F490626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1136 | 422 | 1136 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10147276|Ga0070710_101472762 |
| Length | 347 |
| Sequence | MKRMSSDGHPALAVRPERGWIGRRGWRVGVLFLIAVVPLVFQDSYWRTNLIVCSINIMLAIGLDFILGYAGQLNLGHSAFYGIGAYASTLLITKLGVPFWVAFVLAIALSGTAGMALSIFAVRLRGHYLAIASLGFAVIVHQILLNWISLTQGPLGIYAIKPPPEIALPGFAPISFSNTANMFYLVAGFAFLFYLLLDQLVRSPIGETLAAIREDEVSASSFGINCARWKVFAFGIGSALAGAAGAFYASFVGTLVPDAFIITESFTILAMVIVGGMGTLIGPVWGAILLTLLPEVLREFGDLRLVLYGAALTLVVLFMPGGMVQAVEILRARVRRSPAAASGGMRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 148 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 275 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 415 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.7 |
| Nodule | 0 |
| Rhizoplane | 7.39 |
| Rhizosphere | 91.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214778551 | 2209111006 | Bacteria | 2529 |
| 2 | ARcpr5oldR_c000028 | 3300000041 | Bacteria | 29588 |
| 3 | ARSoilYngRDRAFT_c00197 | 3300000042 | Bacteria | 10090 |
| 4 | ARcpr5yngRDRAFT_c000089 | 3300000043 | Bacteria | 14792 |
| 5 | ARSoilOldRDRAFT_c000023 | 3300000044 | Bacteria | 34965 |
| 6 | ARCol0oldRDRAFT_c01094 | 3300000045 | Bacteria | 2012 |
| 7 | ARCol0yngRDRAFT_1000216 | 3300000652 | Bacteria | 9710 |
| 8 | JGI24739J22299_10001754 | 3300001989 | Bacteria | 8253 |
| 9 | JGI24737J22298_10001842 | 3300001990 | Bacteria | 7581 |
| 10 | JGI24737J22298_10002044 | 3300001990 | Bacteria | 7221 |
| 11 | JGI24750J21931_1000257 | 3300002070 | Bacteria | 9036 |
| 12 | JGI24745J21846_1001091 | 3300002073 | Bacteria | 2565 |
| 13 | JGI24738J21930_10009098 | 3300002075 | Bacteria | 2246 |
| 14 | JGI24749J21850_1001489 | 3300002076 | Bacteria | 3313 |
| 15 | JGI24035J26624_1000791 | 3300002126 | Bacteria | 2975 |
| 16 | JGI24034J26672_10001294 | 3300002239 | Bacteria | 3296 |
| 17 | JGI25405J52794_10005877 | 3300003911 | Bacteria | 2228 |
| 18 | Ga0065712_10001370 | 3300005290 | Bacteria | 6245 |
| 19 | Ga0065712_10087769 | 3300005290 | Bacteria | 2554 |
| 20 | Ga0065715_10002415 | 3300005293 | Bacteria | 7112 |
| 21 | Ga0065715_10093203 | 3300005293 | Bacteria | 4769 |
| 22 | Ga0065715_10145053 | 3300005293 | Bacteria | 1800 |
| 23 | Ga0065707_10099628 | 3300005295 | Bacteria | 2991 |
| 24 | Ga0070676_10001404 | 3300005328 | Bacteria | 12160 |
| 25 | Ga0070676_10023174 | 3300005328 | Bacteria | 3488 |
| 26 | Ga0070683_100000144 | 3300005329 | Bacteria | 45900 |
| 27 | Ga0070683_100040784 | 3300005329 | Bacteria | 4268 |
| 28 | Ga0070690_100007954 | 3300005330 | Bacteria | 6087 |
| 29 | Ga0070690_100079728 | 3300005330 | Bacteria | 2141 |
| 30 | Ga0070690_100120776 | 3300005330 | Bacteria | 1758 |
| 31 | Ga0070690_100269998 | 3300005330 | Bacteria | 1209 |
| 32 | Ga0070670_100000437 | 3300005331 | Bacteria | 34047 |
| 33 | Ga0070677_10001605 | 3300005333 | Bacteria | 7147 |
| 34 | Ga0068869_100000035 | 3300005334 | Bacteria | 55467 |
| 35 | Ga0068869_100005392 | 3300005334 | Bacteria | 8036 |
| 36 | Ga0070666_10006608 | 3300005335 | Bacteria | 7130 |
| 37 | Ga0070666_10075970 | 3300005335 | Bacteria | 2291 |
| 38 | Ga0070680_100004508 | 3300005336 | Bacteria | 10488 |
| 39 | Ga0070680_100011476 | 3300005336 | Bacteria | 6855 |
| 40 | Ga0070680_100066115 | 3300005336 | Bacteria | 2964 |
| 41 | Ga0070680_100131070 | 3300005336 | Bacteria | 2098 |
| 42 | Ga0070680_100289734 | 3300005336 | Bacteria | 1388 |
| 43 | Ga0070682_100001374 | 3300005337 | Bacteria | 13740 |
| 44 | Ga0070682_100088267 | 3300005337 | Bacteria | 2023 |
| 45 | Ga0070682_100168894 | 3300005337 | Bacteria | 1518 |
| 46 | Ga0068868_100001473 | 3300005338 | Bacteria | 16252 |
| 47 | Ga0068868_100033171 | 3300005338 | Bacteria | 3978 |
| 48 | Ga0070660_100128375 | 3300005339 | Bacteria | 2027 |
| 49 | Ga0070689_100004784 | 3300005340 | Bacteria | 9183 |
| 50 | Ga0070689_100073218 | 3300005340 | Bacteria | 2679 |
| 51 | Ga0070689_100111139 | 3300005340 | Bacteria | 2179 |
| 52 | Ga0070689_100169616 | 3300005340 | Bacteria | 1768 |
| 53 | Ga0070691_10000856 | 3300005341 | Bacteria | 12302 |
| 54 | Ga0070691_10009885 | 3300005341 | Bacteria | 4346 |
| 55 | Ga0070691_10037037 | 3300005341 | Bacteria | 2301 |
| 56 | Ga0070687_100000176 | 3300005343 | Bacteria | 22186 |
| 57 | Ga0070687_100000558 | 3300005343 | Bacteria | 12442 |
| 58 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 59 | Ga0070661_100158977 | 3300005344 | Bacteria | 1711 |
| 60 | Ga0070692_10000008 | 3300005345 | Bacteria | 47438 |
| 61 | Ga0070692_10001408 | 3300005345 | Bacteria | 8710 |
| 62 | Ga0070668_100000699 | 3300005347 | Bacteria | 22898 |
| 63 | Ga0070668_100042943 | 3300005347 | Bacteria | 3465 |
| 64 | Ga0070669_100000250 | 3300005353 | Bacteria | 44115 |
| 65 | Ga0070669_100062049 | 3300005353 | Bacteria | 2747 |
| 66 | Ga0070675_100001268 | 3300005354 | Bacteria | 18442 |
| 67 | Ga0070671_100010911 | 3300005355 | Bacteria | 7296 |
| 68 | Ga0070671_100035832 | 3300005355 | Bacteria | 4112 |
| 69 | Ga0070671_100149160 | 3300005355 | Bacteria | 1974 |
| 70 | Ga0070671_100347631 | 3300005355 | Bacteria | 1265 |
| 71 | Ga0070674_100000443 | 3300005356 | Bacteria | 20920 |
| 72 | Ga0070674_100015526 | 3300005356 | Bacteria | 4755 |
| 73 | Ga0070674_100031450 | 3300005356 | Bacteria | 3517 |
| 74 | Ga0070674_100358706 | 3300005356 | Unclassified | 1180 |
| 75 | Ga0070673_100417179 | 3300005364 | Bacteria | 1203 |
| 76 | Ga0070688_100000669 | 3300005365 | Bacteria | 17042 |
| 77 | Ga0070688_100039934 | 3300005365 | Bacteria | 2873 |
| 78 | Ga0070688_100197993 | 3300005365 | Bacteria | 1404 |
| 79 | Ga0070659_100000214 | 3300005366 | Bacteria | 44422 |
| 80 | Ga0070659_100028165 | 3300005366 | Bacteria | 4336 |
| 81 | Ga0070667_100142337 | 3300005367 | Bacteria | 2101 |
| 82 | Ga0070703_10003840 | 3300005406 | Bacteria | 4253 |
| 83 | Ga0070703_10006816 | 3300005406 | Bacteria | 3205 |
| 84 | Ga0070709_10080195 | 3300005434 | Bacteria | 2127 |
| 85 | Ga0070709_10294034 | 3300005434 | Unclassified | 1184 |
| 86 | Ga0070714_100075417 | 3300005435 | Bacteria | 2926 |
| 87 | Ga0070714_100169471 | 3300005435 | Bacteria | 1981 |
| 88 | Ga0070713_100000889 | 3300005436 | Bacteria | 19162 |
| 89 | Ga0070713_100120844 | 3300005436 | Bacteria | 2297 |
| 90 | Ga0070713_100133338 | 3300005436 | Bacteria | 2193 |
| 91 | Ga0070713_100458299 | 3300005436 | Bacteria | 1198 |
| 92 | Ga0070710_10007734 | 3300005437 | Bacteria | 5213 |
| 93 | Ga0070710_10073374 | 3300005437 | Unclassified | 1978 |
| 94 | Ga0070710_10106695 | 3300005437 | Bacteria | 1676 |
| 95 | Ga0070710_10147276 | 3300005437 | Bacteria | 1449 |
| 96 | Ga0070710_10150698 | 3300005437 | Bacteria | 1434 |
| 97 | Ga0070701_10000060 | 3300005438 | Bacteria | 29083 |
| 98 | Ga0070701_10000099 | 3300005438 | Bacteria | 24473 |
| 99 | Ga0070711_100008511 | 3300005439 | Bacteria | 6288 |
| 100 | Ga0070711_100086439 | 3300005439 | Bacteria | 2248 |
| 101 | Ga0070711_100112898 | 3300005439 | Bacteria | 1997 |
| 102 | Ga0070711_100330665 | 3300005439 | Bacteria | 1220 |
| 103 | Ga0070705_100002404 | 3300005440 | Bacteria | 9423 |
| 104 | Ga0070705_100007847 | 3300005440 | Bacteria | 5271 |
| 105 | Ga0070705_100082098 | 3300005440 | Bacteria | 1982 |
| 106 | Ga0070700_100020018 | 3300005441 | Bacteria | 3870 |
| 107 | Ga0070700_100021932 | 3300005441 | Bacteria | 3717 |
| 108 | Ga0070700_100077093 | 3300005441 | Bacteria | 2142 |
| 109 | Ga0070694_100002437 | 3300005444 | Bacteria | 10982 |
| 110 | Ga0070694_100035517 | 3300005444 | Bacteria | 3296 |
| 111 | Ga0070694_100114653 | 3300005444 | Bacteria | 1925 |
| 112 | Ga0070708_100049987 | 3300005445 | Bacteria | 3700 |
| 113 | Ga0070663_100000201 | 3300005455 | Bacteria | 29751 |
| 114 | Ga0070663_100018330 | 3300005455 | Bacteria | 4588 |
| 115 | Ga0070663_100059497 | 3300005455 | Bacteria | 2746 |
| 116 | Ga0070663_100141160 | 3300005455 | Bacteria | 1839 |
| 117 | Ga0070678_100000698 | 3300005456 | Bacteria | 16599 |
| 118 | Ga0070678_100019190 | 3300005456 | Bacteria | 4451 |
| 119 | Ga0070662_100009421 | 3300005457 | Bacteria | 6381 |
| 120 | Ga0070662_100074141 | 3300005457 | Bacteria | 2517 |
| 121 | Ga0070662_100091430 | 3300005457 | Bacteria | 2286 |
| 122 | Ga0070662_100122382 | 3300005457 | Unclassified | 1995 |
| 123 | Ga0070681_10000401 | 3300005458 | Bacteria | 35170 |
| 124 | Ga0070681_10004036 | 3300005458 | Bacteria | 13848 |
| 125 | Ga0070681_10136429 | 3300005458 | Bacteria | 2384 |
| 126 | Ga0068867_100003556 | 3300005459 | Bacteria | 10958 |
| 127 | Ga0068867_100019105 | 3300005459 | Bacteria | 4880 |
| 128 | Ga0068867_100079393 | 3300005459 | Bacteria | 2470 |
| 129 | Ga0068867_100267334 | 3300005459 | Bacteria | 1397 |
| 130 | Ga0070706_100409301 | 3300005467 | Bacteria | 1263 |
| 131 | Ga0070699_100002181 | 3300005518 | Bacteria | 17723 |
| 132 | Ga0070699_100021000 | 3300005518 | Bacteria | 5630 |
| 133 | Ga0070699_100135854 | 3300005518 | Bacteria | 2169 |
| 134 | Ga0070679_100002086 | 3300005530 | Bacteria | 17991 |
| 135 | Ga0070679_100059355 | 3300005530 | Bacteria | 3813 |
| 136 | Ga0070679_100096460 | 3300005530 | Bacteria | 2944 |
| 137 | Ga0070684_100013364 | 3300005535 | Bacteria | 6616 |
| 138 | Ga0070684_100026194 | 3300005535 | Bacteria | 4910 |
| 139 | Ga0070684_100037443 | 3300005535 | Bacteria | 4161 |
| 140 | Ga0070697_100079463 | 3300005536 | Bacteria | 2700 |
| 141 | Ga0068853_100021340 | 3300005539 | Bacteria | 5399 |
| 142 | Ga0068853_100142299 | 3300005539 | Bacteria | 2154 |
| 143 | Ga0068853_100584395 | 3300005539 | Bacteria | 1060 |
| 144 | Ga0070672_100002749 | 3300005543 | Bacteria | 11264 |
| 145 | Ga0070686_100001254 | 3300005544 | Bacteria | 14395 |
| 146 | Ga0070686_100004877 | 3300005544 | Bacteria | 7403 |
| 147 | Ga0070686_100054001 | 3300005544 | Bacteria | 2568 |
| 148 | Ga0070686_100191787 | 3300005544 | Bacteria | 1459 |
| 149 | Ga0070695_100002011 | 3300005545 | Bacteria | 11595 |
| 150 | Ga0070695_100004254 | 3300005545 | Bacteria | 8374 |
| 151 | Ga0070695_100012651 | 3300005545 | Bacteria | 5067 |
| 152 | Ga0070695_100013109 | 3300005545 | Bacteria | 4981 |
| 153 | Ga0070695_100130295 | 3300005545 | Unclassified | 1733 |
| 154 | Ga0070696_100000304 | 3300005546 | Bacteria | 29759 |
| 155 | Ga0070696_100001197 | 3300005546 | Bacteria | 16837 |
| 156 | Ga0070696_100013066 | 3300005546 | Bacteria | 5571 |
| 157 | Ga0070696_100014702 | 3300005546 | Bacteria | 5253 |
| 158 | Ga0070696_100041998 | 3300005546 | Bacteria | 3161 |
| 159 | Ga0070696_100077658 | 3300005546 | Bacteria | 2346 |
| 160 | Ga0070696_100113480 | 3300005546 | Bacteria | 1953 |
| 161 | Ga0070693_100000507 | 3300005547 | Bacteria | 17464 |
| 162 | Ga0070693_100079312 | 3300005547 | Bacteria | 1953 |
| 163 | Ga0070665_100113074 | 3300005548 | Bacteria | 2718 |
| 164 | Ga0070665_100323436 | 3300005548 | Bacteria | 1547 |
| 165 | Ga0070704_100011172 | 3300005549 | Bacteria | 5491 |
| 166 | Ga0068855_100001779 | 3300005563 | Bacteria | 26944 |
| 167 | Ga0068855_100024209 | 3300005563 | Bacteria | 7267 |
| 168 | Ga0068855_100296061 | 3300005563 | Bacteria | 1793 |
| 169 | Ga0070664_100141250 | 3300005564 | Bacteria | 2120 |
| 170 | Ga0070664_100298093 | 3300005564 | Bacteria | 1456 |
| 171 | Ga0068857_100000494 | 3300005577 | Bacteria | 28282 |
| 172 | Ga0068854_100000139 | 3300005578 | Bacteria | 50270 |
| 173 | Ga0068854_100005384 | 3300005578 | Bacteria | 8078 |
| 174 | Ga0068854_100032879 | 3300005578 | Bacteria | 3612 |
| 175 | Ga0068856_100001571 | 3300005614 | Bacteria | 23910 |
| 176 | Ga0068856_100033405 | 3300005614 | Bacteria | 5037 |
| 177 | Ga0068856_100043275 | 3300005614 | Bacteria | 4431 |
| 178 | Ga0068856_100110487 | 3300005614 | Bacteria | 2746 |
| 179 | Ga0070702_100000039 | 3300005615 | Bacteria | 35203 |
| 180 | Ga0070702_100001018 | 3300005615 | Bacteria | 11112 |
| 181 | Ga0070702_100061340 | 3300005615 | Bacteria | 2189 |
| 182 | Ga0068852_100000193 | 3300005616 | Bacteria | 41505 |
| 183 | Ga0068852_100156571 | 3300005616 | Bacteria | 2123 |
| 184 | Ga0068859_100000420 | 3300005617 | Bacteria | 42401 |
| 185 | Ga0068859_100004926 | 3300005617 | Bacteria | 13578 |
| 186 | Ga0068859_100434693 | 3300005617 | Bacteria | 1409 |
| 187 | Ga0068864_100000226 | 3300005618 | Bacteria | 50929 |
| 188 | Ga0068864_100017359 | 3300005618 | Bacteria | 6000 |
| 189 | Ga0068866_10000153 | 3300005718 | Bacteria | 31527 |
| 190 | Ga0068866_10012260 | 3300005718 | Bacteria | 3733 |
| 191 | Ga0068866_10030148 | 3300005718 | Bacteria | 2600 |
| 192 | Ga0068861_100000328 | 3300005719 | Bacteria | 26783 |
| 193 | Ga0068861_100000987 | 3300005719 | Bacteria | 17369 |
| 194 | Ga0068861_100091989 | 3300005719 | Bacteria | 2396 |
| 195 | Ga0068861_100481965 | 3300005719 | Bacteria | 1118 |
| 196 | Ga0068851_10017494 | 3300005834 | Bacteria | 3444 |
| 197 | Ga0068870_10041901 | 3300005840 | Bacteria | 2381 |
| 198 | Ga0068863_100001214 | 3300005841 | Bacteria | 25744 |
| 199 | Ga0068863_100277037 | 3300005841 | Bacteria | 1624 |
| 200 | Ga0068858_100005931 | 3300005842 | Bacteria | 11927 |
| 201 | Ga0068858_100079607 | 3300005842 | Bacteria | 3044 |
| 202 | Ga0068858_100430500 | 3300005842 | Unclassified | 1269 |
| 203 | Ga0068860_100001525 | 3300005843 | Bacteria | 24947 |
| 204 | Ga0068860_100002022 | 3300005843 | Bacteria | 21401 |
| 205 | Ga0068860_100091469 | 3300005843 | Bacteria | 2898 |
| 206 | Ga0068862_100009697 | 3300005844 | Bacteria | 7961 |
| 207 | Ga0068862_100117504 | 3300005844 | Bacteria | 2340 |
| 208 | Ga0068862_100225499 | 3300005844 | Bacteria | 1698 |
| 209 | Ga0081455_10000035 | 3300005937 | Bacteria | 136366 |
| 210 | Ga0081455_10004348 | 3300005937 | Bacteria | 15947 |
| 211 | Ga0081455_10007158 | 3300005937 | Bacteria | 11801 |
| 212 | Ga0081455_10020443 | 3300005937 | Bacteria | 6233 |
| 213 | Ga0081540_1001366 | 3300005983 | Bacteria | 21169 |
| 214 | Ga0081540_1008092 | 3300005983 | Bacteria | 7384 |
| 215 | Ga0081539_10001081 | 3300005985 | Bacteria | 49568 |
| 216 | Ga0070717_10028516 | 3300006028 | Unclassified | 4469 |
| 217 | Ga0070717_10029796 | 3300006028 | Bacteria | 4382 |
| 218 | Ga0070717_10030004 | 3300006028 | Bacteria | 4368 |
| 219 | Ga0070717_10313718 | 3300006028 | Bacteria | 1396 |
| 220 | Ga0075365_10063307 | 3300006038 | Bacteria | 2476 |
| 221 | Ga0075364_10124299 | 3300006051 | Bacteria | 1729 |
| 222 | Ga0070715_10002401 | 3300006163 | Bacteria | 5740 |
| 223 | Ga0070716_100123844 | 3300006173 | Bacteria | 1623 |
| 224 | Ga0070716_100159796 | 3300006173 | Bacteria | 1459 |
| 225 | Ga0070716_100168643 | 3300006173 | Bacteria | 1426 |
| 226 | Ga0070712_100018658 | 3300006175 | Bacteria | 4510 |
| 227 | Ga0070712_100085305 | 3300006175 | Bacteria | 2298 |
| 228 | Ga0070712_100156818 | 3300006175 | Bacteria | 1754 |
| 229 | Ga0070712_100158036 | 3300006175 | Bacteria | 1748 |
| 230 | Ga0070712_100195555 | 3300006175 | Bacteria | 1585 |
| 231 | Ga0070712_100379315 | 3300006175 | Bacteria | 1163 |
| 232 | Ga0075367_10071105 | 3300006178 | Bacteria | 2093 |
| 233 | Ga0075427_10001215 | 3300006194 | Bacteria | 3271 |
| 234 | Ga0097621_100000049 | 3300006237 | Bacteria | 61062 |
| 235 | Ga0097621_100042579 | 3300006237 | Bacteria | 3658 |
| 236 | Ga0097621_100121071 | 3300006237 | Bacteria | 2219 |
| 237 | Ga0068871_100000097 | 3300006358 | Bacteria | 52015 |
| 238 | Ga0068871_100005049 | 3300006358 | Bacteria | 9218 |
| 239 | Ga0068871_100012551 | 3300006358 | Bacteria | 6253 |
| 240 | Ga0068871_100314907 | 3300006358 | Unclassified | 1376 |
| 241 | Ga0068871_100605553 | 3300006358 | Bacteria | 997 |
| 242 | Ga0075428_100000109 | 3300006844 | Bacteria | 69948 |
| 243 | Ga0075428_100001911 | 3300006844 | Bacteria | 22354 |
| 244 | Ga0075428_100003032 | 3300006844 | Bacteria | 18343 |
| 245 | Ga0075430_100000587 | 3300006846 | Bacteria | 27593 |
| 246 | Ga0075431_100006439 | 3300006847 | Bacteria | 11656 |
| 247 | Ga0075431_100265331 | 3300006847 | Bacteria | 1742 |
| 248 | Ga0075433_10000020 | 3300006852 | Bacteria | 61231 |
| 249 | Ga0075433_10022455 | 3300006852 | Bacteria | 5295 |
| 250 | Ga0075433_10052790 | 3300006852 | Archaea | 3543 |
| 251 | Ga0075434_100000349 | 3300006871 | Bacteria | 33394 |
| 252 | Ga0075434_100000383 | 3300006871 | Bacteria | 32396 |
| 253 | Ga0075434_100002124 | 3300006871 | Bacteria | 17253 |
| 254 | Ga0075434_100008956 | 3300006871 | Bacteria | 9320 |
| 255 | Ga0075434_100022971 | 3300006871 | Bacteria | 6071 |
| 256 | Ga0075434_100170341 | 3300006871 | Bacteria | 2197 |
| 257 | Ga0075429_100001264 | 3300006880 | Bacteria | 20583 |
| 258 | Ga0075429_100001660 | 3300006880 | Bacteria | 18412 |
| 259 | Ga0075429_100344656 | 3300006880 | Bacteria | 1304 |
| 260 | Ga0068865_100000119 | 3300006881 | Bacteria | 39895 |
| 261 | Ga0068865_100002459 | 3300006881 | Bacteria | 10967 |
| 262 | Ga0068865_100013953 | 3300006881 | Bacteria | 5096 |
| 263 | Ga0075436_100000075 | 3300006914 | Bacteria | 59554 |
| 264 | Ga0075436_100009889 | 3300006914 | Bacteria | 6523 |
| 265 | Ga0075436_100162440 | 3300006914 | Bacteria | 1575 |
| 266 | Ga0075436_100291853 | 3300006914 | Unclassified | 1167 |
| 267 | Ga0075436_100332668 | 3300006914 | Bacteria | 1093 |
| 268 | Ga0097620_100000420 | 3300006931 | Bacteria | 42401 |
| 269 | Ga0097620_100004926 | 3300006931 | Bacteria | 13578 |
| 270 | Ga0097620_100434665 | 3300006931 | Bacteria | 1409 |
| 271 | Ga0075435_100000116 | 3300007076 | Bacteria | 44259 |
| 272 | Ga0075435_100010428 | 3300007076 | Bacteria | 6798 |
| 273 | Ga0075435_100068235 | 3300007076 | Bacteria | 2896 |
| 274 | Ga0075435_100084229 | 3300007076 | Bacteria | 2616 |
| 275 | Ga0075435_100086474 | 3300007076 | Bacteria | 2582 |
| 276 | Ga0075435_100106012 | 3300007076 | Bacteria | 2333 |
| 277 | Ga0099794_10004509 | 3300007265 | Bacteria | 5484 |
| 278 | Ga0099794_10011922 | 3300007265 | Bacteria | 3737 |
| 279 | Ga0105240_10043010 | 3300009093 | Bacteria | 5753 |
| 280 | Ga0105240_10142934 | 3300009093 | Bacteria | 2859 |
| 281 | Ga0111539_10000237 | 3300009094 | Bacteria | 65638 |
| 282 | Ga0111539_10000373 | 3300009094 | Bacteria | 55466 |
| 283 | Ga0111539_10005738 | 3300009094 | Bacteria | 16054 |
| 284 | Ga0111539_10039849 | 3300009094 | Bacteria | 5658 |
| 285 | Ga0111539_10119492 | 3300009094 | Bacteria | 3089 |
| 286 | Ga0111539_10183865 | 3300009094 | Bacteria | 2441 |
| 287 | Ga0105245_10000202 | 3300009098 | Bacteria | 57012 |
| 288 | Ga0105245_10000533 | 3300009098 | Bacteria | 34922 |
| 289 | Ga0105245_10059377 | 3300009098 | Bacteria | 3444 |
| 290 | Ga0105245_10079781 | 3300009098 | Bacteria | 2989 |
| 291 | Ga0105247_10006779 | 3300009101 | Bacteria | 7063 |
| 292 | Ga0105247_10043825 | 3300009101 | Bacteria | 2742 |
| 293 | Ga0105247_10061305 | 3300009101 | Bacteria | 2332 |
| 294 | Ga0105247_10200075 | 3300009101 | Bacteria | 1342 |
| 295 | Ga0114129_10001030 | 3300009147 | Bacteria | 36420 |
| 296 | Ga0114129_10007859 | 3300009147 | Bacteria | 15175 |
| 297 | Ga0114129_10014462 | 3300009147 | Bacteria | 11245 |
| 298 | Ga0114129_10032825 | 3300009147 | Bacteria | 7335 |
| 299 | Ga0114129_10062119 | 3300009147 | Bacteria | 5219 |
| 300 | Ga0114129_10098133 | 3300009147 | Bacteria | 4055 |
| 301 | Ga0114129_10104720 | 3300009147 | Bacteria | 3910 |
| 302 | Ga0114129_10367322 | 3300009147 | Bacteria | 1903 |
| 303 | Ga0105243_10000495 | 3300009148 | Bacteria | 40193 |
| 304 | Ga0105243_10002106 | 3300009148 | Bacteria | 16836 |
| 305 | Ga0105243_10079714 | 3300009148 | Bacteria | 2669 |
| 306 | Ga0105243_10090495 | 3300009148 | Bacteria | 2518 |
| 307 | Ga0105243_10133051 | 3300009148 | Bacteria | 2113 |
| 308 | Ga0105241_10000430 | 3300009174 | Bacteria | 31789 |
| 309 | Ga0105241_10026871 | 3300009174 | Bacteria | 4284 |
| 310 | Ga0105241_10034348 | 3300009174 | Bacteria | 3809 |
| 311 | Ga0105241_10390499 | 3300009174 | Unclassified | 1218 |
| 312 | Ga0105242_10000248 | 3300009176 | Bacteria | 42523 |
| 313 | Ga0105242_10003639 | 3300009176 | Bacteria | 12003 |
| 314 | Ga0105242_10335081 | 3300009176 | Bacteria | 1392 |
| 315 | Ga0105248_10023208 | 3300009177 | Bacteria | 6889 |
| 316 | Ga0105248_10095373 | 3300009177 | Bacteria | 3349 |
| 317 | Ga0105248_10383812 | 3300009177 | Bacteria | 1582 |
| 318 | Ga0105237_10028031 | 3300009545 | Bacteria | 5739 |
| 319 | Ga0105237_10059994 | 3300009545 | Bacteria | 3806 |
| 320 | Ga0105237_10085558 | 3300009545 | Bacteria | 3143 |
| 321 | Ga0105237_10228124 | 3300009545 | Bacteria | 1863 |
| 322 | Ga0105238_10166511 | 3300009551 | Bacteria | 2180 |
| 323 | Ga0105249_10000215 | 3300009553 | Bacteria | 66439 |
| 324 | Ga0105249_10004892 | 3300009553 | Bacteria | 11560 |
| 325 | Ga0105249_10029800 | 3300009553 | Bacteria | 4931 |
| 326 | Ga0105249_10031327 | 3300009553 | Bacteria | 4809 |
| 327 | Ga0105249_10283487 | 3300009553 | Bacteria | 1655 |
| 328 | Ga0099796_10006479 | 3300010159 | Bacteria | 2998 |
| 329 | Ga0105239_10015015 | 3300010375 | Bacteria | 8585 |
| 330 | Ga0105239_10054877 | 3300010375 | Bacteria | 4371 |
| 331 | Ga0105239_10077348 | 3300010375 | Bacteria | 3661 |
| 332 | Ga0105239_10263627 | 3300010375 | Bacteria | 1937 |
| 333 | Ga0105239_10277795 | 3300010375 | Bacteria | 1885 |
| 334 | Ga0105246_10000019 | 3300011119 | Bacteria | 62666 |
| 335 | Ga0105246_10018242 | 3300011119 | Bacteria | 4471 |
| 336 | Ga0105246_10049993 | 3300011119 | Bacteria | 2866 |
| 337 | Ga0105246_10177655 | 3300011119 | Bacteria | 1636 |
| 338 | Ga0157320_1001286 | 3300012481 | Bacteria | 1242 |
| 339 | Ga0157342_1002013 | 3300012507 | Bacteria | 1595 |
| 340 | Ga0157371_10085937 | 3300013102 | Bacteria | 2228 |
| 341 | Ga0157374_10039059 | 3300013296 | Bacteria | 4366 |
| 342 | Ga0157374_10141328 | 3300013296 | Bacteria | 2337 |
| 343 | Ga0157378_10000387 | 3300013297 | Bacteria | 43542 |
| 344 | Ga0157378_10003335 | 3300013297 | Bacteria | 14284 |
| 345 | Ga0157378_10022727 | 3300013297 | Bacteria | 5520 |
| 346 | Ga0157378_10127694 | 3300013297 | Bacteria | 2351 |
| 347 | Ga0163162_10013606 | 3300013306 | Bacteria | 7949 |
| 348 | Ga0163162_10027382 | 3300013306 | Bacteria | 5637 |
| 349 | Ga0163162_10030184 | 3300013306 | Bacteria | 5371 |
| 350 | Ga0163162_10090707 | 3300013306 | Bacteria | 3138 |
| 351 | Ga0163162_10238685 | 3300013306 | Bacteria | 1948 |
| 352 | Ga0163162_10397754 | 3300013306 | Bacteria | 1510 |
| 353 | Ga0163162_10448923 | 3300013306 | Unclassified | 1421 |
| 354 | Ga0157372_10110740 | 3300013307 | Bacteria | 3145 |
| 355 | Ga0157372_10179250 | 3300013307 | Bacteria | 2452 |
| 356 | Ga0157372_10236654 | 3300013307 | Bacteria | 2118 |
| 357 | Ga0157375_10004516 | 3300013308 | Bacteria | 12092 |
| 358 | Ga0157375_10049998 | 3300013308 | Bacteria | 4099 |
| 359 | Ga0157375_10081858 | 3300013308 | Bacteria | 3269 |
| 360 | Ga0163163_10025278 | 3300014325 | Bacteria | 5662 |
| 361 | Ga0163163_10073419 | 3300014325 | Bacteria | 3412 |
| 362 | Ga0163163_10111370 | 3300014325 | Bacteria | 2766 |
| 363 | Ga0163163_10148262 | 3300014325 | Bacteria | 2390 |
| 364 | Ga0157380_10003569 | 3300014326 | Bacteria | 10699 |
| 365 | Ga0157380_10006409 | 3300014326 | Bacteria | 8284 |
| 366 | Ga0157380_10067440 | 3300014326 | Bacteria | 2881 |
| 367 | Ga0157377_10000507 | 3300014745 | Bacteria | 16565 |
| 368 | Ga0157377_10136276 | 3300014745 | Unclassified | 1504 |
| 369 | Ga0157379_10000065 | 3300014968 | Bacteria | 67475 |
| 370 | Ga0157379_10023744 | 3300014968 | Bacteria | 5444 |
| 371 | Ga0157379_10106227 | 3300014968 | Bacteria | 2520 |
| 372 | Ga0157379_10114902 | 3300014968 | Bacteria | 2419 |
| 373 | Ga0157379_10141086 | 3300014968 | Bacteria | 2172 |
| 374 | Ga0157379_10157585 | 3300014968 | Bacteria | 2048 |
| 375 | Ga0157376_10004198 | 3300014969 | Bacteria | 9993 |
| 376 | Ga0157376_10190298 | 3300014969 | Bacteria | 1881 |
| 377 | Ga0163161_10016674 | 3300017792 | Bacteria | 5132 |
| 378 | Ga0213872_10033133 | 3300021361 | Bacteria | 2367 |
| 379 | Ga0213876_10039419 | 3300021384 | Bacteria | 2496 |
| 380 | Ga0213876_10070602 | 3300021384 | Bacteria | 1845 |
| 381 | Ga0213875_10000236 | 3300021388 | Bacteria | 55426 |
| 382 | Ga0224572_1002511 | 3300024225 | Bacteria | 2978 |
| 383 | Ga0207666_1000278 | 3300025271 | Bacteria | 7296 |
| 384 | Ga0207673_1000135 | 3300025290 | Bacteria | 7012 |
| 385 | Ga0207697_10000287 | 3300025315 | Bacteria | 28055 |
| 386 | Ga0207697_10012481 | 3300025315 | Bacteria | 3561 |
| 387 | Ga0207653_10005645 | 3300025885 | Bacteria | 3907 |
| 388 | Ga0207682_10000437 | 3300025893 | Bacteria | 19265 |
| 389 | Ga0207682_10006813 | 3300025893 | Bacteria | 4583 |
| 390 | Ga0207692_10008757 | 3300025898 | Bacteria | 4201 |
| 391 | Ga0207692_10022895 | 3300025898 | Bacteria | 2882 |
| 392 | Ga0207692_10051741 | 3300025898 | Bacteria | 2084 |
| 393 | Ga0207692_10055998 | 3300025898 | Bacteria | 2021 |
| 394 | Ga0207692_10089007 | 3300025898 | Bacteria | 1670 |
| 395 | Ga0207642_10000268 | 3300025899 | Bacteria | 15628 |
| 396 | Ga0207642_10026058 | 3300025899 | Bacteria | 2375 |
| 397 | Ga0207642_10071895 | 3300025899 | Bacteria | 1649 |
| 398 | Ga0207710_10050960 | 3300025900 | Bacteria | 1858 |
| 399 | Ga0207710_10085245 | 3300025900 | Unclassified | 1471 |
| 400 | Ga0207688_10000014 | 3300025901 | Bacteria | 59269 |
| 401 | Ga0207688_10062810 | 3300025901 | Bacteria | 2094 |
| 402 | Ga0207680_10059057 | 3300025903 | Bacteria | 2328 |
| 403 | Ga0207647_10079629 | 3300025904 | Bacteria | 1966 |
| 404 | Ga0207699_10016704 | 3300025906 | Bacteria | 3845 |
| 405 | Ga0207699_10040563 | 3300025906 | Bacteria | 2683 |
| 406 | Ga0207699_10111005 | 3300025906 | Unclassified | 1757 |
| 407 | Ga0207699_10114665 | 3300025906 | Unclassified | 1733 |
| 408 | Ga0207645_10000160 | 3300025907 | Bacteria | 53155 |
| 409 | Ga0207645_10018769 | 3300025907 | Bacteria | 4543 |
| 410 | Ga0207645_10031128 | 3300025907 | Bacteria | 3434 |
| 411 | Ga0207645_10074384 | 3300025907 | Bacteria | 2175 |
| 412 | Ga0207645_10083440 | 3300025907 | Bacteria | 2050 |
| 413 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 414 | Ga0207643_10203387 | 3300025908 | Bacteria | 1207 |
| 415 | Ga0207684_10183814 | 3300025910 | Bacteria | 1803 |
| 416 | Ga0207654_10119375 | 3300025911 | Bacteria | 1653 |
| 417 | Ga0207654_10203483 | 3300025911 | Bacteria | 1305 |
| 418 | Ga0207707_10000554 | 3300025912 | Bacteria | 37851 |
| 419 | Ga0207707_10005043 | 3300025912 | Bacteria | 11589 |
| 420 | Ga0207707_10017033 | 3300025912 | Bacteria | 6330 |
| 421 | Ga0207695_10055352 | 3300025913 | Bacteria | 4134 |
| 422 | Ga0207695_10182322 | 3300025913 | Bacteria | 2020 |
| 423 | Ga0207671_10076822 | 3300025914 | Bacteria | 2499 |
| 424 | Ga0207693_10011540 | 3300025915 | Bacteria | 7145 |
| 425 | Ga0207693_10015209 | 3300025915 | Bacteria | 6176 |
| 426 | Ga0207693_10026066 | 3300025915 | Bacteria | 4629 |
| 427 | Ga0207693_10042033 | 3300025915 | Bacteria | 3598 |
| 428 | Ga0207693_10042666 | 3300025915 | Bacteria | 3571 |
| 429 | Ga0207693_10072874 | 3300025915 | Bacteria | 2689 |
| 430 | Ga0207693_10087489 | 3300025915 | Bacteria | 2441 |
| 431 | Ga0207693_10146736 | 3300025915 | Bacteria | 1855 |
| 432 | Ga0207693_10158135 | 3300025915 | Bacteria | 1783 |
| 433 | Ga0207693_10239140 | 3300025915 | Bacteria | 1425 |
| 434 | Ga0207693_10305071 | 3300025915 | Bacteria | 1247 |
| 435 | Ga0207663_10059430 | 3300025916 | Bacteria | 2418 |
| 436 | Ga0207663_10122498 | 3300025916 | Bacteria | 1783 |
| 437 | Ga0207663_10127841 | 3300025916 | Bacteria | 1751 |
| 438 | Ga0207663_10264372 | 3300025916 | Bacteria | 1272 |
| 439 | Ga0207663_10318662 | 3300025916 | Bacteria | 1168 |
| 440 | Ga0207660_10000347 | 3300025917 | Bacteria | 30042 |
| 441 | Ga0207660_10002432 | 3300025917 | Bacteria | 12227 |
| 442 | Ga0207660_10094631 | 3300025917 | Bacteria | 2221 |
| 443 | Ga0207660_10123744 | 3300025917 | Bacteria | 1962 |
| 444 | Ga0207660_10138205 | 3300025917 | Bacteria | 1861 |
| 445 | Ga0207662_10000095 | 3300025918 | Bacteria | 41923 |
| 446 | Ga0207662_10000130 | 3300025918 | Bacteria | 36097 |
| 447 | Ga0207662_10084999 | 3300025918 | Bacteria | 1937 |
| 448 | Ga0207662_10108833 | 3300025918 | Bacteria | 1726 |
| 449 | Ga0207657_10000980 | 3300025919 | Bacteria | 30300 |
| 450 | Ga0207657_10006209 | 3300025919 | Bacteria | 12420 |
| 451 | Ga0207657_10015897 | 3300025919 | Bacteria | 7270 |
| 452 | Ga0207649_10006224 | 3300025920 | Bacteria | 6481 |
| 453 | Ga0207649_10232726 | 3300025920 | Bacteria | 1318 |
| 454 | Ga0207652_10000364 | 3300025921 | Bacteria | 47007 |
| 455 | Ga0207652_10027928 | 3300025921 | Bacteria | 4706 |
| 456 | Ga0207652_10197563 | 3300025921 | Bacteria | 1810 |
| 457 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 458 | Ga0207650_10163657 | 3300025925 | Bacteria | 1764 |
| 459 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 460 | Ga0207687_10000432 | 3300025927 | Bacteria | 28412 |
| 461 | Ga0207687_10000556 | 3300025927 | Bacteria | 25111 |
| 462 | Ga0207687_10025653 | 3300025927 | Bacteria | 3944 |
| 463 | Ga0207700_10002968 | 3300025928 | Bacteria | 9783 |
| 464 | Ga0207700_10028689 | 3300025928 | Bacteria | 3918 |
| 465 | Ga0207700_10051819 | 3300025928 | Bacteria | 3065 |
| 466 | Ga0207700_10245476 | 3300025928 | Unclassified | 1528 |
| 467 | Ga0207664_10052248 | 3300025929 | Bacteria | 3232 |
| 468 | Ga0207644_10058816 | 3300025931 | Bacteria | 2779 |
| 469 | Ga0207644_10243623 | 3300025931 | Unclassified | 1432 |
| 470 | Ga0207690_10000056 | 3300025932 | Bacteria | 101387 |
| 471 | Ga0207706_10000307 | 3300025933 | Bacteria | 52944 |
| 472 | Ga0207706_10026539 | 3300025933 | Bacteria | 5185 |
| 473 | Ga0207706_10042358 | 3300025933 | Bacteria | 4035 |
| 474 | Ga0207706_10042772 | 3300025933 | Bacteria | 4015 |
| 475 | Ga0207706_10395560 | 3300025933 | Bacteria | 1198 |
| 476 | Ga0207686_10002300 | 3300025934 | Bacteria | 10462 |
| 477 | Ga0207686_10007325 | 3300025934 | Bacteria | 5938 |
| 478 | Ga0207686_10032928 | 3300025934 | Bacteria | 3089 |
| 479 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 480 | Ga0207709_10000939 | 3300025935 | Bacteria | 21844 |
| 481 | Ga0207709_10061229 | 3300025935 | Bacteria | 2351 |
| 482 | Ga0207670_10000640 | 3300025936 | Bacteria | 18610 |
| 483 | Ga0207670_10058064 | 3300025936 | Bacteria | 2627 |
| 484 | Ga0207670_10090367 | 3300025936 | Bacteria | 2163 |
| 485 | Ga0207670_10091278 | 3300025936 | Bacteria | 2154 |
| 486 | Ga0207670_10122212 | 3300025936 | Bacteria | 1895 |
| 487 | Ga0207669_10000052 | 3300025937 | Bacteria | 58284 |
| 488 | Ga0207669_10045066 | 3300025937 | Bacteria | 2597 |
| 489 | Ga0207669_10154765 | 3300025937 | Unclassified | 1611 |
| 490 | Ga0207704_10000063 | 3300025938 | Bacteria | 74699 |
| 491 | Ga0207704_10000281 | 3300025938 | Bacteria | 24286 |
| 492 | Ga0207704_10012711 | 3300025938 | Bacteria | 4184 |
| 493 | Ga0207704_10139850 | 3300025938 | Bacteria | 1692 |
| 494 | Ga0207704_10192525 | 3300025938 | Bacteria | 1485 |
| 495 | Ga0207665_10032460 | 3300025939 | Bacteria | 3458 |
| 496 | Ga0207665_10065004 | 3300025939 | Bacteria | 2480 |
| 497 | Ga0207665_10078353 | 3300025939 | Bacteria | 2270 |
| 498 | Ga0207665_10080556 | 3300025939 | Bacteria | 2240 |
| 499 | Ga0207691_10000167 | 3300025940 | Bacteria | 60999 |
| 500 | Ga0207691_10005072 | 3300025940 | Bacteria | 12711 |
| 501 | Ga0207711_10001619 | 3300025941 | Bacteria | 20775 |
| 502 | Ga0207711_10070212 | 3300025941 | Bacteria | 3037 |
| 503 | Ga0207711_10074947 | 3300025941 | Bacteria | 2944 |
| 504 | Ga0207711_10209112 | 3300025941 | Bacteria | 1782 |
| 505 | Ga0207711_10231960 | 3300025941 | Bacteria | 1691 |
| 506 | Ga0207689_10000155 | 3300025942 | Bacteria | 59178 |
| 507 | Ga0207689_10003028 | 3300025942 | Bacteria | 15486 |
| 508 | Ga0207661_10000072 | 3300025944 | Bacteria | 69126 |
| 509 | Ga0207679_10000057 | 3300025945 | Bacteria | 104912 |
| 510 | Ga0207712_10000122 | 3300025961 | Bacteria | 83730 |
| 511 | Ga0207712_10027485 | 3300025961 | Bacteria | 3800 |
| 512 | Ga0207712_10071730 | 3300025961 | Bacteria | 2492 |
| 513 | Ga0207668_10000084 | 3300025972 | Bacteria | 70850 |
| 514 | Ga0207668_10038479 | 3300025972 | Bacteria | 3211 |
| 515 | Ga0207668_10042376 | 3300025972 | Bacteria | 3082 |
| 516 | Ga0207640_10001119 | 3300025981 | Bacteria | 14773 |
| 517 | Ga0207640_10018411 | 3300025981 | Bacteria | 4105 |
| 518 | Ga0207658_10003175 | 3300025986 | Bacteria | 11727 |
| 519 | Ga0207658_10226445 | 3300025986 | Bacteria | 1576 |
| 520 | Ga0207677_10000549 | 3300026023 | Bacteria | 23737 |
| 521 | Ga0207677_10002928 | 3300026023 | Bacteria | 9017 |
| 522 | Ga0207703_10006621 | 3300026035 | Bacteria | 9243 |
| 523 | Ga0207703_10089838 | 3300026035 | Bacteria | 2580 |
| 524 | Ga0207703_10161007 | 3300026035 | Bacteria | 1966 |
| 525 | Ga0207703_10293696 | 3300026035 | Bacteria | 1480 |
| 526 | Ga0207639_10002231 | 3300026041 | Bacteria | 13024 |
| 527 | Ga0207639_10190382 | 3300026041 | Bacteria | 1752 |
| 528 | Ga0207639_10767504 | 3300026041 | Bacteria | 897 |
| 529 | Ga0207678_10000187 | 3300026067 | Bacteria | 53154 |
| 530 | Ga0207678_10009676 | 3300026067 | Bacteria | 8478 |
| 531 | Ga0207678_10060604 | 3300026067 | Bacteria | 3255 |
| 532 | Ga0207708_10000158 | 3300026075 | Bacteria | 53154 |
| 533 | Ga0207708_10011537 | 3300026075 | Bacteria | 6583 |
| 534 | Ga0207708_10015344 | 3300026075 | Bacteria | 5746 |
| 535 | Ga0207708_10018227 | 3300026075 | Bacteria | 5285 |
| 536 | Ga0207708_10118119 | 3300026075 | Bacteria | 2065 |
| 537 | Ga0207702_10009588 | 3300026078 | Bacteria | 8129 |
| 538 | Ga0207702_10030968 | 3300026078 | Bacteria | 4458 |
| 539 | Ga0207702_10060859 | 3300026078 | Bacteria | 3219 |
| 540 | Ga0207641_10004012 | 3300026088 | Bacteria | 12844 |
| 541 | Ga0207641_10169494 | 3300026088 | Bacteria | 1991 |
| 542 | Ga0207641_10347340 | 3300026088 | Bacteria | 1413 |
| 543 | Ga0207648_10000513 | 3300026089 | Bacteria | 43298 |
| 544 | Ga0207648_10001167 | 3300026089 | Bacteria | 29390 |
| 545 | Ga0207648_10018167 | 3300026089 | Bacteria | 6370 |
| 546 | Ga0207676_10000089 | 3300026095 | Bacteria | 82462 |
| 547 | Ga0207676_10105477 | 3300026095 | Bacteria | 2346 |
| 548 | Ga0207676_10121061 | 3300026095 | Bacteria | 2207 |
| 549 | Ga0207674_10001478 | 3300026116 | Bacteria | 30348 |
| 550 | Ga0207674_10023656 | 3300026116 | Bacteria | 6577 |
| 551 | Ga0207675_100000229 | 3300026118 | Bacteria | 52966 |
| 552 | Ga0207675_100003827 | 3300026118 | Bacteria | 14645 |
| 553 | Ga0207675_100011672 | 3300026118 | Bacteria | 8215 |
| 554 | Ga0207683_10015823 | 3300026121 | Bacteria | 6422 |
| 555 | Ga0207683_10094497 | 3300026121 | Bacteria | 2665 |
| 556 | Ga0207683_10164365 | 3300026121 | Bacteria | 2008 |
| 557 | Ga0207698_10008027 | 3300026142 | Bacteria | 6655 |
| 558 | Ga0210002_1009797 | 3300027617 | Bacteria | 1464 |
| 559 | Ga0209983_1008764 | 3300027665 | Bacteria | 2064 |
| 560 | Ga0209966_1008159 | 3300027695 | Bacteria | 1853 |
| 561 | Ga0209998_10001281 | 3300027717 | Bacteria | 6152 |
| 562 | Ga0209974_10011045 | 3300027876 | Bacteria | 3039 |
| 563 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 564 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 565 | Ga0207428_10002963 | 3300027907 | Bacteria | 16796 |
| 566 | Ga0207428_10005877 | 3300027907 | Bacteria | 11370 |
| 567 | Ga0207428_10170483 | 3300027907 | Bacteria | 1649 |
| 568 | Ga0268266_10024070 | 3300028379 | Bacteria | 5182 |
| 569 | Ga0268265_10000195 | 3300028380 | Bacteria | 70871 |
| 570 | Ga0268265_10049058 | 3300028380 | Bacteria | 3173 |
| 571 | Ga0268265_10057224 | 3300028380 | Bacteria | 2970 |
| 572 | Ga0268265_10080795 | 3300028380 | Bacteria | 2565 |
| 573 | Ga0268264_10000827 | 3300028381 | Bacteria | 33217 |
| 574 | Ga0268264_10233848 | 3300028381 | Bacteria | 1698 |
| 575 | Ga0265763_1000560 | 3300030763 | Unclassified | 2321 |
| 576 | Ga0265760_10027023 | 3300031090 | Bacteria | 1681 |
| 577 | Ga0265325_10000025 | 3300031241 | Bacteria | 111160 |
| 578 | Ga0265329_10006698 | 3300031242 | Bacteria | 4546 |
| 579 | Ga0265340_10006313 | 3300031247 | Bacteria | 6536 |
| 580 | Ga0265340_10044966 | 3300031247 | Bacteria | 2159 |
| 581 | Ga0265339_10030352 | 3300031249 | Bacteria | 3061 |
| 582 | Ga0265331_10015729 | 3300031250 | Bacteria | 3988 |
| 583 | Ga0265316_10081309 | 3300031344 | Bacteria | 2484 |
| 584 | Ga0265314_10041579 | 3300031711 | Bacteria | 3288 |
| 585 | Ga0307411_10127812 | 3300032005 | Bacteria | 1852 |
| 586 | Ga0373930_0003621 | 3300034816 | Bacteria | 2464 |
| 587 | Ga0373930_0017229 | 3300034816 | Bacteria | 1375 |
| 588 | Ga0373948_0000063 | 3300034817 | Bacteria | 11215 |
| 589 | Ga0373948_0001356 | 3300034817 | Bacteria | 3365 |
| 590 | Ga0373948_0004636 | 3300034817 | Bacteria | 2187 |
| 591 | Ga0373950_0001407 | 3300034818 | Bacteria | 3133 |
| 592 | Ga0373958_0000880 | 3300034819 | Bacteria | 3866 |
| 593 | Ga0373959_0000720 | 3300034820 | Bacteria | 5658 |
| 594 | Ga0373959_0001299 | 3300034820 | Bacteria | 4007 |
| 595 | Ga0373938_0000709 | 3300034957 | Bacteria | 5388 |
| 596 | Ga0373938_0002401 | 3300034957 | Bacteria | 3018 |
| 597 | Ga0373926_0000002 | 3300035083 | Bacteria | 53301 |
| 598 | Ga0373926_0006472 | 3300035083 | Bacteria | 3889 |
| 599 | Ga0373926_0010654 | 3300035083 | Bacteria | 3082 |
| 600 | Ga0373926_0036051 | 3300035083 | Bacteria | 1756 |
| 601 | Ga0373928_0001013 | 3300035084 | Bacteria | 5524 |
| 602 | Ga0373934_0027576 | 3300035086 | Bacteria | 2208 |
| 603 | Ga0373934_0067049 | 3300035086 | Bacteria | 1433 |
| 604 | Ga0373940_0000150 | 3300035088 | Bacteria | 9058 |
| 605 | Ga0373940_0002381 | 3300035088 | Bacteria | 3646 |
| 606 | Ga0373940_0005451 | 3300035088 | Bacteria | 2757 |
| 607 | Ga0373944_0000048 | 3300035089 | Bacteria | 19324 |
| 608 | Ga0373949_0001637 | 3300035090 | Bacteria | 6254 |
| 609 | Ga0373949_0012358 | 3300035090 | Bacteria | 1888 |
| 610 | Ga0373951_0000729 | 3300035091 | Bacteria | 9030 |
| 611 | Ga0373951_0002183 | 3300035091 | Bacteria | 4980 |
| 612 | Ga0373951_0011908 | 3300035091 | Bacteria | 1956 |
| 613 | Ga0373952_0000170 | 3300035092 | Bacteria | 10000 |
| 614 | Ga0373952_0013195 | 3300035092 | Bacteria | 1635 |
| 615 | Ga0373923_0000329 | 3300035111 | Bacteria | 10639 |
| 616 | Ga0373923_0002488 | 3300035111 | Bacteria | 5688 |
| 617 | Ga0373932_0000475 | 3300035112 | Bacteria | 12299 |
| 618 | Ga0373932_0004768 | 3300035112 | Bacteria | 3197 |
| 619 | Ga0373936_0000294 | 3300035113 | Bacteria | 16691 |
| 620 | Ga0373936_0007009 | 3300035113 | Bacteria | 4241 |
| 621 | Ga0373936_0029273 | 3300035113 | Bacteria | 2167 |
| 622 | Ga0373939_0000360 | 3300035114 | Bacteria | 11493 |
| 623 | Ga0373939_0002626 | 3300035114 | Bacteria | 4221 |
| 624 | Ga0373939_0003930 | 3300035114 | Bacteria | 3496 |
| 625 | Ga0373939_0013757 | 3300035114 | Bacteria | 2088 |
| 626 | Ga0373939_0018600 | 3300035114 | Bacteria | 1864 |
| 627 | Ga0373941_0001632 | 3300035115 | Bacteria | 4780 |
| 628 | Ga0373941_0001926 | 3300035115 | Bacteria | 4497 |
| 629 | Ga0373945_0000229 | 3300035116 | Bacteria | 15364 |
| 630 | Ga0373945_0004261 | 3300035116 | Bacteria | 4537 |
| 631 | Ga0373945_0005926 | 3300035116 | Bacteria | 3924 |
| 632 | Ga0373945_0014923 | 3300035116 | Unclassified | 2608 |
| 633 | Ga0373945_0017503 | 3300035116 | Bacteria | 2427 |
| 634 | Ga0373953_0000738 | 3300035117 | Bacteria | 9052 |
| 635 | Ga0373954_0004843 | 3300035118 | Bacteria | 5806 |
| 636 | Ga0373954_0007246 | 3300035118 | Bacteria | 4846 |
| 637 | Ga0373954_0008120 | 3300035118 | Bacteria | 4599 |
| 638 | Ga0373954_0067687 | 3300035118 | Bacteria | 1693 |
| 639 | Ga0373956_0002040 | 3300035119 | Bacteria | 8362 |
| 640 | Ga0373956_0002776 | 3300035119 | Bacteria | 7085 |
| 641 | Ga0373956_0006169 | 3300035119 | Bacteria | 4796 |
| 642 | Ga0373960_0001914 | 3300035121 | Bacteria | 4656 |
| 643 | Ga0373960_0053993 | 3300035121 | Bacteria | 1200 |
| 644 | Ga0373943_0010040 | 3300035170 | Bacteria | 4246 |
| 645 | Ga0373943_0010245 | 3300035170 | Bacteria | 4204 |
| 646 | Ga0373943_0012370 | 3300035170 | Bacteria | 3840 |
| 647 | Ga0373943_0035046 | 3300035170 | Bacteria | 2396 |
| 648 | Ga0373946_0000495 | 3300035171 | Bacteria | 13074 |
| 649 | Ga0373946_0010279 | 3300035171 | Bacteria | 3461 |
| 650 | Ga0373946_0019270 | 3300035171 | Bacteria | 2628 |
| 651 | Ga0373946_0021423 | 3300035171 | Bacteria | 2506 |
| 652 | Ga0373946_0043991 | 3300035171 | Bacteria | 1842 |
| 653 | Ga0373946_0045297 | 3300035171 | Bacteria | 1819 |
| 654 | Ga0373955_0000152 | 3300035172 | Bacteria | 27633 |
| 655 | Ga0373955_0001108 | 3300035172 | Bacteria | 11455 |
| 656 | Ga0373955_0010682 | 3300035172 | Bacteria | 4346 |
| 657 | Ga0373955_0155450 | 3300035172 | Bacteria | 1347 |
| 658 | Ga0373955_0223941 | 3300035172 | Unclassified | 1124 |
| 659 | Ga0373942_0001717 | 3300035207 | Bacteria | 5566 |
| 660 | Ga0373961_0002411 | 3300035241 | Bacteria | 4859 |
| 661 | Ga0373961_0018064 | 3300035241 | Bacteria | 1838 |
| 662 | Ga0373962_0000682 | 3300035242 | Bacteria | 7670 |
| 663 | Ga0373924_0029564 | 3300035410 | Bacteria | 2191 |
| 664 | Ga0373931_0000082 | 3300035691 | Bacteria | 44600 |
| 665 | Ga0373931_0021215 | 3300035691 | Bacteria | 3258 |
| 666 | Ga0373931_0037892 | 3300035691 | Bacteria | 2519 |
| 667 | Ga0373931_0043352 | 3300035691 | Bacteria | 2369 |
| 668 | Ga0373931_0056956 | 3300035691 | Bacteria | 2095 |
| 669 | Ga0373931_0079083 | 3300035691 | Bacteria | 1810 |
| 670 | Ga0373935_0000006 | 3300035692 | Bacteria | 121726 |
| 671 | Ga0373935_0017917 | 3300035692 | Bacteria | 4302 |
| 672 | Ga0373935_0023549 | 3300035692 | Bacteria | 3784 |
| 673 | Ga0373935_0025526 | 3300035692 | Bacteria | 3641 |
| 674 | Ga0373935_0051992 | 3300035692 | Bacteria | 2603 |
| 675 | Ga0373935_0140792 | 3300035692 | Unclassified | 1629 |
| 676 | Ga0373927_0005584 | 3300035695 | Bacteria | 8648 |
| 677 | Ga0373927_0011621 | 3300035695 | Bacteria | 5861 |
| 678 | Ga0373927_0012717 | 3300035695 | Bacteria | 5597 |
| 679 | Ga0373927_0012866 | 3300035695 | Bacteria | 5563 |
| 680 | Ga0373927_0104213 | 3300035695 | Bacteria | 1846 |
| 681 | Ga0373933_0004823 | 3300035724 | Bacteria | 7368 |
| 682 | Ga0373933_0011958 | 3300035724 | Bacteria | 4791 |
| 683 | Ga0373933_0016241 | 3300035724 | Bacteria | 4160 |
| 684 | Ga0373933_0018766 | 3300035724 | Bacteria | 3893 |
| 685 | Ga0373933_0052103 | 3300035724 | Unclassified | 2448 |
| 686 | Ga0373933_0083697 | 3300035724 | Bacteria | 1959 |
| 687 | Ga0373933_0090664 | 3300035724 | Bacteria | 1886 |
| 688 | Ga0373947_0001906 | 3300035725 | Bacteria | 12751 |
| 689 | Ga0373947_0003131 | 3300035725 | Bacteria | 9843 |
| 690 | Ga0373947_0003242 | 3300035725 | Bacteria | 9655 |
| 691 | Ga0373947_0026258 | 3300035725 | Bacteria | 3402 |
| 692 | Ga0373947_0085831 | 3300035725 | Bacteria | 1955 |
| 693 | Ga0373947_0223803 | 3300035725 | Bacteria | 1237 |
| 694 | Ga0373937_0000165 | 3300036401 | Bacteria | 63984 |
| 695 | Ga0373937_0001536 | 3300036401 | Bacteria | 19417 |
| 696 | Ga0373937_0002909 | 3300036401 | Bacteria | 14306 |
| 697 | Ga0373937_0008865 | 3300036401 | Bacteria | 8731 |
| 698 | Ga0373937_0018097 | 3300036401 | Bacteria | 6286 |
| 699 | Ga0373937_0132885 | 3300036401 | Unclassified | 2325 |
| 700 | Ga0373925_0000475 | 3300037068 | Bacteria | 40083 |
| 701 | Ga0373925_0001065 | 3300037068 | Bacteria | 24770 |
| 702 | Ga0373925_0023955 | 3300037068 | Bacteria | 4453 |
| 703 | Ga0373925_0063161 | 3300037068 | Bacteria | 2786 |
| 704 | Ga0373925_0091160 | 3300037068 | Bacteria | 2330 |
| 705 | Ga0373925_0114217 | 3300037068 | Bacteria | 2089 |
| 706 | Ga0373925_0120338 | 3300037068 | Bacteria | 2038 |
| 707 | Ga0395905_0037206 | 3300037471 | Bacteria | 4571 |
| 708 | Ga0436364_0978611 | 3300037853 | Bacteria | 44026 |
| 709 | Ga0242420_005377 | 3300038996 | Bacteria | 1983 |
| 710 | Ga0242420_007484 | 3300038996 | Bacteria | 1752 |
| 711 | Ga0436365_0797236 | 3300039437 | Bacteria | 2004 |
| 712 | Ga0436365_0884217 | 3300039437 | Bacteria | 16535 |
| 713 | Ga0436361_0550596 | 3300039447 | Bacteria | 14713 |
| 714 | Ga0436363_0059666 | 3300039450 | Bacteria | 1309 |
| 715 | Ga0436363_1080804 | 3300039450 | Unclassified | 1626 |
| 716 | Ga0439441_017869 | 3300042001 | Bacteria | 1278 |
| 717 | Ga0439450_005184 | 3300042008 | Bacteria | 2277 |
| 718 | Ga0439455_0019453 | 3300042012 | Bacteria | 1601 |
| 719 | Ga0439446_0033067 | 3300042156 | Bacteria | 1502 |
| 720 | Ga0451577_0046357 | 3300042876 | Bacteria | 3890 |
| 721 | Ga0451577_0140505 | 3300042876 | Bacteria | 2170 |
| 722 | Ga0451577_0530126 | 3300042876 | Bacteria | 1069 |
| 723 | Ga0466964_0102992 | 3300044706 | Bacteria | 1261 |
| 724 | Ga0453684_0395578 | 3300044712 | Bacteria | 1549 |
| 725 | Ga0451576_0001678 | 3300045051 | Bacteria | 36726 |
| 726 | Ga0451576_0024813 | 3300045051 | Bacteria | 6470 |
| 727 | Ga0451576_0065086 | 3300045051 | Bacteria | 3795 |
| 728 | Ga0466967_0271149 | 3300045976 | Bacteria | 1626 |
| 729 | Ga0495617_007534 | 3300046452 | Bacteria | 3775 |
| 730 | Ga0495627_006545 | 3300046453 | Bacteria | 4557 |
| 731 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 732 | Ga0495592_0000766 | 3300046454 | Bacteria | 22364 |
| 733 | Ga0495592_0138203 | 3300046454 | Bacteria | 1697 |
| 734 | Ga0495592_0140235 | 3300046454 | Bacteria | 1682 |
| 735 | Ga0495603_0002904 | 3300046455 | Bacteria | 10140 |
| 736 | Ga0495603_0027183 | 3300046455 | Bacteria | 3454 |
| 737 | Ga0495603_0079883 | 3300046455 | Bacteria | 1917 |
| 738 | Ga0495603_0122000 | 3300046455 | Bacteria | 1518 |
| 739 | Ga0495590_0071601 | 3300046457 | Bacteria | 1217 |
| 740 | Ga0495591_032375 | 3300046458 | Bacteria | 1557 |
| 741 | Ga0495629_0001979 | 3300046459 | Bacteria | 15969 |
| 742 | Ga0495629_0020249 | 3300046459 | Bacteria | 4751 |
| 743 | Ga0495629_0036597 | 3300046459 | Bacteria | 3463 |
| 744 | Ga0495629_0067753 | 3300046459 | Bacteria | 2490 |
| 745 | Ga0495629_0127755 | 3300046459 | Unclassified | 1771 |
| 746 | Ga0495638_0031470 | 3300046460 | Bacteria | 3410 |
| 747 | Ga0495641_0000380 | 3300046461 | Bacteria | 37045 |
| 748 | Ga0495651_0000929 | 3300046462 | Bacteria | 22677 |
| 749 | Ga0495651_0001076 | 3300046462 | Bacteria | 21046 |
| 750 | Ga0495651_0001721 | 3300046462 | Bacteria | 16887 |
| 751 | Ga0495651_0032645 | 3300046462 | Bacteria | 4060 |
| 752 | Ga0495651_0128237 | 3300046462 | Bacteria | 1855 |
| 753 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 754 | Ga0495653_0000209 | 3300046463 | Bacteria | 47358 |
| 755 | Ga0495653_0026185 | 3300046463 | Bacteria | 4679 |
| 756 | Ga0495653_0035144 | 3300046463 | Bacteria | 3957 |
| 757 | Ga0495653_0192607 | 3300046463 | Bacteria | 1390 |
| 758 | Ga0495580_0000775 | 3300046472 | Bacteria | 27515 |
| 759 | Ga0495580_0004313 | 3300046472 | Bacteria | 11960 |
| 760 | Ga0495580_0086475 | 3300046472 | Unclassified | 2183 |
| 761 | Ga0495582_0001370 | 3300046473 | Bacteria | 13696 |
| 762 | Ga0495582_0005359 | 3300046473 | Bacteria | 7159 |
| 763 | Ga0495582_0045180 | 3300046473 | Bacteria | 2426 |
| 764 | Ga0495582_0107328 | 3300046473 | Bacteria | 1567 |
| 765 | Ga0495605_0006898 | 3300046474 | Bacteria | 6486 |
| 766 | Ga0495605_0031727 | 3300046474 | Bacteria | 2697 |
| 767 | Ga0495639_0001523 | 3300046475 | Bacteria | 10340 |
| 768 | Ga0495662_0000197 | 3300046476 | Bacteria | 24864 |
| 769 | Ga0495662_0003633 | 3300046476 | Bacteria | 7777 |
| 770 | Ga0495662_0023378 | 3300046476 | Bacteria | 2984 |
| 771 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 772 | Ga0495664_0000241 | 3300046477 | Bacteria | 26356 |
| 773 | Ga0495664_0045914 | 3300046477 | Bacteria | 2591 |
| 774 | Ga0495584_0011284 | 3300046491 | Bacteria | 4576 |
| 775 | Ga0495584_0027388 | 3300046491 | Bacteria | 2888 |
| 776 | Ga0495585_0001361 | 3300046492 | Bacteria | 19352 |
| 777 | Ga0495585_0057016 | 3300046492 | Bacteria | 2156 |
| 778 | Ga0495594_0008682 | 3300046499 | Bacteria | 5238 |
| 779 | Ga0495594_0009983 | 3300046499 | Bacteria | 4916 |
| 780 | Ga0495594_0015737 | 3300046499 | Bacteria | 3977 |
| 781 | Ga0495594_0111878 | 3300046499 | Bacteria | 1540 |
| 782 | Ga0495596_0017488 | 3300046500 | Bacteria | 2966 |
| 783 | Ga0495607_0003799 | 3300046501 | Bacteria | 11407 |
| 784 | Ga0495607_0008603 | 3300046501 | Bacteria | 6966 |
| 785 | Ga0495608_0000058 | 3300046511 | Bacteria | 90246 |
| 786 | Ga0495608_0001204 | 3300046511 | Bacteria | 18330 |
| 787 | Ga0495608_0007880 | 3300046511 | Bacteria | 7484 |
| 788 | Ga0495616_0022179 | 3300046513 | Bacteria | 3430 |
| 789 | Ga0495618_0000049 | 3300046514 | Bacteria | 91727 |
| 790 | Ga0495618_0004273 | 3300046514 | Bacteria | 8804 |
| 791 | Ga0495618_0015329 | 3300046514 | Bacteria | 4677 |
| 792 | Ga0495618_0107713 | 3300046514 | Bacteria | 1784 |
| 793 | Ga0495620_0017950 | 3300046515 | Bacteria | 3515 |
| 794 | Ga0495628_0000022 | 3300046516 | Bacteria | 140362 |
| 795 | Ga0495628_0001791 | 3300046516 | Bacteria | 19536 |
| 796 | Ga0495628_0008193 | 3300046516 | Bacteria | 8987 |
| 797 | Ga0495628_0048331 | 3300046516 | Bacteria | 3372 |
| 798 | Ga0495630_0002725 | 3300046517 | Bacteria | 12254 |
| 799 | Ga0495630_0003296 | 3300046517 | Bacteria | 11261 |
| 800 | Ga0495630_0016592 | 3300046517 | Bacteria | 5386 |
| 801 | Ga0495630_0042979 | 3300046517 | Bacteria | 3374 |
| 802 | Ga0495631_0008201 | 3300046518 | Bacteria | 5270 |
| 803 | Ga0495637_0005980 | 3300046520 | Bacteria | 6153 |
| 804 | Ga0495644_0001212 | 3300046523 | Bacteria | 10553 |
| 805 | Ga0495644_0038733 | 3300046523 | Bacteria | 1798 |
| 806 | Ga0495663_0002590 | 3300046525 | Bacteria | 5392 |
| 807 | Ga0495666_0000462 | 3300046526 | Bacteria | 18068 |
| 808 | Ga0495666_0014951 | 3300046526 | Bacteria | 3862 |
| 809 | Ga0495666_0051208 | 3300046526 | Bacteria | 1984 |
| 810 | Ga0495642_0021919 | 3300046528 | Bacteria | 2514 |
| 811 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 812 | Ga0495652_0205483 | 3300046529 | Bacteria | 1491 |
| 813 | Ga0495652_0387891 | 3300046529 | Bacteria | 992 |
| 814 | Ga0495665_0013406 | 3300046531 | Bacteria | 4432 |
| 815 | Ga0495665_0191183 | 3300046531 | Bacteria | 1062 |
| 816 | Ga0495640_0000067 | 3300046533 | Bacteria | 58740 |
| 817 | Ga0495640_0010763 | 3300046533 | Bacteria | 7056 |
| 818 | Ga0495640_0039679 | 3300046533 | Bacteria | 3302 |
| 819 | Ga0495640_0082886 | 3300046533 | Bacteria | 2129 |
| 820 | Ga0495640_0108325 | 3300046533 | Bacteria | 1817 |
| 821 | Ga0495586_0001093 | 3300046535 | Bacteria | 15326 |
| 822 | Ga0495586_0004228 | 3300046535 | Bacteria | 7690 |
| 823 | Ga0495586_0009710 | 3300046535 | Bacteria | 5125 |
| 824 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 825 | Ga0495587_0000604 | 3300046536 | Bacteria | 24546 |
| 826 | Ga0495587_0002926 | 3300046536 | Bacteria | 11431 |
| 827 | Ga0495598_0000197 | 3300046537 | Bacteria | 10558 |
| 828 | Ga0495609_0008767 | 3300046538 | Bacteria | 4925 |
| 829 | Ga0495609_0035685 | 3300046538 | Bacteria | 2249 |
| 830 | Ga0495621_0001164 | 3300046539 | Bacteria | 6801 |
| 831 | Ga0495621_0024210 | 3300046539 | Bacteria | 2026 |
| 832 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 833 | Ga0495622_0001441 | 3300046557 | Bacteria | 11966 |
| 834 | Ga0495633_0007689 | 3300046558 | Bacteria | 6168 |
| 835 | Ga0495633_0015044 | 3300046558 | Bacteria | 4022 |
| 836 | Ga0495667_0000090 | 3300046559 | Bacteria | 65991 |
| 837 | Ga0495667_0002395 | 3300046559 | Bacteria | 12537 |
| 838 | Ga0495667_0003934 | 3300046559 | Bacteria | 9957 |
| 839 | Ga0495667_0075745 | 3300046559 | Unclassified | 2189 |
| 840 | Ga0495656_0000553 | 3300046615 | Bacteria | 12229 |
| 841 | Ga0495656_0005258 | 3300046615 | Bacteria | 4461 |
| 842 | Ga0495656_0025978 | 3300046615 | Bacteria | 2327 |
| 843 | Ga0495656_0052855 | 3300046615 | Bacteria | 1743 |
| 844 | Ga0495668_0006195 | 3300046616 | Bacteria | 7900 |
| 845 | Ga0495634_0000167 | 3300046642 | Bacteria | 60315 |
| 846 | Ga0495634_0079109 | 3300046642 | Bacteria | 2153 |
| 847 | Ga0495634_0233607 | 3300046642 | Bacteria | 1130 |
| 848 | Ga0495634_0281474 | 3300046642 | Unclassified | 1010 |
| 849 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 850 | Ga0495635_0010999 | 3300046663 | Bacteria | 6341 |
| 851 | Ga0495635_0022296 | 3300046663 | Bacteria | 4408 |
| 852 | Ga0495635_0048232 | 3300046663 | Unclassified | 2936 |
| 853 | Ga0495635_0070427 | 3300046663 | Bacteria | 2397 |
| 854 | Ga0495635_0102593 | 3300046663 | Bacteria | 1955 |
| 855 | Ga0495659_0002101 | 3300046664 | Bacteria | 6508 |
| 856 | Ga0495659_0070660 | 3300046664 | Bacteria | 1307 |
| 857 | Ga0495661_0026362 | 3300046665 | Bacteria | 3744 |
| 858 | Ga0495661_0065836 | 3300046665 | Bacteria | 2134 |
| 859 | Ga0495588_0000313 | 3300046674 | Bacteria | 32879 |
| 860 | Ga0495588_0017173 | 3300046674 | Bacteria | 3509 |
| 861 | Ga0495588_0022160 | 3300046674 | Bacteria | 3138 |
| 862 | Ga0495657_0000099 | 3300046675 | Bacteria | 76617 |
| 863 | Ga0495657_0005797 | 3300046675 | Bacteria | 9729 |
| 864 | Ga0495657_0062003 | 3300046675 | Bacteria | 2472 |
| 865 | Ga0495657_0114394 | 3300046675 | Bacteria | 1705 |
| 866 | Ga0495599_0000039 | 3300046678 | Bacteria | 98345 |
| 867 | Ga0495599_0000261 | 3300046678 | Bacteria | 33198 |
| 868 | Ga0495599_0108531 | 3300046678 | Bacteria | 1729 |
| 869 | Ga0495623_0000073 | 3300046679 | Bacteria | 61884 |
| 870 | Ga0495623_0057065 | 3300046679 | Bacteria | 2457 |
| 871 | Ga0495623_0067807 | 3300046679 | Bacteria | 2226 |
| 872 | Ga0495646_0000017 | 3300046680 | Bacteria | 123549 |
| 873 | Ga0495646_0000800 | 3300046680 | Bacteria | 17588 |
| 874 | Ga0495647_0000515 | 3300046681 | Bacteria | 11277 |
| 875 | Ga0495647_0001490 | 3300046681 | Bacteria | 7265 |
| 876 | Ga0495647_0022808 | 3300046681 | Bacteria | 2264 |
| 877 | Ga0495647_0055969 | 3300046681 | Bacteria | 1545 |
| 878 | Ga0495658_0001933 | 3300046683 | Bacteria | 10591 |
| 879 | Ga0495658_0018886 | 3300046683 | Bacteria | 3591 |
| 880 | Ga0495669_0013427 | 3300046684 | Bacteria | 3489 |
| 881 | Ga0495613_0002928 | 3300046689 | Bacteria | 12792 |
| 882 | Ga0495613_0006502 | 3300046689 | Bacteria | 8735 |
| 883 | Ga0495613_0144939 | 3300046689 | Bacteria | 1695 |
| 884 | Ga0495613_0259946 | 3300046689 | Bacteria | 1210 |
| 885 | Ga0495624_0006114 | 3300046690 | Bacteria | 8574 |
| 886 | Ga0495624_0012625 | 3300046690 | Bacteria | 5766 |
| 887 | Ga0495624_0030411 | 3300046690 | Bacteria | 3518 |
| 888 | Ga0495670_0008663 | 3300046691 | Bacteria | 5005 |
| 889 | Ga0495670_0076305 | 3300046691 | Bacteria | 1703 |
| 890 | Ga0495671_0037153 | 3300046692 | Bacteria | 2464 |
| 891 | Ga0495649_0017651 | 3300046694 | Bacteria | 4024 |
| 892 | Ga0495589_0014670 | 3300046794 | Bacteria | 4031 |
| 893 | Ga0495600_0000043 | 3300046809 | Bacteria | 73475 |
| 894 | Ga0495600_0000309 | 3300046809 | Bacteria | 25835 |
| 895 | Ga0495600_0001591 | 3300046809 | Bacteria | 12615 |
| 896 | Ga0495660_0013561 | 3300046810 | Bacteria | 4723 |
| 897 | Ga0495581_0001406 | 3300047315 | Bacteria | 13332 |
| 898 | Ga0495581_0058695 | 3300047315 | Bacteria | 2222 |
| 899 | Ga0495581_0146861 | 3300047315 | Bacteria | 1376 |
| 900 | Ga0495604_0000030 | 3300047317 | Bacteria | 138597 |
| 901 | Ga0495604_0003597 | 3300047317 | Bacteria | 12354 |
| 902 | Ga0495604_0042374 | 3300047317 | Bacteria | 3568 |
| 903 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 904 | Ga0495674_0020806 | 3300047319 | Bacteria | 6074 |
| 905 | Ga0495674_0138942 | 3300047319 | Unclassified | 2043 |
| 906 | Ga0495676_0021514 | 3300047321 | Bacteria | 5628 |
| 907 | Ga0495676_0026606 | 3300047321 | Bacteria | 4977 |
| 908 | Ga0495676_0141704 | 3300047321 | Bacteria | 1722 |
| 909 | Ga0495680_0000307 | 3300047322 | Bacteria | 54880 |
| 910 | Ga0495680_0001830 | 3300047322 | Bacteria | 22458 |
| 911 | Ga0495680_0002274 | 3300047322 | Bacteria | 19772 |
| 912 | Ga0495680_0020443 | 3300047322 | Bacteria | 5570 |
| 913 | Ga0495680_0021015 | 3300047322 | Bacteria | 5471 |
| 914 | Ga0495680_0058878 | 3300047322 | Bacteria | 2967 |
| 915 | Ga0495680_0354570 | 3300047322 | Bacteria | 1021 |
| 916 | Ga0495683_0050041 | 3300047323 | Bacteria | 2092 |
| 917 | Ga0495675_0000195 | 3300047444 | Bacteria | 44124 |
| 918 | Ga0495675_0024374 | 3300047444 | Bacteria | 3857 |
| 919 | Ga0495679_017725 | 3300047446 | Bacteria | 2544 |
| 920 | Ga0495681_0021347 | 3300047470 | Bacteria | 3493 |
| 921 | Ga0495684_0000031 | 3300047471 | Bacteria | 116753 |
| 922 | Ga0495684_0000338 | 3300047471 | Bacteria | 37697 |
| 923 | Ga0495684_0037570 | 3300047471 | Bacteria | 3714 |
| 924 | Ga0495593_0000170 | 3300047673 | Bacteria | 33637 |
| 925 | Ga0495593_0009243 | 3300047673 | Bacteria | 5716 |
| 926 | Ga0495593_0184959 | 3300047673 | Bacteria | 1049 |
| 927 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 928 | Ga0495602_0002915 | 3300048088 | Bacteria | 17539 |
| 929 | Ga0495602_0112218 | 3300048088 | Bacteria | 2213 |
| 930 | Ga0495614_0000184 | 3300048089 | Bacteria | 23429 |
| 931 | Ga0495614_0082697 | 3300048089 | Bacteria | 1392 |
| 932 | Ga0495615_0000548 | 3300048090 | Bacteria | 5342 |
| 933 | Ga0495626_0013587 | 3300048091 | Bacteria | 4228 |
| 934 | Ga0496100_0000189 | 3300048903 | Bacteria | 34151 |
| 935 | Ga0496100_0000930 | 3300048903 | Bacteria | 13981 |
| 936 | Ga0496100_0015415 | 3300048903 | Bacteria | 4463 |
| 937 | Ga0496100_0033172 | 3300048903 | Bacteria | 3229 |
| 938 | Ga0496101_0000215 | 3300048904 | Bacteria | 43521 |
| 939 | Ga0496101_0021005 | 3300048904 | Bacteria | 4480 |
| 940 | Ga0496101_0026571 | 3300048904 | Bacteria | 4025 |
| 941 | Ga0496101_0059573 | 3300048904 | Bacteria | 2767 |
| 942 | Ga0496102_0001555 | 3300048905 | Bacteria | 20249 |
| 943 | Ga0496102_0016849 | 3300048905 | Bacteria | 6392 |
| 944 | Ga0496102_0360634 | 3300048905 | Bacteria | 1368 |
| 945 | Ga0496103_0000191 | 3300048906 | Bacteria | 61198 |
| 946 | Ga0496103_0051584 | 3300048906 | Bacteria | 2546 |
| 947 | Ga0496104_0000170 | 3300048907 | Bacteria | 57501 |
| 948 | Ga0496104_0000591 | 3300048907 | Bacteria | 30958 |
| 949 | Ga0496104_0001165 | 3300048907 | Bacteria | 22516 |
| 950 | Ga0496104_0001232 | 3300048907 | Bacteria | 22026 |
| 951 | Ga0496104_0028344 | 3300048907 | Bacteria | 5191 |
| 952 | Ga0496104_0030219 | 3300048907 | Bacteria | 5033 |
| 953 | Ga0496104_0049524 | 3300048907 | Bacteria | 3961 |
| 954 | Ga0496104_0290416 | 3300048907 | Bacteria | 1548 |
| 955 | Ga0496104_0502859 | 3300048907 | Bacteria | 1123 |
| 956 | Ga0496105_0002931 | 3300048908 | Bacteria | 12525 |
| 957 | Ga0496105_0006803 | 3300048908 | Bacteria | 8795 |
| 958 | Ga0496105_0030995 | 3300048908 | Bacteria | 4383 |
| 959 | Ga0496105_0032220 | 3300048908 | Bacteria | 4301 |
| 960 | Ga0496106_0000190 | 3300048909 | Bacteria | 43243 |
| 961 | Ga0496106_0000990 | 3300048909 | Bacteria | 20724 |
| 962 | Ga0496106_0019239 | 3300048909 | Bacteria | 5065 |
| 963 | Ga0496106_0026457 | 3300048909 | Bacteria | 4320 |
| 964 | Ga0496106_0038716 | 3300048909 | Bacteria | 3570 |
| 965 | Ga0496106_0144739 | 3300048909 | Bacteria | 1871 |
| 966 | Ga0496106_0331159 | 3300048909 | Unclassified | 1222 |
| 967 | Ga0496107_0000080 | 3300048910 | Bacteria | 46272 |
| 968 | Ga0496107_0012647 | 3300048910 | Bacteria | 5893 |
| 969 | Ga0496107_0023716 | 3300048910 | Bacteria | 4336 |
| 970 | Ga0496107_0067884 | 3300048910 | Bacteria | 2587 |
| 971 | Ga0496107_0108930 | 3300048910 | Bacteria | 2034 |
| 972 | Ga0496107_0293323 | 3300048910 | Bacteria | 1210 |
| 973 | Ga0496108_0006847 | 3300048911 | Bacteria | 9221 |
| 974 | Ga0496108_0015235 | 3300048911 | Bacteria | 6274 |
| 975 | Ga0496108_0023975 | 3300048911 | Bacteria | 5022 |
| 976 | Ga0496108_0076002 | 3300048911 | Bacteria | 2838 |
| 977 | Ga0496108_0077908 | 3300048911 | Bacteria | 2805 |
| 978 | Ga0496108_0312450 | 3300048911 | Bacteria | 1369 |
| 979 | Ga0496109_0000737 | 3300048912 | Bacteria | 27192 |
| 980 | Ga0496109_0011107 | 3300048912 | Bacteria | 7722 |
| 981 | Ga0496109_0025231 | 3300048912 | Bacteria | 5294 |
| 982 | Ga0496109_0029005 | 3300048912 | Bacteria | 4953 |
| 983 | Ga0496109_0059327 | 3300048912 | Bacteria | 3495 |
| 984 | Ga0496109_0068035 | 3300048912 | Bacteria | 3264 |
| 985 | Ga0496109_0232398 | 3300048912 | Bacteria | 1735 |
| 986 | Ga0496109_0330773 | 3300048912 | Bacteria | 1438 |
| 987 | Ga0496109_0442949 | 3300048912 | Bacteria | 1227 |
| 988 | Ga0496110_0001072 | 3300048913 | Bacteria | 19294 |
| 989 | Ga0496110_0001444 | 3300048913 | Bacteria | 17191 |
| 990 | Ga0496110_0038526 | 3300048913 | Bacteria | 4160 |
| 991 | Ga0496111_0002052 | 3300048914 | Bacteria | 12000 |
| 992 | Ga0496111_0077613 | 3300048914 | Bacteria | 2422 |
| 993 | Ga0496111_0101454 | 3300048914 | Bacteria | 2114 |
| 994 | Ga0496112_0001198 | 3300048915 | Bacteria | 19453 |
| 995 | Ga0496112_0039198 | 3300048915 | Bacteria | 4628 |
| 996 | Ga0496112_0165771 | 3300048915 | Bacteria | 2175 |
| 997 | Ga0496112_0165858 | 3300048915 | Bacteria | 2175 |
| 998 | Ga0496112_0523514 | 3300048915 | Bacteria | 1120 |
| 999 | Ga0496113_0000721 | 3300048916 | Bacteria | 16927 |
| 1000 | Ga0496113_0011762 | 3300048916 | Bacteria | 5858 |
| 1001 | Ga0496113_0027156 | 3300048916 | Bacteria | 4100 |
| 1002 | Ga0496113_0079926 | 3300048916 | Bacteria | 2504 |
| 1003 | Ga0496113_0088054 | 3300048916 | Bacteria | 2388 |
| 1004 | Ga0496113_0117750 | 3300048916 | Bacteria | 2074 |
| 1005 | Ga0496113_0178171 | 3300048916 | Bacteria | 1685 |
| 1006 | Ga0496114_0005702 | 3300048917 | Bacteria | 9762 |
| 1007 | Ga0496114_0006768 | 3300048917 | Bacteria | 9030 |
| 1008 | Ga0496114_0087873 | 3300048917 | Bacteria | 2636 |
| 1009 | Ga0496114_0149012 | 3300048917 | Bacteria | 2029 |
| 1010 | Ga0496114_0173400 | 3300048917 | Bacteria | 1881 |
| 1011 | Ga0496115_0007097 | 3300048918 | Bacteria | 8230 |
| 1012 | Ga0496115_0019256 | 3300048918 | Bacteria | 5251 |
| 1013 | Ga0496115_0046016 | 3300048918 | Bacteria | 3485 |
| 1014 | Ga0496115_0046424 | 3300048918 | Bacteria | 3471 |
| 1015 | Ga0496115_0066247 | 3300048918 | Bacteria | 2918 |
| 1016 | Ga0496115_0069353 | 3300048918 | Bacteria | 2855 |
| 1017 | Ga0496115_0109483 | 3300048918 | Bacteria | 2268 |
| 1018 | Ga0501036_0004646 | 3300049572 | Bacteria | 11098 |
| 1019 | Ga0501036_0091221 | 3300049572 | Bacteria | 2574 |
| 1020 | Ga0501039_0020067 | 3300049575 | Bacteria | 5123 |
| 1021 | Ga0501039_0173507 | 3300049575 | Bacteria | 1695 |
| 1022 | Ga0501040_0003091 | 3300049576 | Bacteria | 10796 |
| 1023 | Ga0501040_0174041 | 3300049576 | Bacteria | 1525 |
| 1024 | Ga0501041_0200992 | 3300049577 | Bacteria | 1249 |
| 1025 | Ga0501042_0007413 | 3300049578 | Bacteria | 7184 |
| 1026 | Ga0501046_0110796 | 3300049580 | Bacteria | 2097 |
| 1027 | Ga0501046_0252174 | 3300049580 | Bacteria | 1299 |
| 1028 | Ga0501048_0019096 | 3300049582 | Bacteria | 5035 |
| 1029 | Ga0501068_0026786 | 3300049584 | Bacteria | 3400 |
| 1030 | Ga0501071_0009259 | 3300049587 | Bacteria | 6551 |
| 1031 | Ga0501071_0072923 | 3300049587 | Bacteria | 2504 |
| 1032 | Ga0501072_0134776 | 3300049588 | Bacteria | 1969 |
| 1033 | Ga0501074_0242012 | 3300049590 | Bacteria | 1283 |
| 1034 | Ga0501075_0006585 | 3300049591 | Bacteria | 8001 |
| 1035 | Ga0501075_0008387 | 3300049591 | Bacteria | 7208 |
| 1036 | Ga0501076_0000870 | 3300049592 | Bacteria | 19633 |
| 1037 | Ga0501076_0044755 | 3300049592 | Bacteria | 3492 |
| 1038 | Ga0501076_0061767 | 3300049592 | Bacteria | 2982 |
| 1039 | Ga0501077_0053699 | 3300049593 | Bacteria | 2558 |
| 1040 | Ga0501080_0012676 | 3300049742 | Bacteria | 7731 |
| 1041 | Ga0501081_0022664 | 3300049743 | Bacteria | 4203 |
| 1042 | Ga0501081_0046592 | 3300049743 | Bacteria | 2981 |
| 1043 | Ga0501081_0125902 | 3300049743 | Bacteria | 1827 |
| 1044 | Ga0501083_0266198 | 3300049744 | Bacteria | 1115 |
| 1045 | Ga0501035_0095956 | 3300049822 | Bacteria | 2606 |
| 1046 | Ga0501035_0121236 | 3300049822 | Bacteria | 2286 |
| 1047 | Ga0501035_0152533 | 3300049822 | Bacteria | 2004 |
| 1048 | Ga0501045_0003545 | 3300049824 | Bacteria | 10711 |
| 1049 | Ga0501045_0165206 | 3300049824 | Bacteria | 1648 |
| 1050 | nmdc:mga0yw44_151121_c1 | 3300050492 | Unclassified | 1515 |
| 1051 | nmdc:mga06z11_62988_c1 | 3300050494 | Bacteria | 1939 |
| 1052 | nmdc:mga05p37_102_c1 | 3300050507 | Bacteria | 69207 |
| 1053 | nmdc:mga05p37_252765_c1 | 3300050507 | Bacteria | 2113 |
| 1054 | nmdc:mga05p37_3280_c1 | 3300050507 | Bacteria | 18865 |
| 1055 | nmdc:mga05p37_55210_c1 | 3300050507 | Bacteria | 4887 |
| 1056 | nmdc:mga05p37_5784_c1 | 3300050507 | Bacteria | 14534 |
| 1057 | nmdc:mga05p37_60007_c1 | 3300050507 | Bacteria | 4684 |
| 1058 | nmdc:mga05p37_7196_c1 | 3300050507 | Bacteria | 13126 |
| 1059 | nmdc:mga09592_259_c1 | 3300050508 | Bacteria | 38550 |
| 1060 | nmdc:mga09592_296713_c1 | 3300050508 | Bacteria | 1401 |
| 1061 | nmdc:mga09592_716_c1 | 3300050508 | Bacteria | 25471 |
| 1062 | nmdc:mga09592_83876_c2 | 3300050508 | Bacteria | 2013 |
| 1063 | nmdc:mga0qj67_119_c1 | 3300050509 | Bacteria | 51910 |
| 1064 | nmdc:mga0qj67_4903_c1 | 3300050509 | Bacteria | 9732 |
| 1065 | nmdc:mga06r32_163089_c1 | 3300050510 | Bacteria | 2211 |
| 1066 | nmdc:mga06r32_2969_c1 | 3300050510 | Bacteria | 15197 |
| 1067 | nmdc:mga08y16_1835_c1 | 3300050511 | Bacteria | 21542 |
| 1068 | nmdc:mga08y16_2739_c1 | 3300050511 | Bacteria | 18063 |
| 1069 | nmdc:mga08y16_2852_c1 | 3300050511 | Bacteria | 17775 |
| 1070 | nmdc:mga08y16_4422_c1 | 3300050511 | Bacteria | 14685 |
| 1071 | nmdc:mga0n895_11586_c1 | 3300050512 | Bacteria | 7878 |
| 1072 | nmdc:mga0n895_164089_c1 | 3300050512 | Bacteria | 2253 |
| 1073 | nmdc:mga0n895_214678_c1 | 3300050512 | Bacteria | 1954 |
| 1074 | nmdc:mga0n895_4040_c1 | 3300050512 | Bacteria | 11934 |
| 1075 | nmdc:mga0n895_459048_c1 | 3300050512 | Bacteria | 1286 |
| 1076 | nmdc:mga0n895_5083_c1 | 3300050512 | Bacteria | 10925 |
| 1077 | nmdc:mga0n895_5415_c1 | 3300050512 | Bacteria | 10663 |
| 1078 | nmdc:mga0n895_57339_c1 | 3300050512 | Bacteria | 3839 |
| 1079 | nmdc:mga0rr50_123918_c1 | 3300050513 | Bacteria | 2061 |
| 1080 | nmdc:mga0rr50_228349_c1 | 3300050513 | Bacteria | 1539 |
| 1081 | nmdc:mga0rr50_23018_c1 | 3300050513 | Bacteria | 4287 |
| 1082 | nmdc:mga0rr50_494_c1 | 3300050513 | Bacteria | 21000 |
| 1083 | nmdc:mga0rr50_505_c1 | 3300050513 | Bacteria | 20786 |
| 1084 | nmdc:mga0rr50_64430_c1 | 3300050513 | Bacteria | 2772 |
| 1085 | nmdc:mga08x19_10398_c1 | 3300050514 | Bacteria | 5586 |
| 1086 | nmdc:mga08x19_143428_c1 | 3300050514 | Bacteria | 1614 |
| 1087 | nmdc:mga08x19_194825_c1 | 3300050514 | Bacteria | 1387 |
| 1088 | nmdc:mga08x19_209506_c1 | 3300050514 | Bacteria | 1338 |
| 1089 | nmdc:mga08x19_304292_c1 | 3300050514 | Bacteria | 1107 |
| 1090 | nmdc:mga0a205_126304_c1 | 3300050515 | Bacteria | 2458 |
| 1091 | nmdc:mga0a205_133448_c1 | 3300050515 | Bacteria | 2383 |
| 1092 | nmdc:mga0a205_19210_c1 | 3300050515 | Bacteria | 6440 |
| 1093 | nmdc:mga0a205_24709_c1 | 3300050515 | Bacteria | 5716 |
| 1094 | nmdc:mga0a205_427_c1 | 3300050515 | Bacteria | 32383 |
| 1095 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 1096 | Ga0495601_0000829 | 3300053077 | Bacteria | 16759 |
| 1097 | Ga0495601_0034843 | 3300053077 | Bacteria | 3140 |
| 1098 | Ga0495601_0072235 | 3300053077 | Bacteria | 2204 |
| 1099 | Ga0495601_0160256 | 3300053077 | Bacteria | 1470 |
| 1100 | Ga0495601_0215005 | 3300053077 | Bacteria | 1255 |
| 1101 | Ga0495612_0000240 | 3300053078 | Bacteria | 22800 |
| 1102 | Ga0495612_0000396 | 3300053078 | Bacteria | 17444 |
| 1103 | Ga0495612_0009684 | 3300053078 | Bacteria | 3903 |
| 1104 | Ga0495612_0019470 | 3300053078 | Bacteria | 2717 |
| 1105 | Ga0495612_0041683 | 3300053078 | Bacteria | 1872 |
| 1106 | Ga0500635_0048894 | 3300053080 | Bacteria | 1442 |
| 1107 | Ga0495655_0000275 | 3300053083 | Bacteria | 9580 |
| 1108 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 1109 | Ga0495595_0000489 | 3300053084 | Bacteria | 15095 |
| 1110 | Ga0495595_0001055 | 3300053084 | Bacteria | 10645 |
| 1111 | Ga0495595_0007407 | 3300053084 | Bacteria | 4495 |
| 1112 | Ga0495595_0017270 | 3300053084 | Bacteria | 3104 |
| 1113 | Ga0495595_0018313 | 3300053084 | Bacteria | 3025 |
| 1114 | Ga0495595_0155002 | 3300053084 | Unclassified | 1128 |
| 1115 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 1116 | Ga0495619_0000265 | 3300053085 | Bacteria | 38076 |
| 1117 | Ga0495619_0000423 | 3300053085 | Bacteria | 28622 |
| 1118 | Ga0495619_0001751 | 3300053085 | Bacteria | 14428 |
| 1119 | Ga0495619_0004854 | 3300053085 | Bacteria | 8530 |
| 1120 | Ga0495619_0026297 | 3300053085 | Bacteria | 3743 |
| 1121 | Ga0495619_0036496 | 3300053085 | Bacteria | 3201 |
| 1122 | Ga0495619_0041747 | 3300053085 | Bacteria | 3001 |
| 1123 | Ga0495619_0044334 | 3300053085 | Bacteria | 2919 |
| 1124 | Ga0500577_0009138 | 3300053142 | Bacteria | 2864 |
| 1125 | Ga0500627_0055269 | 3300053158 | Bacteria | 1738 |
| 1126 | Ga0501084_0017558 | 3300054114 | Bacteria | 5951 |
| 1127 | Ga0501084_0043749 | 3300054114 | Bacteria | 3746 |
| 1128 | Ga0501084_0097542 | 3300054114 | Bacteria | 2468 |
| 1129 | Ga0501084_0166651 | 3300054114 | Bacteria | 1859 |
| 1130 | Ga0501082_0000202 | 3300060353 | Bacteria | 52074 |
| 1131 | Ga0501082_0032249 | 3300060353 | Bacteria | 4517 |
| 1132 | Ga0501082_0173294 | 3300060353 | Bacteria | 1876 |
| 1133 | Ga0501082_0188119 | 3300060353 | Bacteria | 1796 |
| 1134 | Ga0530510_0004260 | 3300061734 | Bacteria | 9897 |
| 1135 | Ga0530510_0031418 | 3300061734 | Bacteria | 3818 |
| 1136 | Ga0530510_0243222 | 3300061734 | Unclassified | 1340 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100106012 | Ga0075435_1001060122 | 241 |
| 2 | 3300050513 | nmdc:mga0rr50_123918_c1 | nmdc:mga0rr50_123918_c1_728_1618 | 241 |
| 3 | 3300050512 | nmdc:mga0n895_214678_c1 | nmdc:mga0n895_214678_c1_793_1683 | 242 |
| 4 | 3300050515 | nmdc:mga0a205_19210_c1 | nmdc:mga0a205_19210_c1_4873_5763 | 242 |
| 5 | 3300035691 | Ga0373931_0043352 | Ga0373931_0043352_1437_2336 | 244 |
| 6 | 3300034816 | Ga0373930_0017229 | Ga0373930_0017229_528_1340 | 248 |
| 7 | 3300035090 | Ga0373949_0012358 | Ga0373949_0012358_12_824 | 248 |
| 8 | 3300025916 | Ga0207663_10318662 | Ga0207663_103186622 | 250 |
| 9 | 3300050514 | nmdc:mga08x19_304292_c1 | nmdc:mga08x19_304292_c1_51_917 | 253 |
| 10 | 3300005330 | Ga0070690_100007954 | Ga0070690_1000079542 | 256 |
| 11 | 3300005334 | Ga0068869_100005392 | Ga0068869_1000053922 | 256 |
| 12 | 3300005336 | Ga0070680_100004508 | Ga0070680_1000045087 | 256 |
| 13 | 3300005338 | Ga0068868_100001473 | Ga0068868_10000147310 | 256 |
| 14 | 3300005340 | Ga0070689_100073218 | Ga0070689_1000732182 | 256 |
| 15 | 3300005341 | Ga0070691_10009885 | Ga0070691_100098854 | 256 |
| 16 | 3300005343 | Ga0070687_100000176 | Ga0070687_1000001769 | 256 |
| 17 | 3300005345 | Ga0070692_10001408 | Ga0070692_100014089 | 256 |
| 18 | 3300005365 | Ga0070688_100197993 | Ga0070688_1001979932 | 256 |
| 19 | 3300005406 | Ga0070703_10003840 | Ga0070703_100038403 | 256 |
| 20 | 3300005438 | Ga0070701_10000060 | Ga0070701_1000006024 | 256 |
| 21 | 3300005440 | Ga0070705_100002404 | Ga0070705_1000024046 | 256 |
| 22 | 3300005444 | Ga0070694_100002437 | Ga0070694_1000024377 | 256 |
| 23 | 3300005459 | Ga0068867_100003556 | Ga0068867_1000035566 | 256 |
| 24 | 3300005530 | Ga0070679_100002086 | Ga0070679_1000020869 | 256 |
| 25 | 3300005544 | Ga0070686_100004877 | Ga0070686_1000048778 | 256 |
| 26 | 3300005545 | Ga0070695_100002011 | Ga0070695_1000020116 | 256 |
| 27 | 3300005546 | Ga0070696_100001197 | Ga0070696_1000011976 | 256 |
| 28 | 3300005547 | Ga0070693_100000507 | Ga0070693_1000005076 | 256 |
| 29 | 3300005549 | Ga0070704_100011172 | Ga0070704_1000111722 | 256 |
| 30 | 3300005563 | Ga0068855_100001779 | Ga0068855_1000017796 | 256 |
| 31 | 3300005578 | Ga0068854_100005384 | Ga0068854_1000053848 | 256 |
| 32 | 3300005614 | Ga0068856_100033405 | Ga0068856_1000334053 | 256 |
| 33 | 3300005615 | Ga0070702_100000039 | Ga0070702_10000003942 | 256 |
| 34 | 3300005616 | Ga0068852_100156571 | Ga0068852_1001565712 | 256 |
| 35 | 3300005617 | Ga0068859_100000420 | Ga0068859_1000004207 | 256 |
| 36 | 3300005718 | Ga0068866_10000153 | Ga0068866_100001537 | 256 |
| 37 | 3300005719 | Ga0068861_100000987 | Ga0068861_10000098710 | 256 |
| 38 | 3300005841 | Ga0068863_100277037 | Ga0068863_1002770372 | 256 |
| 39 | 3300005843 | Ga0068860_100002022 | Ga0068860_10000202218 | 256 |
| 40 | 3300005844 | Ga0068862_100009697 | Ga0068862_1000096973 | 256 |
| 41 | 3300006237 | Ga0097621_100042579 | Ga0097621_1000425792 | 256 |
| 42 | 3300006358 | Ga0068871_100005049 | Ga0068871_1000050499 | 256 |
| 43 | 3300006881 | Ga0068865_100002459 | Ga0068865_1000024596 | 256 |
| 44 | 3300006931 | Ga0097620_100000420 | Ga0097620_1000004207 | 256 |
| 45 | 3300009098 | Ga0105245_10000533 | Ga0105245_1000053334 | 256 |
| 46 | 3300009148 | Ga0105243_10000495 | Ga0105243_1000049523 | 256 |
| 47 | 3300009174 | Ga0105241_10026871 | Ga0105241_100268716 | 256 |
| 48 | 3300009176 | Ga0105242_10000248 | Ga0105242_100002488 | 256 |
| 49 | 3300009553 | Ga0105249_10004892 | Ga0105249_100048929 | 256 |
| 50 | 3300010375 | Ga0105239_10077348 | Ga0105239_100773482 | 256 |
| 51 | 3300011119 | Ga0105246_10018242 | Ga0105246_100182422 | 256 |
| 52 | 3300013297 | Ga0157378_10000387 | Ga0157378_1000038710 | 256 |
| 53 | 3300013306 | Ga0163162_10090707 | Ga0163162_100907073 | 256 |
| 54 | 3300014326 | Ga0157380_10006409 | Ga0157380_100064092 | 256 |
| 55 | 3300014968 | Ga0157379_10157585 | Ga0157379_101575852 | 256 |
| 56 | 3300014969 | Ga0157376_10004198 | Ga0157376_100041986 | 256 |
| 57 | 3300025885 | Ga0207653_10005645 | Ga0207653_100056453 | 256 |
| 58 | 3300025899 | Ga0207642_10026058 | Ga0207642_100260582 | 256 |
| 59 | 3300025908 | Ga0207643_10203387 | Ga0207643_102033872 | 256 |
| 60 | 3300025911 | Ga0207654_10119375 | Ga0207654_101193751 | 256 |
| 61 | 3300025917 | Ga0207660_10002432 | Ga0207660_100024326 | 256 |
| 62 | 3300025918 | Ga0207662_10000095 | Ga0207662_1000009543 | 256 |
| 63 | 3300025927 | Ga0207687_10000432 | Ga0207687_1000043222 | 256 |
| 64 | 3300025931 | Ga0207644_10058816 | Ga0207644_100588161 | 256 |
| 65 | 3300025934 | Ga0207686_10002300 | Ga0207686_100023008 | 256 |
| 66 | 3300025935 | Ga0207709_10000939 | Ga0207709_100009397 | 256 |
| 67 | 3300025936 | Ga0207670_10058064 | Ga0207670_100580643 | 256 |
| 68 | 3300025938 | Ga0207704_10000281 | Ga0207704_1000028119 | 256 |
| 69 | 3300025942 | Ga0207689_10003028 | Ga0207689_100030289 | 256 |
| 70 | 3300025981 | Ga0207640_10018411 | Ga0207640_100184114 | 256 |
| 71 | 3300026023 | Ga0207677_10002928 | Ga0207677_100029282 | 256 |
| 72 | 3300026035 | Ga0207703_10006621 | Ga0207703_100066219 | 256 |
| 73 | 3300026075 | Ga0207708_10011537 | Ga0207708_100115376 | 256 |
| 74 | 3300026078 | Ga0207702_10030968 | Ga0207702_100309685 | 256 |
| 75 | 3300026088 | Ga0207641_10347340 | Ga0207641_103473402 | 256 |
| 76 | 3300026089 | Ga0207648_10000513 | Ga0207648_100005139 | 256 |
| 77 | 3300026118 | Ga0207675_100003827 | Ga0207675_1000038278 | 256 |
| 78 | 3300028380 | Ga0268265_10049058 | Ga0268265_100490582 | 256 |
| 79 | 3300028381 | Ga0268264_10000827 | Ga0268264_100008279 | 256 |
| 80 | 3300035691 | Ga0373931_0037892 | Ga0373931_0037892_220_1149 | 256 |
| 81 | 3300045051 | Ga0451576_0065086 | Ga0451576_0065086_2029_2955 | 256 |
| 82 | 3300044712 | Ga0453684_0395578 | Ga0453684_0395578_568_1497 | 257 |
| 83 | 3300045051 | Ga0451576_0001678 | Ga0451576_0001678_31909_32838 | 257 |
| 84 | 3300006844 | Ga0075428_100000109 | Ga0075428_10000010951 | 258 |
| 85 | 3300006880 | Ga0075429_100001264 | Ga0075429_10000126411 | 258 |
| 86 | 3300009094 | Ga0111539_10183865 | Ga0111539_101838653 | 258 |
| 87 | 3300009147 | Ga0114129_10001030 | Ga0114129_1000103028 | 258 |
| 88 | 3300025917 | Ga0207660_10138205 | Ga0207660_101382051 | 258 |
| 89 | 3300026075 | Ga0207708_10118119 | Ga0207708_101181192 | 258 |
| 90 | 3300027907 | Ga0207428_10002963 | Ga0207428_100029633 | 258 |
| 91 | 3300042876 | Ga0451577_0530126 | Ga0451577_0530126_93_1025 | 258 |
| 92 | 3300050507 | nmdc:mga05p37_3280_c1 | nmdc:mga05p37_3280_c1_9218_10150 | 258 |
| 93 | 3300050508 | nmdc:mga09592_259_c1 | nmdc:mga09592_259_c1_26940_27872 | 258 |
| 94 | 3300050511 | nmdc:mga08y16_2852_c1 | nmdc:mga08y16_2852_c1_5988_6920 | 258 |
| 95 | 3300050513 | nmdc:mga0rr50_228349_c1 | nmdc:mga0rr50_228349_c1_620_1510 | 258 |
| 96 | 3300046455 | Ga0495603_0002904 | Ga0495603_0002904_14_892 | 264 |
| 97 | 3300006914 | Ga0075436_100162440 | Ga0075436_1001624402 | 265 |
| 98 | 3300050514 | nmdc:mga08x19_143428_c1 | nmdc:mga08x19_143428_c1_346_1143 | 265 |
| 99 | 3300047322 | Ga0495680_0354570 | Ga0495680_0354570_148_966 | 267 |
| 100 | 3300049743 | Ga0501081_0125902 | Ga0501081_0125902_11_901 | 269 |
| 101 | 3300049590 | Ga0501074_0242012 | Ga0501074_0242012_437_1249 | 270 |
| 102 | 3300035083 | Ga0373926_0010654 | Ga0373926_0010654_700_1614 | 272 |
| 103 | 3300035171 | Ga0373946_0019270 | Ga0373946_0019270_159_1073 | 272 |
| 104 | 3300035692 | Ga0373935_0023549 | Ga0373935_0023549_2314_3228 | 272 |
| 105 | 3300035725 | Ga0373947_0026258 | Ga0373947_0026258_163_1077 | 272 |
| 106 | 3300046472 | Ga0495580_0000775 | Ga0495580_0000775_23028_23942 | 272 |
| 107 | 3300046499 | Ga0495594_0008682 | Ga0495594_0008682_1419_2333 | 272 |
| 108 | 3300046526 | Ga0495666_0051208 | Ga0495666_0051208_801_1715 | 272 |
| 109 | 3300046531 | Ga0495665_0191183 | Ga0495665_0191183_12_926 | 272 |
| 110 | 3300046535 | Ga0495586_0004228 | Ga0495586_0004228_1161_2075 | 272 |
| 111 | 3300046681 | Ga0495647_0000515 | Ga0495647_0000515_9293_10207 | 272 |
| 112 | 3300032005 | Ga0307411_10127812 | Ga0307411_101278122 | 273 |
| 113 | 3300035695 | Ga0373927_0011621 | Ga0373927_0011621_2958_3875 | 273 |
| 114 | 3300007265 | Ga0099794_10011922 | Ga0099794_100119223 | 278 |
| 115 | 3300049576 | Ga0501040_0174041 | Ga0501040_0174041_152_1069 | 278 |
| 116 | 3300037471 | Ga0395905_0037206 | Ga0395905_0037206_2310_3293 | 279 |
| 117 | 3300039450 | Ga0436363_0059666 | Ga0436363_0059666_12_872 | 279 |
| 118 | 3300005983 | Ga0081540_1001366 | Ga0081540_10013669 | 280 |
| 119 | 3300050510 | nmdc:mga06r32_163089_c1 | nmdc:mga06r32_163089_c1_469_1341 | 280 |
| 120 | 3300035088 | Ga0373940_0005451 | Ga0373940_0005451_217_1149 | 281 |
| 121 | 3300035114 | Ga0373939_0003930 | Ga0373939_0003930_2118_3050 | 281 |
| 122 | 3300005440 | Ga0070705_100007847 | Ga0070705_1000078478 | 283 |
| 123 | 3300005444 | Ga0070694_100114653 | Ga0070694_1001146532 | 283 |
| 124 | 3300005467 | Ga0070706_100409301 | Ga0070706_1004093012 | 283 |
| 125 | 3300005536 | Ga0070697_100079463 | Ga0070697_1000794633 | 283 |
| 126 | 3300005545 | Ga0070695_100004254 | Ga0070695_1000042545 | 283 |
| 127 | 3300005546 | Ga0070696_100041998 | Ga0070696_1000419983 | 283 |
| 128 | 3300006173 | Ga0070716_100159796 | Ga0070716_1001597962 | 283 |
| 129 | 3300006914 | Ga0075436_100009889 | Ga0075436_1000098899 | 283 |
| 130 | 3300007076 | Ga0075435_100068235 | Ga0075435_1000682353 | 283 |
| 131 | 3300025910 | Ga0207684_10183814 | Ga0207684_101838142 | 283 |
| 132 | 3300025939 | Ga0207665_10065004 | Ga0207665_100650042 | 283 |
| 133 | 3300050514 | nmdc:mga08x19_10398_c1 | nmdc:mga08x19_10398_c1_799_1662 | 283 |
| 134 | 3300026041 | Ga0207639_10767504 | Ga0207639_107675041 | 284 |
| 135 | 3300042876 | Ga0451577_0140505 | Ga0451577_0140505_591_1607 | 284 |
| 136 | 3300005618 | Ga0068864_100017359 | Ga0068864_1000173593 | 287 |
| 137 | 3300006358 | Ga0068871_100605553 | Ga0068871_1006055531 | 287 |
| 138 | 3300006914 | Ga0075436_100000075 | Ga0075436_10000007534 | 287 |
| 139 | 3300007076 | Ga0075435_100000116 | Ga0075435_10000011640 | 287 |
| 140 | 3300025939 | Ga0207665_10078353 | Ga0207665_100783532 | 287 |
| 141 | 3300035113 | Ga0373936_0007009 | Ga0373936_0007009_3301_4191 | 288 |
| 142 | 3300035092 | Ga0373952_0013195 | Ga0373952_0013195_745_1614 | 289 |
| 143 | 3300048907 | Ga0496104_0502859 | Ga0496104_0502859_16_885 | 289 |
| 144 | 3300005985 | Ga0081539_10001081 | Ga0081539_1000108149 | 290 |
| 145 | 3300049572 | Ga0501036_0004646 | Ga0501036_0004646_6288_7181 | 290 |
| 146 | 3300049575 | Ga0501039_0020067 | Ga0501039_0020067_2153_3046 | 290 |
| 147 | 3300049576 | Ga0501040_0003091 | Ga0501040_0003091_7697_8590 | 290 |
| 148 | 3300049578 | Ga0501042_0007413 | Ga0501042_0007413_2968_3861 | 290 |
| 149 | 3300049580 | Ga0501046_0110796 | Ga0501046_0110796_225_1118 | 290 |
| 150 | 3300049582 | Ga0501048_0019096 | Ga0501048_0019096_1356_2249 | 290 |
| 151 | 3300049584 | Ga0501068_0026786 | Ga0501068_0026786_956_1849 | 290 |
| 152 | 3300049587 | Ga0501071_0009259 | Ga0501071_0009259_1345_2238 | 290 |
| 153 | 3300049591 | Ga0501075_0006585 | Ga0501075_0006585_889_1782 | 290 |
| 154 | 3300049592 | Ga0501076_0000870 | Ga0501076_0000870_2996_3889 | 290 |
| 155 | 3300049742 | Ga0501080_0012676 | Ga0501080_0012676_703_1596 | 290 |
| 156 | 3300049743 | Ga0501081_0022664 | Ga0501081_0022664_746_1639 | 290 |
| 157 | 3300049824 | Ga0501045_0003545 | Ga0501045_0003545_6654_7547 | 290 |
| 158 | 3300054114 | Ga0501084_0017558 | Ga0501084_0017558_3362_4255 | 290 |
| 159 | 3300060353 | Ga0501082_0032249 | Ga0501082_0032249_3421_4314 | 290 |
| 160 | 3300061734 | Ga0530510_0004260 | Ga0530510_0004260_2450_3343 | 290 |
| 161 | 3300005458 | Ga0070681_10004036 | Ga0070681_100040364 | 291 |
| 162 | 3300005518 | Ga0070699_100021000 | Ga0070699_1000210003 | 291 |
| 163 | 3300025912 | Ga0207707_10005043 | Ga0207707_1000504310 | 291 |
| 164 | 3300035114 | Ga0373939_0018600 | Ga0373939_0018600_354_1250 | 291 |
| 165 | 3300035121 | Ga0373960_0053993 | Ga0373960_0053993_206_1102 | 291 |
| 166 | 3300035691 | Ga0373931_0056956 | Ga0373931_0056956_939_1835 | 291 |
| 167 | 3300006852 | Ga0075433_10052790 | Ga0075433_100527904 | 292 |
| 168 | 3300006871 | Ga0075434_100022971 | Ga0075434_1000229716 | 292 |
| 169 | 3300009147 | Ga0114129_10007859 | Ga0114129_1000785913 | 292 |
| 170 | 3300050507 | nmdc:mga05p37_7196_c1 | nmdc:mga05p37_7196_c1_6689_7642 | 292 |
| 171 | 3300050512 | nmdc:mga0n895_4040_c1 | nmdc:mga0n895_4040_c1_5875_6828 | 292 |
| 172 | 3300050513 | nmdc:mga0rr50_23018_c1 | nmdc:mga0rr50_23018_c1_2750_3703 | 292 |
| 173 | 3300050515 | nmdc:mga0a205_126304_c1 | nmdc:mga0a205_126304_c1_894_1847 | 292 |
| 174 | 3300046679 | Ga0495623_0000073 | Ga0495623_0000073_60870_61841 | 294 |
| 175 | 3300005546 | Ga0070696_100013066 | Ga0070696_1000130667 | 298 |
| 176 | 3300049575 | Ga0501039_0173507 | Ga0501039_0173507_716_1633 | 298 |
| 177 | 3300049588 | Ga0501072_0134776 | Ga0501072_0134776_299_1216 | 298 |
| 178 | 3300049591 | Ga0501075_0008387 | Ga0501075_0008387_3508_4425 | 298 |
| 179 | 3300049822 | Ga0501035_0152533 | Ga0501035_0152533_66_983 | 298 |
| 180 | 3300049824 | Ga0501045_0165206 | Ga0501045_0165206_17_934 | 298 |
| 181 | 3300060353 | Ga0501082_0188119 | Ga0501082_0188119_662_1579 | 298 |
| 182 | 3300035118 | Ga0373954_0067687 | Ga0373954_0067687_671_1639 | 299 |
| 183 | 3300035119 | Ga0373956_0006169 | Ga0373956_0006169_25_954 | 299 |
| 184 | 3300048088 | Ga0495602_0112218 | Ga0495602_0112218_114_1082 | 299 |
| 185 | 3300045976 | Ga0466967_0271149 | Ga0466967_0271149_345_1352 | 300 |
| 186 | 3300009147 | Ga0114129_10367322 | Ga0114129_103673222 | 301 |
| 187 | 3300053084 | Ga0495595_0017270 | Ga0495595_0017270_449_1393 | 301 |
| 188 | 3300053085 | Ga0495619_0026297 | Ga0495619_0026297_1846_2790 | 301 |
| 189 | 3300005330 | Ga0070690_100269998 | Ga0070690_1002699982 | 302 |
| 190 | 3300005340 | Ga0070689_100169616 | Ga0070689_1001696162 | 302 |
| 191 | 3300005539 | Ga0068853_100584395 | Ga0068853_1005843951 | 302 |
| 192 | 3300005614 | Ga0068856_100110487 | Ga0068856_1001104872 | 302 |
| 193 | 3300005617 | Ga0068859_100434693 | Ga0068859_1004346932 | 302 |
| 194 | 3300006871 | Ga0075434_100000349 | Ga0075434_1000003492 | 302 |
| 195 | 3300006931 | Ga0097620_100434665 | Ga0097620_1004346652 | 302 |
| 196 | 3300025936 | Ga0207670_10122212 | Ga0207670_101222122 | 302 |
| 197 | 3300026078 | Ga0207702_10060859 | Ga0207702_100608594 | 302 |
| 198 | 3300026095 | Ga0207676_10121061 | Ga0207676_101210613 | 302 |
| 199 | 3300035170 | Ga0373943_0012370 | Ga0373943_0012370_142_1095 | 302 |
| 200 | 3300035172 | Ga0373955_0223941 | Ga0373955_0223941_29_982 | 302 |
| 201 | 3300035692 | Ga0373935_0140792 | Ga0373935_0140792_650_1603 | 302 |
| 202 | 3300038996 | Ga0242420_005377 | Ga0242420_005377_796_1755 | 302 |
| 203 | 3300046463 | Ga0495653_0035144 | Ga0495653_0035144_1813_2766 | 302 |
| 204 | 3300046463 | Ga0495653_0192607 | Ga0495653_0192607_399_1352 | 302 |
| 205 | 3300046476 | Ga0495662_0023378 | Ga0495662_0023378_955_1908 | 302 |
| 206 | 3300046477 | Ga0495664_0000241 | Ga0495664_0000241_20685_21638 | 302 |
| 207 | 3300046514 | Ga0495618_0015329 | Ga0495618_0015329_1876_2829 | 302 |
| 208 | 3300046529 | Ga0495652_0387891 | Ga0495652_0387891_17_970 | 302 |
| 209 | 3300046533 | Ga0495640_0010763 | Ga0495640_0010763_622_1575 | 302 |
| 210 | 3300046615 | Ga0495656_0025978 | Ga0495656_0025978_865_1794 | 302 |
| 211 | 3300046642 | Ga0495634_0079109 | Ga0495634_0079109_622_1575 | 302 |
| 212 | 3300046642 | Ga0495634_0233607 | Ga0495634_0233607_60_1013 | 302 |
| 213 | 3300046663 | Ga0495635_0022296 | Ga0495635_0022296_1580_2533 | 302 |
| 214 | 3300046679 | Ga0495623_0057065 | Ga0495623_0057065_1308_2267 | 302 |
| 215 | 3300047471 | Ga0495684_0037570 | Ga0495684_0037570_2704_3657 | 302 |
| 216 | 3300047673 | Ga0495593_0184959 | Ga0495593_0184959_85_1038 | 302 |
| 217 | 3300050512 | nmdc:mga0n895_5415_c1 | nmdc:mga0n895_5415_c1_9563_10492 | 302 |
| 218 | 3300050513 | nmdc:mga0rr50_505_c1 | nmdc:mga0rr50_505_c1_7089_8018 | 302 |
| 219 | 3300050515 | nmdc:mga0a205_133448_c1 | nmdc:mga0a205_133448_c1_693_1652 | 302 |
| 220 | 3300053077 | Ga0495601_0034843 | Ga0495601_0034843_271_1224 | 302 |
| 221 | 3300053078 | Ga0495612_0041683 | Ga0495612_0041683_443_1396 | 302 |
| 222 | 3300053085 | Ga0495619_0041747 | Ga0495619_0041747_1413_2366 | 302 |
| 223 | 3300005563 | Ga0068855_100296061 | Ga0068855_1002960612 | 306 |
| 224 | 3300025912 | Ga0207707_10017033 | Ga0207707_100170335 | 306 |
| 225 | 3300026067 | Ga0207678_10009676 | Ga0207678_100096767 | 306 |
| 226 | 3300049577 | Ga0501041_0200992 | Ga0501041_0200992_230_1207 | 306 |
| 227 | 3300049580 | Ga0501046_0252174 | Ga0501046_0252174_74_1051 | 306 |
| 228 | 3300049744 | Ga0501083_0266198 | Ga0501083_0266198_80_1057 | 306 |
| 229 | 3300054114 | Ga0501084_0166651 | Ga0501084_0166651_164_1141 | 306 |
| 230 | 3300061734 | Ga0530510_0031418 | Ga0530510_0031418_1266_2243 | 306 |
| 231 | 3300048912 | Ga0496109_0442949 | Ga0496109_0442949_94_1128 | 308 |
| 232 | 3300005937 | Ga0081455_10007158 | Ga0081455_100071589 | 309 |
| 233 | 3300035724 | Ga0373933_0052103 | Ga0373933_0052103_640_1593 | 309 |
| 234 | 3300036401 | Ga0373937_0132885 | Ga0373937_0132885_1155_2108 | 309 |
| 235 | 3300046457 | Ga0495590_0071601 | Ga0495590_0071601_228_1202 | 309 |
| 236 | 3300046474 | Ga0495605_0031727 | Ga0495605_0031727_1694_2644 | 309 |
| 237 | 3300046533 | Ga0495640_0039679 | Ga0495640_0039679_270_1223 | 309 |
| 238 | 3300046559 | Ga0495667_0075745 | Ga0495667_0075745_650_1603 | 309 |
| 239 | 3300046642 | Ga0495634_0281474 | Ga0495634_0281474_35_988 | 309 |
| 240 | 3300046663 | Ga0495635_0048232 | Ga0495635_0048232_1832_2785 | 309 |
| 241 | 3300047319 | Ga0495674_0138942 | Ga0495674_0138942_480_1433 | 309 |
| 242 | 3300048905 | Ga0496102_0360634 | Ga0496102_0360634_26_979 | 309 |
| 243 | 3300053077 | Ga0495601_0215005 | Ga0495601_0215005_30_983 | 309 |
| 244 | 3300053084 | Ga0495595_0018313 | Ga0495595_0018313_1016_1969 | 309 |
| 245 | 3300053085 | Ga0495619_0001751 | Ga0495619_0001751_10727_11680 | 309 |
| 246 | 3300006871 | Ga0075434_100008956 | Ga0075434_1000089566 | 310 |
| 247 | 3300035111 | Ga0373923_0002488 | Ga0373923_0002488_1752_2771 | 310 |
| 248 | 3300035116 | Ga0373945_0005926 | Ga0373945_0005926_858_1877 | 310 |
| 249 | 3300035117 | Ga0373953_0000738 | Ga0373953_0000738_5807_6826 | 310 |
| 250 | 3300035118 | Ga0373954_0004843 | Ga0373954_0004843_3048_4067 | 310 |
| 251 | 3300035171 | Ga0373946_0000495 | Ga0373946_0000495_10759_11778 | 310 |
| 252 | 3300035172 | Ga0373955_0000152 | Ga0373955_0000152_3677_4696 | 310 |
| 253 | 3300035692 | Ga0373935_0000006 | Ga0373935_0000006_58764_59783 | 310 |
| 254 | 3300035695 | Ga0373927_0005584 | Ga0373927_0005584_3301_4320 | 310 |
| 255 | 3300035724 | Ga0373933_0016241 | Ga0373933_0016241_2650_3669 | 310 |
| 256 | 3300035725 | Ga0373947_0001906 | Ga0373947_0001906_2764_3783 | 310 |
| 257 | 3300036401 | Ga0373937_0000165 | Ga0373937_0000165_38079_39098 | 310 |
| 258 | 3300037068 | Ga0373925_0000475 | Ga0373925_0000475_31699_32718 | 310 |
| 259 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_40776_41795 | 310 |
| 260 | 3300046459 | Ga0495629_0020249 | Ga0495629_0020249_1040_2059 | 310 |
| 261 | 3300046462 | Ga0495651_0001076 | Ga0495651_0001076_961_1980 | 310 |
| 262 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_99003_100022 | 310 |
| 263 | 3300046476 | Ga0495662_0003633 | Ga0495662_0003633_3431_4450 | 310 |
| 264 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_98944_99963 | 310 |
| 265 | 3300046511 | Ga0495608_0000058 | Ga0495608_0000058_19248_20267 | 310 |
| 266 | 3300046514 | Ga0495618_0000049 | Ga0495618_0000049_3772_4791 | 310 |
| 267 | 3300046516 | Ga0495628_0000022 | Ga0495628_0000022_72090_73109 | 310 |
| 268 | 3300046517 | Ga0495630_0002725 | Ga0495630_0002725_2427_3446 | 310 |
| 269 | 3300046529 | Ga0495652_0000008 | Ga0495652_0000008_270529_271548 | 310 |
| 270 | 3300046533 | Ga0495640_0000067 | Ga0495640_0000067_38499_39518 | 310 |
| 271 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_62172_63191 | 310 |
| 272 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_143832_144851 | 310 |
| 273 | 3300046559 | Ga0495667_0000090 | Ga0495667_0000090_60887_61906 | 310 |
| 274 | 3300046642 | Ga0495634_0000167 | Ga0495634_0000167_36097_37116 | 310 |
| 275 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_62404_63423 | 310 |
| 276 | 3300046675 | Ga0495657_0000099 | Ga0495657_0000099_42536_43555 | 310 |
| 277 | 3300046678 | Ga0495599_0000039 | Ga0495599_0000039_34506_35525 | 310 |
| 278 | 3300046680 | Ga0495646_0000017 | Ga0495646_0000017_58010_59029 | 310 |
| 279 | 3300046690 | Ga0495624_0030411 | Ga0495624_0030411_858_1877 | 310 |
| 280 | 3300046809 | Ga0495600_0000043 | Ga0495600_0000043_63162_64181 | 310 |
| 281 | 3300047315 | Ga0495581_0058695 | Ga0495581_0058695_871_1890 | 310 |
| 282 | 3300047317 | Ga0495604_0000030 | Ga0495604_0000030_65361_66380 | 310 |
| 283 | 3300047319 | Ga0495674_0000009 | Ga0495674_0000009_237243_238262 | 310 |
| 284 | 3300047322 | Ga0495680_0000307 | Ga0495680_0000307_3197_4216 | 310 |
| 285 | 3300047444 | Ga0495675_0000195 | Ga0495675_0000195_40032_41051 | 310 |
| 286 | 3300047471 | Ga0495684_0000031 | Ga0495684_0000031_96502_97521 | 310 |
| 287 | 3300047673 | Ga0495593_0009243 | Ga0495593_0009243_1770_2789 | 310 |
| 288 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_98894_99913 | 310 |
| 289 | 3300048911 | Ga0496108_0006847 | Ga0496108_0006847_2717_3697 | 310 |
| 290 | 3300048912 | Ga0496109_0029005 | Ga0496109_0029005_933_1913 | 310 |
| 291 | 3300048913 | Ga0496110_0001072 | Ga0496110_0001072_14458_15438 | 310 |
| 292 | 3300048915 | Ga0496112_0039198 | Ga0496112_0039198_30_1010 | 310 |
| 293 | 3300048915 | Ga0496112_0523514 | Ga0496112_0523514_59_1039 | 310 |
| 294 | 3300050512 | nmdc:mga0n895_11586_c1 | nmdc:mga0n895_11586_c1_4641_5606 | 310 |
| 295 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_266145_267164 | 310 |
| 296 | 3300053078 | Ga0495612_0000240 | Ga0495612_0000240_2528_3547 | 310 |
| 297 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_86575_87594 | 310 |
| 298 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_66274_67293 | 310 |
| 299 | 3300006844 | Ga0075428_100001911 | Ga0075428_10000191112 | 311 |
| 300 | 3300009094 | Ga0111539_10005738 | Ga0111539_1000573816 | 311 |
| 301 | 3300009147 | Ga0114129_10032825 | Ga0114129_100328258 | 311 |
| 302 | 3300025918 | Ga0207662_10108833 | Ga0207662_101088332 | 311 |
| 303 | 3300027907 | Ga0207428_10005877 | Ga0207428_100058777 | 311 |
| 304 | 3300050507 | nmdc:mga05p37_5784_c1 | nmdc:mga05p37_5784_c1_12758_13795 | 311 |
| 305 | 3300050509 | nmdc:mga0qj67_4903_c1 | nmdc:mga0qj67_4903_c1_4641_5678 | 311 |
| 306 | 3300050511 | nmdc:mga08y16_4422_c1 | nmdc:mga08y16_4422_c1_12758_13795 | 311 |
| 307 | 3300046689 | Ga0495613_0259946 | Ga0495613_0259946_78_1070 | 312 |
| 308 | 3300049587 | Ga0501071_0072923 | Ga0501071_0072923_1493_2488 | 313 |
| 309 | 3300049592 | Ga0501076_0061767 | Ga0501076_0061767_411_1406 | 313 |
| 310 | 3300054114 | Ga0501084_0043749 | Ga0501084_0043749_1070_2065 | 313 |
| 311 | 3300060353 | Ga0501082_0173294 | Ga0501082_0173294_248_1243 | 313 |
| 312 | 3300061734 | Ga0530510_0243222 | Ga0530510_0243222_49_1044 | 313 |
| 313 | 3300031242 | Ga0265329_10006698 | Ga0265329_100066982 | 315 |
| 314 | 3300031247 | Ga0265340_10006313 | Ga0265340_100063133 | 315 |
| 315 | 3300031249 | Ga0265339_10030352 | Ga0265339_100303522 | 315 |
| 316 | 3300048907 | Ga0496104_0030219 | Ga0496104_0030219_3658_4674 | 315 |
| 317 | 3300050507 | nmdc:mga05p37_55210_c1 | nmdc:mga05p37_55210_c1_425_1447 | 315 |
| 318 | 3300005445 | Ga0070708_100049987 | Ga0070708_1000499872 | 316 |
| 319 | 3300005518 | Ga0070699_100135854 | Ga0070699_1001358542 | 316 |
| 320 | 3300005614 | Ga0068856_100043275 | Ga0068856_1000432753 | 316 |
| 321 | 3300006175 | Ga0070712_100085305 | Ga0070712_1000853053 | 316 |
| 322 | 3300006880 | Ga0075429_100344656 | Ga0075429_1003446562 | 316 |
| 323 | 3300007265 | Ga0099794_10004509 | Ga0099794_100045094 | 316 |
| 324 | 3300009147 | Ga0114129_10062119 | Ga0114129_100621193 | 316 |
| 325 | 3300009147 | Ga0114129_10098133 | Ga0114129_100981333 | 316 |
| 326 | 3300021361 | Ga0213872_10033133 | Ga0213872_100331332 | 316 |
| 327 | 3300025915 | Ga0207693_10087489 | Ga0207693_100874893 | 316 |
| 328 | 3300035118 | Ga0373954_0008120 | Ga0373954_0008120_1906_2907 | 316 |
| 329 | 3300035410 | Ga0373924_0029564 | Ga0373924_0029564_473_1474 | 316 |
| 330 | 3300035724 | Ga0373933_0018766 | Ga0373933_0018766_71_1072 | 316 |
| 331 | 3300036401 | Ga0373937_0008865 | Ga0373937_0008865_80_1081 | 316 |
| 332 | 3300039447 | Ga0436361_0550596 | Ga0436361_0550596_6044_7048 | 316 |
| 333 | 3300046454 | Ga0495592_0138203 | Ga0495592_0138203_569_1570 | 316 |
| 334 | 3300046462 | Ga0495651_0128237 | Ga0495651_0128237_71_1072 | 316 |
| 335 | 3300046663 | Ga0495635_0102593 | Ga0495635_0102593_932_1933 | 316 |
| 336 | 3300046675 | Ga0495657_0005797 | Ga0495657_0005797_7446_8447 | 316 |
| 337 | 3300047322 | Ga0495680_0021015 | Ga0495680_0021015_3986_4987 | 316 |
| 338 | 3300048903 | Ga0496100_0000930 | Ga0496100_0000930_2959_3987 | 316 |
| 339 | 3300048905 | Ga0496102_0016849 | Ga0496102_0016849_1596_2624 | 316 |
| 340 | 3300048907 | Ga0496104_0000591 | Ga0496104_0000591_14481_15509 | 316 |
| 341 | 3300048909 | Ga0496106_0000990 | Ga0496106_0000990_4178_5206 | 316 |
| 342 | 3300048911 | Ga0496108_0015235 | Ga0496108_0015235_2740_3768 | 316 |
| 343 | 3300048912 | Ga0496109_0011107 | Ga0496109_0011107_2583_3611 | 316 |
| 344 | 3300048913 | Ga0496110_0001444 | Ga0496110_0001444_1036_2064 | 316 |
| 345 | 3300048914 | Ga0496111_0002052 | Ga0496111_0002052_3741_4769 | 316 |
| 346 | 3300048915 | Ga0496112_0001198 | Ga0496112_0001198_11095_12123 | 316 |
| 347 | 3300048916 | Ga0496113_0088054 | Ga0496113_0088054_911_1939 | 316 |
| 348 | 3300048917 | Ga0496114_0149012 | Ga0496114_0149012_129_1157 | 316 |
| 349 | 3300048918 | Ga0496115_0019256 | Ga0496115_0019256_2620_3648 | 316 |
| 350 | 3300050492 | nmdc:mga0yw44_151121_c1 | nmdc:mga0yw44_151121_c1_348_1352 | 316 |
| 351 | 3300050507 | nmdc:mga05p37_252765_c1 | nmdc:mga05p37_252765_c1_333_1337 | 316 |
| 352 | 3300050507 | nmdc:mga05p37_60007_c1 | nmdc:mga05p37_60007_c1_1759_2754 | 316 |
| 353 | 3300050508 | nmdc:mga09592_83876_c2 | nmdc:mga09592_83876_c2_107_1102 | 316 |
| 354 | 3300053077 | Ga0495601_0160256 | Ga0495601_0160256_79_1080 | 316 |
| 355 | 3300053085 | Ga0495619_0044334 | Ga0495619_0044334_1696_2697 | 316 |
| 356 | 3300021384 | Ga0213876_10070602 | Ga0213876_100706022 | 317 |
| 357 | 3300021388 | Ga0213875_10000236 | Ga0213875_1000023613 | 317 |
| 358 | 3300035724 | Ga0373933_0090664 | Ga0373933_0090664_139_1131 | 317 |
| 359 | 3300037853 | Ga0436364_0978611 | Ga0436364_0978611_34996_36003 | 317 |
| 360 | 3300039437 | Ga0436365_0797236 | Ga0436365_0797236_602_1606 | 317 |
| 361 | 3300005353 | Ga0070669_100062049 | Ga0070669_1000620492 | 318 |
| 362 | 3300009553 | Ga0105249_10283487 | Ga0105249_102834872 | 318 |
| 363 | 3300028380 | Ga0268265_10080795 | Ga0268265_100807953 | 318 |
| 364 | 3300036401 | Ga0373937_0018097 | Ga0373937_0018097_5123_6130 | 318 |
| 365 | 3300047444 | Ga0495675_0024374 | Ga0495675_0024374_1721_2728 | 318 |
| 366 | 3300049743 | Ga0501081_0046592 | Ga0501081_0046592_1083_2114 | 318 |
| 367 | 3300053077 | Ga0495601_0072235 | Ga0495601_0072235_14_1027 | 318 |
| 368 | 3300053078 | Ga0495612_0009684 | Ga0495612_0009684_2315_3328 | 318 |
| 369 | 3300005328 | Ga0070676_10023174 | Ga0070676_100231743 | 320 |
| 370 | 3300005335 | Ga0070666_10075970 | Ga0070666_100759702 | 320 |
| 371 | 3300005355 | Ga0070671_100035832 | Ga0070671_1000358323 | 320 |
| 372 | 3300005356 | Ga0070674_100358706 | Ga0070674_1003587062 | 320 |
| 373 | 3300005435 | Ga0070714_100075417 | Ga0070714_1000754173 | 320 |
| 374 | 3300005436 | Ga0070713_100133338 | Ga0070713_1001333382 | 320 |
| 375 | 3300005437 | Ga0070710_10106695 | Ga0070710_101066952 | 320 |
| 376 | 3300005456 | Ga0070678_100019190 | Ga0070678_1000191905 | 320 |
| 377 | 3300005457 | Ga0070662_100122382 | Ga0070662_1001223822 | 320 |
| 378 | 3300005545 | Ga0070695_100130295 | Ga0070695_1001302951 | 320 |
| 379 | 3300006237 | Ga0097621_100121071 | Ga0097621_1001210712 | 320 |
| 380 | 3300025898 | Ga0207692_10008757 | Ga0207692_100087572 | 320 |
| 381 | 3300025900 | Ga0207710_10085245 | Ga0207710_100852452 | 320 |
| 382 | 3300025904 | Ga0207647_10079629 | Ga0207647_100796292 | 320 |
| 383 | 3300025907 | Ga0207645_10031128 | Ga0207645_100311284 | 320 |
| 384 | 3300025915 | Ga0207693_10042666 | Ga0207693_100426662 | 320 |
| 385 | 3300025916 | Ga0207663_10122498 | Ga0207663_101224982 | 320 |
| 386 | 3300025919 | Ga0207657_10006209 | Ga0207657_100062093 | 320 |
| 387 | 3300025929 | Ga0207664_10052248 | Ga0207664_100522482 | 320 |
| 388 | 3300025931 | Ga0207644_10243623 | Ga0207644_102436232 | 320 |
| 389 | 3300025933 | Ga0207706_10042358 | Ga0207706_100423583 | 320 |
| 390 | 3300025934 | Ga0207686_10032928 | Ga0207686_100329282 | 320 |
| 391 | 3300025939 | Ga0207665_10032460 | Ga0207665_100324602 | 320 |
| 392 | 3300025941 | Ga0207711_10070212 | Ga0207711_100702123 | 320 |
| 393 | 3300026121 | Ga0207683_10164365 | Ga0207683_101643652 | 320 |
| 394 | 3300046675 | Ga0495657_0114394 | Ga0495657_0114394_10_996 | 320 |
| 395 | 3300048918 | Ga0496115_0046016 | Ga0496115_0046016_21_1007 | 320 |
| 396 | 3300006847 | Ga0075431_100265331 | Ga0075431_1002653312 | 321 |
| 397 | 3300025915 | Ga0207693_10239140 | Ga0207693_102391402 | 321 |
| 398 | 3300005719 | Ga0068861_100481965 | Ga0068861_1004819651 | 322 |
| 399 | 3300025893 | Ga0207682_10006813 | Ga0207682_100068132 | 322 |
| 400 | 3300005293 | Ga0065715_10145053 | Ga0065715_101450532 | 323 |
| 401 | 3300005340 | Ga0070689_100111139 | Ga0070689_1001111392 | 323 |
| 402 | 3300005355 | Ga0070671_100347631 | Ga0070671_1003476312 | 323 |
| 403 | 3300005356 | Ga0070674_100031450 | Ga0070674_1000314502 | 323 |
| 404 | 3300011119 | Ga0105246_10177655 | Ga0105246_101776552 | 323 |
| 405 | 3300014325 | Ga0163163_10111370 | Ga0163163_101113702 | 323 |
| 406 | 3300021384 | Ga0213876_10039419 | Ga0213876_100394192 | 323 |
| 407 | 3300025925 | Ga0207650_10163657 | Ga0207650_101636572 | 323 |
| 408 | 3300025936 | Ga0207670_10091278 | Ga0207670_100912782 | 323 |
| 409 | 3300025938 | Ga0207704_10192525 | Ga0207704_101925252 | 323 |
| 410 | 3300025940 | Ga0207691_10005072 | Ga0207691_100050723 | 323 |
| 411 | 3300026089 | Ga0207648_10018167 | Ga0207648_100181674 | 323 |
| 412 | 3300026095 | Ga0207676_10105477 | Ga0207676_101054772 | 323 |
| 413 | 3300026116 | Ga0207674_10023656 | Ga0207674_100236563 | 323 |
| 414 | 3300026121 | Ga0207683_10094497 | Ga0207683_100944972 | 323 |
| 415 | 3300039437 | Ga0436365_0884217 | Ga0436365_0884217_14704_15702 | 323 |
| 416 | 3300046539 | Ga0495621_0024210 | Ga0495621_0024210_88_1083 | 323 |
| 417 | 3300050508 | nmdc:mga09592_296713_c1 | nmdc:mga09592_296713_c1_212_1207 | 323 |
| 418 | 3300009147 | Ga0114129_10104720 | Ga0114129_101047202 | 324 |
| 419 | 3300013306 | Ga0163162_10397754 | Ga0163162_103977542 | 324 |
| 420 | 3300025901 | Ga0207688_10062810 | Ga0207688_100628102 | 324 |
| 421 | 3300025907 | Ga0207645_10074384 | Ga0207645_100743841 | 324 |
| 422 | 3300039450 | Ga0436363_1080804 | Ga0436363_1080804_173_1195 | 324 |
| 423 | 3300048907 | Ga0496104_0001165 | Ga0496104_0001165_21380_22411 | 324 |
| 424 | 3300048907 | Ga0496104_0001232 | Ga0496104_0001232_15858_16889 | 324 |
| 425 | 3300048908 | Ga0496105_0032220 | Ga0496105_0032220_884_1915 | 324 |
| 426 | 3300048909 | Ga0496106_0038716 | Ga0496106_0038716_1045_2076 | 324 |
| 427 | 3300048916 | Ga0496113_0079926 | Ga0496113_0079926_38_1069 | 324 |
| 428 | 3300048916 | Ga0496113_0178171 | Ga0496113_0178171_275_1306 | 324 |
| 429 | 3300048917 | Ga0496114_0173400 | Ga0496114_0173400_157_1188 | 324 |
| 430 | 3300005347 | Ga0070668_100042943 | Ga0070668_1000429432 | 325 |
| 431 | 3300005356 | Ga0070674_100015526 | Ga0070674_1000155264 | 325 |
| 432 | 3300005364 | Ga0070673_100417179 | Ga0070673_1004171791 | 325 |
| 433 | 3300005366 | Ga0070659_100028165 | Ga0070659_1000281654 | 325 |
| 434 | 3300005436 | Ga0070713_100458299 | Ga0070713_1004582991 | 325 |
| 435 | 3300005437 | Ga0070710_10073374 | Ga0070710_100733741 | 325 |
| 436 | 3300005437 | Ga0070710_10147276 | Ga0070710_101472762 | 325 |
| 437 | 3300005439 | Ga0070711_100008511 | Ga0070711_1000085114 | 325 |
| 438 | 3300005441 | Ga0070700_100020018 | Ga0070700_1000200184 | 325 |
| 439 | 3300005455 | Ga0070663_100059497 | Ga0070663_1000594973 | 325 |
| 440 | 3300005457 | Ga0070662_100074141 | Ga0070662_1000741413 | 325 |
| 441 | 3300005518 | Ga0070699_100002181 | Ga0070699_1000021816 | 325 |
| 442 | 3300005544 | Ga0070686_100191787 | Ga0070686_1001917871 | 325 |
| 443 | 3300005548 | Ga0070665_100323436 | Ga0070665_1003234361 | 325 |
| 444 | 3300005615 | Ga0070702_100061340 | Ga0070702_1000613402 | 325 |
| 445 | 3300005718 | Ga0068866_10012260 | Ga0068866_100122601 | 325 |
| 446 | 3300005842 | Ga0068858_100079607 | Ga0068858_1000796072 | 325 |
| 447 | 3300005843 | Ga0068860_100091469 | Ga0068860_1000914692 | 325 |
| 448 | 3300005844 | Ga0068862_100225499 | Ga0068862_1002254992 | 325 |
| 449 | 3300005937 | Ga0081455_10004348 | Ga0081455_100043484 | 325 |
| 450 | 3300005983 | Ga0081540_1008092 | Ga0081540_10080924 | 325 |
| 451 | 3300006028 | Ga0070717_10028516 | Ga0070717_100285165 | 325 |
| 452 | 3300006028 | Ga0070717_10030004 | Ga0070717_100300042 | 325 |
| 453 | 3300006038 | Ga0075365_10063307 | Ga0075365_100633073 | 325 |
| 454 | 3300006051 | Ga0075364_10124299 | Ga0075364_101242992 | 325 |
| 455 | 3300006163 | Ga0070715_10002401 | Ga0070715_100024013 | 325 |
| 456 | 3300006173 | Ga0070716_100168643 | Ga0070716_1001686432 | 325 |
| 457 | 3300006175 | Ga0070712_100158036 | Ga0070712_1001580362 | 325 |
| 458 | 3300006175 | Ga0070712_100195555 | Ga0070712_1001955552 | 325 |
| 459 | 3300006175 | Ga0070712_100379315 | Ga0070712_1003793151 | 325 |
| 460 | 3300006881 | Ga0068865_100013953 | Ga0068865_1000139534 | 325 |
| 461 | 3300007076 | Ga0075435_100084229 | Ga0075435_1000842292 | 325 |
| 462 | 3300009098 | Ga0105245_10079781 | Ga0105245_100797813 | 325 |
| 463 | 3300009101 | Ga0105247_10200075 | Ga0105247_102000752 | 325 |
| 464 | 3300009148 | Ga0105243_10090495 | Ga0105243_100904952 | 325 |
| 465 | 3300009177 | Ga0105248_10383812 | Ga0105248_103838122 | 325 |
| 466 | 3300009545 | Ga0105237_10228124 | Ga0105237_102281242 | 325 |
| 467 | 3300009551 | Ga0105238_10166511 | Ga0105238_101665112 | 325 |
| 468 | 3300009553 | Ga0105249_10029800 | Ga0105249_100298003 | 325 |
| 469 | 3300010375 | Ga0105239_10277795 | Ga0105239_102777952 | 325 |
| 470 | 3300011119 | Ga0105246_10049993 | Ga0105246_100499933 | 325 |
| 471 | 3300013296 | Ga0157374_10141328 | Ga0157374_101413282 | 325 |
| 472 | 3300013297 | Ga0157378_10022727 | Ga0157378_100227274 | 325 |
| 473 | 3300013306 | Ga0163162_10030184 | Ga0163162_100301844 | 325 |
| 474 | 3300013308 | Ga0157375_10049998 | Ga0157375_100499982 | 325 |
| 475 | 3300014325 | Ga0163163_10073419 | Ga0163163_100734192 | 325 |
| 476 | 3300014968 | Ga0157379_10114902 | Ga0157379_101149022 | 325 |
| 477 | 3300017792 | Ga0163161_10016674 | Ga0163161_100166743 | 325 |
| 478 | 3300025898 | Ga0207692_10055998 | Ga0207692_100559982 | 325 |
| 479 | 3300025899 | Ga0207642_10071895 | Ga0207642_100718952 | 325 |
| 480 | 3300025914 | Ga0207671_10076822 | Ga0207671_100768222 | 325 |
| 481 | 3300025915 | Ga0207693_10158135 | Ga0207693_101581351 | 325 |
| 482 | 3300025915 | Ga0207693_10305071 | Ga0207693_103050711 | 325 |
| 483 | 3300025916 | Ga0207663_10059430 | Ga0207663_100594302 | 325 |
| 484 | 3300025916 | Ga0207663_10264372 | Ga0207663_102643722 | 325 |
| 485 | 3300025928 | Ga0207700_10051819 | Ga0207700_100518192 | 325 |
| 486 | 3300025933 | Ga0207706_10042772 | Ga0207706_100427724 | 325 |
| 487 | 3300025935 | Ga0207709_10061229 | Ga0207709_100612292 | 325 |
| 488 | 3300025938 | Ga0207704_10012711 | Ga0207704_100127113 | 325 |
| 489 | 3300025939 | Ga0207665_10080556 | Ga0207665_100805562 | 325 |
| 490 | 3300025972 | Ga0207668_10042376 | Ga0207668_100423763 | 325 |
| 491 | 3300025986 | Ga0207658_10226445 | Ga0207658_102264452 | 325 |
| 492 | 3300026075 | Ga0207708_10018227 | Ga0207708_100182274 | 325 |
| 493 | 3300026118 | Ga0207675_100011672 | Ga0207675_1000116727 | 325 |
| 494 | 3300028381 | Ga0268264_10233848 | Ga0268264_102338481 | 325 |
| 495 | 3300031247 | Ga0265340_10044966 | Ga0265340_100449662 | 325 |
| 496 | 3300031711 | Ga0265314_10041579 | Ga0265314_100415793 | 325 |
| 497 | 3300035114 | Ga0373939_0013757 | Ga0373939_0013757_900_1931 | 325 |
| 498 | 3300035116 | Ga0373945_0004261 | Ga0373945_0004261_1979_3004 | 325 |
| 499 | 3300035170 | Ga0373943_0010245 | Ga0373943_0010245_1671_2696 | 325 |
| 500 | 3300035171 | Ga0373946_0043991 | Ga0373946_0043991_602_1627 | 325 |
| 501 | 3300035692 | Ga0373935_0051992 | Ga0373935_0051992_1008_2033 | 325 |
| 502 | 3300035695 | Ga0373927_0012866 | Ga0373927_0012866_1796_2821 | 325 |
| 503 | 3300035725 | Ga0373947_0085831 | Ga0373947_0085831_747_1772 | 325 |
| 504 | 3300037068 | Ga0373925_0114217 | Ga0373925_0114217_17_1042 | 325 |
| 505 | 3300044706 | Ga0466964_0102992 | Ga0466964_0102992_16_1050 | 325 |
| 506 | 3300046453 | Ga0495627_006545 | Ga0495627_006545_2337_3362 | 325 |
| 507 | 3300046455 | Ga0495603_0027183 | Ga0495603_0027183_1855_2880 | 325 |
| 508 | 3300046458 | Ga0495591_032375 | Ga0495591_032375_416_1441 | 325 |
| 509 | 3300046474 | Ga0495605_0006898 | Ga0495605_0006898_1592_2617 | 325 |
| 510 | 3300046491 | Ga0495584_0011284 | Ga0495584_0011284_588_1613 | 325 |
| 511 | 3300046491 | Ga0495584_0027388 | Ga0495584_0027388_241_1275 | 325 |
| 512 | 3300046492 | Ga0495585_0057016 | Ga0495585_0057016_870_1895 | 325 |
| 513 | 3300046499 | Ga0495594_0009983 | Ga0495594_0009983_1889_2914 | 325 |
| 514 | 3300046500 | Ga0495596_0017488 | Ga0495596_0017488_786_1811 | 325 |
| 515 | 3300046501 | Ga0495607_0008603 | Ga0495607_0008603_2215_3240 | 325 |
| 516 | 3300046513 | Ga0495616_0022179 | Ga0495616_0022179_1932_2957 | 325 |
| 517 | 3300046515 | Ga0495620_0017950 | Ga0495620_0017950_899_1924 | 325 |
| 518 | 3300046518 | Ga0495631_0008201 | Ga0495631_0008201_2375_3400 | 325 |
| 519 | 3300046520 | Ga0495637_0005980 | Ga0495637_0005980_3177_4202 | 325 |
| 520 | 3300046523 | Ga0495644_0001212 | Ga0495644_0001212_5074_6099 | 325 |
| 521 | 3300046523 | Ga0495644_0038733 | Ga0495644_0038733_370_1404 | 325 |
| 522 | 3300046525 | Ga0495663_0002590 | Ga0495663_0002590_37_1062 | 325 |
| 523 | 3300046528 | Ga0495642_0021919 | Ga0495642_0021919_571_1596 | 325 |
| 524 | 3300046537 | Ga0495598_0000197 | Ga0495598_0000197_5051_6076 | 325 |
| 525 | 3300046538 | Ga0495609_0008767 | Ga0495609_0008767_2018_3043 | 325 |
| 526 | 3300046539 | Ga0495621_0001164 | Ga0495621_0001164_1977_3002 | 325 |
| 527 | 3300046558 | Ga0495633_0007689 | Ga0495633_0007689_22_1047 | 325 |
| 528 | 3300046615 | Ga0495656_0005258 | Ga0495656_0005258_2883_3908 | 325 |
| 529 | 3300046615 | Ga0495656_0052855 | Ga0495656_0052855_276_1310 | 325 |
| 530 | 3300046616 | Ga0495668_0006195 | Ga0495668_0006195_5618_6643 | 325 |
| 531 | 3300046664 | Ga0495659_0070660 | Ga0495659_0070660_59_1093 | 325 |
| 532 | 3300046665 | Ga0495661_0026362 | Ga0495661_0026362_2180_3205 | 325 |
| 533 | 3300046674 | Ga0495588_0022160 | Ga0495588_0022160_270_1295 | 325 |
| 534 | 3300046681 | Ga0495647_0055969 | Ga0495647_0055969_162_1187 | 325 |
| 535 | 3300046684 | Ga0495669_0013427 | Ga0495669_0013427_1342_2367 | 325 |
| 536 | 3300046691 | Ga0495670_0076305 | Ga0495670_0076305_593_1627 | 325 |
| 537 | 3300046692 | Ga0495671_0037153 | Ga0495671_0037153_1005_2030 | 325 |
| 538 | 3300046694 | Ga0495649_0017651 | Ga0495649_0017651_466_1491 | 325 |
| 539 | 3300046794 | Ga0495589_0014670 | Ga0495589_0014670_1885_2910 | 325 |
| 540 | 3300046810 | Ga0495660_0013561 | Ga0495660_0013561_1196_2221 | 325 |
| 541 | 3300047321 | Ga0495676_0026606 | Ga0495676_0026606_999_2024 | 325 |
| 542 | 3300047323 | Ga0495683_0050041 | Ga0495683_0050041_594_1619 | 325 |
| 543 | 3300047470 | Ga0495681_0021347 | Ga0495681_0021347_667_1692 | 325 |
| 544 | 3300048090 | Ga0495615_0000548 | Ga0495615_0000548_702_1727 | 325 |
| 545 | 3300048091 | Ga0495626_0013587 | Ga0495626_0013587_2718_3743 | 325 |
| 546 | 3300048903 | Ga0496100_0033172 | Ga0496100_0033172_59_1063 | 325 |
| 547 | 3300048904 | Ga0496101_0021005 | Ga0496101_0021005_2586_3611 | 325 |
| 548 | 3300048907 | Ga0496104_0028344 | Ga0496104_0028344_3151_4176 | 325 |
| 549 | 3300048912 | Ga0496109_0068035 | Ga0496109_0068035_2073_3098 | 325 |
| 550 | 3300048917 | Ga0496114_0087873 | Ga0496114_0087873_926_1951 | 325 |
| 551 | 3300048918 | Ga0496115_0046424 | Ga0496115_0046424_2017_3042 | 325 |
| 552 | 3300053083 | Ga0495655_0000275 | Ga0495655_0000275_5060_6085 | 325 |
| 553 | 3300060353 | Ga0501082_0000202 | Ga0501082_0000202_39971_40969 | 325 |
| 554 | 3300005548 | Ga0070665_100113074 | Ga0070665_1001130743 | 326 |
| 555 | 3300006914 | Ga0075436_100332668 | Ga0075436_1003326681 | 326 |
| 556 | 3300042156 | Ga0439446_0033067 | Ga0439446_0033067_402_1409 | 326 |
| 557 | 3300049572 | Ga0501036_0091221 | Ga0501036_0091221_1073_2083 | 326 |
| 558 | 3300049822 | Ga0501035_0095956 | Ga0501035_0095956_779_1789 | 326 |
| 559 | 3300049822 | Ga0501035_0121236 | Ga0501035_0121236_635_1645 | 326 |
| 560 | 3300005437 | Ga0070710_10150698 | Ga0070710_101506982 | 327 |
| 561 | 3300006028 | Ga0070717_10313718 | Ga0070717_103137182 | 327 |
| 562 | 3300006175 | Ga0070712_100156818 | Ga0070712_1001568181 | 327 |
| 563 | 3300010159 | Ga0099796_10006479 | Ga0099796_100064792 | 327 |
| 564 | 3300024225 | Ga0224572_1002511 | Ga0224572_10025113 | 327 |
| 565 | 3300025898 | Ga0207692_10089007 | Ga0207692_100890072 | 327 |
| 566 | 3300025906 | Ga0207699_10040563 | Ga0207699_100405632 | 327 |
| 567 | 3300025915 | Ga0207693_10015209 | Ga0207693_100152092 | 327 |
| 568 | 3300025915 | Ga0207693_10146736 | Ga0207693_101467362 | 327 |
| 569 | 3300025928 | Ga0207700_10245476 | Ga0207700_102454762 | 327 |
| 570 | 3300030763 | Ga0265763_1000560 | Ga0265763_10005602 | 327 |
| 571 | 3300031090 | Ga0265760_10027023 | Ga0265760_100270232 | 327 |
| 572 | 3300031250 | Ga0265331_10015729 | Ga0265331_100157294 | 327 |
| 573 | 3300035083 | Ga0373926_0006472 | Ga0373926_0006472_1082_2116 | 327 |
| 574 | 3300035116 | Ga0373945_0014923 | Ga0373945_0014923_1501_2535 | 327 |
| 575 | 3300035171 | Ga0373946_0045297 | Ga0373946_0045297_271_1305 | 327 |
| 576 | 3300035695 | Ga0373927_0104213 | Ga0373927_0104213_188_1222 | 327 |
| 577 | 3300035725 | Ga0373947_0003131 | Ga0373947_0003131_7453_8487 | 327 |
| 578 | 3300037068 | Ga0373925_0023955 | Ga0373925_0023955_2063_3097 | 327 |
| 579 | 3300046459 | Ga0495629_0127755 | Ga0495629_0127755_474_1508 | 327 |
| 580 | 3300046472 | Ga0495580_0086475 | Ga0495580_0086475_253_1287 | 327 |
| 581 | 3300046473 | Ga0495582_0107328 | Ga0495582_0107328_369_1403 | 327 |
| 582 | 3300046517 | Ga0495630_0042979 | Ga0495630_0042979_2055_3089 | 327 |
| 583 | 3300046689 | Ga0495613_0144939 | Ga0495613_0144939_171_1205 | 327 |
| 584 | 3300046690 | Ga0495624_0012625 | Ga0495624_0012625_4697_5731 | 327 |
| 585 | 3300047315 | Ga0495581_0146861 | Ga0495581_0146861_171_1205 | 327 |
| 586 | 3300050514 | nmdc:mga08x19_194825_c1 | nmdc:mga08x19_194825_c1_204_1238 | 327 |
| 587 | 3300048911 | Ga0496108_0312450 | Ga0496108_0312450_201_1211 | 328 |
| 588 | 3300053080 | Ga0500635_0048894 | Ga0500635_0048894_79_1092 | 328 |
| 589 | 3300006194 | Ga0075427_10001215 | Ga0075427_100012153 | 329 |
| 590 | 3300006844 | Ga0075428_100003032 | Ga0075428_10000303212 | 329 |
| 591 | 3300006846 | Ga0075430_100000587 | Ga0075430_10000058720 | 329 |
| 592 | 3300006847 | Ga0075431_100006439 | Ga0075431_10000643910 | 329 |
| 593 | 3300006852 | Ga0075433_10000020 | Ga0075433_1000002028 | 329 |
| 594 | 3300006871 | Ga0075434_100002124 | Ga0075434_10000212416 | 329 |
| 595 | 3300006880 | Ga0075429_100001660 | Ga0075429_10000166010 | 329 |
| 596 | 3300007076 | Ga0075435_100010428 | Ga0075435_1000104287 | 329 |
| 597 | 3300009094 | Ga0111539_10000373 | Ga0111539_1000037345 | 329 |
| 598 | 3300009147 | Ga0114129_10014462 | Ga0114129_100144624 | 329 |
| 599 | 3300027907 | Ga0207428_10000172 | Ga0207428_1000017262 | 329 |
| 600 | 3300031344 | Ga0265316_10081309 | Ga0265316_100813092 | 329 |
| 601 | 3300034820 | Ga0373959_0001299 | Ga0373959_0001299_210_1223 | 329 |
| 602 | 3300046460 | Ga0495638_0031470 | Ga0495638_0031470_1010_2026 | 329 |
| 603 | 3300050507 | nmdc:mga05p37_102_c1 | nmdc:mga05p37_102_c1_51231_52244 | 329 |
| 604 | 3300050508 | nmdc:mga09592_716_c1 | nmdc:mga09592_716_c1_11572_12585 | 329 |
| 605 | 3300050509 | nmdc:mga0qj67_119_c1 | nmdc:mga0qj67_119_c1_11989_13002 | 329 |
| 606 | 3300050510 | nmdc:mga06r32_2969_c1 | nmdc:mga06r32_2969_c1_6679_7692 | 329 |
| 607 | 3300050511 | nmdc:mga08y16_2739_c1 | nmdc:mga08y16_2739_c1_9092_10105 | 329 |
| 608 | 3300050512 | nmdc:mga0n895_5083_c1 | nmdc:mga0n895_5083_c1_1901_2914 | 329 |
| 609 | 3300050513 | nmdc:mga0rr50_494_c1 | nmdc:mga0rr50_494_c1_14954_15967 | 329 |
| 610 | 3300050514 | nmdc:mga08x19_209506_c1 | nmdc:mga08x19_209506_c1_46_1059 | 329 |
| 611 | 3300050515 | nmdc:mga0a205_427_c1 | nmdc:mga0a205_427_c1_967_1980 | 329 |
| 612 | 3300053142 | Ga0500577_0009138 | Ga0500577_0009138_458_1474 | 329 |
| 613 | 3300053158 | Ga0500627_0055269 | Ga0500627_0055269_278_1294 | 329 |
| 614 | 2209111006 | 2214778551 | 2213800525 | 330 |
| 615 | 3300000041 | ARcpr5oldR_c000028 | ARcpr5oldR_00002816 | 330 |
| 616 | 3300000042 | ARSoilYngRDRAFT_c00197 | ARSoilYngRDRAFT_001974 | 330 |
| 617 | 3300000043 | ARcpr5yngRDRAFT_c000089 | ARcpr5yngRDRAFT_00008912 | 330 |
| 618 | 3300000044 | ARSoilOldRDRAFT_c000023 | ARSoilOldRDRAFT_00002315 | 330 |
| 619 | 3300000045 | ARCol0oldRDRAFT_c01094 | ARCol0oldRDRAFT_010941 | 330 |
| 620 | 3300000652 | ARCol0yngRDRAFT_1000216 | ARCol0yngRDRAFT_10002169 | 330 |
| 621 | 3300001989 | JGI24739J22299_10001754 | JGI24739J22299_100017542 | 330 |
| 622 | 3300001990 | JGI24737J22298_10001842 | JGI24737J22298_100018424 | 330 |
| 623 | 3300001990 | JGI24737J22298_10002044 | JGI24737J22298_100020445 | 330 |
| 624 | 3300002070 | JGI24750J21931_1000257 | JGI24750J21931_10002574 | 330 |
| 625 | 3300002073 | JGI24745J21846_1001091 | JGI24745J21846_10010913 | 330 |
| 626 | 3300002075 | JGI24738J21930_10009098 | JGI24738J21930_100090983 | 330 |
| 627 | 3300002076 | JGI24749J21850_1001489 | JGI24749J21850_10014892 | 330 |
| 628 | 3300002126 | JGI24035J26624_1000791 | JGI24035J26624_10007912 | 330 |
| 629 | 3300002239 | JGI24034J26672_10001294 | JGI24034J26672_100012942 | 330 |
| 630 | 3300003911 | JGI25405J52794_10005877 | JGI25405J52794_100058772 | 330 |
| 631 | 3300005290 | Ga0065712_10001370 | Ga0065712_100013704 | 330 |
| 632 | 3300005290 | Ga0065712_10087769 | Ga0065712_100877691 | 330 |
| 633 | 3300005293 | Ga0065715_10002415 | Ga0065715_100024155 | 330 |
| 634 | 3300005293 | Ga0065715_10093203 | Ga0065715_100932034 | 330 |
| 635 | 3300005295 | Ga0065707_10099628 | Ga0065707_100996283 | 330 |
| 636 | 3300005328 | Ga0070676_10001404 | Ga0070676_1000140410 | 330 |
| 637 | 3300005329 | Ga0070683_100000144 | Ga0070683_10000014431 | 330 |
| 638 | 3300005329 | Ga0070683_100040784 | Ga0070683_1000407845 | 330 |
| 639 | 3300005330 | Ga0070690_100079728 | Ga0070690_1000797282 | 330 |
| 640 | 3300005330 | Ga0070690_100120776 | Ga0070690_1001207762 | 330 |
| 641 | 3300005331 | Ga0070670_100000437 | Ga0070670_1000004372 | 330 |
| 642 | 3300005333 | Ga0070677_10001605 | Ga0070677_100016054 | 330 |
| 643 | 3300005334 | Ga0068869_100000035 | Ga0068869_1000000355 | 330 |
| 644 | 3300005335 | Ga0070666_10006608 | Ga0070666_100066085 | 330 |
| 645 | 3300005336 | Ga0070680_100011476 | Ga0070680_1000114763 | 330 |
| 646 | 3300005336 | Ga0070680_100066115 | Ga0070680_1000661153 | 330 |
| 647 | 3300005336 | Ga0070680_100131070 | Ga0070680_1001310702 | 330 |
| 648 | 3300005336 | Ga0070680_100289734 | Ga0070680_1002897341 | 330 |
| 649 | 3300005337 | Ga0070682_100001374 | Ga0070682_10000137412 | 330 |
| 650 | 3300005337 | Ga0070682_100088267 | Ga0070682_1000882673 | 330 |
| 651 | 3300005337 | Ga0070682_100168894 | Ga0070682_1001688942 | 330 |
| 652 | 3300005338 | Ga0068868_100033171 | Ga0068868_1000331714 | 330 |
| 653 | 3300005339 | Ga0070660_100128375 | Ga0070660_1001283752 | 330 |
| 654 | 3300005340 | Ga0070689_100004784 | Ga0070689_1000047849 | 330 |
| 655 | 3300005341 | Ga0070691_10000856 | Ga0070691_100008562 | 330 |
| 656 | 3300005341 | Ga0070691_10037037 | Ga0070691_100370372 | 330 |
| 657 | 3300005343 | Ga0070687_100000558 | Ga0070687_10000055811 | 330 |
| 658 | 3300005344 | Ga0070661_100000017 | Ga0070661_10000001716 | 330 |
| 659 | 3300005344 | Ga0070661_100158977 | Ga0070661_1001589772 | 330 |
| 660 | 3300005345 | Ga0070692_10000008 | Ga0070692_1000000816 | 330 |
| 661 | 3300005347 | Ga0070668_100000699 | Ga0070668_1000006992 | 330 |
| 662 | 3300005353 | Ga0070669_100000250 | Ga0070669_10000025032 | 330 |
| 663 | 3300005354 | Ga0070675_100001268 | Ga0070675_10000126811 | 330 |
| 664 | 3300005355 | Ga0070671_100010911 | Ga0070671_1000109118 | 330 |
| 665 | 3300005355 | Ga0070671_100149160 | Ga0070671_1001491602 | 330 |
| 666 | 3300005356 | Ga0070674_100000443 | Ga0070674_1000004438 | 330 |
| 667 | 3300005365 | Ga0070688_100000669 | Ga0070688_10000066915 | 330 |
| 668 | 3300005365 | Ga0070688_100039934 | Ga0070688_1000399343 | 330 |
| 669 | 3300005366 | Ga0070659_100000214 | Ga0070659_10000021434 | 330 |
| 670 | 3300005367 | Ga0070667_100142337 | Ga0070667_1001423372 | 330 |
| 671 | 3300005406 | Ga0070703_10006816 | Ga0070703_100068163 | 330 |
| 672 | 3300005434 | Ga0070709_10080195 | Ga0070709_100801953 | 330 |
| 673 | 3300005434 | Ga0070709_10294034 | Ga0070709_102940341 | 330 |
| 674 | 3300005435 | Ga0070714_100169471 | Ga0070714_1001694712 | 330 |
| 675 | 3300005436 | Ga0070713_100000889 | Ga0070713_10000088918 | 330 |
| 676 | 3300005436 | Ga0070713_100120844 | Ga0070713_1001208442 | 330 |
| 677 | 3300005437 | Ga0070710_10007734 | Ga0070710_100077346 | 330 |
| 678 | 3300005438 | Ga0070701_10000099 | Ga0070701_1000009911 | 330 |
| 679 | 3300005439 | Ga0070711_100086439 | Ga0070711_1000864393 | 330 |
| 680 | 3300005439 | Ga0070711_100112898 | Ga0070711_1001128982 | 330 |
| 681 | 3300005439 | Ga0070711_100330665 | Ga0070711_1003306652 | 330 |
| 682 | 3300005440 | Ga0070705_100082098 | Ga0070705_1000820982 | 330 |
| 683 | 3300005441 | Ga0070700_100021932 | Ga0070700_1000219324 | 330 |
| 684 | 3300005441 | Ga0070700_100077093 | Ga0070700_1000770933 | 330 |
| 685 | 3300005444 | Ga0070694_100035517 | Ga0070694_1000355172 | 330 |
| 686 | 3300005455 | Ga0070663_100000201 | Ga0070663_10000020121 | 330 |
| 687 | 3300005455 | Ga0070663_100018330 | Ga0070663_1000183304 | 330 |
| 688 | 3300005455 | Ga0070663_100141160 | Ga0070663_1001411602 | 330 |
| 689 | 3300005456 | Ga0070678_100000698 | Ga0070678_10000069813 | 330 |
| 690 | 3300005457 | Ga0070662_100009421 | Ga0070662_1000094217 | 330 |
| 691 | 3300005457 | Ga0070662_100091430 | Ga0070662_1000914302 | 330 |
| 692 | 3300005458 | Ga0070681_10000401 | Ga0070681_1000040133 | 330 |
| 693 | 3300005458 | Ga0070681_10136429 | Ga0070681_101364292 | 330 |
| 694 | 3300005459 | Ga0068867_100019105 | Ga0068867_1000191054 | 330 |
| 695 | 3300005459 | Ga0068867_100079393 | Ga0068867_1000793932 | 330 |
| 696 | 3300005459 | Ga0068867_100267334 | Ga0068867_1002673342 | 330 |
| 697 | 3300005530 | Ga0070679_100059355 | Ga0070679_1000593555 | 330 |
| 698 | 3300005530 | Ga0070679_100096460 | Ga0070679_1000964602 | 330 |
| 699 | 3300005535 | Ga0070684_100013364 | Ga0070684_1000133643 | 330 |
| 700 | 3300005535 | Ga0070684_100026194 | Ga0070684_1000261944 | 330 |
| 701 | 3300005535 | Ga0070684_100037443 | Ga0070684_1000374433 | 330 |
| 702 | 3300005539 | Ga0068853_100021340 | Ga0068853_1000213403 | 330 |
| 703 | 3300005539 | Ga0068853_100142299 | Ga0068853_1001422992 | 330 |
| 704 | 3300005543 | Ga0070672_100002749 | Ga0070672_1000027493 | 330 |
| 705 | 3300005544 | Ga0070686_100001254 | Ga0070686_1000012543 | 330 |
| 706 | 3300005544 | Ga0070686_100054001 | Ga0070686_1000540012 | 330 |
| 707 | 3300005545 | Ga0070695_100012651 | Ga0070695_1000126512 | 330 |
| 708 | 3300005545 | Ga0070695_100013109 | Ga0070695_1000131093 | 330 |
| 709 | 3300005546 | Ga0070696_100000304 | Ga0070696_10000030428 | 330 |
| 710 | 3300005546 | Ga0070696_100014702 | Ga0070696_1000147024 | 330 |
| 711 | 3300005546 | Ga0070696_100077658 | Ga0070696_1000776582 | 330 |
| 712 | 3300005546 | Ga0070696_100113480 | Ga0070696_1001134802 | 330 |
| 713 | 3300005547 | Ga0070693_100079312 | Ga0070693_1000793122 | 330 |
| 714 | 3300005563 | Ga0068855_100024209 | Ga0068855_1000242097 | 330 |
| 715 | 3300005564 | Ga0070664_100141250 | Ga0070664_1001412502 | 330 |
| 716 | 3300005564 | Ga0070664_100298093 | Ga0070664_1002980932 | 330 |
| 717 | 3300005577 | Ga0068857_100000494 | Ga0068857_10000049422 | 330 |
| 718 | 3300005578 | Ga0068854_100000139 | Ga0068854_10000013929 | 330 |
| 719 | 3300005578 | Ga0068854_100032879 | Ga0068854_1000328792 | 330 |
| 720 | 3300005614 | Ga0068856_100001571 | Ga0068856_10000157111 | 330 |
| 721 | 3300005615 | Ga0070702_100001018 | Ga0070702_10000101811 | 330 |
| 722 | 3300005616 | Ga0068852_100000193 | Ga0068852_10000019333 | 330 |
| 723 | 3300005617 | Ga0068859_100004926 | Ga0068859_10000492612 | 330 |
| 724 | 3300005618 | Ga0068864_100000226 | Ga0068864_1000002269 | 330 |
| 725 | 3300005718 | Ga0068866_10030148 | Ga0068866_100301482 | 330 |
| 726 | 3300005719 | Ga0068861_100000328 | Ga0068861_10000032813 | 330 |
| 727 | 3300005719 | Ga0068861_100091989 | Ga0068861_1000919892 | 330 |
| 728 | 3300005834 | Ga0068851_10017494 | Ga0068851_100174944 | 330 |
| 729 | 3300005840 | Ga0068870_10041901 | Ga0068870_100419012 | 330 |
| 730 | 3300005841 | Ga0068863_100001214 | Ga0068863_10000121415 | 330 |
| 731 | 3300005842 | Ga0068858_100005931 | Ga0068858_1000059313 | 330 |
| 732 | 3300005842 | Ga0068858_100430500 | Ga0068858_1004305002 | 330 |
| 733 | 3300005843 | Ga0068860_100001525 | Ga0068860_1000015252 | 330 |
| 734 | 3300005844 | Ga0068862_100117504 | Ga0068862_1001175042 | 330 |
| 735 | 3300005937 | Ga0081455_10000035 | Ga0081455_1000003556 | 330 |
| 736 | 3300005937 | Ga0081455_10020443 | Ga0081455_100204433 | 330 |
| 737 | 3300006028 | Ga0070717_10029796 | Ga0070717_100297962 | 330 |
| 738 | 3300006173 | Ga0070716_100123844 | Ga0070716_1001238442 | 330 |
| 739 | 3300006175 | Ga0070712_100018658 | Ga0070712_1000186584 | 330 |
| 740 | 3300006178 | Ga0075367_10071105 | Ga0075367_100711052 | 330 |
| 741 | 3300006237 | Ga0097621_100000049 | Ga0097621_10000004934 | 330 |
| 742 | 3300006358 | Ga0068871_100000097 | Ga0068871_1000000979 | 330 |
| 743 | 3300006358 | Ga0068871_100012551 | Ga0068871_1000125518 | 330 |
| 744 | 3300006358 | Ga0068871_100314907 | Ga0068871_1003149072 | 330 |
| 745 | 3300006852 | Ga0075433_10022455 | Ga0075433_100224552 | 330 |
| 746 | 3300006871 | Ga0075434_100000383 | Ga0075434_10000038329 | 330 |
| 747 | 3300006871 | Ga0075434_100170341 | Ga0075434_1001703412 | 330 |
| 748 | 3300006881 | Ga0068865_100000119 | Ga0068865_10000011911 | 330 |
| 749 | 3300006914 | Ga0075436_100291853 | Ga0075436_1002918531 | 330 |
| 750 | 3300006931 | Ga0097620_100004926 | Ga0097620_1000049262 | 330 |
| 751 | 3300007076 | Ga0075435_100086474 | Ga0075435_1000864743 | 330 |
| 752 | 3300009093 | Ga0105240_10043010 | Ga0105240_100430104 | 330 |
| 753 | 3300009093 | Ga0105240_10142934 | Ga0105240_101429342 | 330 |
| 754 | 3300009094 | Ga0111539_10000237 | Ga0111539_1000023736 | 330 |
| 755 | 3300009094 | Ga0111539_10039849 | Ga0111539_100398493 | 330 |
| 756 | 3300009094 | Ga0111539_10119492 | Ga0111539_101194923 | 330 |
| 757 | 3300009098 | Ga0105245_10000202 | Ga0105245_1000020236 | 330 |
| 758 | 3300009098 | Ga0105245_10059377 | Ga0105245_100593773 | 330 |
| 759 | 3300009101 | Ga0105247_10006779 | Ga0105247_100067798 | 330 |
| 760 | 3300009101 | Ga0105247_10043825 | Ga0105247_100438253 | 330 |
| 761 | 3300009101 | Ga0105247_10061305 | Ga0105247_100613052 | 330 |
| 762 | 3300009148 | Ga0105243_10002106 | Ga0105243_100021064 | 330 |
| 763 | 3300009148 | Ga0105243_10079714 | Ga0105243_100797143 | 330 |
| 764 | 3300009148 | Ga0105243_10133051 | Ga0105243_101330512 | 330 |
| 765 | 3300009174 | Ga0105241_10000430 | Ga0105241_100004302 | 330 |
| 766 | 3300009174 | Ga0105241_10034348 | Ga0105241_100343483 | 330 |
| 767 | 3300009174 | Ga0105241_10390499 | Ga0105241_103904992 | 330 |
| 768 | 3300009176 | Ga0105242_10003639 | Ga0105242_1000363911 | 330 |
| 769 | 3300009176 | Ga0105242_10335081 | Ga0105242_103350812 | 330 |
| 770 | 3300009177 | Ga0105248_10023208 | Ga0105248_100232086 | 330 |
| 771 | 3300009177 | Ga0105248_10095373 | Ga0105248_100953732 | 330 |
| 772 | 3300009545 | Ga0105237_10028031 | Ga0105237_100280314 | 330 |
| 773 | 3300009545 | Ga0105237_10059994 | Ga0105237_100599943 | 330 |
| 774 | 3300009545 | Ga0105237_10085558 | Ga0105237_100855582 | 330 |
| 775 | 3300009553 | Ga0105249_10000215 | Ga0105249_1000021534 | 330 |
| 776 | 3300009553 | Ga0105249_10031327 | Ga0105249_100313272 | 330 |
| 777 | 3300010375 | Ga0105239_10015015 | Ga0105239_100150154 | 330 |
| 778 | 3300010375 | Ga0105239_10054877 | Ga0105239_100548774 | 330 |
| 779 | 3300010375 | Ga0105239_10263627 | Ga0105239_102636272 | 330 |
| 780 | 3300011119 | Ga0105246_10000019 | Ga0105246_1000001944 | 330 |
| 781 | 3300012481 | Ga0157320_1001286 | Ga0157320_10012862 | 330 |
| 782 | 3300012507 | Ga0157342_1002013 | Ga0157342_10020132 | 330 |
| 783 | 3300013102 | Ga0157371_10085937 | Ga0157371_100859372 | 330 |
| 784 | 3300013296 | Ga0157374_10039059 | Ga0157374_100390593 | 330 |
| 785 | 3300013297 | Ga0157378_10003335 | Ga0157378_1000333514 | 330 |
| 786 | 3300013297 | Ga0157378_10127694 | Ga0157378_101276942 | 330 |
| 787 | 3300013306 | Ga0163162_10013606 | Ga0163162_100136063 | 330 |
| 788 | 3300013306 | Ga0163162_10027382 | Ga0163162_100273822 | 330 |
| 789 | 3300013306 | Ga0163162_10238685 | Ga0163162_102386852 | 330 |
| 790 | 3300013306 | Ga0163162_10448923 | Ga0163162_104489232 | 330 |
| 791 | 3300013307 | Ga0157372_10110740 | Ga0157372_101107402 | 330 |
| 792 | 3300013307 | Ga0157372_10179250 | Ga0157372_101792503 | 330 |
| 793 | 3300013307 | Ga0157372_10236654 | Ga0157372_102366542 | 330 |
| 794 | 3300013308 | Ga0157375_10004516 | Ga0157375_100045165 | 330 |
| 795 | 3300013308 | Ga0157375_10081858 | Ga0157375_100818583 | 330 |
| 796 | 3300014325 | Ga0163163_10025278 | Ga0163163_100252783 | 330 |
| 797 | 3300014325 | Ga0163163_10148262 | Ga0163163_101482622 | 330 |
| 798 | 3300014326 | Ga0157380_10003569 | Ga0157380_100035693 | 330 |
| 799 | 3300014326 | Ga0157380_10067440 | Ga0157380_100674402 | 330 |
| 800 | 3300014745 | Ga0157377_10000507 | Ga0157377_1000050713 | 330 |
| 801 | 3300014745 | Ga0157377_10136276 | Ga0157377_101362762 | 330 |
| 802 | 3300014968 | Ga0157379_10000065 | Ga0157379_1000006544 | 330 |
| 803 | 3300014968 | Ga0157379_10023744 | Ga0157379_100237445 | 330 |
| 804 | 3300014968 | Ga0157379_10106227 | Ga0157379_101062272 | 330 |
| 805 | 3300014968 | Ga0157379_10141086 | Ga0157379_101410862 | 330 |
| 806 | 3300014969 | Ga0157376_10190298 | Ga0157376_101902982 | 330 |
| 807 | 3300025271 | Ga0207666_1000278 | Ga0207666_10002785 | 330 |
| 808 | 3300025290 | Ga0207673_1000135 | Ga0207673_10001357 | 330 |
| 809 | 3300025315 | Ga0207697_10000287 | Ga0207697_1000028732 | 330 |
| 810 | 3300025315 | Ga0207697_10012481 | Ga0207697_100124814 | 330 |
| 811 | 3300025893 | Ga0207682_10000437 | Ga0207682_100004374 | 330 |
| 812 | 3300025898 | Ga0207692_10022895 | Ga0207692_100228952 | 330 |
| 813 | 3300025898 | Ga0207692_10051741 | Ga0207692_100517413 | 330 |
| 814 | 3300025899 | Ga0207642_10000268 | Ga0207642_1000026814 | 330 |
| 815 | 3300025900 | Ga0207710_10050960 | Ga0207710_100509602 | 330 |
| 816 | 3300025901 | Ga0207688_10000014 | Ga0207688_1000001441 | 330 |
| 817 | 3300025903 | Ga0207680_10059057 | Ga0207680_100590572 | 330 |
| 818 | 3300025906 | Ga0207699_10016704 | Ga0207699_100167043 | 330 |
| 819 | 3300025906 | Ga0207699_10111005 | Ga0207699_101110052 | 330 |
| 820 | 3300025906 | Ga0207699_10114665 | Ga0207699_101146652 | 330 |
| 821 | 3300025907 | Ga0207645_10000160 | Ga0207645_1000016025 | 330 |
| 822 | 3300025907 | Ga0207645_10018769 | Ga0207645_100187692 | 330 |
| 823 | 3300025907 | Ga0207645_10083440 | Ga0207645_100834402 | 330 |
| 824 | 3300025908 | Ga0207643_10000009 | Ga0207643_10000009168 | 330 |
| 825 | 3300025911 | Ga0207654_10203483 | Ga0207654_102034832 | 330 |
| 826 | 3300025912 | Ga0207707_10000554 | Ga0207707_100005547 | 330 |
| 827 | 3300025913 | Ga0207695_10055352 | Ga0207695_100553524 | 330 |
| 828 | 3300025913 | Ga0207695_10182322 | Ga0207695_101823222 | 330 |
| 829 | 3300025915 | Ga0207693_10011540 | Ga0207693_100115405 | 330 |
| 830 | 3300025915 | Ga0207693_10026066 | Ga0207693_100260662 | 330 |
| 831 | 3300025915 | Ga0207693_10042033 | Ga0207693_100420335 | 330 |
| 832 | 3300025915 | Ga0207693_10072874 | Ga0207693_100728742 | 330 |
| 833 | 3300025916 | Ga0207663_10127841 | Ga0207663_101278412 | 330 |
| 834 | 3300025917 | Ga0207660_10000347 | Ga0207660_100003472 | 330 |
| 835 | 3300025917 | Ga0207660_10094631 | Ga0207660_100946313 | 330 |
| 836 | 3300025917 | Ga0207660_10123744 | Ga0207660_101237442 | 330 |
| 837 | 3300025918 | Ga0207662_10000130 | Ga0207662_1000013039 | 330 |
| 838 | 3300025918 | Ga0207662_10084999 | Ga0207662_100849991 | 330 |
| 839 | 3300025919 | Ga0207657_10000980 | Ga0207657_1000098017 | 330 |
| 840 | 3300025919 | Ga0207657_10015897 | Ga0207657_100158975 | 330 |
| 841 | 3300025920 | Ga0207649_10006224 | Ga0207649_100062243 | 330 |
| 842 | 3300025920 | Ga0207649_10232726 | Ga0207649_102327262 | 330 |
| 843 | 3300025921 | Ga0207652_10000364 | Ga0207652_1000036419 | 330 |
| 844 | 3300025921 | Ga0207652_10027928 | Ga0207652_100279282 | 330 |
| 845 | 3300025921 | Ga0207652_10197563 | Ga0207652_101975632 | 330 |
| 846 | 3300025923 | Ga0207681_10000035 | Ga0207681_1000003539 | 330 |
| 847 | 3300025926 | Ga0207659_10000027 | Ga0207659_1000002799 | 330 |
| 848 | 3300025927 | Ga0207687_10000556 | Ga0207687_1000055626 | 330 |
| 849 | 3300025927 | Ga0207687_10025653 | Ga0207687_100256533 | 330 |
| 850 | 3300025928 | Ga0207700_10002968 | Ga0207700_100029682 | 330 |
| 851 | 3300025928 | Ga0207700_10028689 | Ga0207700_100286893 | 330 |
| 852 | 3300025932 | Ga0207690_10000056 | Ga0207690_1000005676 | 330 |
| 853 | 3300025933 | Ga0207706_10000307 | Ga0207706_1000030725 | 330 |
| 854 | 3300025933 | Ga0207706_10026539 | Ga0207706_100265392 | 330 |
| 855 | 3300025933 | Ga0207706_10395560 | Ga0207706_103955602 | 330 |
| 856 | 3300025934 | Ga0207686_10007325 | Ga0207686_100073253 | 330 |
| 857 | 3300025935 | Ga0207709_10000087 | Ga0207709_1000008741 | 330 |
| 858 | 3300025936 | Ga0207670_10000640 | Ga0207670_100006409 | 330 |
| 859 | 3300025936 | Ga0207670_10090367 | Ga0207670_100903672 | 330 |
| 860 | 3300025937 | Ga0207669_10000052 | Ga0207669_1000005226 | 330 |
| 861 | 3300025937 | Ga0207669_10045066 | Ga0207669_100450663 | 330 |
| 862 | 3300025937 | Ga0207669_10154765 | Ga0207669_101547652 | 330 |
| 863 | 3300025938 | Ga0207704_10000063 | Ga0207704_1000006336 | 330 |
| 864 | 3300025938 | Ga0207704_10139850 | Ga0207704_101398502 | 330 |
| 865 | 3300025940 | Ga0207691_10000167 | Ga0207691_1000016725 | 330 |
| 866 | 3300025941 | Ga0207711_10001619 | Ga0207711_1000161912 | 330 |
| 867 | 3300025941 | Ga0207711_10074947 | Ga0207711_100749473 | 330 |
| 868 | 3300025941 | Ga0207711_10209112 | Ga0207711_102091122 | 330 |
| 869 | 3300025941 | Ga0207711_10231960 | Ga0207711_102319602 | 330 |
| 870 | 3300025942 | Ga0207689_10000155 | Ga0207689_1000015539 | 330 |
| 871 | 3300025944 | Ga0207661_10000072 | Ga0207661_1000007251 | 330 |
| 872 | 3300025945 | Ga0207679_10000057 | Ga0207679_1000005770 | 330 |
| 873 | 3300025961 | Ga0207712_10000122 | Ga0207712_1000012239 | 330 |
| 874 | 3300025961 | Ga0207712_10027485 | Ga0207712_100274853 | 330 |
| 875 | 3300025961 | Ga0207712_10071730 | Ga0207712_100717303 | 330 |
| 876 | 3300025972 | Ga0207668_10000084 | Ga0207668_1000008445 | 330 |
| 877 | 3300025972 | Ga0207668_10038479 | Ga0207668_100384792 | 330 |
| 878 | 3300025981 | Ga0207640_10001119 | Ga0207640_100011194 | 330 |
| 879 | 3300025986 | Ga0207658_10003175 | Ga0207658_100031758 | 330 |
| 880 | 3300026023 | Ga0207677_10000549 | Ga0207677_100005494 | 330 |
| 881 | 3300026035 | Ga0207703_10089838 | Ga0207703_100898382 | 330 |
| 882 | 3300026035 | Ga0207703_10161007 | Ga0207703_101610072 | 330 |
| 883 | 3300026035 | Ga0207703_10293696 | Ga0207703_102936962 | 330 |
| 884 | 3300026041 | Ga0207639_10002231 | Ga0207639_100022314 | 330 |
| 885 | 3300026041 | Ga0207639_10190382 | Ga0207639_101903822 | 330 |
| 886 | 3300026067 | Ga0207678_10000187 | Ga0207678_1000018725 | 330 |
| 887 | 3300026067 | Ga0207678_10060604 | Ga0207678_100606043 | 330 |
| 888 | 3300026075 | Ga0207708_10000158 | Ga0207708_1000015825 | 330 |
| 889 | 3300026075 | Ga0207708_10015344 | Ga0207708_100153445 | 330 |
| 890 | 3300026078 | Ga0207702_10009588 | Ga0207702_100095884 | 330 |
| 891 | 3300026088 | Ga0207641_10004012 | Ga0207641_1000401212 | 330 |
| 892 | 3300026088 | Ga0207641_10169494 | Ga0207641_101694942 | 330 |
| 893 | 3300026089 | Ga0207648_10001167 | Ga0207648_100011675 | 330 |
| 894 | 3300026095 | Ga0207676_10000089 | Ga0207676_1000008939 | 330 |
| 895 | 3300026116 | Ga0207674_10001478 | Ga0207674_1000147825 | 330 |
| 896 | 3300026118 | Ga0207675_100000229 | Ga0207675_10000022925 | 330 |
| 897 | 3300026121 | Ga0207683_10015823 | Ga0207683_100158232 | 330 |
| 898 | 3300026142 | Ga0207698_10008027 | Ga0207698_100080277 | 330 |
| 899 | 3300027617 | Ga0210002_1009797 | Ga0210002_10097972 | 330 |
| 900 | 3300027665 | Ga0209983_1008764 | Ga0209983_10087642 | 330 |
| 901 | 3300027695 | Ga0209966_1008159 | Ga0209966_10081592 | 330 |
| 902 | 3300027717 | Ga0209998_10001281 | Ga0209998_100012813 | 330 |
| 903 | 3300027876 | Ga0209974_10011045 | Ga0209974_100110452 | 330 |
| 904 | 3300027907 | Ga0207428_10000037 | Ga0207428_1000003763 | 330 |
| 905 | 3300027907 | Ga0207428_10170483 | Ga0207428_101704832 | 330 |
| 906 | 3300028379 | Ga0268266_10024070 | Ga0268266_100240703 | 330 |
| 907 | 3300028380 | Ga0268265_10000195 | Ga0268265_1000019516 | 330 |
| 908 | 3300028380 | Ga0268265_10057224 | Ga0268265_100572243 | 330 |
| 909 | 3300031241 | Ga0265325_10000025 | Ga0265325_1000002578 | 330 |
| 910 | 3300034816 | Ga0373930_0003621 | Ga0373930_0003621_266_1279 | 330 |
| 911 | 3300034817 | Ga0373948_0000063 | Ga0373948_0000063_545_1558 | 330 |
| 912 | 3300034817 | Ga0373948_0001356 | Ga0373948_0001356_1494_2507 | 330 |
| 913 | 3300034817 | Ga0373948_0004636 | Ga0373948_0004636_150_1163 | 330 |
| 914 | 3300034818 | Ga0373950_0001407 | Ga0373950_0001407_141_1154 | 330 |
| 915 | 3300034819 | Ga0373958_0000880 | Ga0373958_0000880_1700_2713 | 330 |
| 916 | 3300034820 | Ga0373959_0000720 | Ga0373959_0000720_4329_5342 | 330 |
| 917 | 3300034957 | Ga0373938_0000709 | Ga0373938_0000709_934_1947 | 330 |
| 918 | 3300034957 | Ga0373938_0002401 | Ga0373938_0002401_1524_2537 | 330 |
| 919 | 3300035083 | Ga0373926_0000002 | Ga0373926_0000002_8856_9869 | 330 |
| 920 | 3300035083 | Ga0373926_0036051 | Ga0373926_0036051_552_1568 | 330 |
| 921 | 3300035084 | Ga0373928_0001013 | Ga0373928_0001013_362_1375 | 330 |
| 922 | 3300035086 | Ga0373934_0027576 | Ga0373934_0027576_867_1883 | 330 |
| 923 | 3300035086 | Ga0373934_0067049 | Ga0373934_0067049_224_1237 | 330 |
| 924 | 3300035088 | Ga0373940_0000150 | Ga0373940_0000150_1677_2690 | 330 |
| 925 | 3300035088 | Ga0373940_0002381 | Ga0373940_0002381_921_1934 | 330 |
| 926 | 3300035089 | Ga0373944_0000048 | Ga0373944_0000048_4743_5756 | 330 |
| 927 | 3300035090 | Ga0373949_0001637 | Ga0373949_0001637_919_1932 | 330 |
| 928 | 3300035091 | Ga0373951_0000729 | Ga0373951_0000729_4274_5287 | 330 |
| 929 | 3300035091 | Ga0373951_0002183 | Ga0373951_0002183_3469_4482 | 330 |
| 930 | 3300035091 | Ga0373951_0011908 | Ga0373951_0011908_604_1617 | 330 |
| 931 | 3300035092 | Ga0373952_0000170 | Ga0373952_0000170_7608_8621 | 330 |
| 932 | 3300035111 | Ga0373923_0000329 | Ga0373923_0000329_1961_2974 | 330 |
| 933 | 3300035112 | Ga0373932_0000475 | Ga0373932_0000475_4470_5483 | 330 |
| 934 | 3300035112 | Ga0373932_0004768 | Ga0373932_0004768_264_1277 | 330 |
| 935 | 3300035113 | Ga0373936_0000294 | Ga0373936_0000294_10551_11564 | 330 |
| 936 | 3300035113 | Ga0373936_0029273 | Ga0373936_0029273_517_1533 | 330 |
| 937 | 3300035114 | Ga0373939_0000360 | Ga0373939_0000360_393_1406 | 330 |
| 938 | 3300035114 | Ga0373939_0002626 | Ga0373939_0002626_767_1780 | 330 |
| 939 | 3300035115 | Ga0373941_0001632 | Ga0373941_0001632_489_1502 | 330 |
| 940 | 3300035115 | Ga0373941_0001926 | Ga0373941_0001926_2543_3556 | 330 |
| 941 | 3300035116 | Ga0373945_0000229 | Ga0373945_0000229_11391_12404 | 330 |
| 942 | 3300035116 | Ga0373945_0017503 | Ga0373945_0017503_718_1734 | 330 |
| 943 | 3300035118 | Ga0373954_0007246 | Ga0373954_0007246_34_1047 | 330 |
| 944 | 3300035119 | Ga0373956_0002040 | Ga0373956_0002040_931_1944 | 330 |
| 945 | 3300035119 | Ga0373956_0002776 | Ga0373956_0002776_2115_3131 | 330 |
| 946 | 3300035121 | Ga0373960_0001914 | Ga0373960_0001914_210_1223 | 330 |
| 947 | 3300035170 | Ga0373943_0010040 | Ga0373943_0010040_2822_3835 | 330 |
| 948 | 3300035170 | Ga0373943_0035046 | Ga0373943_0035046_58_1074 | 330 |
| 949 | 3300035171 | Ga0373946_0010279 | Ga0373946_0010279_2165_3178 | 330 |
| 950 | 3300035171 | Ga0373946_0021423 | Ga0373946_0021423_1375_2391 | 330 |
| 951 | 3300035172 | Ga0373955_0001108 | Ga0373955_0001108_10148_11161 | 330 |
| 952 | 3300035172 | Ga0373955_0010682 | Ga0373955_0010682_2509_3525 | 330 |
| 953 | 3300035172 | Ga0373955_0155450 | Ga0373955_0155450_282_1298 | 330 |
| 954 | 3300035207 | Ga0373942_0001717 | Ga0373942_0001717_820_1833 | 330 |
| 955 | 3300035241 | Ga0373961_0002411 | Ga0373961_0002411_1303_2316 | 330 |
| 956 | 3300035241 | Ga0373961_0018064 | Ga0373961_0018064_375_1388 | 330 |
| 957 | 3300035242 | Ga0373962_0000682 | Ga0373962_0000682_3738_4751 | 330 |
| 958 | 3300035691 | Ga0373931_0000082 | Ga0373931_0000082_22255_23268 | 330 |
| 959 | 3300035691 | Ga0373931_0021215 | Ga0373931_0021215_83_1096 | 330 |
| 960 | 3300035691 | Ga0373931_0079083 | Ga0373931_0079083_520_1533 | 330 |
| 961 | 3300035692 | Ga0373935_0017917 | Ga0373935_0017917_284_1297 | 330 |
| 962 | 3300035692 | Ga0373935_0025526 | Ga0373935_0025526_2237_3250 | 330 |
| 963 | 3300035695 | Ga0373927_0012717 | Ga0373927_0012717_1155_2168 | 330 |
| 964 | 3300035724 | Ga0373933_0004823 | Ga0373933_0004823_4183_5196 | 330 |
| 965 | 3300035724 | Ga0373933_0011958 | Ga0373933_0011958_3114_4130 | 330 |
| 966 | 3300035724 | Ga0373933_0083697 | Ga0373933_0083697_860_1876 | 330 |
| 967 | 3300035725 | Ga0373947_0003242 | Ga0373947_0003242_5676_6689 | 330 |
| 968 | 3300035725 | Ga0373947_0223803 | Ga0373947_0223803_76_1089 | 330 |
| 969 | 3300036401 | Ga0373937_0001536 | Ga0373937_0001536_6600_7613 | 330 |
| 970 | 3300036401 | Ga0373937_0002909 | Ga0373937_0002909_8115_9131 | 330 |
| 971 | 3300037068 | Ga0373925_0001065 | Ga0373925_0001065_19897_20910 | 330 |
| 972 | 3300037068 | Ga0373925_0063161 | Ga0373925_0063161_505_1518 | 330 |
| 973 | 3300037068 | Ga0373925_0091160 | Ga0373925_0091160_40_1056 | 330 |
| 974 | 3300037068 | Ga0373925_0120338 | Ga0373925_0120338_237_1253 | 330 |
| 975 | 3300038996 | Ga0242420_007484 | Ga0242420_007484_504_1517 | 330 |
| 976 | 3300042001 | Ga0439441_017869 | Ga0439441_017869_145_1158 | 330 |
| 977 | 3300042008 | Ga0439450_005184 | Ga0439450_005184_491_1504 | 330 |
| 978 | 3300042012 | Ga0439455_0019453 | Ga0439455_0019453_67_1080 | 330 |
| 979 | 3300042876 | Ga0451577_0046357 | Ga0451577_0046357_922_1935 | 330 |
| 980 | 3300045051 | Ga0451576_0024813 | Ga0451576_0024813_4478_5491 | 330 |
| 981 | 3300046452 | Ga0495617_007534 | Ga0495617_007534_2200_3213 | 330 |
| 982 | 3300046454 | Ga0495592_0000766 | Ga0495592_0000766_5155_6168 | 330 |
| 983 | 3300046454 | Ga0495592_0140235 | Ga0495592_0140235_52_1068 | 330 |
| 984 | 3300046455 | Ga0495603_0079883 | Ga0495603_0079883_407_1420 | 330 |
| 985 | 3300046455 | Ga0495603_0122000 | Ga0495603_0122000_256_1269 | 330 |
| 986 | 3300046459 | Ga0495629_0001979 | Ga0495629_0001979_9462_10475 | 330 |
| 987 | 3300046459 | Ga0495629_0036597 | Ga0495629_0036597_2039_3052 | 330 |
| 988 | 3300046459 | Ga0495629_0067753 | Ga0495629_0067753_13_1029 | 330 |
| 989 | 3300046461 | Ga0495641_0000380 | Ga0495641_0000380_14252_15265 | 330 |
| 990 | 3300046462 | Ga0495651_0000929 | Ga0495651_0000929_10337_11350 | 330 |
| 991 | 3300046462 | Ga0495651_0001721 | Ga0495651_0001721_13099_14115 | 330 |
| 992 | 3300046462 | Ga0495651_0032645 | Ga0495651_0032645_771_1787 | 330 |
| 993 | 3300046463 | Ga0495653_0000209 | Ga0495653_0000209_33901_34914 | 330 |
| 994 | 3300046463 | Ga0495653_0026185 | Ga0495653_0026185_489_1505 | 330 |
| 995 | 3300046472 | Ga0495580_0004313 | Ga0495580_0004313_7941_8954 | 330 |
| 996 | 3300046473 | Ga0495582_0001370 | Ga0495582_0001370_10553_11566 | 330 |
| 997 | 3300046473 | Ga0495582_0005359 | Ga0495582_0005359_860_1873 | 330 |
| 998 | 3300046473 | Ga0495582_0045180 | Ga0495582_0045180_631_1647 | 330 |
| 999 | 3300046475 | Ga0495639_0001523 | Ga0495639_0001523_2464_3477 | 330 |
| 1000 | 3300046476 | Ga0495662_0000197 | Ga0495662_0000197_21654_22667 | 330 |
| 1001 | 3300046477 | Ga0495664_0045914 | Ga0495664_0045914_608_1624 | 330 |
| 1002 | 3300046492 | Ga0495585_0001361 | Ga0495585_0001361_13204_14217 | 330 |
| 1003 | 3300046499 | Ga0495594_0015737 | Ga0495594_0015737_1902_2915 | 330 |
| 1004 | 3300046499 | Ga0495594_0111878 | Ga0495594_0111878_264_1277 | 330 |
| 1005 | 3300046501 | Ga0495607_0003799 | Ga0495607_0003799_8107_9120 | 330 |
| 1006 | 3300046511 | Ga0495608_0001204 | Ga0495608_0001204_5803_6816 | 330 |
| 1007 | 3300046511 | Ga0495608_0007880 | Ga0495608_0007880_4104_5120 | 330 |
| 1008 | 3300046514 | Ga0495618_0004273 | Ga0495618_0004273_6696_7709 | 330 |
| 1009 | 3300046514 | Ga0495618_0107713 | Ga0495618_0107713_404_1420 | 330 |
| 1010 | 3300046516 | Ga0495628_0001791 | Ga0495628_0001791_6694_7707 | 330 |
| 1011 | 3300046516 | Ga0495628_0008193 | Ga0495628_0008193_4831_5847 | 330 |
| 1012 | 3300046516 | Ga0495628_0048331 | Ga0495628_0048331_1695_2711 | 330 |
| 1013 | 3300046517 | Ga0495630_0003296 | Ga0495630_0003296_4520_5533 | 330 |
| 1014 | 3300046517 | Ga0495630_0016592 | Ga0495630_0016592_3732_4748 | 330 |
| 1015 | 3300046526 | Ga0495666_0000462 | Ga0495666_0000462_15298_16311 | 330 |
| 1016 | 3300046526 | Ga0495666_0014951 | Ga0495666_0014951_980_1996 | 330 |
| 1017 | 3300046529 | Ga0495652_0205483 | Ga0495652_0205483_99_1115 | 330 |
| 1018 | 3300046531 | Ga0495665_0013406 | Ga0495665_0013406_3008_4021 | 330 |
| 1019 | 3300046533 | Ga0495640_0082886 | Ga0495640_0082886_859_1875 | 330 |
| 1020 | 3300046533 | Ga0495640_0108325 | Ga0495640_0108325_426_1442 | 330 |
| 1021 | 3300046535 | Ga0495586_0001093 | Ga0495586_0001093_4317_5330 | 330 |
| 1022 | 3300046535 | Ga0495586_0009710 | Ga0495586_0009710_2558_3574 | 330 |
| 1023 | 3300046536 | Ga0495587_0000604 | Ga0495587_0000604_12391_13407 | 330 |
| 1024 | 3300046536 | Ga0495587_0002926 | Ga0495587_0002926_3843_4856 | 330 |
| 1025 | 3300046538 | Ga0495609_0035685 | Ga0495609_0035685_1148_2161 | 330 |
| 1026 | 3300046557 | Ga0495622_0001441 | Ga0495622_0001441_255_1268 | 330 |
| 1027 | 3300046558 | Ga0495633_0015044 | Ga0495633_0015044_1847_2860 | 330 |
| 1028 | 3300046559 | Ga0495667_0002395 | Ga0495667_0002395_7899_8915 | 330 |
| 1029 | 3300046559 | Ga0495667_0003934 | Ga0495667_0003934_5708_6721 | 330 |
| 1030 | 3300046615 | Ga0495656_0000553 | Ga0495656_0000553_8131_9144 | 330 |
| 1031 | 3300046663 | Ga0495635_0010999 | Ga0495635_0010999_5224_6237 | 330 |
| 1032 | 3300046663 | Ga0495635_0070427 | Ga0495635_0070427_884_1900 | 330 |
| 1033 | 3300046664 | Ga0495659_0002101 | Ga0495659_0002101_2327_3340 | 330 |
| 1034 | 3300046665 | Ga0495661_0065836 | Ga0495661_0065836_584_1597 | 330 |
| 1035 | 3300046674 | Ga0495588_0000313 | Ga0495588_0000313_28317_29330 | 330 |
| 1036 | 3300046674 | Ga0495588_0017173 | Ga0495588_0017173_732_1748 | 330 |
| 1037 | 3300046675 | Ga0495657_0062003 | Ga0495657_0062003_1198_2214 | 330 |
| 1038 | 3300046678 | Ga0495599_0000261 | Ga0495599_0000261_5547_6560 | 330 |
| 1039 | 3300046678 | Ga0495599_0108531 | Ga0495599_0108531_62_1078 | 330 |
| 1040 | 3300046679 | Ga0495623_0067807 | Ga0495623_0067807_388_1404 | 330 |
| 1041 | 3300046680 | Ga0495646_0000800 | Ga0495646_0000800_6959_7972 | 330 |
| 1042 | 3300046681 | Ga0495647_0001490 | Ga0495647_0001490_2823_3836 | 330 |
| 1043 | 3300046681 | Ga0495647_0022808 | Ga0495647_0022808_319_1332 | 330 |
| 1044 | 3300046683 | Ga0495658_0001933 | Ga0495658_0001933_8045_9058 | 330 |
| 1045 | 3300046683 | Ga0495658_0018886 | Ga0495658_0018886_412_1425 | 330 |
| 1046 | 3300046689 | Ga0495613_0002928 | Ga0495613_0002928_7716_8729 | 330 |
| 1047 | 3300046689 | Ga0495613_0006502 | Ga0495613_0006502_5095_6108 | 330 |
| 1048 | 3300046690 | Ga0495624_0006114 | Ga0495624_0006114_4064_5077 | 330 |
| 1049 | 3300046691 | Ga0495670_0008663 | Ga0495670_0008663_2314_3327 | 330 |
| 1050 | 3300046809 | Ga0495600_0000309 | Ga0495600_0000309_19676_20689 | 330 |
| 1051 | 3300046809 | Ga0495600_0001591 | Ga0495600_0001591_3687_4703 | 330 |
| 1052 | 3300047315 | Ga0495581_0001406 | Ga0495581_0001406_7019_8032 | 330 |
| 1053 | 3300047317 | Ga0495604_0003597 | Ga0495604_0003597_2121_3137 | 330 |
| 1054 | 3300047317 | Ga0495604_0042374 | Ga0495604_0042374_301_1317 | 330 |
| 1055 | 3300047319 | Ga0495674_0020806 | Ga0495674_0020806_3044_4057 | 330 |
| 1056 | 3300047321 | Ga0495676_0021514 | Ga0495676_0021514_2152_3165 | 330 |
| 1057 | 3300047321 | Ga0495676_0141704 | Ga0495676_0141704_657_1670 | 330 |
| 1058 | 3300047322 | Ga0495680_0001830 | Ga0495680_0001830_18845_19861 | 330 |
| 1059 | 3300047322 | Ga0495680_0002274 | Ga0495680_0002274_17096_18109 | 330 |
| 1060 | 3300047322 | Ga0495680_0020443 | Ga0495680_0020443_2215_3231 | 330 |
| 1061 | 3300047322 | Ga0495680_0058878 | Ga0495680_0058878_216_1229 | 330 |
| 1062 | 3300047446 | Ga0495679_017725 | Ga0495679_017725_795_1808 | 330 |
| 1063 | 3300047471 | Ga0495684_0000338 | Ga0495684_0000338_5729_6742 | 330 |
| 1064 | 3300047673 | Ga0495593_0000170 | Ga0495593_0000170_19682_20695 | 330 |
| 1065 | 3300048088 | Ga0495602_0002915 | Ga0495602_0002915_2170_3186 | 330 |
| 1066 | 3300048089 | Ga0495614_0000184 | Ga0495614_0000184_16689_17702 | 330 |
| 1067 | 3300048089 | Ga0495614_0082697 | Ga0495614_0082697_126_1142 | 330 |
| 1068 | 3300048903 | Ga0496100_0000189 | Ga0496100_0000189_25360_26373 | 330 |
| 1069 | 3300048903 | Ga0496100_0015415 | Ga0496100_0015415_909_1922 | 330 |
| 1070 | 3300048904 | Ga0496101_0000215 | Ga0496101_0000215_6147_7160 | 330 |
| 1071 | 3300048904 | Ga0496101_0026571 | Ga0496101_0026571_2191_3207 | 330 |
| 1072 | 3300048904 | Ga0496101_0059573 | Ga0496101_0059573_982_1995 | 330 |
| 1073 | 3300048905 | Ga0496102_0001555 | Ga0496102_0001555_6147_7160 | 330 |
| 1074 | 3300048906 | Ga0496103_0000191 | Ga0496103_0000191_13585_14598 | 330 |
| 1075 | 3300048906 | Ga0496103_0051584 | Ga0496103_0051584_933_1946 | 330 |
| 1076 | 3300048907 | Ga0496104_0000170 | Ga0496104_0000170_12161_13177 | 330 |
| 1077 | 3300048907 | Ga0496104_0049524 | Ga0496104_0049524_1489_2502 | 330 |
| 1078 | 3300048907 | Ga0496104_0290416 | Ga0496104_0290416_348_1361 | 330 |
| 1079 | 3300048908 | Ga0496105_0002931 | Ga0496105_0002931_2795_3811 | 330 |
| 1080 | 3300048908 | Ga0496105_0006803 | Ga0496105_0006803_2450_3466 | 330 |
| 1081 | 3300048908 | Ga0496105_0030995 | Ga0496105_0030995_2542_3555 | 330 |
| 1082 | 3300048909 | Ga0496106_0000190 | Ga0496106_0000190_7942_8955 | 330 |
| 1083 | 3300048909 | Ga0496106_0019239 | Ga0496106_0019239_3913_4926 | 330 |
| 1084 | 3300048909 | Ga0496106_0026457 | Ga0496106_0026457_683_1699 | 330 |
| 1085 | 3300048909 | Ga0496106_0144739 | Ga0496106_0144739_817_1830 | 330 |
| 1086 | 3300048909 | Ga0496106_0331159 | Ga0496106_0331159_131_1144 | 330 |
| 1087 | 3300048910 | Ga0496107_0000080 | Ga0496107_0000080_30124_31137 | 330 |
| 1088 | 3300048910 | Ga0496107_0012647 | Ga0496107_0012647_346_1359 | 330 |
| 1089 | 3300048910 | Ga0496107_0023716 | Ga0496107_0023716_2171_3184 | 330 |
| 1090 | 3300048910 | Ga0496107_0067884 | Ga0496107_0067884_738_1754 | 330 |
| 1091 | 3300048910 | Ga0496107_0108930 | Ga0496107_0108930_500_1513 | 330 |
| 1092 | 3300048910 | Ga0496107_0293323 | Ga0496107_0293323_125_1138 | 330 |
| 1093 | 3300048911 | Ga0496108_0023975 | Ga0496108_0023975_3160_4173 | 330 |
| 1094 | 3300048911 | Ga0496108_0076002 | Ga0496108_0076002_1084_2097 | 330 |
| 1095 | 3300048911 | Ga0496108_0077908 | Ga0496108_0077908_479_1495 | 330 |
| 1096 | 3300048912 | Ga0496109_0000737 | Ga0496109_0000737_7911_8924 | 330 |
| 1097 | 3300048912 | Ga0496109_0025231 | Ga0496109_0025231_1968_2981 | 330 |
| 1098 | 3300048912 | Ga0496109_0059327 | Ga0496109_0059327_2400_3413 | 330 |
| 1099 | 3300048912 | Ga0496109_0232398 | Ga0496109_0232398_701_1717 | 330 |
| 1100 | 3300048912 | Ga0496109_0330773 | Ga0496109_0330773_216_1229 | 330 |
| 1101 | 3300048913 | Ga0496110_0038526 | Ga0496110_0038526_2173_3186 | 330 |
| 1102 | 3300048914 | Ga0496111_0077613 | Ga0496111_0077613_850_1863 | 330 |
| 1103 | 3300048914 | Ga0496111_0101454 | Ga0496111_0101454_805_1818 | 330 |
| 1104 | 3300048915 | Ga0496112_0165771 | Ga0496112_0165771_11_1024 | 330 |
| 1105 | 3300048915 | Ga0496112_0165858 | Ga0496112_0165858_910_1926 | 330 |
| 1106 | 3300048916 | Ga0496113_0000721 | Ga0496113_0000721_15552_16565 | 330 |
| 1107 | 3300048916 | Ga0496113_0011762 | Ga0496113_0011762_1694_2707 | 330 |
| 1108 | 3300048916 | Ga0496113_0027156 | Ga0496113_0027156_481_1494 | 330 |
| 1109 | 3300048916 | Ga0496113_0117750 | Ga0496113_0117750_210_1223 | 330 |
| 1110 | 3300048917 | Ga0496114_0005702 | Ga0496114_0005702_1623_2636 | 330 |
| 1111 | 3300048917 | Ga0496114_0006768 | Ga0496114_0006768_3783_4796 | 330 |
| 1112 | 3300048918 | Ga0496115_0007097 | Ga0496115_0007097_1139_2152 | 330 |
| 1113 | 3300048918 | Ga0496115_0066247 | Ga0496115_0066247_1775_2791 | 330 |
| 1114 | 3300048918 | Ga0496115_0069353 | Ga0496115_0069353_861_1874 | 330 |
| 1115 | 3300048918 | Ga0496115_0109483 | Ga0496115_0109483_677_1693 | 330 |
| 1116 | 3300049592 | Ga0501076_0044755 | Ga0501076_0044755_2365_3378 | 330 |
| 1117 | 3300049593 | Ga0501077_0053699 | Ga0501077_0053699_560_1573 | 330 |
| 1118 | 3300050494 | nmdc:mga06z11_62988_c1 | nmdc:mga06z11_62988_c1_190_1203 | 330 |
| 1119 | 3300050511 | nmdc:mga08y16_1835_c1 | nmdc:mga08y16_1835_c1_11279_12292 | 330 |
| 1120 | 3300050512 | nmdc:mga0n895_164089_c1 | nmdc:mga0n895_164089_c1_304_1317 | 330 |
| 1121 | 3300050512 | nmdc:mga0n895_459048_c1 | nmdc:mga0n895_459048_c1_152_1165 | 330 |
| 1122 | 3300050512 | nmdc:mga0n895_57339_c1 | nmdc:mga0n895_57339_c1_2125_3138 | 330 |
| 1123 | 3300050513 | nmdc:mga0rr50_64430_c1 | nmdc:mga0rr50_64430_c1_1619_2632 | 330 |
| 1124 | 3300050515 | nmdc:mga0a205_24709_c1 | nmdc:mga0a205_24709_c1_616_1629 | 330 |
| 1125 | 3300053077 | Ga0495601_0000829 | Ga0495601_0000829_4540_5556 | 330 |
| 1126 | 3300053078 | Ga0495612_0000396 | Ga0495612_0000396_9531_10544 | 330 |
| 1127 | 3300053078 | Ga0495612_0019470 | Ga0495612_0019470_807_1823 | 330 |
| 1128 | 3300053084 | Ga0495595_0000489 | Ga0495595_0000489_9640_10656 | 330 |
| 1129 | 3300053084 | Ga0495595_0001055 | Ga0495595_0001055_5569_6582 | 330 |
| 1130 | 3300053084 | Ga0495595_0007407 | Ga0495595_0007407_3157_4173 | 330 |
| 1131 | 3300053084 | Ga0495595_0155002 | Ga0495595_0155002_47_1081 | 330 |
| 1132 | 3300053085 | Ga0495619_0000265 | Ga0495619_0000265_12282_13295 | 330 |
| 1133 | 3300053085 | Ga0495619_0000423 | Ga0495619_0000423_18268_19284 | 330 |
| 1134 | 3300053085 | Ga0495619_0004854 | Ga0495619_0004854_6550_7563 | 330 |
| 1135 | 3300053085 | Ga0495619_0036496 | Ga0495619_0036496_602_1618 | 330 |
| 1136 | 3300054114 | Ga0501084_0097542 | Ga0501084_0097542_22_1035 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5649 | 33 | 310 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5606 | 33 | 310 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5604 | 26 | 306 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5538 | 22 | 310 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.537 | 22 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8163 | 37 | 309 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7929 | 38 | 305 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7844 | 39 | 305 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7791 | 38 | 305 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7768 | 36 | 305 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847A9G8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9241 | 13 | 327 |
GO:0005886
GO:0015658 |
| AF-A0A537NJW4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9228 | 16 | 326 |
GO:0005886
GO:0015658 |
| AF-A0A2V6USM8-F1-model_v4 | ABC transporter domain-containing protein | 0.9224 | 15 | 277 |
GO:0005524
GO:0005886 GO:0015658 GO:0016887 |
| AF-A0A2N2FS50-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9198 | 14 | 282 |
GO:0005886
GO:0015658 |
| AF-A0A7C3S3N1-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9197 | 10 | 322 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar