga0439448_0217146 | |||
| 2030 | Ga0439462_0190014 | |||
| 2031 | Ga0439459_0034449 | |||
| 2032 | Ga0439464_0260829 | |||
| 2033 | Ga0453683_0237773 | |||
| 2034 | Ga0466966_0006428 | |||
| 2035 | Ga0466961_0353716 | |||
| 2036 | Ga0466963_0763584 | |||
| 2037 | Ga0466968_0131366 | |||
| 2038 | Ga0466959_0138828 | |||
| 2039 | Ga0466959_0245932 | |||
| 2040 | Ga0451576_0096283 | |||
| 2041 | Ga0451576_0324089 | |||
| 2042 | Ga0451576_1938275 | |||
| 2043 | Ga0466958_0149700 | |||
| 2044 | Ga0466967_0051428 | |||
| 2045 | Ga0466967_0053164 | |||
| 2046 | Ga0466967_1753547 | |||
| 2047 | Ga0495603_0148904 | |||
| 2048 | Ga0495603_0259261 | |||
| 2049 | Ga0495651_0095791 | |||
| 2050 | Ga0495653_0446460 | |||
| 2051 | Ga0495580_0241862 | |||
| 2052 | Ga0495580_0274356 | |||
| 2053 | Ga0495582_0051938 | |||
| 2054 | Ga0495639_0035601 | |||
| 2055 | Ga0495639_0341240 | |||
| 2056 | Ga0495585_0519111 | |||
| 2057 | Ga0495594_0003903 | |||
| 2058 | Ga0495630_0406727 | |||
| 2059 | Ga0495642_0237170 | |||
| 2060 | Ga0495642_0283222 | |||
| 2061 | Ga0495665_0220187 | |||
| 2062 | Ga0495586_0414389 | |||
| 2063 | Ga0495586_0718783 | |||
| 2064 | Ga0495645_0791700 | |||
| 2065 | Ga0495635_0269359 | |||
| 2066 | Ga0495588_0106648 | |||
| 2067 | Ga0495657_0099611 | |||
| 2068 | Ga0495623_0072686 | |||
| 2069 | Ga0495646_0282306 | |||
| 2070 | Ga0495658_0367988 | |||
| 2071 | Ga0495669_0081314 | |||
| 2072 | Ga0495669_0449071 | |||
| 2073 | Ga0495613_0213966 | |||
| 2074 | Ga0495624_0913584 | |||
| 2075 | Ga0495670_0158102 | |||
| 2076 | Ga0495604_0069017 | |||
| 2077 | Ga0495636_0368365 | |||
| 2078 | Ga0495636_0455311 | |||
| 2079 | Ga0495675_0031867 | |||
| 2080 | Ga0495684_0580651 | |||
| 2081 | Ga0495602_0616594 | |||
| 2082 | Ga0496100_0028486 | |||
| 2083 | Ga0496101_0070446 | |||
| 2084 | Ga0496102_0048752 | |||
| 2085 | Ga0496102_0828054 | |||
| 2086 | Ga0496103_0153546 | |||
| 2087 | Ga0496104_0230390 | |||
| 2088 | Ga0496104_0379434 | |||
| 2089 | Ga0496105_0019048 | |||
| 2090 | Ga0496105_0311419 | |||
| 2091 | Ga0496106_0008590 | |||
| 2092 | Ga0496106_0176096 | |||
| 2093 | Ga0496106_0239834 | |||
| 2094 | Ga0496106_0483409 | |||
| 2095 | Ga0496106_0662024 | |||
| 2096 | Ga0496106_1186282 | |||
| 2097 | Ga0496107_0140925 | |||
| 2098 | Ga0496107_0398852 | |||
| 2099 | Ga0496107_0939054 | |||
| 2100 | Ga0496108_0033441 | |||
| 2101 | Ga0496108_0299849 | |||
| 2102 | Ga0496109_0029870 | |||
| 2103 | Ga0496109_0053468 | |||
| 2104 | Ga0496109_0064850 | |||
| 2105 | Ga0496109_1499451 | |||
| 2106 | Ga0496109_1603004 | |||
| 2107 | Ga0496110_0268084 | |||
| 2108 | Ga0496111_0014025 | |||
| 2109 | Ga0496112_0190729 | |||
| 2110 | Ga0496112_0276708 | |||
| 2111 | Ga0496112_0339114 | |||
| 2112 | Ga0496112_0381989 | |||
| 2113 | Ga0496113_0041989 | |||
| 2114 | Ga0496113_0268583 | |||
| 2115 | Ga0496114_0677657 | |||
| 2116 | Ga0501032_0113263 | |||
| 2117 | Ga0501033_0211316 | |||
| 2118 | Ga0501034_0328126 | |||
| 2119 | Ga0501034_0352675 | |||
| 2120 | Ga0501036_0606533 | |||
| 2121 | Ga0501037_0046794 | |||
| 2122 | Ga0501038_0081827 | |||
| 2123 | Ga0501040_0032134 | |||
| 2124 | Ga0501040_0120637 | |||
| 2125 | Ga0501040_0484720 | |||
| 2126 | Ga0501041_0863071 | |||
| 2127 | Ga0501043_0254745 | |||
| 2128 | Ga0501046_0310997 | |||
| 2129 | Ga0501046_1016568 | |||
| 2130 | Ga0501047_0000979 | |||
| 2131 | Ga0501047_0247130 | |||
| 2132 | Ga0501067_0023038 | |||
| 2133 | Ga0501068_0072868 | |||
| 2134 | Ga0501069_0064247 | |||
| 2135 | Ga0501069_0164608 | |||
| 2136 | Ga0501069_0518313 | |||
| 2137 | Ga0501070_1315712 | |||
| 2138 | Ga0501071_0122283 | |||
| 2139 | Ga0501071_0193741 | |||
| 2140 | Ga0501071_0739627 | |||
| 2141 | Ga0501071_1104195 | |||
| 2142 | Ga0501072_0082776 | |||
| 2143 | Ga0501072_0198809 | |||
| 2144 | Ga0501072_0388201 | |||
| 2145 | Ga0501072_0405816 | |||
| 2146 | Ga0501072_0633988 | |||
| 2147 | Ga0501074_0435276 | |||
| 2148 | Ga0501075_0021755 | |||
| 2149 | Ga0501075_0261350 | |||
| 2150 | Ga0501075_0315612 | |||
| 2151 | Ga0501075_0957784 | |||
| 2152 | Ga0501076_0019506 | |||
| 2153 | Ga0501076_0021161 | |||
| 2154 | Ga0501076_0921892 | |||
| 2155 | Ga0501077_0026472 | |||
| 2156 | Ga0501199_066168 | |||
| 2157 | Ga0501216_039772 | |||
| 2158 | Ga0501217_050861 | |||
| 2159 | Ga0501227_070079 | |||
| 2160 | Ga0501259_101386 | |||
| 2161 | Ga0501225_0276707 | |||
| 2162 | Ga0501079_0119386 | |||
| 2163 | Ga0501079_0169622 | |||
| 2164 | Ga0501079_0815631 | |||
| 2165 | Ga0501080_0121210 | |||
| 2166 | Ga0501080_0143109 | |||
| 2167 | Ga0501081_0271178 | |||
| 2168 | Ga0501083_0103351 | |||
| 2169 | Ga0501268_080393 | |||
| 2170 | Ga0501035_0004340 | |||
| 2171 | Ga0501044_0002943 | |||
| 2172 | Ga0501045_0006609 | |||
| 2173 | Ga0501045_0044272 | |||
| 2174 | Ga0501045_0684710 | |||
| 2175 | nmdc:mga0yw44_216611_c1 | |||
| 2176 | nmdc:mga05p37_1273889_c1 | |||
| 2177 | nmdc:mga05p37_22632_c1 | |||
| 2178 | nmdc:mga05p37_253245_c1 | |||
| 2179 | nmdc:mga05p37_39672_c1 | |||
| 2180 | nmdc:mga05p37_491275_c1 | |||
| 2181 | nmdc:mga05p37_666526_c1 | |||
| 2182 | nmdc:mga05p37_716832_c1 | |||
| 2183 | nmdc:mga05p37_89760_c1 | |||
| 2184 | nmdc:mga09592_195714_c1 | |||
| 2185 | nmdc:mga09592_2664_c1 | |||
| 2186 | nmdc:mga09592_277949_c1 | |||
| 2187 | nmdc:mga09592_40263_c1 | |||
| 2188 | nmdc:mga0qj67_15386_c1 | |||
| 2189 | nmdc:mga0qj67_37542_c1 | |||
| 2190 | nmdc:mga0qj67_545440_c1 | |||
| 2191 | nmdc:mga0qj67_995_c1 | |||
| 2192 | nmdc:mga06r32_1867410_c1 | |||
| 2193 | nmdc:mga06r32_224086_c1 | |||
| 2194 | nmdc:mga06r32_2309_c1 | |||
| 2195 | nmdc:mga06r32_35779_c1 | |||
| 2196 | nmdc:mga06r32_484149_c1 | |||
| 2197 | nmdc:mga06r32_51372_c1 | |||
| 2198 | nmdc:mga06r32_593383_c1 | |||
| 2199 | nmdc:mga08y16_1540852_c1 | |||
| 2200 | nmdc:mga08y16_1972981_c1 | |||
| 2201 | nmdc:mga08y16_22767_c1 | |||
| 2202 | nmdc:mga08y16_679165_c1 | |||
| 2203 | nmdc:mga08y16_743619_c1 | |||
| 2204 | nmdc:mga0n895_106107_c1 | |||
| 2205 | nmdc:mga0n895_1079505_c1 | |||
| 2206 | nmdc:mga0n895_1163127_c1 | |||
| 2207 | nmdc:mga0n895_1232050_c1 | |||
| 2208 | nmdc:mga0n895_129_c1 | |||
| 2209 | nmdc:mga0n895_130368_c1 | |||
| 2210 | nmdc:mga0n895_204376_c1 | |||
| 2211 | nmdc:mga0n895_218348_c1 | |||
| 2212 | nmdc:mga0n895_320380_c2 | |||
| 2213 | nmdc:mga0n895_458958_c1 | |||
| 2214 | nmdc:mga0n895_4920_c1 | |||
| 2215 | nmdc:mga0n895_53532_c1 | |||
| 2216 | nmdc:mga0n895_79202_c1 | |||
| 2217 | nmdc:mga0rr50_125372_c1 | |||
| 2218 | nmdc:mga0rr50_13917_c1 | |||
| 2219 | nmdc:mga0rr50_155_c1 | |||
| 2220 | nmdc:mga0rr50_1891035_c1 | |||
| 2221 | nmdc:mga0rr50_346524_c1 | |||
| 2222 | nmdc:mga0rr50_49369_c1 | |||
| 2223 | nmdc:mga0rr50_801452_c1 | |||
| 2224 | nmdc:mga08x19_1230161_c1 | |||
| 2225 | nmdc:mga08x19_14843_c1 | |||
| 2226 | nmdc:mga08x19_182375_c1 | |||
| 2227 | nmdc:mga08x19_3644_c1 | |||
| 2228 | nmdc:mga08x19_42637_c1 | |||
| 2229 | nmdc:mga0a205_112269_c1 | |||
| 2230 | nmdc:mga0a205_123436_c1 | |||
| 2231 | nmdc:mga0a205_2838_c1 | |||
| 2232 | nmdc:mga0a205_296616_c1 | |||
| 2233 | nmdc:mga0a205_3385_c1 | |||
| 2234 | nmdc:mga0a205_44168_c1 | |||
| 2235 | Ga0500628_174500 | |||
| 2236 | Ga0501084_0253369 | |||
| 2237 | Ga0501084_0409829 | |||
| 2238 | Ga0501084_1797871 | |||
| 2239 | Ga0590071_033599 | |||
| 2240 | Ga0590071_158989 | |||
| 2241 | Ga0590075_072288 | |||
| 2242 | Ga0590075_218473 | |||
| 2243 | Ga0590077_036050 | |||
| 2244 | Ga0587066_031592 | |||
| 2245 | Ga0587077_031191 | |||
| 2246 | Ga0587077_050222 | |||
| 2247 | Ga0587080_010219 | |||
| 2248 | Ga0587082_038097 | |||
| 2249 | Ga0587083_0075366 | |||
| 2250 | Ga0587086_029037 | |||
| 2251 | Ga0587088_054997 | |||
| 2252 | Ga0587090_021374 | |||
| 2253 | Ga0587092_023781 | |||
| 2254 | Ga0587094_021924 | |||
| 2255 | Ga0587106_038924 | |||
| 2256 | Ga0587099_058534 | |||
| 2257 | Ga0587101_019847 | |||
| 2258 | Ga0587109_043788 | |||
| 2259 | Ga0587115_030278 | |||
| 2260 | Ga0587062_126179 | |||
| 2261 | Ga0587067_010700 | |||
| 2262 | Ga0587069_026614 | |||
| 2263 | Ga0587072_056000 | |||
| 2264 | Ga0587075_105819 | |||
| 2265 | Ga0587076_049422 | |||
| 2266 | Ga0587078_011385 | |||
| 2267 | Ga0587079_059078 | |||
| 2268 | Ga0587107_028879 | |||
| 2269 | Ga0587071_025597 | |||
| 2270 | Ga0587111_0037261 | |||
| 2271 | Ga0501082_0474716 | |||
| 2272 | Ga0501082_0567013 | |||
| 2273 | Ga0501082_0633379 | |||
| 2274 | Ga0530510_0463737 | |||
| 2275 | Ga0530510_0617024 | |||
| 2276 | Ga0530510_1463336 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy