F490626

General Info

Members Datasets Scaffolds Average Seq Length
1136 422 1136 325

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10147276|Ga0070710_101472762
Length 347
Sequence MKRMSSDGHPALAVRPERGWIGRRGWRVGVLFLIAVVPLVFQDSYWRTNLIVCSINIMLAIGLDFILGYAGQLNLGHSAFYGIGAYASTLLITKLGVPFWVAFVLAIALSGTAGMALSIFAVRLRGHYLAIASLGFAVIVHQILLNWISLTQGPLGIYAIKPPPEIALPGFAPISFSNTANMFYLVAGFAFLFYLLLDQLVRSPIGETLAAIREDEVSASSFGINCARWKVFAFGIGSALAGAAGAFYASFVGTLVPDAFIITESFTILAMVIVGGMGTLIGPVWGAILLTLLPEVLREFGDLRLVLYGAALTLVVLFMPGGMVQAVEILRARVRRSPAAASGGMRP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
131 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
148 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
275 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
276 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
284 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
304 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
324 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
345 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
346 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
347 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
359 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
360 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
390 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
415 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
419 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 7.39
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214778551 2209111006 Bacteria 2529
2 ARcpr5oldR_c000028 3300000041 Bacteria 29588
3 ARSoilYngRDRAFT_c00197 3300000042 Bacteria 10090
4 ARcpr5yngRDRAFT_c000089 3300000043 Bacteria 14792
5 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
6 ARCol0oldRDRAFT_c01094 3300000045 Bacteria 2012
7 ARCol0yngRDRAFT_1000216 3300000652 Bacteria 9710
8 JGI24739J22299_10001754 3300001989 Bacteria 8253
9 JGI24737J22298_10001842 3300001990 Bacteria 7581
10 JGI24737J22298_10002044 3300001990 Bacteria 7221
11 JGI24750J21931_1000257 3300002070 Bacteria 9036
12 JGI24745J21846_1001091 3300002073 Bacteria 2565
13 JGI24738J21930_10009098 3300002075 Bacteria 2246
14 JGI24749J21850_1001489 3300002076 Bacteria 3313
15 JGI24035J26624_1000791 3300002126 Bacteria 2975
16 JGI24034J26672_10001294 3300002239 Bacteria 3296
17 JGI25405J52794_10005877 3300003911 Bacteria 2228
18 Ga0065712_10001370 3300005290 Bacteria 6245
19 Ga0065712_10087769 3300005290 Bacteria 2554
20 Ga0065715_10002415 3300005293 Bacteria 7112
21 Ga0065715_10093203 3300005293 Bacteria 4769
22 Ga0065715_10145053 3300005293 Bacteria 1800
23 Ga0065707_10099628 3300005295 Bacteria 2991
24 Ga0070676_10001404 3300005328 Bacteria 12160
25 Ga0070676_10023174 3300005328 Bacteria 3488
26 Ga0070683_100000144 3300005329 Bacteria 45900
27 Ga0070683_100040784 3300005329 Bacteria 4268
28 Ga0070690_100007954 3300005330 Bacteria 6087
29 Ga0070690_100079728 3300005330 Bacteria 2141
30 Ga0070690_100120776 3300005330 Bacteria 1758
31 Ga0070690_100269998 3300005330 Bacteria 1209
32 Ga0070670_100000437 3300005331 Bacteria 34047
33 Ga0070677_10001605 3300005333 Bacteria 7147
34 Ga0068869_100000035 3300005334 Bacteria 55467
35 Ga0068869_100005392 3300005334 Bacteria 8036
36 Ga0070666_10006608 3300005335 Bacteria 7130
37 Ga0070666_10075970 3300005335 Bacteria 2291
38 Ga0070680_100004508 3300005336 Bacteria 10488
39 Ga0070680_100011476 3300005336 Bacteria 6855
40 Ga0070680_100066115 3300005336 Bacteria 2964
41 Ga0070680_100131070 3300005336 Bacteria 2098
42 Ga0070680_100289734 3300005336 Bacteria 1388
43 Ga0070682_100001374 3300005337 Bacteria 13740
44 Ga0070682_100088267 3300005337 Bacteria 2023
45 Ga0070682_100168894 3300005337 Bacteria 1518
46 Ga0068868_100001473 3300005338 Bacteria 16252
47 Ga0068868_100033171 3300005338 Bacteria 3978
48 Ga0070660_100128375 3300005339 Bacteria 2027
49 Ga0070689_100004784 3300005340 Bacteria 9183
50 Ga0070689_100073218 3300005340 Bacteria 2679
51 Ga0070689_100111139 3300005340 Bacteria 2179
52 Ga0070689_100169616 3300005340 Bacteria 1768
53 Ga0070691_10000856 3300005341 Bacteria 12302
54 Ga0070691_10009885 3300005341 Bacteria 4346
55 Ga0070691_10037037 3300005341 Bacteria 2301
56 Ga0070687_100000176 3300005343 Bacteria 22186
57 Ga0070687_100000558 3300005343 Bacteria 12442
58 Ga0070661_100000017 3300005344 Bacteria 153232
59 Ga0070661_100158977 3300005344 Bacteria 1711
60 Ga0070692_10000008 3300005345 Bacteria 47438
61 Ga0070692_10001408 3300005345 Bacteria 8710
62 Ga0070668_100000699 3300005347 Bacteria 22898
63 Ga0070668_100042943 3300005347 Bacteria 3465
64 Ga0070669_100000250 3300005353 Bacteria 44115
65 Ga0070669_100062049 3300005353 Bacteria 2747
66 Ga0070675_100001268 3300005354 Bacteria 18442
67 Ga0070671_100010911 3300005355 Bacteria 7296
68 Ga0070671_100035832 3300005355 Bacteria 4112
69 Ga0070671_100149160 3300005355 Bacteria 1974
70 Ga0070671_100347631 3300005355 Bacteria 1265
71 Ga0070674_100000443 3300005356 Bacteria 20920
72 Ga0070674_100015526 3300005356 Bacteria 4755
73 Ga0070674_100031450 3300005356 Bacteria 3517
74 Ga0070674_100358706 3300005356 Unclassified 1180
75 Ga0070673_100417179 3300005364 Bacteria 1203
76 Ga0070688_100000669 3300005365 Bacteria 17042
77 Ga0070688_100039934 3300005365 Bacteria 2873
78 Ga0070688_100197993 3300005365 Bacteria 1404
79 Ga0070659_100000214 3300005366 Bacteria 44422
80 Ga0070659_100028165 3300005366 Bacteria 4336
81 Ga0070667_100142337 3300005367 Bacteria 2101
82 Ga0070703_10003840 3300005406 Bacteria 4253
83 Ga0070703_10006816 3300005406 Bacteria 3205
84 Ga0070709_10080195 3300005434 Bacteria 2127
85 Ga0070709_10294034 3300005434 Unclassified 1184
86 Ga0070714_100075417 3300005435 Bacteria 2926
87 Ga0070714_100169471 3300005435 Bacteria 1981
88 Ga0070713_100000889 3300005436 Bacteria 19162
89 Ga0070713_100120844 3300005436 Bacteria 2297
90 Ga0070713_100133338 3300005436 Bacteria 2193
91 Ga0070713_100458299 3300005436 Bacteria 1198
92 Ga0070710_10007734 3300005437 Bacteria 5213
93 Ga0070710_10073374 3300005437 Unclassified 1978
94 Ga0070710_10106695 3300005437 Bacteria 1676
95 Ga0070710_10147276 3300005437 Bacteria 1449
96 Ga0070710_10150698 3300005437 Bacteria 1434
97 Ga0070701_10000060 3300005438 Bacteria 29083
98 Ga0070701_10000099 3300005438 Bacteria 24473
99 Ga0070711_100008511 3300005439 Bacteria 6288
100 Ga0070711_100086439 3300005439 Bacteria 2248
101 Ga0070711_100112898 3300005439 Bacteria 1997
102 Ga0070711_100330665 3300005439 Bacteria 1220
103 Ga0070705_100002404 3300005440 Bacteria 9423
104 Ga0070705_100007847 3300005440 Bacteria 5271
105 Ga0070705_100082098 3300005440 Bacteria 1982
106 Ga0070700_100020018 3300005441 Bacteria 3870
107 Ga0070700_100021932 3300005441 Bacteria 3717
108 Ga0070700_100077093 3300005441 Bacteria 2142
109 Ga0070694_100002437 3300005444 Bacteria 10982
110 Ga0070694_100035517 3300005444 Bacteria 3296
111 Ga0070694_100114653 3300005444 Bacteria 1925
112 Ga0070708_100049987 3300005445 Bacteria 3700
113 Ga0070663_100000201 3300005455 Bacteria 29751
114 Ga0070663_100018330 3300005455 Bacteria 4588
115 Ga0070663_100059497 3300005455 Bacteria 2746
116 Ga0070663_100141160 3300005455 Bacteria 1839
117 Ga0070678_100000698 3300005456 Bacteria 16599
118 Ga0070678_100019190 3300005456 Bacteria 4451
119 Ga0070662_100009421 3300005457 Bacteria 6381
120 Ga0070662_100074141 3300005457 Bacteria 2517
121 Ga0070662_100091430 3300005457 Bacteria 2286
122 Ga0070662_100122382 3300005457 Unclassified 1995
123 Ga0070681_10000401 3300005458 Bacteria 35170
124 Ga0070681_10004036 3300005458 Bacteria 13848
125 Ga0070681_10136429 3300005458 Bacteria 2384
126 Ga0068867_100003556 3300005459 Bacteria 10958
127 Ga0068867_100019105 3300005459 Bacteria 4880
128 Ga0068867_100079393 3300005459 Bacteria 2470
129 Ga0068867_100267334 3300005459 Bacteria 1397
130 Ga0070706_100409301 3300005467 Bacteria 1263
131 Ga0070699_100002181 3300005518 Bacteria 17723
132 Ga0070699_100021000 3300005518 Bacteria 5630
133 Ga0070699_100135854 3300005518 Bacteria 2169
134 Ga0070679_100002086 3300005530 Bacteria 17991
135 Ga0070679_100059355 3300005530 Bacteria 3813
136 Ga0070679_100096460 3300005530 Bacteria 2944
137 Ga0070684_100013364 3300005535 Bacteria 6616
138 Ga0070684_100026194 3300005535 Bacteria 4910
139 Ga0070684_100037443 3300005535 Bacteria 4161
140 Ga0070697_100079463 3300005536 Bacteria 2700
141 Ga0068853_100021340 3300005539 Bacteria 5399
142 Ga0068853_100142299 3300005539 Bacteria 2154
143 Ga0068853_100584395 3300005539 Bacteria 1060
144 Ga0070672_100002749 3300005543 Bacteria 11264
145 Ga0070686_100001254 3300005544 Bacteria 14395
146 Ga0070686_100004877 3300005544 Bacteria 7403
147 Ga0070686_100054001 3300005544 Bacteria 2568
148 Ga0070686_100191787 3300005544 Bacteria 1459
149 Ga0070695_100002011 3300005545 Bacteria 11595
150 Ga0070695_100004254 3300005545 Bacteria 8374
151 Ga0070695_100012651 3300005545 Bacteria 5067
152 Ga0070695_100013109 3300005545 Bacteria 4981
153 Ga0070695_100130295 3300005545 Unclassified 1733
154 Ga0070696_100000304 3300005546 Bacteria 29759
155 Ga0070696_100001197 3300005546 Bacteria 16837
156 Ga0070696_100013066 3300005546 Bacteria 5571
157 Ga0070696_100014702 3300005546 Bacteria 5253
158 Ga0070696_100041998 3300005546 Bacteria 3161
159 Ga0070696_100077658 3300005546 Bacteria 2346
160 Ga0070696_100113480 3300005546 Bacteria 1953
161 Ga0070693_100000507 3300005547 Bacteria 17464
162 Ga0070693_100079312 3300005547 Bacteria 1953
163 Ga0070665_100113074 3300005548 Bacteria 2718
164 Ga0070665_100323436 3300005548 Bacteria 1547
165 Ga0070704_100011172 3300005549 Bacteria 5491
166 Ga0068855_100001779 3300005563 Bacteria 26944
167 Ga0068855_100024209 3300005563 Bacteria 7267
168 Ga0068855_100296061 3300005563 Bacteria 1793
169 Ga0070664_100141250 3300005564 Bacteria 2120
170 Ga0070664_100298093 3300005564 Bacteria 1456
171 Ga0068857_100000494 3300005577 Bacteria 28282
172 Ga0068854_100000139 3300005578 Bacteria 50270
173 Ga0068854_100005384 3300005578 Bacteria 8078
174 Ga0068854_100032879 3300005578 Bacteria 3612
175 Ga0068856_100001571 3300005614 Bacteria 23910
176 Ga0068856_100033405 3300005614 Bacteria 5037
177 Ga0068856_100043275 3300005614 Bacteria 4431
178 Ga0068856_100110487 3300005614 Bacteria 2746
179 Ga0070702_100000039 3300005615 Bacteria 35203
180 Ga0070702_100001018 3300005615 Bacteria 11112
181 Ga0070702_100061340 3300005615 Bacteria 2189
182 Ga0068852_100000193 3300005616 Bacteria 41505
183 Ga0068852_100156571 3300005616 Bacteria 2123
184 Ga0068859_100000420 3300005617 Bacteria 42401
185 Ga0068859_100004926 3300005617 Bacteria 13578
186 Ga0068859_100434693 3300005617 Bacteria 1409
187 Ga0068864_100000226 3300005618 Bacteria 50929
188 Ga0068864_100017359 3300005618 Bacteria 6000
189 Ga0068866_10000153 3300005718 Bacteria 31527
190 Ga0068866_10012260 3300005718 Bacteria 3733
191 Ga0068866_10030148 3300005718 Bacteria 2600
192 Ga0068861_100000328 3300005719 Bacteria 26783
193 Ga0068861_100000987 3300005719 Bacteria 17369
194 Ga0068861_100091989 3300005719 Bacteria 2396
195 Ga0068861_100481965 3300005719 Bacteria 1118
196 Ga0068851_10017494 3300005834 Bacteria 3444
197 Ga0068870_10041901 3300005840 Bacteria 2381
198 Ga0068863_100001214 3300005841 Bacteria 25744
199 Ga0068863_100277037 3300005841 Bacteria 1624
200 Ga0068858_100005931 3300005842 Bacteria 11927
201 Ga0068858_100079607 3300005842 Bacteria 3044
202 Ga0068858_100430500 3300005842 Unclassified 1269
203 Ga0068860_100001525 3300005843 Bacteria 24947
204 Ga0068860_100002022 3300005843 Bacteria 21401
205 Ga0068860_100091469 3300005843 Bacteria 2898
206 Ga0068862_100009697 3300005844 Bacteria 7961
207 Ga0068862_100117504 3300005844 Bacteria 2340
208 Ga0068862_100225499 3300005844 Bacteria 1698
209 Ga0081455_10000035 3300005937 Bacteria 136366
210 Ga0081455_10004348 3300005937 Bacteria 15947
211 Ga0081455_10007158 3300005937 Bacteria 11801
212 Ga0081455_10020443 3300005937 Bacteria 6233
213 Ga0081540_1001366 3300005983 Bacteria 21169
214 Ga0081540_1008092 3300005983 Bacteria 7384
215 Ga0081539_10001081 3300005985 Bacteria 49568
216 Ga0070717_10028516 3300006028 Unclassified 4469
217 Ga0070717_10029796 3300006028 Bacteria 4382
218 Ga0070717_10030004 3300006028 Bacteria 4368
219 Ga0070717_10313718 3300006028 Bacteria 1396
220 Ga0075365_10063307 3300006038 Bacteria 2476
221 Ga0075364_10124299 3300006051 Bacteria 1729
222 Ga0070715_10002401 3300006163 Bacteria 5740
223 Ga0070716_100123844 3300006173 Bacteria 1623
224 Ga0070716_100159796 3300006173 Bacteria 1459
225 Ga0070716_100168643 3300006173 Bacteria 1426
226 Ga0070712_100018658 3300006175 Bacteria 4510
227 Ga0070712_100085305 3300006175 Bacteria 2298
228 Ga0070712_100156818 3300006175 Bacteria 1754
229 Ga0070712_100158036 3300006175 Bacteria 1748
230 Ga0070712_100195555 3300006175 Bacteria 1585
231 Ga0070712_100379315 3300006175 Bacteria 1163
232 Ga0075367_10071105 3300006178 Bacteria 2093
233 Ga0075427_10001215 3300006194 Bacteria 3271
234 Ga0097621_100000049 3300006237 Bacteria 61062
235 Ga0097621_100042579 3300006237 Bacteria 3658
236 Ga0097621_100121071 3300006237 Bacteria 2219
237 Ga0068871_100000097 3300006358 Bacteria 52015
238 Ga0068871_100005049 3300006358 Bacteria 9218
239 Ga0068871_100012551 3300006358 Bacteria 6253
240 Ga0068871_100314907 3300006358 Unclassified 1376
241 Ga0068871_100605553 3300006358 Bacteria 997
242 Ga0075428_100000109 3300006844 Bacteria 69948
243 Ga0075428_100001911 3300006844 Bacteria 22354
244 Ga0075428_100003032 3300006844 Bacteria 18343
245 Ga0075430_100000587 3300006846 Bacteria 27593
246 Ga0075431_100006439 3300006847 Bacteria 11656
247 Ga0075431_100265331 3300006847 Bacteria 1742
248 Ga0075433_10000020 3300006852 Bacteria 61231
249 Ga0075433_10022455 3300006852 Bacteria 5295
250 Ga0075433_10052790 3300006852 Archaea 3543
251 Ga0075434_100000349 3300006871 Bacteria 33394
252 Ga0075434_100000383 3300006871 Bacteria 32396
253 Ga0075434_100002124 3300006871 Bacteria 17253
254 Ga0075434_100008956 3300006871 Bacteria 9320
255 Ga0075434_100022971 3300006871 Bacteria 6071
256 Ga0075434_100170341 3300006871 Bacteria 2197
257 Ga0075429_100001264 3300006880 Bacteria 20583
258 Ga0075429_100001660 3300006880 Bacteria 18412
259 Ga0075429_100344656 3300006880 Bacteria 1304
260 Ga0068865_100000119 3300006881 Bacteria 39895
261 Ga0068865_100002459 3300006881 Bacteria 10967
262 Ga0068865_100013953 3300006881 Bacteria 5096
263 Ga0075436_100000075 3300006914 Bacteria 59554
264 Ga0075436_100009889 3300006914 Bacteria 6523
265 Ga0075436_100162440 3300006914 Bacteria 1575
266 Ga0075436_100291853 3300006914 Unclassified 1167
267 Ga0075436_100332668 3300006914 Bacteria 1093
268 Ga0097620_100000420 3300006931 Bacteria 42401
269 Ga0097620_100004926 3300006931 Bacteria 13578
270 Ga0097620_100434665 3300006931 Bacteria 1409
271 Ga0075435_100000116 3300007076 Bacteria 44259
272 Ga0075435_100010428 3300007076 Bacteria 6798
273 Ga0075435_100068235 3300007076 Bacteria 2896
274 Ga0075435_100084229 3300007076 Bacteria 2616
275 Ga0075435_100086474 3300007076 Bacteria 2582
276 Ga0075435_100106012 3300007076 Bacteria 2333
277 Ga0099794_10004509 3300007265 Bacteria 5484
278 Ga0099794_10011922 3300007265 Bacteria 3737
279 Ga0105240_10043010 3300009093 Bacteria 5753
280 Ga0105240_10142934 3300009093 Bacteria 2859
281 Ga0111539_10000237 3300009094 Bacteria 65638
282 Ga0111539_10000373 3300009094 Bacteria 55466
283 Ga0111539_10005738 3300009094 Bacteria 16054
284 Ga0111539_10039849 3300009094 Bacteria 5658
285 Ga0111539_10119492 3300009094 Bacteria 3089
286 Ga0111539_10183865 3300009094 Bacteria 2441
287 Ga0105245_10000202 3300009098 Bacteria 57012
288 Ga0105245_10000533 3300009098 Bacteria 34922
289 Ga0105245_10059377 3300009098 Bacteria 3444
290 Ga0105245_10079781 3300009098 Bacteria 2989
291 Ga0105247_10006779 3300009101 Bacteria 7063
292 Ga0105247_10043825 3300009101 Bacteria 2742
293 Ga0105247_10061305 3300009101 Bacteria 2332
294 Ga0105247_10200075 3300009101 Bacteria 1342
295 Ga0114129_10001030 3300009147 Bacteria 36420
296 Ga0114129_10007859 3300009147 Bacteria 15175
297 Ga0114129_10014462 3300009147 Bacteria 11245
298 Ga0114129_10032825 3300009147 Bacteria 7335
299 Ga0114129_10062119 3300009147 Bacteria 5219
300 Ga0114129_10098133 3300009147 Bacteria 4055
301 Ga0114129_10104720 3300009147 Bacteria 3910
302 Ga0114129_10367322 3300009147 Bacteria 1903
303 Ga0105243_10000495 3300009148 Bacteria 40193
304 Ga0105243_10002106 3300009148 Bacteria 16836
305 Ga0105243_10079714 3300009148 Bacteria 2669
306 Ga0105243_10090495 3300009148 Bacteria 2518
307 Ga0105243_10133051 3300009148 Bacteria 2113
308 Ga0105241_10000430 3300009174 Bacteria 31789
309 Ga0105241_10026871 3300009174 Bacteria 4284
310 Ga0105241_10034348 3300009174 Bacteria 3809
311 Ga0105241_10390499 3300009174 Unclassified 1218
312 Ga0105242_10000248 3300009176 Bacteria 42523
313 Ga0105242_10003639 3300009176 Bacteria 12003
314 Ga0105242_10335081 3300009176 Bacteria 1392
315 Ga0105248_10023208 3300009177 Bacteria 6889
316 Ga0105248_10095373 3300009177 Bacteria 3349
317 Ga0105248_10383812 3300009177 Bacteria 1582
318 Ga0105237_10028031 3300009545 Bacteria 5739
319 Ga0105237_10059994 3300009545 Bacteria 3806
320 Ga0105237_10085558 3300009545 Bacteria 3143
321 Ga0105237_10228124 3300009545 Bacteria 1863
322 Ga0105238_10166511 3300009551 Bacteria 2180
323 Ga0105249_10000215 3300009553 Bacteria 66439
324 Ga0105249_10004892 3300009553 Bacteria 11560
325 Ga0105249_10029800 3300009553 Bacteria 4931
326 Ga0105249_10031327 3300009553 Bacteria 4809
327 Ga0105249_10283487 3300009553 Bacteria 1655
328 Ga0099796_10006479 3300010159 Bacteria 2998
329 Ga0105239_10015015 3300010375 Bacteria 8585
330 Ga0105239_10054877 3300010375 Bacteria 4371
331 Ga0105239_10077348 3300010375 Bacteria 3661
332 Ga0105239_10263627 3300010375 Bacteria 1937
333 Ga0105239_10277795 3300010375 Bacteria 1885
334 Ga0105246_10000019 3300011119 Bacteria 62666
335 Ga0105246_10018242 3300011119 Bacteria 4471
336 Ga0105246_10049993 3300011119 Bacteria 2866
337 Ga0105246_10177655 3300011119 Bacteria 1636
338 Ga0157320_1001286 3300012481 Bacteria 1242
339 Ga0157342_1002013 3300012507 Bacteria 1595
340 Ga0157371_10085937 3300013102 Bacteria 2228
341 Ga0157374_10039059 3300013296 Bacteria 4366
342 Ga0157374_10141328 3300013296 Bacteria 2337
343 Ga0157378_10000387 3300013297 Bacteria 43542
344 Ga0157378_10003335 3300013297 Bacteria 14284
345 Ga0157378_10022727 3300013297 Bacteria 5520
346 Ga0157378_10127694 3300013297 Bacteria 2351
347 Ga0163162_10013606 3300013306 Bacteria 7949
348 Ga0163162_10027382 3300013306 Bacteria 5637
349 Ga0163162_10030184 3300013306 Bacteria 5371
350 Ga0163162_10090707 3300013306 Bacteria 3138
351 Ga0163162_10238685 3300013306 Bacteria 1948
352 Ga0163162_10397754 3300013306 Bacteria 1510
353 Ga0163162_10448923 3300013306 Unclassified 1421
354 Ga0157372_10110740 3300013307 Bacteria 3145
355 Ga0157372_10179250 3300013307 Bacteria 2452
356 Ga0157372_10236654 3300013307 Bacteria 2118
357 Ga0157375_10004516 3300013308 Bacteria 12092
358 Ga0157375_10049998 3300013308 Bacteria 4099
359 Ga0157375_10081858 3300013308 Bacteria 3269
360 Ga0163163_10025278 3300014325 Bacteria 5662
361 Ga0163163_10073419 3300014325 Bacteria 3412
362 Ga0163163_10111370 3300014325 Bacteria 2766
363 Ga0163163_10148262 3300014325 Bacteria 2390
364 Ga0157380_10003569 3300014326 Bacteria 10699
365 Ga0157380_10006409 3300014326 Bacteria 8284
366 Ga0157380_10067440 3300014326 Bacteria 2881
367 Ga0157377_10000507 3300014745 Bacteria 16565
368 Ga0157377_10136276 3300014745 Unclassified 1504
369 Ga0157379_10000065 3300014968 Bacteria 67475
370 Ga0157379_10023744 3300014968 Bacteria 5444
371 Ga0157379_10106227 3300014968 Bacteria 2520
372 Ga0157379_10114902 3300014968 Bacteria 2419
373 Ga0157379_10141086 3300014968 Bacteria 2172
374 Ga0157379_10157585 3300014968 Bacteria 2048
375 Ga0157376_10004198 3300014969 Bacteria 9993
376 Ga0157376_10190298 3300014969 Bacteria 1881
377 Ga0163161_10016674 3300017792 Bacteria 5132
378 Ga0213872_10033133 3300021361 Bacteria 2367
379 Ga0213876_10039419 3300021384 Bacteria 2496
380 Ga0213876_10070602 3300021384 Bacteria 1845
381 Ga0213875_10000236 3300021388 Bacteria 55426
382 Ga0224572_1002511 3300024225 Bacteria 2978
383 Ga0207666_1000278 3300025271 Bacteria 7296
384 Ga0207673_1000135 3300025290 Bacteria 7012
385 Ga0207697_10000287 3300025315 Bacteria 28055
386 Ga0207697_10012481 3300025315 Bacteria 3561
387 Ga0207653_10005645 3300025885 Bacteria 3907
388 Ga0207682_10000437 3300025893 Bacteria 19265
389 Ga0207682_10006813 3300025893 Bacteria 4583
390 Ga0207692_10008757 3300025898 Bacteria 4201
391 Ga0207692_10022895 3300025898 Bacteria 2882
392 Ga0207692_10051741 3300025898 Bacteria 2084
393 Ga0207692_10055998 3300025898 Bacteria 2021
394 Ga0207692_10089007 3300025898 Bacteria 1670
395 Ga0207642_10000268 3300025899 Bacteria 15628
396 Ga0207642_10026058 3300025899 Bacteria 2375
397 Ga0207642_10071895 3300025899 Bacteria 1649
398 Ga0207710_10050960 3300025900 Bacteria 1858
399 Ga0207710_10085245 3300025900 Unclassified 1471
400 Ga0207688_10000014 3300025901 Bacteria 59269
401 Ga0207688_10062810 3300025901 Bacteria 2094
402 Ga0207680_10059057 3300025903 Bacteria 2328
403 Ga0207647_10079629 3300025904 Bacteria 1966
404 Ga0207699_10016704 3300025906 Bacteria 3845
405 Ga0207699_10040563 3300025906 Bacteria 2683
406 Ga0207699_10111005 3300025906 Unclassified 1757
407 Ga0207699_10114665 3300025906 Unclassified 1733
408 Ga0207645_10000160 3300025907 Bacteria 53155
409 Ga0207645_10018769 3300025907 Bacteria 4543
410 Ga0207645_10031128 3300025907 Bacteria 3434
411 Ga0207645_10074384 3300025907 Bacteria 2175
412 Ga0207645_10083440 3300025907 Bacteria 2050
413 Ga0207643_10000009 3300025908 Bacteria 160496
414 Ga0207643_10203387 3300025908 Bacteria 1207
415 Ga0207684_10183814 3300025910 Bacteria 1803
416 Ga0207654_10119375 3300025911 Bacteria 1653
417 Ga0207654_10203483 3300025911 Bacteria 1305
418 Ga0207707_10000554 3300025912 Bacteria 37851
419 Ga0207707_10005043 3300025912 Bacteria 11589
420 Ga0207707_10017033 3300025912 Bacteria 6330
421 Ga0207695_10055352 3300025913 Bacteria 4134
422 Ga0207695_10182322 3300025913 Bacteria 2020
423 Ga0207671_10076822 3300025914 Bacteria 2499
424 Ga0207693_10011540 3300025915 Bacteria 7145
425 Ga0207693_10015209 3300025915 Bacteria 6176
426 Ga0207693_10026066 3300025915 Bacteria 4629
427 Ga0207693_10042033 3300025915 Bacteria 3598
428 Ga0207693_10042666 3300025915 Bacteria 3571
429 Ga0207693_10072874 3300025915 Bacteria 2689
430 Ga0207693_10087489 3300025915 Bacteria 2441
431 Ga0207693_10146736 3300025915 Bacteria 1855
432 Ga0207693_10158135 3300025915 Bacteria 1783
433 Ga0207693_10239140 3300025915 Bacteria 1425
434 Ga0207693_10305071 3300025915 Bacteria 1247
435 Ga0207663_10059430 3300025916 Bacteria 2418
436 Ga0207663_10122498 3300025916 Bacteria 1783
437 Ga0207663_10127841 3300025916 Bacteria 1751
438 Ga0207663_10264372 3300025916 Bacteria 1272
439 Ga0207663_10318662 3300025916 Bacteria 1168
440 Ga0207660_10000347 3300025917 Bacteria 30042
441 Ga0207660_10002432 3300025917 Bacteria 12227
442 Ga0207660_10094631 3300025917 Bacteria 2221
443 Ga0207660_10123744 3300025917 Bacteria 1962
444 Ga0207660_10138205 3300025917 Bacteria 1861
445 Ga0207662_10000095 3300025918 Bacteria 41923
446 Ga0207662_10000130 3300025918 Bacteria 36097
447 Ga0207662_10084999 3300025918 Bacteria 1937
448 Ga0207662_10108833 3300025918 Bacteria 1726
449 Ga0207657_10000980 3300025919 Bacteria 30300
450 Ga0207657_10006209 3300025919 Bacteria 12420
451 Ga0207657_10015897 3300025919 Bacteria 7270
452 Ga0207649_10006224 3300025920 Bacteria 6481
453 Ga0207649_10232726 3300025920 Bacteria 1318
454 Ga0207652_10000364 3300025921 Bacteria 47007
455 Ga0207652_10027928 3300025921 Bacteria 4706
456 Ga0207652_10197563 3300025921 Bacteria 1810
457 Ga0207681_10000035 3300025923 Bacteria 161792
458 Ga0207650_10163657 3300025925 Bacteria 1764
459 Ga0207659_10000027 3300025926 Bacteria 135454
460 Ga0207687_10000432 3300025927 Bacteria 28412
461 Ga0207687_10000556 3300025927 Bacteria 25111
462 Ga0207687_10025653 3300025927 Bacteria 3944
463 Ga0207700_10002968 3300025928 Bacteria 9783
464 Ga0207700_10028689 3300025928 Bacteria 3918
465 Ga0207700_10051819 3300025928 Bacteria 3065
466 Ga0207700_10245476 3300025928 Unclassified 1528
467 Ga0207664_10052248 3300025929 Bacteria 3232
468 Ga0207644_10058816 3300025931 Bacteria 2779
469 Ga0207644_10243623 3300025931 Unclassified 1432
470 Ga0207690_10000056 3300025932 Bacteria 101387
471 Ga0207706_10000307 3300025933 Bacteria 52944
472 Ga0207706_10026539 3300025933 Bacteria 5185
473 Ga0207706_10042358 3300025933 Bacteria 4035
474 Ga0207706_10042772 3300025933 Bacteria 4015
475 Ga0207706_10395560 3300025933 Bacteria 1198
476 Ga0207686_10002300 3300025934 Bacteria 10462
477 Ga0207686_10007325 3300025934 Bacteria 5938
478 Ga0207686_10032928 3300025934 Bacteria 3089
479 Ga0207709_10000087 3300025935 Bacteria 155019
480 Ga0207709_10000939 3300025935 Bacteria 21844
481 Ga0207709_10061229 3300025935 Bacteria 2351
482 Ga0207670_10000640 3300025936 Bacteria 18610
483 Ga0207670_10058064 3300025936 Bacteria 2627
484 Ga0207670_10090367 3300025936 Bacteria 2163
485 Ga0207670_10091278 3300025936 Bacteria 2154
486 Ga0207670_10122212 3300025936 Bacteria 1895
487 Ga0207669_10000052 3300025937 Bacteria 58284
488 Ga0207669_10045066 3300025937 Bacteria 2597
489 Ga0207669_10154765 3300025937 Unclassified 1611
490 Ga0207704_10000063 3300025938 Bacteria 74699
491 Ga0207704_10000281 3300025938 Bacteria 24286
492 Ga0207704_10012711 3300025938 Bacteria 4184
493 Ga0207704_10139850 3300025938 Bacteria 1692
494 Ga0207704_10192525 3300025938 Bacteria 1485
495 Ga0207665_10032460 3300025939 Bacteria 3458
496 Ga0207665_10065004 3300025939 Bacteria 2480
497 Ga0207665_10078353 3300025939 Bacteria 2270
498 Ga0207665_10080556 3300025939 Bacteria 2240
499 Ga0207691_10000167 3300025940 Bacteria 60999
500 Ga0207691_10005072 3300025940 Bacteria 12711
501 Ga0207711_10001619 3300025941 Bacteria 20775
502 Ga0207711_10070212 3300025941 Bacteria 3037
503 Ga0207711_10074947 3300025941 Bacteria 2944
504 Ga0207711_10209112 3300025941 Bacteria 1782
505 Ga0207711_10231960 3300025941 Bacteria 1691
506 Ga0207689_10000155 3300025942 Bacteria 59178
507 Ga0207689_10003028 3300025942 Bacteria 15486
508 Ga0207661_10000072 3300025944 Bacteria 69126
509 Ga0207679_10000057 3300025945 Bacteria 104912
510 Ga0207712_10000122 3300025961 Bacteria 83730
511 Ga0207712_10027485 3300025961 Bacteria 3800
512 Ga0207712_10071730 3300025961 Bacteria 2492
513 Ga0207668_10000084 3300025972 Bacteria 70850
514 Ga0207668_10038479 3300025972 Bacteria 3211
515 Ga0207668_10042376 3300025972 Bacteria 3082
516 Ga0207640_10001119 3300025981 Bacteria 14773
517 Ga0207640_10018411 3300025981 Bacteria 4105
518 Ga0207658_10003175 3300025986 Bacteria 11727
519 Ga0207658_10226445 3300025986 Bacteria 1576
520 Ga0207677_10000549 3300026023 Bacteria 23737
521 Ga0207677_10002928 3300026023 Bacteria 9017
522 Ga0207703_10006621 3300026035 Bacteria 9243
523 Ga0207703_10089838 3300026035 Bacteria 2580
524 Ga0207703_10161007 3300026035 Bacteria 1966
525 Ga0207703_10293696 3300026035 Bacteria 1480
526 Ga0207639_10002231 3300026041 Bacteria 13024
527 Ga0207639_10190382 3300026041 Bacteria 1752
528 Ga0207639_10767504 3300026041 Bacteria 897
529 Ga0207678_10000187 3300026067 Bacteria 53154
530 Ga0207678_10009676 3300026067 Bacteria 8478
531 Ga0207678_10060604 3300026067 Bacteria 3255
532 Ga0207708_10000158 3300026075 Bacteria 53154
533 Ga0207708_10011537 3300026075 Bacteria 6583
534 Ga0207708_10015344 3300026075 Bacteria 5746
535 Ga0207708_10018227 3300026075 Bacteria 5285
536 Ga0207708_10118119 3300026075 Bacteria 2065
537 Ga0207702_10009588 3300026078 Bacteria 8129
538 Ga0207702_10030968 3300026078 Bacteria 4458
539 Ga0207702_10060859 3300026078 Bacteria 3219
540 Ga0207641_10004012 3300026088 Bacteria 12844
541 Ga0207641_10169494 3300026088 Bacteria 1991
542 Ga0207641_10347340 3300026088 Bacteria 1413
543 Ga0207648_10000513 3300026089 Bacteria 43298
544 Ga0207648_10001167 3300026089 Bacteria 29390
545 Ga0207648_10018167 3300026089 Bacteria 6370
546 Ga0207676_10000089 3300026095 Bacteria 82462
547 Ga0207676_10105477 3300026095 Bacteria 2346
548 Ga0207676_10121061 3300026095 Bacteria 2207
549 Ga0207674_10001478 3300026116 Bacteria 30348
550 Ga0207674_10023656 3300026116 Bacteria 6577
551 Ga0207675_100000229 3300026118 Bacteria 52966
552 Ga0207675_100003827 3300026118 Bacteria 14645
553 Ga0207675_100011672 3300026118 Bacteria 8215
554 Ga0207683_10015823 3300026121 Bacteria 6422
555 Ga0207683_10094497 3300026121 Bacteria 2665
556 Ga0207683_10164365 3300026121 Bacteria 2008
557 Ga0207698_10008027 3300026142 Bacteria 6655
558 Ga0210002_1009797 3300027617 Bacteria 1464
559 Ga0209983_1008764 3300027665 Bacteria 2064
560 Ga0209966_1008159 3300027695 Bacteria 1853
561 Ga0209998_10001281 3300027717 Bacteria 6152
562 Ga0209974_10011045 3300027876 Bacteria 3039
563 Ga0207428_10000037 3300027907 Bacteria 218857
564 Ga0207428_10000172 3300027907 Bacteria 90200
565 Ga0207428_10002963 3300027907 Bacteria 16796
566 Ga0207428_10005877 3300027907 Bacteria 11370
567 Ga0207428_10170483 3300027907 Bacteria 1649
568 Ga0268266_10024070 3300028379 Bacteria 5182
569 Ga0268265_10000195 3300028380 Bacteria 70871
570 Ga0268265_10049058 3300028380 Bacteria 3173
571 Ga0268265_10057224 3300028380 Bacteria 2970
572 Ga0268265_10080795 3300028380 Bacteria 2565
573 Ga0268264_10000827 3300028381 Bacteria 33217
574 Ga0268264_10233848 3300028381 Bacteria 1698
575 Ga0265763_1000560 3300030763 Unclassified 2321
576 Ga0265760_10027023 3300031090 Bacteria 1681
577 Ga0265325_10000025 3300031241 Bacteria 111160
578 Ga0265329_10006698 3300031242 Bacteria 4546
579 Ga0265340_10006313 3300031247 Bacteria 6536
580 Ga0265340_10044966 3300031247 Bacteria 2159
581 Ga0265339_10030352 3300031249 Bacteria 3061
582 Ga0265331_10015729 3300031250 Bacteria 3988
583 Ga0265316_10081309 3300031344 Bacteria 2484
584 Ga0265314_10041579 3300031711 Bacteria 3288
585 Ga0307411_10127812 3300032005 Bacteria 1852
586 Ga0373930_0003621 3300034816 Bacteria 2464
587 Ga0373930_0017229 3300034816 Bacteria 1375
588 Ga0373948_0000063 3300034817 Bacteria 11215
589 Ga0373948_0001356 3300034817 Bacteria 3365
590 Ga0373948_0004636 3300034817 Bacteria 2187
591 Ga0373950_0001407 3300034818 Bacteria 3133
592 Ga0373958_0000880 3300034819 Bacteria 3866
593 Ga0373959_0000720 3300034820 Bacteria 5658
594 Ga0373959_0001299 3300034820 Bacteria 4007
595 Ga0373938_0000709 3300034957 Bacteria 5388
596 Ga0373938_0002401 3300034957 Bacteria 3018
597 Ga0373926_0000002 3300035083 Bacteria 53301
598 Ga0373926_0006472 3300035083 Bacteria 3889
599 Ga0373926_0010654 3300035083 Bacteria 3082
600 Ga0373926_0036051 3300035083 Bacteria 1756
601 Ga0373928_0001013 3300035084 Bacteria 5524
602 Ga0373934_0027576 3300035086 Bacteria 2208
603 Ga0373934_0067049 3300035086 Bacteria 1433
604 Ga0373940_0000150 3300035088 Bacteria 9058
605 Ga0373940_0002381 3300035088 Bacteria 3646
606 Ga0373940_0005451 3300035088 Bacteria 2757
607 Ga0373944_0000048 3300035089 Bacteria 19324
608 Ga0373949_0001637 3300035090 Bacteria 6254
609 Ga0373949_0012358 3300035090 Bacteria 1888
610 Ga0373951_0000729 3300035091 Bacteria 9030
611 Ga0373951_0002183 3300035091 Bacteria 4980
612 Ga0373951_0011908 3300035091 Bacteria 1956
613 Ga0373952_0000170 3300035092 Bacteria 10000
614 Ga0373952_0013195 3300035092 Bacteria 1635
615 Ga0373923_0000329 3300035111 Bacteria 10639
616 Ga0373923_0002488 3300035111 Bacteria 5688
617 Ga0373932_0000475 3300035112 Bacteria 12299
618 Ga0373932_0004768 3300035112 Bacteria 3197
619 Ga0373936_0000294 3300035113 Bacteria 16691
620 Ga0373936_0007009 3300035113 Bacteria 4241
621 Ga0373936_0029273 3300035113 Bacteria 2167
622 Ga0373939_0000360 3300035114 Bacteria 11493
623 Ga0373939_0002626 3300035114 Bacteria 4221
624 Ga0373939_0003930 3300035114 Bacteria 3496
625 Ga0373939_0013757 3300035114 Bacteria 2088
626 Ga0373939_0018600 3300035114 Bacteria 1864
627 Ga0373941_0001632 3300035115 Bacteria 4780
628 Ga0373941_0001926 3300035115 Bacteria 4497
629 Ga0373945_0000229 3300035116 Bacteria 15364
630 Ga0373945_0004261 3300035116 Bacteria 4537
631 Ga0373945_0005926 3300035116 Bacteria 3924
632 Ga0373945_0014923 3300035116 Unclassified 2608
633 Ga0373945_0017503 3300035116 Bacteria 2427
634 Ga0373953_0000738 3300035117 Bacteria 9052
635 Ga0373954_0004843 3300035118 Bacteria 5806
636 Ga0373954_0007246 3300035118 Bacteria 4846
637 Ga0373954_0008120 3300035118 Bacteria 4599
638 Ga0373954_0067687 3300035118 Bacteria 1693
639 Ga0373956_0002040 3300035119 Bacteria 8362
640 Ga0373956_0002776 3300035119 Bacteria 7085
641 Ga0373956_0006169 3300035119 Bacteria 4796
642 Ga0373960_0001914 3300035121 Bacteria 4656
643 Ga0373960_0053993 3300035121 Bacteria 1200
644 Ga0373943_0010040 3300035170 Bacteria 4246
645 Ga0373943_0010245 3300035170 Bacteria 4204
646 Ga0373943_0012370 3300035170 Bacteria 3840
647 Ga0373943_0035046 3300035170 Bacteria 2396
648 Ga0373946_0000495 3300035171 Bacteria 13074
649 Ga0373946_0010279 3300035171 Bacteria 3461
650 Ga0373946_0019270 3300035171 Bacteria 2628
651 Ga0373946_0021423 3300035171 Bacteria 2506
652 Ga0373946_0043991 3300035171 Bacteria 1842
653 Ga0373946_0045297 3300035171 Bacteria 1819
654 Ga0373955_0000152 3300035172 Bacteria 27633
655 Ga0373955_0001108 3300035172 Bacteria 11455
656 Ga0373955_0010682 3300035172 Bacteria 4346
657 Ga0373955_0155450 3300035172 Bacteria 1347
658 Ga0373955_0223941 3300035172 Unclassified 1124
659 Ga0373942_0001717 3300035207 Bacteria 5566
660 Ga0373961_0002411 3300035241 Bacteria 4859
661 Ga0373961_0018064 3300035241 Bacteria 1838
662 Ga0373962_0000682 3300035242 Bacteria 7670
663 Ga0373924_0029564 3300035410 Bacteria 2191
664 Ga0373931_0000082 3300035691 Bacteria 44600
665 Ga0373931_0021215 3300035691 Bacteria 3258
666 Ga0373931_0037892 3300035691 Bacteria 2519
667 Ga0373931_0043352 3300035691 Bacteria 2369
668 Ga0373931_0056956 3300035691 Bacteria 2095
669 Ga0373931_0079083 3300035691 Bacteria 1810
670 Ga0373935_0000006 3300035692 Bacteria 121726
671 Ga0373935_0017917 3300035692 Bacteria 4302
672 Ga0373935_0023549 3300035692 Bacteria 3784
673 Ga0373935_0025526 3300035692 Bacteria 3641
674 Ga0373935_0051992 3300035692 Bacteria 2603
675 Ga0373935_0140792 3300035692 Unclassified 1629
676 Ga0373927_0005584 3300035695 Bacteria 8648
677 Ga0373927_0011621 3300035695 Bacteria 5861
678 Ga0373927_0012717 3300035695 Bacteria 5597
679 Ga0373927_0012866 3300035695 Bacteria 5563
680 Ga0373927_0104213 3300035695 Bacteria 1846
681 Ga0373933_0004823 3300035724 Bacteria 7368
682 Ga0373933_0011958 3300035724 Bacteria 4791
683 Ga0373933_0016241 3300035724 Bacteria 4160
684 Ga0373933_0018766 3300035724 Bacteria 3893
685 Ga0373933_0052103 3300035724 Unclassified 2448
686 Ga0373933_0083697 3300035724 Bacteria 1959
687 Ga0373933_0090664 3300035724 Bacteria 1886
688 Ga0373947_0001906 3300035725 Bacteria 12751
689 Ga0373947_0003131 3300035725 Bacteria 9843
690 Ga0373947_0003242 3300035725 Bacteria 9655
691 Ga0373947_0026258 3300035725 Bacteria 3402
692 Ga0373947_0085831 3300035725 Bacteria 1955
693 Ga0373947_0223803 3300035725 Bacteria 1237
694 Ga0373937_0000165 3300036401 Bacteria 63984
695 Ga0373937_0001536 3300036401 Bacteria 19417
696 Ga0373937_0002909 3300036401 Bacteria 14306
697 Ga0373937_0008865 3300036401 Bacteria 8731
698 Ga0373937_0018097 3300036401 Bacteria 6286
699 Ga0373937_0132885 3300036401 Unclassified 2325
700 Ga0373925_0000475 3300037068 Bacteria 40083
701 Ga0373925_0001065 3300037068 Bacteria 24770
702 Ga0373925_0023955 3300037068 Bacteria 4453
703 Ga0373925_0063161 3300037068 Bacteria 2786
704 Ga0373925_0091160 3300037068 Bacteria 2330
705 Ga0373925_0114217 3300037068 Bacteria 2089
706 Ga0373925_0120338 3300037068 Bacteria 2038
707 Ga0395905_0037206 3300037471 Bacteria 4571
708 Ga0436364_0978611 3300037853 Bacteria 44026
709 Ga0242420_005377 3300038996 Bacteria 1983
710 Ga0242420_007484 3300038996 Bacteria 1752
711 Ga0436365_0797236 3300039437 Bacteria 2004
712 Ga0436365_0884217 3300039437 Bacteria 16535
713 Ga0436361_0550596 3300039447 Bacteria 14713
714 Ga0436363_0059666 3300039450 Bacteria 1309
715 Ga0436363_1080804 3300039450 Unclassified 1626
716 Ga0439441_017869 3300042001 Bacteria 1278
717 Ga0439450_005184 3300042008 Bacteria 2277
718 Ga0439455_0019453 3300042012 Bacteria 1601
719 Ga0439446_0033067 3300042156 Bacteria 1502
720 Ga0451577_0046357 3300042876 Bacteria 3890
721 Ga0451577_0140505 3300042876 Bacteria 2170
722 Ga0451577_0530126 3300042876 Bacteria 1069
723 Ga0466964_0102992 3300044706 Bacteria 1261
724 Ga0453684_0395578 3300044712 Bacteria 1549
725 Ga0451576_0001678 3300045051 Bacteria 36726
726 Ga0451576_0024813 3300045051 Bacteria 6470
727 Ga0451576_0065086 3300045051 Bacteria 3795
728 Ga0466967_0271149 3300045976 Bacteria 1626
729 Ga0495617_007534 3300046452 Bacteria 3775
730 Ga0495627_006545 3300046453 Bacteria 4557
731 Ga0495592_0000020 3300046454 Bacteria 140576
732 Ga0495592_0000766 3300046454 Bacteria 22364
733 Ga0495592_0138203 3300046454 Bacteria 1697
734 Ga0495592_0140235 3300046454 Bacteria 1682
735 Ga0495603_0002904 3300046455 Bacteria 10140
736 Ga0495603_0027183 3300046455 Bacteria 3454
737 Ga0495603_0079883 3300046455 Bacteria 1917
738 Ga0495603_0122000 3300046455 Bacteria 1518
739 Ga0495590_0071601 3300046457 Bacteria 1217
740 Ga0495591_032375 3300046458 Bacteria 1557
741 Ga0495629_0001979 3300046459 Bacteria 15969
742 Ga0495629_0020249 3300046459 Bacteria 4751
743 Ga0495629_0036597 3300046459 Bacteria 3463
744 Ga0495629_0067753 3300046459 Bacteria 2490
745 Ga0495629_0127755 3300046459 Unclassified 1771
746 Ga0495638_0031470 3300046460 Bacteria 3410
747 Ga0495641_0000380 3300046461 Bacteria 37045
748 Ga0495651_0000929 3300046462 Bacteria 22677
749 Ga0495651_0001076 3300046462 Bacteria 21046
750 Ga0495651_0001721 3300046462 Bacteria 16887
751 Ga0495651_0032645 3300046462 Bacteria 4060
752 Ga0495651_0128237 3300046462 Bacteria 1855
753 Ga0495653_0000046 3300046463 Bacteria 113893
754 Ga0495653_0000209 3300046463 Bacteria 47358
755 Ga0495653_0026185 3300046463 Bacteria 4679
756 Ga0495653_0035144 3300046463 Bacteria 3957
757 Ga0495653_0192607 3300046463 Bacteria 1390
758 Ga0495580_0000775 3300046472 Bacteria 27515
759 Ga0495580_0004313 3300046472 Bacteria 11960
760 Ga0495580_0086475 3300046472 Unclassified 2183
761 Ga0495582_0001370 3300046473 Bacteria 13696
762 Ga0495582_0005359 3300046473 Bacteria 7159
763 Ga0495582_0045180 3300046473 Bacteria 2426
764 Ga0495582_0107328 3300046473 Bacteria 1567
765 Ga0495605_0006898 3300046474 Bacteria 6486
766 Ga0495605_0031727 3300046474 Bacteria 2697
767 Ga0495639_0001523 3300046475 Bacteria 10340
768 Ga0495662_0000197 3300046476 Bacteria 24864
769 Ga0495662_0003633 3300046476 Bacteria 7777
770 Ga0495662_0023378 3300046476 Bacteria 2984
771 Ga0495664_0000017 3300046477 Bacteria 172210
772 Ga0495664_0000241 3300046477 Bacteria 26356
773 Ga0495664_0045914 3300046477 Bacteria 2591
774 Ga0495584_0011284 3300046491 Bacteria 4576
775 Ga0495584_0027388 3300046491 Bacteria 2888
776 Ga0495585_0001361 3300046492 Bacteria 19352
777 Ga0495585_0057016 3300046492 Bacteria 2156
778 Ga0495594_0008682 3300046499 Bacteria 5238
779 Ga0495594_0009983 3300046499 Bacteria 4916
780 Ga0495594_0015737 3300046499 Bacteria 3977
781 Ga0495594_0111878 3300046499 Bacteria 1540
782 Ga0495596_0017488 3300046500 Bacteria 2966
783 Ga0495607_0003799 3300046501 Bacteria 11407
784 Ga0495607_0008603 3300046501 Bacteria 6966
785 Ga0495608_0000058 3300046511 Bacteria 90246
786 Ga0495608_0001204 3300046511 Bacteria 18330
787 Ga0495608_0007880 3300046511 Bacteria 7484
788 Ga0495616_0022179 3300046513 Bacteria 3430
789 Ga0495618_0000049 3300046514 Bacteria 91727
790 Ga0495618_0004273 3300046514 Bacteria 8804
791 Ga0495618_0015329 3300046514 Bacteria 4677
792 Ga0495618_0107713 3300046514 Bacteria 1784
793 Ga0495620_0017950 3300046515 Bacteria 3515
794 Ga0495628_0000022 3300046516 Bacteria 140362
795 Ga0495628_0001791 3300046516 Bacteria 19536
796 Ga0495628_0008193 3300046516 Bacteria 8987
797 Ga0495628_0048331 3300046516 Bacteria 3372
798 Ga0495630_0002725 3300046517 Bacteria 12254
799 Ga0495630_0003296 3300046517 Bacteria 11261
800 Ga0495630_0016592 3300046517 Bacteria 5386
801 Ga0495630_0042979 3300046517 Bacteria 3374
802 Ga0495631_0008201 3300046518 Bacteria 5270
803 Ga0495637_0005980 3300046520 Bacteria 6153
804 Ga0495644_0001212 3300046523 Bacteria 10553
805 Ga0495644_0038733 3300046523 Bacteria 1798
806 Ga0495663_0002590 3300046525 Bacteria 5392
807 Ga0495666_0000462 3300046526 Bacteria 18068
808 Ga0495666_0014951 3300046526 Bacteria 3862
809 Ga0495666_0051208 3300046526 Bacteria 1984
810 Ga0495642_0021919 3300046528 Bacteria 2514
811 Ga0495652_0000008 3300046529 Bacteria 343637
812 Ga0495652_0205483 3300046529 Bacteria 1491
813 Ga0495652_0387891 3300046529 Bacteria 992
814 Ga0495665_0013406 3300046531 Bacteria 4432
815 Ga0495665_0191183 3300046531 Bacteria 1062
816 Ga0495640_0000067 3300046533 Bacteria 58740
817 Ga0495640_0010763 3300046533 Bacteria 7056
818 Ga0495640_0039679 3300046533 Bacteria 3302
819 Ga0495640_0082886 3300046533 Bacteria 2129
820 Ga0495640_0108325 3300046533 Bacteria 1817
821 Ga0495586_0001093 3300046535 Bacteria 15326
822 Ga0495586_0004228 3300046535 Bacteria 7690
823 Ga0495586_0009710 3300046535 Bacteria 5125
824 Ga0495587_0000019 3300046536 Bacteria 161972
825 Ga0495587_0000604 3300046536 Bacteria 24546
826 Ga0495587_0002926 3300046536 Bacteria 11431
827 Ga0495598_0000197 3300046537 Bacteria 10558
828 Ga0495609_0008767 3300046538 Bacteria 4925
829 Ga0495609_0035685 3300046538 Bacteria 2249
830 Ga0495621_0001164 3300046539 Bacteria 6801
831 Ga0495621_0024210 3300046539 Bacteria 2026
832 Ga0495645_0000006 3300046543 Bacteria 382503
833 Ga0495622_0001441 3300046557 Bacteria 11966
834 Ga0495633_0007689 3300046558 Bacteria 6168
835 Ga0495633_0015044 3300046558 Bacteria 4022
836 Ga0495667_0000090 3300046559 Bacteria 65991
837 Ga0495667_0002395 3300046559 Bacteria 12537
838 Ga0495667_0003934 3300046559 Bacteria 9957
839 Ga0495667_0075745 3300046559 Unclassified 2189
840 Ga0495656_0000553 3300046615 Bacteria 12229
841 Ga0495656_0005258 3300046615 Bacteria 4461
842 Ga0495656_0025978 3300046615 Bacteria 2327
843 Ga0495656_0052855 3300046615 Bacteria 1743
844 Ga0495668_0006195 3300046616 Bacteria 7900
845 Ga0495634_0000167 3300046642 Bacteria 60315
846 Ga0495634_0079109 3300046642 Bacteria 2153
847 Ga0495634_0233607 3300046642 Bacteria 1130
848 Ga0495634_0281474 3300046642 Unclassified 1010
849 Ga0495635_0000023 3300046663 Bacteria 153429
850 Ga0495635_0010999 3300046663 Bacteria 6341
851 Ga0495635_0022296 3300046663 Bacteria 4408
852 Ga0495635_0048232 3300046663 Unclassified 2936
853 Ga0495635_0070427 3300046663 Bacteria 2397
854 Ga0495635_0102593 3300046663 Bacteria 1955
855 Ga0495659_0002101 3300046664 Bacteria 6508
856 Ga0495659_0070660 3300046664 Bacteria 1307
857 Ga0495661_0026362 3300046665 Bacteria 3744
858 Ga0495661_0065836 3300046665 Bacteria 2134
859 Ga0495588_0000313 3300046674 Bacteria 32879
860 Ga0495588_0017173 3300046674 Bacteria 3509
861 Ga0495588_0022160 3300046674 Bacteria 3138
862 Ga0495657_0000099 3300046675 Bacteria 76617
863 Ga0495657_0005797 3300046675 Bacteria 9729
864 Ga0495657_0062003 3300046675 Bacteria 2472
865 Ga0495657_0114394 3300046675 Bacteria 1705
866 Ga0495599_0000039 3300046678 Bacteria 98345
867 Ga0495599_0000261 3300046678 Bacteria 33198
868 Ga0495599_0108531 3300046678 Bacteria 1729
869 Ga0495623_0000073 3300046679 Bacteria 61884
870 Ga0495623_0057065 3300046679 Bacteria 2457
871 Ga0495623_0067807 3300046679 Bacteria 2226
872 Ga0495646_0000017 3300046680 Bacteria 123549
873 Ga0495646_0000800 3300046680 Bacteria 17588
874 Ga0495647_0000515 3300046681 Bacteria 11277
875 Ga0495647_0001490 3300046681 Bacteria 7265
876 Ga0495647_0022808 3300046681 Bacteria 2264
877 Ga0495647_0055969 3300046681 Bacteria 1545
878 Ga0495658_0001933 3300046683 Bacteria 10591
879 Ga0495658_0018886 3300046683 Bacteria 3591
880 Ga0495669_0013427 3300046684 Bacteria 3489
881 Ga0495613_0002928 3300046689 Bacteria 12792
882 Ga0495613_0006502 3300046689 Bacteria 8735
883 Ga0495613_0144939 3300046689 Bacteria 1695
884 Ga0495613_0259946 3300046689 Bacteria 1210
885 Ga0495624_0006114 3300046690 Bacteria 8574
886 Ga0495624_0012625 3300046690 Bacteria 5766
887 Ga0495624_0030411 3300046690 Bacteria 3518
888 Ga0495670_0008663 3300046691 Bacteria 5005
889 Ga0495670_0076305 3300046691 Bacteria 1703
890 Ga0495671_0037153 3300046692 Bacteria 2464
891 Ga0495649_0017651 3300046694 Bacteria 4024
892 Ga0495589_0014670 3300046794 Bacteria 4031
893 Ga0495600_0000043 3300046809 Bacteria 73475
894 Ga0495600_0000309 3300046809 Bacteria 25835
895 Ga0495600_0001591 3300046809 Bacteria 12615
896 Ga0495660_0013561 3300046810 Bacteria 4723
897 Ga0495581_0001406 3300047315 Bacteria 13332
898 Ga0495581_0058695 3300047315 Bacteria 2222
899 Ga0495581_0146861 3300047315 Bacteria 1376
900 Ga0495604_0000030 3300047317 Bacteria 138597
901 Ga0495604_0003597 3300047317 Bacteria 12354
902 Ga0495604_0042374 3300047317 Bacteria 3568
903 Ga0495674_0000009 3300047319 Bacteria 310479
904 Ga0495674_0020806 3300047319 Bacteria 6074
905 Ga0495674_0138942 3300047319 Unclassified 2043
906 Ga0495676_0021514 3300047321 Bacteria 5628
907 Ga0495676_0026606 3300047321 Bacteria 4977
908 Ga0495676_0141704 3300047321 Bacteria 1722
909 Ga0495680_0000307 3300047322 Bacteria 54880
910 Ga0495680_0001830 3300047322 Bacteria 22458
911 Ga0495680_0002274 3300047322 Bacteria 19772
912 Ga0495680_0020443 3300047322 Bacteria 5570
913 Ga0495680_0021015 3300047322 Bacteria 5471
914 Ga0495680_0058878 3300047322 Bacteria 2967
915 Ga0495680_0354570 3300047322 Bacteria 1021
916 Ga0495683_0050041 3300047323 Bacteria 2092
917 Ga0495675_0000195 3300047444 Bacteria 44124
918 Ga0495675_0024374 3300047444 Bacteria 3857
919 Ga0495679_017725 3300047446 Bacteria 2544
920 Ga0495681_0021347 3300047470 Bacteria 3493
921 Ga0495684_0000031 3300047471 Bacteria 116753
922 Ga0495684_0000338 3300047471 Bacteria 37697
923 Ga0495684_0037570 3300047471 Bacteria 3714
924 Ga0495593_0000170 3300047673 Bacteria 33637
925 Ga0495593_0009243 3300047673 Bacteria 5716
926 Ga0495593_0184959 3300047673 Bacteria 1049
927 Ga0495602_0000006 3300048088 Bacteria 322593
928 Ga0495602_0002915 3300048088 Bacteria 17539
929 Ga0495602_0112218 3300048088 Bacteria 2213
930 Ga0495614_0000184 3300048089 Bacteria 23429
931 Ga0495614_0082697 3300048089 Bacteria 1392
932 Ga0495615_0000548 3300048090 Bacteria 5342
933 Ga0495626_0013587 3300048091 Bacteria 4228
934 Ga0496100_0000189 3300048903 Bacteria 34151
935 Ga0496100_0000930 3300048903 Bacteria 13981
936 Ga0496100_0015415 3300048903 Bacteria 4463
937 Ga0496100_0033172 3300048903 Bacteria 3229
938 Ga0496101_0000215 3300048904 Bacteria 43521
939 Ga0496101_0021005 3300048904 Bacteria 4480
940 Ga0496101_0026571 3300048904 Bacteria 4025
941 Ga0496101_0059573 3300048904 Bacteria 2767
942 Ga0496102_0001555 3300048905 Bacteria 20249
943 Ga0496102_0016849 3300048905 Bacteria 6392
944 Ga0496102_0360634 3300048905 Bacteria 1368
945 Ga0496103_0000191 3300048906 Bacteria 61198
946 Ga0496103_0051584 3300048906 Bacteria 2546
947 Ga0496104_0000170 3300048907 Bacteria 57501
948 Ga0496104_0000591 3300048907 Bacteria 30958
949 Ga0496104_0001165 3300048907 Bacteria 22516
950 Ga0496104_0001232 3300048907 Bacteria 22026
951 Ga0496104_0028344 3300048907 Bacteria 5191
952 Ga0496104_0030219 3300048907 Bacteria 5033
953 Ga0496104_0049524 3300048907 Bacteria 3961
954 Ga0496104_0290416 3300048907 Bacteria 1548
955 Ga0496104_0502859 3300048907 Bacteria 1123
956 Ga0496105_0002931 3300048908 Bacteria 12525
957 Ga0496105_0006803 3300048908 Bacteria 8795
958 Ga0496105_0030995 3300048908 Bacteria 4383
959 Ga0496105_0032220 3300048908 Bacteria 4301
960 Ga0496106_0000190 3300048909 Bacteria 43243
961 Ga0496106_0000990 3300048909 Bacteria 20724
962 Ga0496106_0019239 3300048909 Bacteria 5065
963 Ga0496106_0026457 3300048909 Bacteria 4320
964 Ga0496106_0038716 3300048909 Bacteria 3570
965 Ga0496106_0144739 3300048909 Bacteria 1871
966 Ga0496106_0331159 3300048909 Unclassified 1222
967 Ga0496107_0000080 3300048910 Bacteria 46272
968 Ga0496107_0012647 3300048910 Bacteria 5893
969 Ga0496107_0023716 3300048910 Bacteria 4336
970 Ga0496107_0067884 3300048910 Bacteria 2587
971 Ga0496107_0108930 3300048910 Bacteria 2034
972 Ga0496107_0293323 3300048910 Bacteria 1210
973 Ga0496108_0006847 3300048911 Bacteria 9221
974 Ga0496108_0015235 3300048911 Bacteria 6274
975 Ga0496108_0023975 3300048911 Bacteria 5022
976 Ga0496108_0076002 3300048911 Bacteria 2838
977 Ga0496108_0077908 3300048911 Bacteria 2805
978 Ga0496108_0312450 3300048911 Bacteria 1369
979 Ga0496109_0000737 3300048912 Bacteria 27192
980 Ga0496109_0011107 3300048912 Bacteria 7722
981 Ga0496109_0025231 3300048912 Bacteria 5294
982 Ga0496109_0029005 3300048912 Bacteria 4953
983 Ga0496109_0059327 3300048912 Bacteria 3495
984 Ga0496109_0068035 3300048912 Bacteria 3264
985 Ga0496109_0232398 3300048912 Bacteria 1735
986 Ga0496109_0330773 3300048912 Bacteria 1438
987 Ga0496109_0442949 3300048912 Bacteria 1227
988 Ga0496110_0001072 3300048913 Bacteria 19294
989 Ga0496110_0001444 3300048913 Bacteria 17191
990 Ga0496110_0038526 3300048913 Bacteria 4160
991 Ga0496111_0002052 3300048914 Bacteria 12000
992 Ga0496111_0077613 3300048914 Bacteria 2422
993 Ga0496111_0101454 3300048914 Bacteria 2114
994 Ga0496112_0001198 3300048915 Bacteria 19453
995 Ga0496112_0039198 3300048915 Bacteria 4628
996 Ga0496112_0165771 3300048915 Bacteria 2175
997 Ga0496112_0165858 3300048915 Bacteria 2175
998 Ga0496112_0523514 3300048915 Bacteria 1120
999 Ga0496113_0000721 3300048916 Bacteria 16927
1000 Ga0496113_0011762 3300048916 Bacteria 5858
1001 Ga0496113_0027156 3300048916 Bacteria 4100
1002 Ga0496113_0079926 3300048916 Bacteria 2504
1003 Ga0496113_0088054 3300048916 Bacteria 2388
1004 Ga0496113_0117750 3300048916 Bacteria 2074
1005 Ga0496113_0178171 3300048916 Bacteria 1685
1006 Ga0496114_0005702 3300048917 Bacteria 9762
1007 Ga0496114_0006768 3300048917 Bacteria 9030
1008 Ga0496114_0087873 3300048917 Bacteria 2636
1009 Ga0496114_0149012 3300048917 Bacteria 2029
1010 Ga0496114_0173400 3300048917 Bacteria 1881
1011 Ga0496115_0007097 3300048918 Bacteria 8230
1012 Ga0496115_0019256 3300048918 Bacteria 5251
1013 Ga0496115_0046016 3300048918 Bacteria 3485
1014 Ga0496115_0046424 3300048918 Bacteria 3471
1015 Ga0496115_0066247 3300048918 Bacteria 2918
1016 Ga0496115_0069353 3300048918 Bacteria 2855
1017 Ga0496115_0109483 3300048918 Bacteria 2268
1018 Ga0501036_0004646 3300049572 Bacteria 11098
1019 Ga0501036_0091221 3300049572 Bacteria 2574
1020 Ga0501039_0020067 3300049575 Bacteria 5123
1021 Ga0501039_0173507 3300049575 Bacteria 1695
1022 Ga0501040_0003091 3300049576 Bacteria 10796
1023 Ga0501040_0174041 3300049576 Bacteria 1525
1024 Ga0501041_0200992 3300049577 Bacteria 1249
1025 Ga0501042_0007413 3300049578 Bacteria 7184
1026 Ga0501046_0110796 3300049580 Bacteria 2097
1027 Ga0501046_0252174 3300049580 Bacteria 1299
1028 Ga0501048_0019096 3300049582 Bacteria 5035
1029 Ga0501068_0026786 3300049584 Bacteria 3400
1030 Ga0501071_0009259 3300049587 Bacteria 6551
1031 Ga0501071_0072923 3300049587 Bacteria 2504
1032 Ga0501072_0134776 3300049588 Bacteria 1969
1033 Ga0501074_0242012 3300049590 Bacteria 1283
1034 Ga0501075_0006585 3300049591 Bacteria 8001
1035 Ga0501075_0008387 3300049591 Bacteria 7208
1036 Ga0501076_0000870 3300049592 Bacteria 19633
1037 Ga0501076_0044755 3300049592 Bacteria 3492
1038 Ga0501076_0061767 3300049592 Bacteria 2982
1039 Ga0501077_0053699 3300049593 Bacteria 2558
1040 Ga0501080_0012676 3300049742 Bacteria 7731
1041 Ga0501081_0022664 3300049743 Bacteria 4203
1042 Ga0501081_0046592 3300049743 Bacteria 2981
1043 Ga0501081_0125902 3300049743 Bacteria 1827
1044 Ga0501083_0266198 3300049744 Bacteria 1115
1045 Ga0501035_0095956 3300049822 Bacteria 2606
1046 Ga0501035_0121236 3300049822 Bacteria 2286
1047 Ga0501035_0152533 3300049822 Bacteria 2004
1048 Ga0501045_0003545 3300049824 Bacteria 10711
1049 Ga0501045_0165206 3300049824 Bacteria 1648
1050 nmdc:mga0yw44_151121_c1 3300050492 Unclassified 1515
1051 nmdc:mga06z11_62988_c1 3300050494 Bacteria 1939
1052 nmdc:mga05p37_102_c1 3300050507 Bacteria 69207
1053 nmdc:mga05p37_252765_c1 3300050507 Bacteria 2113
1054 nmdc:mga05p37_3280_c1 3300050507 Bacteria 18865
1055 nmdc:mga05p37_55210_c1 3300050507 Bacteria 4887
1056 nmdc:mga05p37_5784_c1 3300050507 Bacteria 14534
1057 nmdc:mga05p37_60007_c1 3300050507 Bacteria 4684
1058 nmdc:mga05p37_7196_c1 3300050507 Bacteria 13126
1059 nmdc:mga09592_259_c1 3300050508 Bacteria 38550
1060 nmdc:mga09592_296713_c1 3300050508 Bacteria 1401
1061 nmdc:mga09592_716_c1 3300050508 Bacteria 25471
1062 nmdc:mga09592_83876_c2 3300050508 Bacteria 2013
1063 nmdc:mga0qj67_119_c1 3300050509 Bacteria 51910
1064 nmdc:mga0qj67_4903_c1 3300050509 Bacteria 9732
1065 nmdc:mga06r32_163089_c1 3300050510 Bacteria 2211
1066 nmdc:mga06r32_2969_c1 3300050510 Bacteria 15197
1067 nmdc:mga08y16_1835_c1 3300050511 Bacteria 21542
1068 nmdc:mga08y16_2739_c1 3300050511 Bacteria 18063
1069 nmdc:mga08y16_2852_c1 3300050511 Bacteria 17775
1070 nmdc:mga08y16_4422_c1 3300050511 Bacteria 14685
1071 nmdc:mga0n895_11586_c1 3300050512 Bacteria 7878
1072 nmdc:mga0n895_164089_c1 3300050512 Bacteria 2253
1073 nmdc:mga0n895_214678_c1 3300050512 Bacteria 1954
1074 nmdc:mga0n895_4040_c1 3300050512 Bacteria 11934
1075 nmdc:mga0n895_459048_c1 3300050512 Bacteria 1286
1076 nmdc:mga0n895_5083_c1 3300050512 Bacteria 10925
1077 nmdc:mga0n895_5415_c1 3300050512 Bacteria 10663
1078 nmdc:mga0n895_57339_c1 3300050512 Bacteria 3839
1079 nmdc:mga0rr50_123918_c1 3300050513 Bacteria 2061
1080 nmdc:mga0rr50_228349_c1 3300050513 Bacteria 1539
1081 nmdc:mga0rr50_23018_c1 3300050513 Bacteria 4287
1082 nmdc:mga0rr50_494_c1 3300050513 Bacteria 21000
1083 nmdc:mga0rr50_505_c1 3300050513 Bacteria 20786
1084 nmdc:mga0rr50_64430_c1 3300050513 Bacteria 2772
1085 nmdc:mga08x19_10398_c1 3300050514 Bacteria 5586
1086 nmdc:mga08x19_143428_c1 3300050514 Bacteria 1614
1087 nmdc:mga08x19_194825_c1 3300050514 Bacteria 1387
1088 nmdc:mga08x19_209506_c1 3300050514 Bacteria 1338
1089 nmdc:mga08x19_304292_c1 3300050514 Bacteria 1107
1090 nmdc:mga0a205_126304_c1 3300050515 Bacteria 2458
1091 nmdc:mga0a205_133448_c1 3300050515 Bacteria 2383
1092 nmdc:mga0a205_19210_c1 3300050515 Bacteria 6440
1093 nmdc:mga0a205_24709_c1 3300050515 Bacteria 5716
1094 nmdc:mga0a205_427_c1 3300050515 Bacteria 32383
1095 Ga0495601_0000007 3300053077 Bacteria 365972
1096 Ga0495601_0000829 3300053077 Bacteria 16759
1097 Ga0495601_0034843 3300053077 Bacteria 3140
1098 Ga0495601_0072235 3300053077 Bacteria 2204
1099 Ga0495601_0160256 3300053077 Bacteria 1470
1100 Ga0495601_0215005 3300053077 Bacteria 1255
1101 Ga0495612_0000240 3300053078 Bacteria 22800
1102 Ga0495612_0000396 3300053078 Bacteria 17444
1103 Ga0495612_0009684 3300053078 Bacteria 3903
1104 Ga0495612_0019470 3300053078 Bacteria 2717
1105 Ga0495612_0041683 3300053078 Bacteria 1872
1106 Ga0500635_0048894 3300053080 Bacteria 1442
1107 Ga0495655_0000275 3300053083 Bacteria 9580
1108 Ga0495595_0000031 3300053084 Bacteria 89199
1109 Ga0495595_0000489 3300053084 Bacteria 15095
1110 Ga0495595_0001055 3300053084 Bacteria 10645
1111 Ga0495595_0007407 3300053084 Bacteria 4495
1112 Ga0495595_0017270 3300053084 Bacteria 3104
1113 Ga0495595_0018313 3300053084 Bacteria 3025
1114 Ga0495595_0155002 3300053084 Unclassified 1128
1115 Ga0495619_0000023 3300053085 Bacteria 182266
1116 Ga0495619_0000265 3300053085 Bacteria 38076
1117 Ga0495619_0000423 3300053085 Bacteria 28622
1118 Ga0495619_0001751 3300053085 Bacteria 14428
1119 Ga0495619_0004854 3300053085 Bacteria 8530
1120 Ga0495619_0026297 3300053085 Bacteria 3743
1121 Ga0495619_0036496 3300053085 Bacteria 3201
1122 Ga0495619_0041747 3300053085 Bacteria 3001
1123 Ga0495619_0044334 3300053085 Bacteria 2919
1124 Ga0500577_0009138 3300053142 Bacteria 2864
1125 Ga0500627_0055269 3300053158 Bacteria 1738
1126 Ga0501084_0017558 3300054114 Bacteria 5951
1127 Ga0501084_0043749 3300054114 Bacteria 3746
1128 Ga0501084_0097542 3300054114 Bacteria 2468
1129 Ga0501084_0166651 3300054114 Bacteria 1859
1130 Ga0501082_0000202 3300060353 Bacteria 52074
1131 Ga0501082_0032249 3300060353 Bacteria 4517
1132 Ga0501082_0173294 3300060353 Bacteria 1876
1133 Ga0501082_0188119 3300060353 Bacteria 1796
1134 Ga0530510_0004260 3300061734 Bacteria 9897
1135 Ga0530510_0031418 3300061734 Bacteria 3818
1136 Ga0530510_0243222 3300061734 Unclassified 1340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100106012 Ga0075435_1001060122 241
2 3300050513 nmdc:mga0rr50_123918_c1 nmdc:mga0rr50_123918_c1_728_1618 241
3 3300050512 nmdc:mga0n895_214678_c1 nmdc:mga0n895_214678_c1_793_1683 242
4 3300050515 nmdc:mga0a205_19210_c1 nmdc:mga0a205_19210_c1_4873_5763 242
5 3300035691 Ga0373931_0043352 Ga0373931_0043352_1437_2336 244
6 3300034816 Ga0373930_0017229 Ga0373930_0017229_528_1340 248
7 3300035090 Ga0373949_0012358 Ga0373949_0012358_12_824 248
8 3300025916 Ga0207663_10318662 Ga0207663_103186622 250
9 3300050514 nmdc:mga08x19_304292_c1 nmdc:mga08x19_304292_c1_51_917 253
10 3300005330 Ga0070690_100007954 Ga0070690_1000079542 256
11 3300005334 Ga0068869_100005392 Ga0068869_1000053922 256
12 3300005336 Ga0070680_100004508 Ga0070680_1000045087 256
13 3300005338 Ga0068868_100001473 Ga0068868_10000147310 256
14 3300005340 Ga0070689_100073218 Ga0070689_1000732182 256
15 3300005341 Ga0070691_10009885 Ga0070691_100098854 256
16 3300005343 Ga0070687_100000176 Ga0070687_1000001769 256
17 3300005345 Ga0070692_10001408 Ga0070692_100014089 256
18 3300005365 Ga0070688_100197993 Ga0070688_1001979932 256
19 3300005406 Ga0070703_10003840 Ga0070703_100038403 256
20 3300005438 Ga0070701_10000060 Ga0070701_1000006024 256
21 3300005440 Ga0070705_100002404 Ga0070705_1000024046 256
22 3300005444 Ga0070694_100002437 Ga0070694_1000024377 256
23 3300005459 Ga0068867_100003556 Ga0068867_1000035566 256
24 3300005530 Ga0070679_100002086 Ga0070679_1000020869 256
25 3300005544 Ga0070686_100004877 Ga0070686_1000048778 256
26 3300005545 Ga0070695_100002011 Ga0070695_1000020116 256
27 3300005546 Ga0070696_100001197 Ga0070696_1000011976 256
28 3300005547 Ga0070693_100000507 Ga0070693_1000005076 256
29 3300005549 Ga0070704_100011172 Ga0070704_1000111722 256
30 3300005563 Ga0068855_100001779 Ga0068855_1000017796 256
31 3300005578 Ga0068854_100005384 Ga0068854_1000053848 256
32 3300005614 Ga0068856_100033405 Ga0068856_1000334053 256
33 3300005615 Ga0070702_100000039 Ga0070702_10000003942 256
34 3300005616 Ga0068852_100156571 Ga0068852_1001565712 256
35 3300005617 Ga0068859_100000420 Ga0068859_1000004207 256
36 3300005718 Ga0068866_10000153 Ga0068866_100001537 256
37 3300005719 Ga0068861_100000987 Ga0068861_10000098710 256
38 3300005841 Ga0068863_100277037 Ga0068863_1002770372 256
39 3300005843 Ga0068860_100002022 Ga0068860_10000202218 256
40 3300005844 Ga0068862_100009697 Ga0068862_1000096973 256
41 3300006237 Ga0097621_100042579 Ga0097621_1000425792 256
42 3300006358 Ga0068871_100005049 Ga0068871_1000050499 256
43 3300006881 Ga0068865_100002459 Ga0068865_1000024596 256
44 3300006931 Ga0097620_100000420 Ga0097620_1000004207 256
45 3300009098 Ga0105245_10000533 Ga0105245_1000053334 256
46 3300009148 Ga0105243_10000495 Ga0105243_1000049523 256
47 3300009174 Ga0105241_10026871 Ga0105241_100268716 256
48 3300009176 Ga0105242_10000248 Ga0105242_100002488 256
49 3300009553 Ga0105249_10004892 Ga0105249_100048929 256
50 3300010375 Ga0105239_10077348 Ga0105239_100773482 256
51 3300011119 Ga0105246_10018242 Ga0105246_100182422 256
52 3300013297 Ga0157378_10000387 Ga0157378_1000038710 256
53 3300013306 Ga0163162_10090707 Ga0163162_100907073 256
54 3300014326 Ga0157380_10006409 Ga0157380_100064092 256
55 3300014968 Ga0157379_10157585 Ga0157379_101575852 256
56 3300014969 Ga0157376_10004198 Ga0157376_100041986 256
57 3300025885 Ga0207653_10005645 Ga0207653_100056453 256
58 3300025899 Ga0207642_10026058 Ga0207642_100260582 256
59 3300025908 Ga0207643_10203387 Ga0207643_102033872 256
60 3300025911 Ga0207654_10119375 Ga0207654_101193751 256
61 3300025917 Ga0207660_10002432 Ga0207660_100024326 256
62 3300025918 Ga0207662_10000095 Ga0207662_1000009543 256
63 3300025927 Ga0207687_10000432 Ga0207687_1000043222 256
64 3300025931 Ga0207644_10058816 Ga0207644_100588161 256
65 3300025934 Ga0207686_10002300 Ga0207686_100023008 256
66 3300025935 Ga0207709_10000939 Ga0207709_100009397 256
67 3300025936 Ga0207670_10058064 Ga0207670_100580643 256
68 3300025938 Ga0207704_10000281 Ga0207704_1000028119 256
69 3300025942 Ga0207689_10003028 Ga0207689_100030289 256
70 3300025981 Ga0207640_10018411 Ga0207640_100184114 256
71 3300026023 Ga0207677_10002928 Ga0207677_100029282 256
72 3300026035 Ga0207703_10006621 Ga0207703_100066219 256
73 3300026075 Ga0207708_10011537 Ga0207708_100115376 256
74 3300026078 Ga0207702_10030968 Ga0207702_100309685 256
75 3300026088 Ga0207641_10347340 Ga0207641_103473402 256
76 3300026089 Ga0207648_10000513 Ga0207648_100005139 256
77 3300026118 Ga0207675_100003827 Ga0207675_1000038278 256
78 3300028380 Ga0268265_10049058 Ga0268265_100490582 256
79 3300028381 Ga0268264_10000827 Ga0268264_100008279 256
80 3300035691 Ga0373931_0037892 Ga0373931_0037892_220_1149 256
81 3300045051 Ga0451576_0065086 Ga0451576_0065086_2029_2955 256
82 3300044712 Ga0453684_0395578 Ga0453684_0395578_568_1497 257
83 3300045051 Ga0451576_0001678 Ga0451576_0001678_31909_32838 257
84 3300006844 Ga0075428_100000109 Ga0075428_10000010951 258
85 3300006880 Ga0075429_100001264 Ga0075429_10000126411 258
86 3300009094 Ga0111539_10183865 Ga0111539_101838653 258
87 3300009147 Ga0114129_10001030 Ga0114129_1000103028 258
88 3300025917 Ga0207660_10138205 Ga0207660_101382051 258
89 3300026075 Ga0207708_10118119 Ga0207708_101181192 258
90 3300027907 Ga0207428_10002963 Ga0207428_100029633 258
91 3300042876 Ga0451577_0530126 Ga0451577_0530126_93_1025 258
92 3300050507 nmdc:mga05p37_3280_c1 nmdc:mga05p37_3280_c1_9218_10150 258
93 3300050508 nmdc:mga09592_259_c1 nmdc:mga09592_259_c1_26940_27872 258
94 3300050511 nmdc:mga08y16_2852_c1 nmdc:mga08y16_2852_c1_5988_6920 258
95 3300050513 nmdc:mga0rr50_228349_c1 nmdc:mga0rr50_228349_c1_620_1510 258
96 3300046455 Ga0495603_0002904 Ga0495603_0002904_14_892 264
97 3300006914 Ga0075436_100162440 Ga0075436_1001624402 265
98 3300050514 nmdc:mga08x19_143428_c1 nmdc:mga08x19_143428_c1_346_1143 265
99 3300047322 Ga0495680_0354570 Ga0495680_0354570_148_966 267
100 3300049743 Ga0501081_0125902 Ga0501081_0125902_11_901 269
101 3300049590 Ga0501074_0242012 Ga0501074_0242012_437_1249 270
102 3300035083 Ga0373926_0010654 Ga0373926_0010654_700_1614 272
103 3300035171 Ga0373946_0019270 Ga0373946_0019270_159_1073 272
104 3300035692 Ga0373935_0023549 Ga0373935_0023549_2314_3228 272
105 3300035725 Ga0373947_0026258 Ga0373947_0026258_163_1077 272
106 3300046472 Ga0495580_0000775 Ga0495580_0000775_23028_23942 272
107 3300046499 Ga0495594_0008682 Ga0495594_0008682_1419_2333 272
108 3300046526 Ga0495666_0051208 Ga0495666_0051208_801_1715 272
109 3300046531 Ga0495665_0191183 Ga0495665_0191183_12_926 272
110 3300046535 Ga0495586_0004228 Ga0495586_0004228_1161_2075 272
111 3300046681 Ga0495647_0000515 Ga0495647_0000515_9293_10207 272
112 3300032005 Ga0307411_10127812 Ga0307411_101278122 273
113 3300035695 Ga0373927_0011621 Ga0373927_0011621_2958_3875 273
114 3300007265 Ga0099794_10011922 Ga0099794_100119223 278
115 3300049576 Ga0501040_0174041 Ga0501040_0174041_152_1069 278
116 3300037471 Ga0395905_0037206 Ga0395905_0037206_2310_3293 279
117 3300039450 Ga0436363_0059666 Ga0436363_0059666_12_872 279
118 3300005983 Ga0081540_1001366 Ga0081540_10013669 280
119 3300050510 nmdc:mga06r32_163089_c1 nmdc:mga06r32_163089_c1_469_1341 280
120 3300035088 Ga0373940_0005451 Ga0373940_0005451_217_1149 281
121 3300035114 Ga0373939_0003930 Ga0373939_0003930_2118_3050 281
122 3300005440 Ga0070705_100007847 Ga0070705_1000078478 283
123 3300005444 Ga0070694_100114653 Ga0070694_1001146532 283
124 3300005467 Ga0070706_100409301 Ga0070706_1004093012 283
125 3300005536 Ga0070697_100079463 Ga0070697_1000794633 283
126 3300005545 Ga0070695_100004254 Ga0070695_1000042545 283
127 3300005546 Ga0070696_100041998 Ga0070696_1000419983 283
128 3300006173 Ga0070716_100159796 Ga0070716_1001597962 283
129 3300006914 Ga0075436_100009889 Ga0075436_1000098899 283
130 3300007076 Ga0075435_100068235 Ga0075435_1000682353 283
131 3300025910 Ga0207684_10183814 Ga0207684_101838142 283
132 3300025939 Ga0207665_10065004 Ga0207665_100650042 283
133 3300050514 nmdc:mga08x19_10398_c1 nmdc:mga08x19_10398_c1_799_1662 283
134 3300026041 Ga0207639_10767504 Ga0207639_107675041 284
135 3300042876 Ga0451577_0140505 Ga0451577_0140505_591_1607 284
136 3300005618 Ga0068864_100017359 Ga0068864_1000173593 287
137 3300006358 Ga0068871_100605553 Ga0068871_1006055531 287
138 3300006914 Ga0075436_100000075 Ga0075436_10000007534 287
139 3300007076 Ga0075435_100000116 Ga0075435_10000011640 287
140 3300025939 Ga0207665_10078353 Ga0207665_100783532 287
141 3300035113 Ga0373936_0007009 Ga0373936_0007009_3301_4191 288
142 3300035092 Ga0373952_0013195 Ga0373952_0013195_745_1614 289
143 3300048907 Ga0496104_0502859 Ga0496104_0502859_16_885 289
144 3300005985 Ga0081539_10001081 Ga0081539_1000108149 290
145 3300049572 Ga0501036_0004646 Ga0501036_0004646_6288_7181 290
146 3300049575 Ga0501039_0020067 Ga0501039_0020067_2153_3046 290
147 3300049576 Ga0501040_0003091 Ga0501040_0003091_7697_8590 290
148 3300049578 Ga0501042_0007413 Ga0501042_0007413_2968_3861 290
149 3300049580 Ga0501046_0110796 Ga0501046_0110796_225_1118 290
150 3300049582 Ga0501048_0019096 Ga0501048_0019096_1356_2249 290
151 3300049584 Ga0501068_0026786 Ga0501068_0026786_956_1849 290
152 3300049587 Ga0501071_0009259 Ga0501071_0009259_1345_2238 290
153 3300049591 Ga0501075_0006585 Ga0501075_0006585_889_1782 290
154 3300049592 Ga0501076_0000870 Ga0501076_0000870_2996_3889 290
155 3300049742 Ga0501080_0012676 Ga0501080_0012676_703_1596 290
156 3300049743 Ga0501081_0022664 Ga0501081_0022664_746_1639 290
157 3300049824 Ga0501045_0003545 Ga0501045_0003545_6654_7547 290
158 3300054114 Ga0501084_0017558 Ga0501084_0017558_3362_4255 290
159 3300060353 Ga0501082_0032249 Ga0501082_0032249_3421_4314 290
160 3300061734 Ga0530510_0004260 Ga0530510_0004260_2450_3343 290
161 3300005458 Ga0070681_10004036 Ga0070681_100040364 291
162 3300005518 Ga0070699_100021000 Ga0070699_1000210003 291
163 3300025912 Ga0207707_10005043 Ga0207707_1000504310 291
164 3300035114 Ga0373939_0018600 Ga0373939_0018600_354_1250 291
165 3300035121 Ga0373960_0053993 Ga0373960_0053993_206_1102 291
166 3300035691 Ga0373931_0056956 Ga0373931_0056956_939_1835 291
167 3300006852 Ga0075433_10052790 Ga0075433_100527904 292
168 3300006871 Ga0075434_100022971 Ga0075434_1000229716 292
169 3300009147 Ga0114129_10007859 Ga0114129_1000785913 292
170 3300050507 nmdc:mga05p37_7196_c1 nmdc:mga05p37_7196_c1_6689_7642 292
171 3300050512 nmdc:mga0n895_4040_c1 nmdc:mga0n895_4040_c1_5875_6828 292
172 3300050513 nmdc:mga0rr50_23018_c1 nmdc:mga0rr50_23018_c1_2750_3703 292
173 3300050515 nmdc:mga0a205_126304_c1 nmdc:mga0a205_126304_c1_894_1847 292
174 3300046679 Ga0495623_0000073 Ga0495623_0000073_60870_61841 294
175 3300005546 Ga0070696_100013066 Ga0070696_1000130667 298
176 3300049575 Ga0501039_0173507 Ga0501039_0173507_716_1633 298
177 3300049588 Ga0501072_0134776 Ga0501072_0134776_299_1216 298
178 3300049591 Ga0501075_0008387 Ga0501075_0008387_3508_4425 298
179 3300049822 Ga0501035_0152533 Ga0501035_0152533_66_983 298
180 3300049824 Ga0501045_0165206 Ga0501045_0165206_17_934 298
181 3300060353 Ga0501082_0188119 Ga0501082_0188119_662_1579 298
182 3300035118 Ga0373954_0067687 Ga0373954_0067687_671_1639 299
183 3300035119 Ga0373956_0006169 Ga0373956_0006169_25_954 299
184 3300048088 Ga0495602_0112218 Ga0495602_0112218_114_1082 299
185 3300045976 Ga0466967_0271149 Ga0466967_0271149_345_1352 300
186 3300009147 Ga0114129_10367322 Ga0114129_103673222 301
187 3300053084 Ga0495595_0017270 Ga0495595_0017270_449_1393 301
188 3300053085 Ga0495619_0026297 Ga0495619_0026297_1846_2790 301
189 3300005330 Ga0070690_100269998 Ga0070690_1002699982 302
190 3300005340 Ga0070689_100169616 Ga0070689_1001696162 302
191 3300005539 Ga0068853_100584395 Ga0068853_1005843951 302
192 3300005614 Ga0068856_100110487 Ga0068856_1001104872 302
193 3300005617 Ga0068859_100434693 Ga0068859_1004346932 302
194 3300006871 Ga0075434_100000349 Ga0075434_1000003492 302
195 3300006931 Ga0097620_100434665 Ga0097620_1004346652 302
196 3300025936 Ga0207670_10122212 Ga0207670_101222122 302
197 3300026078 Ga0207702_10060859 Ga0207702_100608594 302
198 3300026095 Ga0207676_10121061 Ga0207676_101210613 302
199 3300035170 Ga0373943_0012370 Ga0373943_0012370_142_1095 302
200 3300035172 Ga0373955_0223941 Ga0373955_0223941_29_982 302
201 3300035692 Ga0373935_0140792 Ga0373935_0140792_650_1603 302
202 3300038996 Ga0242420_005377 Ga0242420_005377_796_1755 302
203 3300046463 Ga0495653_0035144 Ga0495653_0035144_1813_2766 302
204 3300046463 Ga0495653_0192607 Ga0495653_0192607_399_1352 302
205 3300046476 Ga0495662_0023378 Ga0495662_0023378_955_1908 302
206 3300046477 Ga0495664_0000241 Ga0495664_0000241_20685_21638 302
207 3300046514 Ga0495618_0015329 Ga0495618_0015329_1876_2829 302
208 3300046529 Ga0495652_0387891 Ga0495652_0387891_17_970 302
209 3300046533 Ga0495640_0010763 Ga0495640_0010763_622_1575 302
210 3300046615 Ga0495656_0025978 Ga0495656_0025978_865_1794 302
211 3300046642 Ga0495634_0079109 Ga0495634_0079109_622_1575 302
212 3300046642 Ga0495634_0233607 Ga0495634_0233607_60_1013 302
213 3300046663 Ga0495635_0022296 Ga0495635_0022296_1580_2533 302
214 3300046679 Ga0495623_0057065 Ga0495623_0057065_1308_2267 302
215 3300047471 Ga0495684_0037570 Ga0495684_0037570_2704_3657 302
216 3300047673 Ga0495593_0184959 Ga0495593_0184959_85_1038 302
217 3300050512 nmdc:mga0n895_5415_c1 nmdc:mga0n895_5415_c1_9563_10492 302
218 3300050513 nmdc:mga0rr50_505_c1 nmdc:mga0rr50_505_c1_7089_8018 302
219 3300050515 nmdc:mga0a205_133448_c1 nmdc:mga0a205_133448_c1_693_1652 302
220 3300053077 Ga0495601_0034843 Ga0495601_0034843_271_1224 302
221 3300053078 Ga0495612_0041683 Ga0495612_0041683_443_1396 302
222 3300053085 Ga0495619_0041747 Ga0495619_0041747_1413_2366 302
223 3300005563 Ga0068855_100296061 Ga0068855_1002960612 306
224 3300025912 Ga0207707_10017033 Ga0207707_100170335 306
225 3300026067 Ga0207678_10009676 Ga0207678_100096767 306
226 3300049577 Ga0501041_0200992 Ga0501041_0200992_230_1207 306
227 3300049580 Ga0501046_0252174 Ga0501046_0252174_74_1051 306
228 3300049744 Ga0501083_0266198 Ga0501083_0266198_80_1057 306
229 3300054114 Ga0501084_0166651 Ga0501084_0166651_164_1141 306
230 3300061734 Ga0530510_0031418 Ga0530510_0031418_1266_2243 306
231 3300048912 Ga0496109_0442949 Ga0496109_0442949_94_1128 308
232 3300005937 Ga0081455_10007158 Ga0081455_100071589 309
233 3300035724 Ga0373933_0052103 Ga0373933_0052103_640_1593 309
234 3300036401 Ga0373937_0132885 Ga0373937_0132885_1155_2108 309
235 3300046457 Ga0495590_0071601 Ga0495590_0071601_228_1202 309
236 3300046474 Ga0495605_0031727 Ga0495605_0031727_1694_2644 309
237 3300046533 Ga0495640_0039679 Ga0495640_0039679_270_1223 309
238 3300046559 Ga0495667_0075745 Ga0495667_0075745_650_1603 309
239 3300046642 Ga0495634_0281474 Ga0495634_0281474_35_988 309
240 3300046663 Ga0495635_0048232 Ga0495635_0048232_1832_2785 309
241 3300047319 Ga0495674_0138942 Ga0495674_0138942_480_1433 309
242 3300048905 Ga0496102_0360634 Ga0496102_0360634_26_979 309
243 3300053077 Ga0495601_0215005 Ga0495601_0215005_30_983 309
244 3300053084 Ga0495595_0018313 Ga0495595_0018313_1016_1969 309
245 3300053085 Ga0495619_0001751 Ga0495619_0001751_10727_11680 309
246 3300006871 Ga0075434_100008956 Ga0075434_1000089566 310
247 3300035111 Ga0373923_0002488 Ga0373923_0002488_1752_2771 310
248 3300035116 Ga0373945_0005926 Ga0373945_0005926_858_1877 310
249 3300035117 Ga0373953_0000738 Ga0373953_0000738_5807_6826 310
250 3300035118 Ga0373954_0004843 Ga0373954_0004843_3048_4067 310
251 3300035171 Ga0373946_0000495 Ga0373946_0000495_10759_11778 310
252 3300035172 Ga0373955_0000152 Ga0373955_0000152_3677_4696 310
253 3300035692 Ga0373935_0000006 Ga0373935_0000006_58764_59783 310
254 3300035695 Ga0373927_0005584 Ga0373927_0005584_3301_4320 310
255 3300035724 Ga0373933_0016241 Ga0373933_0016241_2650_3669 310
256 3300035725 Ga0373947_0001906 Ga0373947_0001906_2764_3783 310
257 3300036401 Ga0373937_0000165 Ga0373937_0000165_38079_39098 310
258 3300037068 Ga0373925_0000475 Ga0373925_0000475_31699_32718 310
259 3300046454 Ga0495592_0000020 Ga0495592_0000020_40776_41795 310
260 3300046459 Ga0495629_0020249 Ga0495629_0020249_1040_2059 310
261 3300046462 Ga0495651_0001076 Ga0495651_0001076_961_1980 310
262 3300046463 Ga0495653_0000046 Ga0495653_0000046_99003_100022 310
263 3300046476 Ga0495662_0003633 Ga0495662_0003633_3431_4450 310
264 3300046477 Ga0495664_0000017 Ga0495664_0000017_98944_99963 310
265 3300046511 Ga0495608_0000058 Ga0495608_0000058_19248_20267 310
266 3300046514 Ga0495618_0000049 Ga0495618_0000049_3772_4791 310
267 3300046516 Ga0495628_0000022 Ga0495628_0000022_72090_73109 310
268 3300046517 Ga0495630_0002725 Ga0495630_0002725_2427_3446 310
269 3300046529 Ga0495652_0000008 Ga0495652_0000008_270529_271548 310
270 3300046533 Ga0495640_0000067 Ga0495640_0000067_38499_39518 310
271 3300046536 Ga0495587_0000019 Ga0495587_0000019_62172_63191 310
272 3300046543 Ga0495645_0000006 Ga0495645_0000006_143832_144851 310
273 3300046559 Ga0495667_0000090 Ga0495667_0000090_60887_61906 310
274 3300046642 Ga0495634_0000167 Ga0495634_0000167_36097_37116 310
275 3300046663 Ga0495635_0000023 Ga0495635_0000023_62404_63423 310
276 3300046675 Ga0495657_0000099 Ga0495657_0000099_42536_43555 310
277 3300046678 Ga0495599_0000039 Ga0495599_0000039_34506_35525 310
278 3300046680 Ga0495646_0000017 Ga0495646_0000017_58010_59029 310
279 3300046690 Ga0495624_0030411 Ga0495624_0030411_858_1877 310
280 3300046809 Ga0495600_0000043 Ga0495600_0000043_63162_64181 310
281 3300047315 Ga0495581_0058695 Ga0495581_0058695_871_1890 310
282 3300047317 Ga0495604_0000030 Ga0495604_0000030_65361_66380 310
283 3300047319 Ga0495674_0000009 Ga0495674_0000009_237243_238262 310
284 3300047322 Ga0495680_0000307 Ga0495680_0000307_3197_4216 310
285 3300047444 Ga0495675_0000195 Ga0495675_0000195_40032_41051 310
286 3300047471 Ga0495684_0000031 Ga0495684_0000031_96502_97521 310
287 3300047673 Ga0495593_0009243 Ga0495593_0009243_1770_2789 310
288 3300048088 Ga0495602_0000006 Ga0495602_0000006_98894_99913 310
289 3300048911 Ga0496108_0006847 Ga0496108_0006847_2717_3697 310
290 3300048912 Ga0496109_0029005 Ga0496109_0029005_933_1913 310
291 3300048913 Ga0496110_0001072 Ga0496110_0001072_14458_15438 310
292 3300048915 Ga0496112_0039198 Ga0496112_0039198_30_1010 310
293 3300048915 Ga0496112_0523514 Ga0496112_0523514_59_1039 310
294 3300050512 nmdc:mga0n895_11586_c1 nmdc:mga0n895_11586_c1_4641_5606 310
295 3300053077 Ga0495601_0000007 Ga0495601_0000007_266145_267164 310
296 3300053078 Ga0495612_0000240 Ga0495612_0000240_2528_3547 310
297 3300053084 Ga0495595_0000031 Ga0495595_0000031_86575_87594 310
298 3300053085 Ga0495619_0000023 Ga0495619_0000023_66274_67293 310
299 3300006844 Ga0075428_100001911 Ga0075428_10000191112 311
300 3300009094 Ga0111539_10005738 Ga0111539_1000573816 311
301 3300009147 Ga0114129_10032825 Ga0114129_100328258 311
302 3300025918 Ga0207662_10108833 Ga0207662_101088332 311
303 3300027907 Ga0207428_10005877 Ga0207428_100058777 311
304 3300050507 nmdc:mga05p37_5784_c1 nmdc:mga05p37_5784_c1_12758_13795 311
305 3300050509 nmdc:mga0qj67_4903_c1 nmdc:mga0qj67_4903_c1_4641_5678 311
306 3300050511 nmdc:mga08y16_4422_c1 nmdc:mga08y16_4422_c1_12758_13795 311
307 3300046689 Ga0495613_0259946 Ga0495613_0259946_78_1070 312
308 3300049587 Ga0501071_0072923 Ga0501071_0072923_1493_2488 313
309 3300049592 Ga0501076_0061767 Ga0501076_0061767_411_1406 313
310 3300054114 Ga0501084_0043749 Ga0501084_0043749_1070_2065 313
311 3300060353 Ga0501082_0173294 Ga0501082_0173294_248_1243 313
312 3300061734 Ga0530510_0243222 Ga0530510_0243222_49_1044 313
313 3300031242 Ga0265329_10006698 Ga0265329_100066982 315
314 3300031247 Ga0265340_10006313 Ga0265340_100063133 315
315 3300031249 Ga0265339_10030352 Ga0265339_100303522 315
316 3300048907 Ga0496104_0030219 Ga0496104_0030219_3658_4674 315
317 3300050507 nmdc:mga05p37_55210_c1 nmdc:mga05p37_55210_c1_425_1447 315
318 3300005445 Ga0070708_100049987 Ga0070708_1000499872 316
319 3300005518 Ga0070699_100135854 Ga0070699_1001358542 316
320 3300005614 Ga0068856_100043275 Ga0068856_1000432753 316
321 3300006175 Ga0070712_100085305 Ga0070712_1000853053 316
322 3300006880 Ga0075429_100344656 Ga0075429_1003446562 316
323 3300007265 Ga0099794_10004509 Ga0099794_100045094 316
324 3300009147 Ga0114129_10062119 Ga0114129_100621193 316
325 3300009147 Ga0114129_10098133 Ga0114129_100981333 316
326 3300021361 Ga0213872_10033133 Ga0213872_100331332 316
327 3300025915 Ga0207693_10087489 Ga0207693_100874893 316
328 3300035118 Ga0373954_0008120 Ga0373954_0008120_1906_2907 316
329 3300035410 Ga0373924_0029564 Ga0373924_0029564_473_1474 316
330 3300035724 Ga0373933_0018766 Ga0373933_0018766_71_1072 316
331 3300036401 Ga0373937_0008865 Ga0373937_0008865_80_1081 316
332 3300039447 Ga0436361_0550596 Ga0436361_0550596_6044_7048 316
333 3300046454 Ga0495592_0138203 Ga0495592_0138203_569_1570 316
334 3300046462 Ga0495651_0128237 Ga0495651_0128237_71_1072 316
335 3300046663 Ga0495635_0102593 Ga0495635_0102593_932_1933 316
336 3300046675 Ga0495657_0005797 Ga0495657_0005797_7446_8447 316
337 3300047322 Ga0495680_0021015 Ga0495680_0021015_3986_4987 316
338 3300048903 Ga0496100_0000930 Ga0496100_0000930_2959_3987 316
339 3300048905 Ga0496102_0016849 Ga0496102_0016849_1596_2624 316
340 3300048907 Ga0496104_0000591 Ga0496104_0000591_14481_15509 316
341 3300048909 Ga0496106_0000990 Ga0496106_0000990_4178_5206 316
342 3300048911 Ga0496108_0015235 Ga0496108_0015235_2740_3768 316
343 3300048912 Ga0496109_0011107 Ga0496109_0011107_2583_3611 316
344 3300048913 Ga0496110_0001444 Ga0496110_0001444_1036_2064 316
345 3300048914 Ga0496111_0002052 Ga0496111_0002052_3741_4769 316
346 3300048915 Ga0496112_0001198 Ga0496112_0001198_11095_12123 316
347 3300048916 Ga0496113_0088054 Ga0496113_0088054_911_1939 316
348 3300048917 Ga0496114_0149012 Ga0496114_0149012_129_1157 316
349 3300048918 Ga0496115_0019256 Ga0496115_0019256_2620_3648 316
350 3300050492 nmdc:mga0yw44_151121_c1 nmdc:mga0yw44_151121_c1_348_1352 316
351 3300050507 nmdc:mga05p37_252765_c1 nmdc:mga05p37_252765_c1_333_1337 316
352 3300050507 nmdc:mga05p37_60007_c1 nmdc:mga05p37_60007_c1_1759_2754 316
353 3300050508 nmdc:mga09592_83876_c2 nmdc:mga09592_83876_c2_107_1102 316
354 3300053077 Ga0495601_0160256 Ga0495601_0160256_79_1080 316
355 3300053085 Ga0495619_0044334 Ga0495619_0044334_1696_2697 316
356 3300021384 Ga0213876_10070602 Ga0213876_100706022 317
357 3300021388 Ga0213875_10000236 Ga0213875_1000023613 317
358 3300035724 Ga0373933_0090664 Ga0373933_0090664_139_1131 317
359 3300037853 Ga0436364_0978611 Ga0436364_0978611_34996_36003 317
360 3300039437 Ga0436365_0797236 Ga0436365_0797236_602_1606 317
361 3300005353 Ga0070669_100062049 Ga0070669_1000620492 318
362 3300009553 Ga0105249_10283487 Ga0105249_102834872 318
363 3300028380 Ga0268265_10080795 Ga0268265_100807953 318
364 3300036401 Ga0373937_0018097 Ga0373937_0018097_5123_6130 318
365 3300047444 Ga0495675_0024374 Ga0495675_0024374_1721_2728 318
366 3300049743 Ga0501081_0046592 Ga0501081_0046592_1083_2114 318
367 3300053077 Ga0495601_0072235 Ga0495601_0072235_14_1027 318
368 3300053078 Ga0495612_0009684 Ga0495612_0009684_2315_3328 318
369 3300005328 Ga0070676_10023174 Ga0070676_100231743 320
370 3300005335 Ga0070666_10075970 Ga0070666_100759702 320
371 3300005355 Ga0070671_100035832 Ga0070671_1000358323 320
372 3300005356 Ga0070674_100358706 Ga0070674_1003587062 320
373 3300005435 Ga0070714_100075417 Ga0070714_1000754173 320
374 3300005436 Ga0070713_100133338 Ga0070713_1001333382 320
375 3300005437 Ga0070710_10106695 Ga0070710_101066952 320
376 3300005456 Ga0070678_100019190 Ga0070678_1000191905 320
377 3300005457 Ga0070662_100122382 Ga0070662_1001223822 320
378 3300005545 Ga0070695_100130295 Ga0070695_1001302951 320
379 3300006237 Ga0097621_100121071 Ga0097621_1001210712 320
380 3300025898 Ga0207692_10008757 Ga0207692_100087572 320
381 3300025900 Ga0207710_10085245 Ga0207710_100852452 320
382 3300025904 Ga0207647_10079629 Ga0207647_100796292 320
383 3300025907 Ga0207645_10031128 Ga0207645_100311284 320
384 3300025915 Ga0207693_10042666 Ga0207693_100426662 320
385 3300025916 Ga0207663_10122498 Ga0207663_101224982 320
386 3300025919 Ga0207657_10006209 Ga0207657_100062093 320
387 3300025929 Ga0207664_10052248 Ga0207664_100522482 320
388 3300025931 Ga0207644_10243623 Ga0207644_102436232 320
389 3300025933 Ga0207706_10042358 Ga0207706_100423583 320
390 3300025934 Ga0207686_10032928 Ga0207686_100329282 320
391 3300025939 Ga0207665_10032460 Ga0207665_100324602 320
392 3300025941 Ga0207711_10070212 Ga0207711_100702123 320
393 3300026121 Ga0207683_10164365 Ga0207683_101643652 320
394 3300046675 Ga0495657_0114394 Ga0495657_0114394_10_996 320
395 3300048918 Ga0496115_0046016 Ga0496115_0046016_21_1007 320
396 3300006847 Ga0075431_100265331 Ga0075431_1002653312 321
397 3300025915 Ga0207693_10239140 Ga0207693_102391402 321
398 3300005719 Ga0068861_100481965 Ga0068861_1004819651 322
399 3300025893 Ga0207682_10006813 Ga0207682_100068132 322
400 3300005293 Ga0065715_10145053 Ga0065715_101450532 323
401 3300005340 Ga0070689_100111139 Ga0070689_1001111392 323
402 3300005355 Ga0070671_100347631 Ga0070671_1003476312 323
403 3300005356 Ga0070674_100031450 Ga0070674_1000314502 323
404 3300011119 Ga0105246_10177655 Ga0105246_101776552 323
405 3300014325 Ga0163163_10111370 Ga0163163_101113702 323
406 3300021384 Ga0213876_10039419 Ga0213876_100394192 323
407 3300025925 Ga0207650_10163657 Ga0207650_101636572 323
408 3300025936 Ga0207670_10091278 Ga0207670_100912782 323
409 3300025938 Ga0207704_10192525 Ga0207704_101925252 323
410 3300025940 Ga0207691_10005072 Ga0207691_100050723 323
411 3300026089 Ga0207648_10018167 Ga0207648_100181674 323
412 3300026095 Ga0207676_10105477 Ga0207676_101054772 323
413 3300026116 Ga0207674_10023656 Ga0207674_100236563 323
414 3300026121 Ga0207683_10094497 Ga0207683_100944972 323
415 3300039437 Ga0436365_0884217 Ga0436365_0884217_14704_15702 323
416 3300046539 Ga0495621_0024210 Ga0495621_0024210_88_1083 323
417 3300050508 nmdc:mga09592_296713_c1 nmdc:mga09592_296713_c1_212_1207 323
418 3300009147 Ga0114129_10104720 Ga0114129_101047202 324
419 3300013306 Ga0163162_10397754 Ga0163162_103977542 324
420 3300025901 Ga0207688_10062810 Ga0207688_100628102 324
421 3300025907 Ga0207645_10074384 Ga0207645_100743841 324
422 3300039450 Ga0436363_1080804 Ga0436363_1080804_173_1195 324
423 3300048907 Ga0496104_0001165 Ga0496104_0001165_21380_22411 324
424 3300048907 Ga0496104_0001232 Ga0496104_0001232_15858_16889 324
425 3300048908 Ga0496105_0032220 Ga0496105_0032220_884_1915 324
426 3300048909 Ga0496106_0038716 Ga0496106_0038716_1045_2076 324
427 3300048916 Ga0496113_0079926 Ga0496113_0079926_38_1069 324
428 3300048916 Ga0496113_0178171 Ga0496113_0178171_275_1306 324
429 3300048917 Ga0496114_0173400 Ga0496114_0173400_157_1188 324
430 3300005347 Ga0070668_100042943 Ga0070668_1000429432 325
431 3300005356 Ga0070674_100015526 Ga0070674_1000155264 325
432 3300005364 Ga0070673_100417179 Ga0070673_1004171791 325
433 3300005366 Ga0070659_100028165 Ga0070659_1000281654 325
434 3300005436 Ga0070713_100458299 Ga0070713_1004582991 325
435 3300005437 Ga0070710_10073374 Ga0070710_100733741 325
436 3300005437 Ga0070710_10147276 Ga0070710_101472762 325
437 3300005439 Ga0070711_100008511 Ga0070711_1000085114 325
438 3300005441 Ga0070700_100020018 Ga0070700_1000200184 325
439 3300005455 Ga0070663_100059497 Ga0070663_1000594973 325
440 3300005457 Ga0070662_100074141 Ga0070662_1000741413 325
441 3300005518 Ga0070699_100002181 Ga0070699_1000021816 325
442 3300005544 Ga0070686_100191787 Ga0070686_1001917871 325
443 3300005548 Ga0070665_100323436 Ga0070665_1003234361 325
444 3300005615 Ga0070702_100061340 Ga0070702_1000613402 325
445 3300005718 Ga0068866_10012260 Ga0068866_100122601 325
446 3300005842 Ga0068858_100079607 Ga0068858_1000796072 325
447 3300005843 Ga0068860_100091469 Ga0068860_1000914692 325
448 3300005844 Ga0068862_100225499 Ga0068862_1002254992 325
449 3300005937 Ga0081455_10004348 Ga0081455_100043484 325
450 3300005983 Ga0081540_1008092 Ga0081540_10080924 325
451 3300006028 Ga0070717_10028516 Ga0070717_100285165 325
452 3300006028 Ga0070717_10030004 Ga0070717_100300042 325
453 3300006038 Ga0075365_10063307 Ga0075365_100633073 325
454 3300006051 Ga0075364_10124299 Ga0075364_101242992 325
455 3300006163 Ga0070715_10002401 Ga0070715_100024013 325
456 3300006173 Ga0070716_100168643 Ga0070716_1001686432 325
457 3300006175 Ga0070712_100158036 Ga0070712_1001580362 325
458 3300006175 Ga0070712_100195555 Ga0070712_1001955552 325
459 3300006175 Ga0070712_100379315 Ga0070712_1003793151 325
460 3300006881 Ga0068865_100013953 Ga0068865_1000139534 325
461 3300007076 Ga0075435_100084229 Ga0075435_1000842292 325
462 3300009098 Ga0105245_10079781 Ga0105245_100797813 325
463 3300009101 Ga0105247_10200075 Ga0105247_102000752 325
464 3300009148 Ga0105243_10090495 Ga0105243_100904952 325
465 3300009177 Ga0105248_10383812 Ga0105248_103838122 325
466 3300009545 Ga0105237_10228124 Ga0105237_102281242 325
467 3300009551 Ga0105238_10166511 Ga0105238_101665112 325
468 3300009553 Ga0105249_10029800 Ga0105249_100298003 325
469 3300010375 Ga0105239_10277795 Ga0105239_102777952 325
470 3300011119 Ga0105246_10049993 Ga0105246_100499933 325
471 3300013296 Ga0157374_10141328 Ga0157374_101413282 325
472 3300013297 Ga0157378_10022727 Ga0157378_100227274 325
473 3300013306 Ga0163162_10030184 Ga0163162_100301844 325
474 3300013308 Ga0157375_10049998 Ga0157375_100499982 325
475 3300014325 Ga0163163_10073419 Ga0163163_100734192 325
476 3300014968 Ga0157379_10114902 Ga0157379_101149022 325
477 3300017792 Ga0163161_10016674 Ga0163161_100166743 325
478 3300025898 Ga0207692_10055998 Ga0207692_100559982 325
479 3300025899 Ga0207642_10071895 Ga0207642_100718952 325
480 3300025914 Ga0207671_10076822 Ga0207671_100768222 325
481 3300025915 Ga0207693_10158135 Ga0207693_101581351 325
482 3300025915 Ga0207693_10305071 Ga0207693_103050711 325
483 3300025916 Ga0207663_10059430 Ga0207663_100594302 325
484 3300025916 Ga0207663_10264372 Ga0207663_102643722 325
485 3300025928 Ga0207700_10051819 Ga0207700_100518192 325
486 3300025933 Ga0207706_10042772 Ga0207706_100427724 325
487 3300025935 Ga0207709_10061229 Ga0207709_100612292 325
488 3300025938 Ga0207704_10012711 Ga0207704_100127113 325
489 3300025939 Ga0207665_10080556 Ga0207665_100805562 325
490 3300025972 Ga0207668_10042376 Ga0207668_100423763 325
491 3300025986 Ga0207658_10226445 Ga0207658_102264452 325
492 3300026075 Ga0207708_10018227 Ga0207708_100182274 325
493 3300026118 Ga0207675_100011672 Ga0207675_1000116727 325
494 3300028381 Ga0268264_10233848 Ga0268264_102338481 325
495 3300031247 Ga0265340_10044966 Ga0265340_100449662 325
496 3300031711 Ga0265314_10041579 Ga0265314_100415793 325
497 3300035114 Ga0373939_0013757 Ga0373939_0013757_900_1931 325
498 3300035116 Ga0373945_0004261 Ga0373945_0004261_1979_3004 325
499 3300035170 Ga0373943_0010245 Ga0373943_0010245_1671_2696 325
500 3300035171 Ga0373946_0043991 Ga0373946_0043991_602_1627 325
501 3300035692 Ga0373935_0051992 Ga0373935_0051992_1008_2033 325
502 3300035695 Ga0373927_0012866 Ga0373927_0012866_1796_2821 325
503 3300035725 Ga0373947_0085831 Ga0373947_0085831_747_1772 325
504 3300037068 Ga0373925_0114217 Ga0373925_0114217_17_1042 325
505 3300044706 Ga0466964_0102992 Ga0466964_0102992_16_1050 325
506 3300046453 Ga0495627_006545 Ga0495627_006545_2337_3362 325
507 3300046455 Ga0495603_0027183 Ga0495603_0027183_1855_2880 325
508 3300046458 Ga0495591_032375 Ga0495591_032375_416_1441 325
509 3300046474 Ga0495605_0006898 Ga0495605_0006898_1592_2617 325
510 3300046491 Ga0495584_0011284 Ga0495584_0011284_588_1613 325
511 3300046491 Ga0495584_0027388 Ga0495584_0027388_241_1275 325
512 3300046492 Ga0495585_0057016 Ga0495585_0057016_870_1895 325
513 3300046499 Ga0495594_0009983 Ga0495594_0009983_1889_2914 325
514 3300046500 Ga0495596_0017488 Ga0495596_0017488_786_1811 325
515 3300046501 Ga0495607_0008603 Ga0495607_0008603_2215_3240 325
516 3300046513 Ga0495616_0022179 Ga0495616_0022179_1932_2957 325
517 3300046515 Ga0495620_0017950 Ga0495620_0017950_899_1924 325
518 3300046518 Ga0495631_0008201 Ga0495631_0008201_2375_3400 325
519 3300046520 Ga0495637_0005980 Ga0495637_0005980_3177_4202 325
520 3300046523 Ga0495644_0001212 Ga0495644_0001212_5074_6099 325
521 3300046523 Ga0495644_0038733 Ga0495644_0038733_370_1404 325
522 3300046525 Ga0495663_0002590 Ga0495663_0002590_37_1062 325
523 3300046528 Ga0495642_0021919 Ga0495642_0021919_571_1596 325
524 3300046537 Ga0495598_0000197 Ga0495598_0000197_5051_6076 325
525 3300046538 Ga0495609_0008767 Ga0495609_0008767_2018_3043 325
526 3300046539 Ga0495621_0001164 Ga0495621_0001164_1977_3002 325
527 3300046558 Ga0495633_0007689 Ga0495633_0007689_22_1047 325
528 3300046615 Ga0495656_0005258 Ga0495656_0005258_2883_3908 325
529 3300046615 Ga0495656_0052855 Ga0495656_0052855_276_1310 325
530 3300046616 Ga0495668_0006195 Ga0495668_0006195_5618_6643 325
531 3300046664 Ga0495659_0070660 Ga0495659_0070660_59_1093 325
532 3300046665 Ga0495661_0026362 Ga0495661_0026362_2180_3205 325
533 3300046674 Ga0495588_0022160 Ga0495588_0022160_270_1295 325
534 3300046681 Ga0495647_0055969 Ga0495647_0055969_162_1187 325
535 3300046684 Ga0495669_0013427 Ga0495669_0013427_1342_2367 325
536 3300046691 Ga0495670_0076305 Ga0495670_0076305_593_1627 325
537 3300046692 Ga0495671_0037153 Ga0495671_0037153_1005_2030 325
538 3300046694 Ga0495649_0017651 Ga0495649_0017651_466_1491 325
539 3300046794 Ga0495589_0014670 Ga0495589_0014670_1885_2910 325
540 3300046810 Ga0495660_0013561 Ga0495660_0013561_1196_2221 325
541 3300047321 Ga0495676_0026606 Ga0495676_0026606_999_2024 325
542 3300047323 Ga0495683_0050041 Ga0495683_0050041_594_1619 325
543 3300047470 Ga0495681_0021347 Ga0495681_0021347_667_1692 325
544 3300048090 Ga0495615_0000548 Ga0495615_0000548_702_1727 325
545 3300048091 Ga0495626_0013587 Ga0495626_0013587_2718_3743 325
546 3300048903 Ga0496100_0033172 Ga0496100_0033172_59_1063 325
547 3300048904 Ga0496101_0021005 Ga0496101_0021005_2586_3611 325
548 3300048907 Ga0496104_0028344 Ga0496104_0028344_3151_4176 325
549 3300048912 Ga0496109_0068035 Ga0496109_0068035_2073_3098 325
550 3300048917 Ga0496114_0087873 Ga0496114_0087873_926_1951 325
551 3300048918 Ga0496115_0046424 Ga0496115_0046424_2017_3042 325
552 3300053083 Ga0495655_0000275 Ga0495655_0000275_5060_6085 325
553 3300060353 Ga0501082_0000202 Ga0501082_0000202_39971_40969 325
554 3300005548 Ga0070665_100113074 Ga0070665_1001130743 326
555 3300006914 Ga0075436_100332668 Ga0075436_1003326681 326
556 3300042156 Ga0439446_0033067 Ga0439446_0033067_402_1409 326
557 3300049572 Ga0501036_0091221 Ga0501036_0091221_1073_2083 326
558 3300049822 Ga0501035_0095956 Ga0501035_0095956_779_1789 326
559 3300049822 Ga0501035_0121236 Ga0501035_0121236_635_1645 326
560 3300005437 Ga0070710_10150698 Ga0070710_101506982 327
561 3300006028 Ga0070717_10313718 Ga0070717_103137182 327
562 3300006175 Ga0070712_100156818 Ga0070712_1001568181 327
563 3300010159 Ga0099796_10006479 Ga0099796_100064792 327
564 3300024225 Ga0224572_1002511 Ga0224572_10025113 327
565 3300025898 Ga0207692_10089007 Ga0207692_100890072 327
566 3300025906 Ga0207699_10040563 Ga0207699_100405632 327
567 3300025915 Ga0207693_10015209 Ga0207693_100152092 327
568 3300025915 Ga0207693_10146736 Ga0207693_101467362 327
569 3300025928 Ga0207700_10245476 Ga0207700_102454762 327
570 3300030763 Ga0265763_1000560 Ga0265763_10005602 327
571 3300031090 Ga0265760_10027023 Ga0265760_100270232 327
572 3300031250 Ga0265331_10015729 Ga0265331_100157294 327
573 3300035083 Ga0373926_0006472 Ga0373926_0006472_1082_2116 327
574 3300035116 Ga0373945_0014923 Ga0373945_0014923_1501_2535 327
575 3300035171 Ga0373946_0045297 Ga0373946_0045297_271_1305 327
576 3300035695 Ga0373927_0104213 Ga0373927_0104213_188_1222 327
577 3300035725 Ga0373947_0003131 Ga0373947_0003131_7453_8487 327
578 3300037068 Ga0373925_0023955 Ga0373925_0023955_2063_3097 327
579 3300046459 Ga0495629_0127755 Ga0495629_0127755_474_1508 327
580 3300046472 Ga0495580_0086475 Ga0495580_0086475_253_1287 327
581 3300046473 Ga0495582_0107328 Ga0495582_0107328_369_1403 327
582 3300046517 Ga0495630_0042979 Ga0495630_0042979_2055_3089 327
583 3300046689 Ga0495613_0144939 Ga0495613_0144939_171_1205 327
584 3300046690 Ga0495624_0012625 Ga0495624_0012625_4697_5731 327
585 3300047315 Ga0495581_0146861 Ga0495581_0146861_171_1205 327
586 3300050514 nmdc:mga08x19_194825_c1 nmdc:mga08x19_194825_c1_204_1238 327
587 3300048911 Ga0496108_0312450 Ga0496108_0312450_201_1211 328
588 3300053080 Ga0500635_0048894 Ga0500635_0048894_79_1092 328
589 3300006194 Ga0075427_10001215 Ga0075427_100012153 329
590 3300006844 Ga0075428_100003032 Ga0075428_10000303212 329
591 3300006846 Ga0075430_100000587 Ga0075430_10000058720 329
592 3300006847 Ga0075431_100006439 Ga0075431_10000643910 329
593 3300006852 Ga0075433_10000020 Ga0075433_1000002028 329
594 3300006871 Ga0075434_100002124 Ga0075434_10000212416 329
595 3300006880 Ga0075429_100001660 Ga0075429_10000166010 329
596 3300007076 Ga0075435_100010428 Ga0075435_1000104287 329
597 3300009094 Ga0111539_10000373 Ga0111539_1000037345 329
598 3300009147 Ga0114129_10014462 Ga0114129_100144624 329
599 3300027907 Ga0207428_10000172 Ga0207428_1000017262 329
600 3300031344 Ga0265316_10081309 Ga0265316_100813092 329
601 3300034820 Ga0373959_0001299 Ga0373959_0001299_210_1223 329
602 3300046460 Ga0495638_0031470 Ga0495638_0031470_1010_2026 329
603 3300050507 nmdc:mga05p37_102_c1 nmdc:mga05p37_102_c1_51231_52244 329
604 3300050508 nmdc:mga09592_716_c1 nmdc:mga09592_716_c1_11572_12585 329
605 3300050509 nmdc:mga0qj67_119_c1 nmdc:mga0qj67_119_c1_11989_13002 329
606 3300050510 nmdc:mga06r32_2969_c1 nmdc:mga06r32_2969_c1_6679_7692 329
607 3300050511 nmdc:mga08y16_2739_c1 nmdc:mga08y16_2739_c1_9092_10105 329
608 3300050512 nmdc:mga0n895_5083_c1 nmdc:mga0n895_5083_c1_1901_2914 329
609 3300050513 nmdc:mga0rr50_494_c1 nmdc:mga0rr50_494_c1_14954_15967 329
610 3300050514 nmdc:mga08x19_209506_c1 nmdc:mga08x19_209506_c1_46_1059 329
611 3300050515 nmdc:mga0a205_427_c1 nmdc:mga0a205_427_c1_967_1980 329
612 3300053142 Ga0500577_0009138 Ga0500577_0009138_458_1474 329
613 3300053158 Ga0500627_0055269 Ga0500627_0055269_278_1294 329
614 2209111006 2214778551 2213800525 330
615 3300000041 ARcpr5oldR_c000028 ARcpr5oldR_00002816 330
616 3300000042 ARSoilYngRDRAFT_c00197 ARSoilYngRDRAFT_001974 330
617 3300000043 ARcpr5yngRDRAFT_c000089 ARcpr5yngRDRAFT_00008912 330
618 3300000044 ARSoilOldRDRAFT_c000023 ARSoilOldRDRAFT_00002315 330
619 3300000045 ARCol0oldRDRAFT_c01094 ARCol0oldRDRAFT_010941 330
620 3300000652 ARCol0yngRDRAFT_1000216 ARCol0yngRDRAFT_10002169 330
621 3300001989 JGI24739J22299_10001754 JGI24739J22299_100017542 330
622 3300001990 JGI24737J22298_10001842 JGI24737J22298_100018424 330
623 3300001990 JGI24737J22298_10002044 JGI24737J22298_100020445 330
624 3300002070 JGI24750J21931_1000257 JGI24750J21931_10002574 330
625 3300002073 JGI24745J21846_1001091 JGI24745J21846_10010913 330
626 3300002075 JGI24738J21930_10009098 JGI24738J21930_100090983 330
627 3300002076 JGI24749J21850_1001489 JGI24749J21850_10014892 330
628 3300002126 JGI24035J26624_1000791 JGI24035J26624_10007912 330
629 3300002239 JGI24034J26672_10001294 JGI24034J26672_100012942 330
630 3300003911 JGI25405J52794_10005877 JGI25405J52794_100058772 330
631 3300005290 Ga0065712_10001370 Ga0065712_100013704 330
632 3300005290 Ga0065712_10087769 Ga0065712_100877691 330
633 3300005293 Ga0065715_10002415 Ga0065715_100024155 330
634 3300005293 Ga0065715_10093203 Ga0065715_100932034 330
635 3300005295 Ga0065707_10099628 Ga0065707_100996283 330
636 3300005328 Ga0070676_10001404 Ga0070676_1000140410 330
637 3300005329 Ga0070683_100000144 Ga0070683_10000014431 330
638 3300005329 Ga0070683_100040784 Ga0070683_1000407845 330
639 3300005330 Ga0070690_100079728 Ga0070690_1000797282 330
640 3300005330 Ga0070690_100120776 Ga0070690_1001207762 330
641 3300005331 Ga0070670_100000437 Ga0070670_1000004372 330
642 3300005333 Ga0070677_10001605 Ga0070677_100016054 330
643 3300005334 Ga0068869_100000035 Ga0068869_1000000355 330
644 3300005335 Ga0070666_10006608 Ga0070666_100066085 330
645 3300005336 Ga0070680_100011476 Ga0070680_1000114763 330
646 3300005336 Ga0070680_100066115 Ga0070680_1000661153 330
647 3300005336 Ga0070680_100131070 Ga0070680_1001310702 330
648 3300005336 Ga0070680_100289734 Ga0070680_1002897341 330
649 3300005337 Ga0070682_100001374 Ga0070682_10000137412 330
650 3300005337 Ga0070682_100088267 Ga0070682_1000882673 330
651 3300005337 Ga0070682_100168894 Ga0070682_1001688942 330
652 3300005338 Ga0068868_100033171 Ga0068868_1000331714 330
653 3300005339 Ga0070660_100128375 Ga0070660_1001283752 330
654 3300005340 Ga0070689_100004784 Ga0070689_1000047849 330
655 3300005341 Ga0070691_10000856 Ga0070691_100008562 330
656 3300005341 Ga0070691_10037037 Ga0070691_100370372 330
657 3300005343 Ga0070687_100000558 Ga0070687_10000055811 330
658 3300005344 Ga0070661_100000017 Ga0070661_10000001716 330
659 3300005344 Ga0070661_100158977 Ga0070661_1001589772 330
660 3300005345 Ga0070692_10000008 Ga0070692_1000000816 330
661 3300005347 Ga0070668_100000699 Ga0070668_1000006992 330
662 3300005353 Ga0070669_100000250 Ga0070669_10000025032 330
663 3300005354 Ga0070675_100001268 Ga0070675_10000126811 330
664 3300005355 Ga0070671_100010911 Ga0070671_1000109118 330
665 3300005355 Ga0070671_100149160 Ga0070671_1001491602 330
666 3300005356 Ga0070674_100000443 Ga0070674_1000004438 330
667 3300005365 Ga0070688_100000669 Ga0070688_10000066915 330
668 3300005365 Ga0070688_100039934 Ga0070688_1000399343 330
669 3300005366 Ga0070659_100000214 Ga0070659_10000021434 330
670 3300005367 Ga0070667_100142337 Ga0070667_1001423372 330
671 3300005406 Ga0070703_10006816 Ga0070703_100068163 330
672 3300005434 Ga0070709_10080195 Ga0070709_100801953 330
673 3300005434 Ga0070709_10294034 Ga0070709_102940341 330
674 3300005435 Ga0070714_100169471 Ga0070714_1001694712 330
675 3300005436 Ga0070713_100000889 Ga0070713_10000088918 330
676 3300005436 Ga0070713_100120844 Ga0070713_1001208442 330
677 3300005437 Ga0070710_10007734 Ga0070710_100077346 330
678 3300005438 Ga0070701_10000099 Ga0070701_1000009911 330
679 3300005439 Ga0070711_100086439 Ga0070711_1000864393 330
680 3300005439 Ga0070711_100112898 Ga0070711_1001128982 330
681 3300005439 Ga0070711_100330665 Ga0070711_1003306652 330
682 3300005440 Ga0070705_100082098 Ga0070705_1000820982 330
683 3300005441 Ga0070700_100021932 Ga0070700_1000219324 330
684 3300005441 Ga0070700_100077093 Ga0070700_1000770933 330
685 3300005444 Ga0070694_100035517 Ga0070694_1000355172 330
686 3300005455 Ga0070663_100000201 Ga0070663_10000020121 330
687 3300005455 Ga0070663_100018330 Ga0070663_1000183304 330
688 3300005455 Ga0070663_100141160 Ga0070663_1001411602 330
689 3300005456 Ga0070678_100000698 Ga0070678_10000069813 330
690 3300005457 Ga0070662_100009421 Ga0070662_1000094217 330
691 3300005457 Ga0070662_100091430 Ga0070662_1000914302 330
692 3300005458 Ga0070681_10000401 Ga0070681_1000040133 330
693 3300005458 Ga0070681_10136429 Ga0070681_101364292 330
694 3300005459 Ga0068867_100019105 Ga0068867_1000191054 330
695 3300005459 Ga0068867_100079393 Ga0068867_1000793932 330
696 3300005459 Ga0068867_100267334 Ga0068867_1002673342 330
697 3300005530 Ga0070679_100059355 Ga0070679_1000593555 330
698 3300005530 Ga0070679_100096460 Ga0070679_1000964602 330
699 3300005535 Ga0070684_100013364 Ga0070684_1000133643 330
700 3300005535 Ga0070684_100026194 Ga0070684_1000261944 330
701 3300005535 Ga0070684_100037443 Ga0070684_1000374433 330
702 3300005539 Ga0068853_100021340 Ga0068853_1000213403 330
703 3300005539 Ga0068853_100142299 Ga0068853_1001422992 330
704 3300005543 Ga0070672_100002749 Ga0070672_1000027493 330
705 3300005544 Ga0070686_100001254 Ga0070686_1000012543 330
706 3300005544 Ga0070686_100054001 Ga0070686_1000540012 330
707 3300005545 Ga0070695_100012651 Ga0070695_1000126512 330
708 3300005545 Ga0070695_100013109 Ga0070695_1000131093 330
709 3300005546 Ga0070696_100000304 Ga0070696_10000030428 330
710 3300005546 Ga0070696_100014702 Ga0070696_1000147024 330
711 3300005546 Ga0070696_100077658 Ga0070696_1000776582 330
712 3300005546 Ga0070696_100113480 Ga0070696_1001134802 330
713 3300005547 Ga0070693_100079312 Ga0070693_1000793122 330
714 3300005563 Ga0068855_100024209 Ga0068855_1000242097 330
715 3300005564 Ga0070664_100141250 Ga0070664_1001412502 330
716 3300005564 Ga0070664_100298093 Ga0070664_1002980932 330
717 3300005577 Ga0068857_100000494 Ga0068857_10000049422 330
718 3300005578 Ga0068854_100000139 Ga0068854_10000013929 330
719 3300005578 Ga0068854_100032879 Ga0068854_1000328792 330
720 3300005614 Ga0068856_100001571 Ga0068856_10000157111 330
721 3300005615 Ga0070702_100001018 Ga0070702_10000101811 330
722 3300005616 Ga0068852_100000193 Ga0068852_10000019333 330
723 3300005617 Ga0068859_100004926 Ga0068859_10000492612 330
724 3300005618 Ga0068864_100000226 Ga0068864_1000002269 330
725 3300005718 Ga0068866_10030148 Ga0068866_100301482 330
726 3300005719 Ga0068861_100000328 Ga0068861_10000032813 330
727 3300005719 Ga0068861_100091989 Ga0068861_1000919892 330
728 3300005834 Ga0068851_10017494 Ga0068851_100174944 330
729 3300005840 Ga0068870_10041901 Ga0068870_100419012 330
730 3300005841 Ga0068863_100001214 Ga0068863_10000121415 330
731 3300005842 Ga0068858_100005931 Ga0068858_1000059313 330
732 3300005842 Ga0068858_100430500 Ga0068858_1004305002 330
733 3300005843 Ga0068860_100001525 Ga0068860_1000015252 330
734 3300005844 Ga0068862_100117504 Ga0068862_1001175042 330
735 3300005937 Ga0081455_10000035 Ga0081455_1000003556 330
736 3300005937 Ga0081455_10020443 Ga0081455_100204433 330
737 3300006028 Ga0070717_10029796 Ga0070717_100297962 330
738 3300006173 Ga0070716_100123844 Ga0070716_1001238442 330
739 3300006175 Ga0070712_100018658 Ga0070712_1000186584 330
740 3300006178 Ga0075367_10071105 Ga0075367_100711052 330
741 3300006237 Ga0097621_100000049 Ga0097621_10000004934 330
742 3300006358 Ga0068871_100000097 Ga0068871_1000000979 330
743 3300006358 Ga0068871_100012551 Ga0068871_1000125518 330
744 3300006358 Ga0068871_100314907 Ga0068871_1003149072 330
745 3300006852 Ga0075433_10022455 Ga0075433_100224552 330
746 3300006871 Ga0075434_100000383 Ga0075434_10000038329 330
747 3300006871 Ga0075434_100170341 Ga0075434_1001703412 330
748 3300006881 Ga0068865_100000119 Ga0068865_10000011911 330
749 3300006914 Ga0075436_100291853 Ga0075436_1002918531 330
750 3300006931 Ga0097620_100004926 Ga0097620_1000049262 330
751 3300007076 Ga0075435_100086474 Ga0075435_1000864743 330
752 3300009093 Ga0105240_10043010 Ga0105240_100430104 330
753 3300009093 Ga0105240_10142934 Ga0105240_101429342 330
754 3300009094 Ga0111539_10000237 Ga0111539_1000023736 330
755 3300009094 Ga0111539_10039849 Ga0111539_100398493 330
756 3300009094 Ga0111539_10119492 Ga0111539_101194923 330
757 3300009098 Ga0105245_10000202 Ga0105245_1000020236 330
758 3300009098 Ga0105245_10059377 Ga0105245_100593773 330
759 3300009101 Ga0105247_10006779 Ga0105247_100067798 330
760 3300009101 Ga0105247_10043825 Ga0105247_100438253 330
761 3300009101 Ga0105247_10061305 Ga0105247_100613052 330
762 3300009148 Ga0105243_10002106 Ga0105243_100021064 330
763 3300009148 Ga0105243_10079714 Ga0105243_100797143 330
764 3300009148 Ga0105243_10133051 Ga0105243_101330512 330
765 3300009174 Ga0105241_10000430 Ga0105241_100004302 330
766 3300009174 Ga0105241_10034348 Ga0105241_100343483 330
767 3300009174 Ga0105241_10390499 Ga0105241_103904992 330
768 3300009176 Ga0105242_10003639 Ga0105242_1000363911 330
769 3300009176 Ga0105242_10335081 Ga0105242_103350812 330
770 3300009177 Ga0105248_10023208 Ga0105248_100232086 330
771 3300009177 Ga0105248_10095373 Ga0105248_100953732 330
772 3300009545 Ga0105237_10028031 Ga0105237_100280314 330
773 3300009545 Ga0105237_10059994 Ga0105237_100599943 330
774 3300009545 Ga0105237_10085558 Ga0105237_100855582 330
775 3300009553 Ga0105249_10000215 Ga0105249_1000021534 330
776 3300009553 Ga0105249_10031327 Ga0105249_100313272 330
777 3300010375 Ga0105239_10015015 Ga0105239_100150154 330
778 3300010375 Ga0105239_10054877 Ga0105239_100548774 330
779 3300010375 Ga0105239_10263627 Ga0105239_102636272 330
780 3300011119 Ga0105246_10000019 Ga0105246_1000001944 330
781 3300012481 Ga0157320_1001286 Ga0157320_10012862 330
782 3300012507 Ga0157342_1002013 Ga0157342_10020132 330
783 3300013102 Ga0157371_10085937 Ga0157371_100859372 330
784 3300013296 Ga0157374_10039059 Ga0157374_100390593 330
785 3300013297 Ga0157378_10003335 Ga0157378_1000333514 330
786 3300013297 Ga0157378_10127694 Ga0157378_101276942 330
787 3300013306 Ga0163162_10013606 Ga0163162_100136063 330
788 3300013306 Ga0163162_10027382 Ga0163162_100273822 330
789 3300013306 Ga0163162_10238685 Ga0163162_102386852 330
790 3300013306 Ga0163162_10448923 Ga0163162_104489232 330
791 3300013307 Ga0157372_10110740 Ga0157372_101107402 330
792 3300013307 Ga0157372_10179250 Ga0157372_101792503 330
793 3300013307 Ga0157372_10236654 Ga0157372_102366542 330
794 3300013308 Ga0157375_10004516 Ga0157375_100045165 330
795 3300013308 Ga0157375_10081858 Ga0157375_100818583 330
796 3300014325 Ga0163163_10025278 Ga0163163_100252783 330
797 3300014325 Ga0163163_10148262 Ga0163163_101482622 330
798 3300014326 Ga0157380_10003569 Ga0157380_100035693 330
799 3300014326 Ga0157380_10067440 Ga0157380_100674402 330
800 3300014745 Ga0157377_10000507 Ga0157377_1000050713 330
801 3300014745 Ga0157377_10136276 Ga0157377_101362762 330
802 3300014968 Ga0157379_10000065 Ga0157379_1000006544 330
803 3300014968 Ga0157379_10023744 Ga0157379_100237445 330
804 3300014968 Ga0157379_10106227 Ga0157379_101062272 330
805 3300014968 Ga0157379_10141086 Ga0157379_101410862 330
806 3300014969 Ga0157376_10190298 Ga0157376_101902982 330
807 3300025271 Ga0207666_1000278 Ga0207666_10002785 330
808 3300025290 Ga0207673_1000135 Ga0207673_10001357 330
809 3300025315 Ga0207697_10000287 Ga0207697_1000028732 330
810 3300025315 Ga0207697_10012481 Ga0207697_100124814 330
811 3300025893 Ga0207682_10000437 Ga0207682_100004374 330
812 3300025898 Ga0207692_10022895 Ga0207692_100228952 330
813 3300025898 Ga0207692_10051741 Ga0207692_100517413 330
814 3300025899 Ga0207642_10000268 Ga0207642_1000026814 330
815 3300025900 Ga0207710_10050960 Ga0207710_100509602 330
816 3300025901 Ga0207688_10000014 Ga0207688_1000001441 330
817 3300025903 Ga0207680_10059057 Ga0207680_100590572 330
818 3300025906 Ga0207699_10016704 Ga0207699_100167043 330
819 3300025906 Ga0207699_10111005 Ga0207699_101110052 330
820 3300025906 Ga0207699_10114665 Ga0207699_101146652 330
821 3300025907 Ga0207645_10000160 Ga0207645_1000016025 330
822 3300025907 Ga0207645_10018769 Ga0207645_100187692 330
823 3300025907 Ga0207645_10083440 Ga0207645_100834402 330
824 3300025908 Ga0207643_10000009 Ga0207643_10000009168 330
825 3300025911 Ga0207654_10203483 Ga0207654_102034832 330
826 3300025912 Ga0207707_10000554 Ga0207707_100005547 330
827 3300025913 Ga0207695_10055352 Ga0207695_100553524 330
828 3300025913 Ga0207695_10182322 Ga0207695_101823222 330
829 3300025915 Ga0207693_10011540 Ga0207693_100115405 330
830 3300025915 Ga0207693_10026066 Ga0207693_100260662 330
831 3300025915 Ga0207693_10042033 Ga0207693_100420335 330
832 3300025915 Ga0207693_10072874 Ga0207693_100728742 330
833 3300025916 Ga0207663_10127841 Ga0207663_101278412 330
834 3300025917 Ga0207660_10000347 Ga0207660_100003472 330
835 3300025917 Ga0207660_10094631 Ga0207660_100946313 330
836 3300025917 Ga0207660_10123744 Ga0207660_101237442 330
837 3300025918 Ga0207662_10000130 Ga0207662_1000013039 330
838 3300025918 Ga0207662_10084999 Ga0207662_100849991 330
839 3300025919 Ga0207657_10000980 Ga0207657_1000098017 330
840 3300025919 Ga0207657_10015897 Ga0207657_100158975 330
841 3300025920 Ga0207649_10006224 Ga0207649_100062243 330
842 3300025920 Ga0207649_10232726 Ga0207649_102327262 330
843 3300025921 Ga0207652_10000364 Ga0207652_1000036419 330
844 3300025921 Ga0207652_10027928 Ga0207652_100279282 330
845 3300025921 Ga0207652_10197563 Ga0207652_101975632 330
846 3300025923 Ga0207681_10000035 Ga0207681_1000003539 330
847 3300025926 Ga0207659_10000027 Ga0207659_1000002799 330
848 3300025927 Ga0207687_10000556 Ga0207687_1000055626 330
849 3300025927 Ga0207687_10025653 Ga0207687_100256533 330
850 3300025928 Ga0207700_10002968 Ga0207700_100029682 330
851 3300025928 Ga0207700_10028689 Ga0207700_100286893 330
852 3300025932 Ga0207690_10000056 Ga0207690_1000005676 330
853 3300025933 Ga0207706_10000307 Ga0207706_1000030725 330
854 3300025933 Ga0207706_10026539 Ga0207706_100265392 330
855 3300025933 Ga0207706_10395560 Ga0207706_103955602 330
856 3300025934 Ga0207686_10007325 Ga0207686_100073253 330
857 3300025935 Ga0207709_10000087 Ga0207709_1000008741 330
858 3300025936 Ga0207670_10000640 Ga0207670_100006409 330
859 3300025936 Ga0207670_10090367 Ga0207670_100903672 330
860 3300025937 Ga0207669_10000052 Ga0207669_1000005226 330
861 3300025937 Ga0207669_10045066 Ga0207669_100450663 330
862 3300025937 Ga0207669_10154765 Ga0207669_101547652 330
863 3300025938 Ga0207704_10000063 Ga0207704_1000006336 330
864 3300025938 Ga0207704_10139850 Ga0207704_101398502 330
865 3300025940 Ga0207691_10000167 Ga0207691_1000016725 330
866 3300025941 Ga0207711_10001619 Ga0207711_1000161912 330
867 3300025941 Ga0207711_10074947 Ga0207711_100749473 330
868 3300025941 Ga0207711_10209112 Ga0207711_102091122 330
869 3300025941 Ga0207711_10231960 Ga0207711_102319602 330
870 3300025942 Ga0207689_10000155 Ga0207689_1000015539 330
871 3300025944 Ga0207661_10000072 Ga0207661_1000007251 330
872 3300025945 Ga0207679_10000057 Ga0207679_1000005770 330
873 3300025961 Ga0207712_10000122 Ga0207712_1000012239 330
874 3300025961 Ga0207712_10027485 Ga0207712_100274853 330
875 3300025961 Ga0207712_10071730 Ga0207712_100717303 330
876 3300025972 Ga0207668_10000084 Ga0207668_1000008445 330
877 3300025972 Ga0207668_10038479 Ga0207668_100384792 330
878 3300025981 Ga0207640_10001119 Ga0207640_100011194 330
879 3300025986 Ga0207658_10003175 Ga0207658_100031758 330
880 3300026023 Ga0207677_10000549 Ga0207677_100005494 330
881 3300026035 Ga0207703_10089838 Ga0207703_100898382 330
882 3300026035 Ga0207703_10161007 Ga0207703_101610072 330
883 3300026035 Ga0207703_10293696 Ga0207703_102936962 330
884 3300026041 Ga0207639_10002231 Ga0207639_100022314 330
885 3300026041 Ga0207639_10190382 Ga0207639_101903822 330
886 3300026067 Ga0207678_10000187 Ga0207678_1000018725 330
887 3300026067 Ga0207678_10060604 Ga0207678_100606043 330
888 3300026075 Ga0207708_10000158 Ga0207708_1000015825 330
889 3300026075 Ga0207708_10015344 Ga0207708_100153445 330
890 3300026078 Ga0207702_10009588 Ga0207702_100095884 330
891 3300026088 Ga0207641_10004012 Ga0207641_1000401212 330
892 3300026088 Ga0207641_10169494 Ga0207641_101694942 330
893 3300026089 Ga0207648_10001167 Ga0207648_100011675 330
894 3300026095 Ga0207676_10000089 Ga0207676_1000008939 330
895 3300026116 Ga0207674_10001478 Ga0207674_1000147825 330
896 3300026118 Ga0207675_100000229 Ga0207675_10000022925 330
897 3300026121 Ga0207683_10015823 Ga0207683_100158232 330
898 3300026142 Ga0207698_10008027 Ga0207698_100080277 330
899 3300027617 Ga0210002_1009797 Ga0210002_10097972 330
900 3300027665 Ga0209983_1008764 Ga0209983_10087642 330
901 3300027695 Ga0209966_1008159 Ga0209966_10081592 330
902 3300027717 Ga0209998_10001281 Ga0209998_100012813 330
903 3300027876 Ga0209974_10011045 Ga0209974_100110452 330
904 3300027907 Ga0207428_10000037 Ga0207428_1000003763 330
905 3300027907 Ga0207428_10170483 Ga0207428_101704832 330
906 3300028379 Ga0268266_10024070 Ga0268266_100240703 330
907 3300028380 Ga0268265_10000195 Ga0268265_1000019516 330
908 3300028380 Ga0268265_10057224 Ga0268265_100572243 330
909 3300031241 Ga0265325_10000025 Ga0265325_1000002578 330
910 3300034816 Ga0373930_0003621 Ga0373930_0003621_266_1279 330
911 3300034817 Ga0373948_0000063 Ga0373948_0000063_545_1558 330
912 3300034817 Ga0373948_0001356 Ga0373948_0001356_1494_2507 330
913 3300034817 Ga0373948_0004636 Ga0373948_0004636_150_1163 330
914 3300034818 Ga0373950_0001407 Ga0373950_0001407_141_1154 330
915 3300034819 Ga0373958_0000880 Ga0373958_0000880_1700_2713 330
916 3300034820 Ga0373959_0000720 Ga0373959_0000720_4329_5342 330
917 3300034957 Ga0373938_0000709 Ga0373938_0000709_934_1947 330
918 3300034957 Ga0373938_0002401 Ga0373938_0002401_1524_2537 330
919 3300035083 Ga0373926_0000002 Ga0373926_0000002_8856_9869 330
920 3300035083 Ga0373926_0036051 Ga0373926_0036051_552_1568 330
921 3300035084 Ga0373928_0001013 Ga0373928_0001013_362_1375 330
922 3300035086 Ga0373934_0027576 Ga0373934_0027576_867_1883 330
923 3300035086 Ga0373934_0067049 Ga0373934_0067049_224_1237 330
924 3300035088 Ga0373940_0000150 Ga0373940_0000150_1677_2690 330
925 3300035088 Ga0373940_0002381 Ga0373940_0002381_921_1934 330
926 3300035089 Ga0373944_0000048 Ga0373944_0000048_4743_5756 330
927 3300035090 Ga0373949_0001637 Ga0373949_0001637_919_1932 330
928 3300035091 Ga0373951_0000729 Ga0373951_0000729_4274_5287 330
929 3300035091 Ga0373951_0002183 Ga0373951_0002183_3469_4482 330
930 3300035091 Ga0373951_0011908 Ga0373951_0011908_604_1617 330
931 3300035092 Ga0373952_0000170 Ga0373952_0000170_7608_8621 330
932 3300035111 Ga0373923_0000329 Ga0373923_0000329_1961_2974 330
933 3300035112 Ga0373932_0000475 Ga0373932_0000475_4470_5483 330
934 3300035112 Ga0373932_0004768 Ga0373932_0004768_264_1277 330
935 3300035113 Ga0373936_0000294 Ga0373936_0000294_10551_11564 330
936 3300035113 Ga0373936_0029273 Ga0373936_0029273_517_1533 330
937 3300035114 Ga0373939_0000360 Ga0373939_0000360_393_1406 330
938 3300035114 Ga0373939_0002626 Ga0373939_0002626_767_1780 330
939 3300035115 Ga0373941_0001632 Ga0373941_0001632_489_1502 330
940 3300035115 Ga0373941_0001926 Ga0373941_0001926_2543_3556 330
941 3300035116 Ga0373945_0000229 Ga0373945_0000229_11391_12404 330
942 3300035116 Ga0373945_0017503 Ga0373945_0017503_718_1734 330
943 3300035118 Ga0373954_0007246 Ga0373954_0007246_34_1047 330
944 3300035119 Ga0373956_0002040 Ga0373956_0002040_931_1944 330
945 3300035119 Ga0373956_0002776 Ga0373956_0002776_2115_3131 330
946 3300035121 Ga0373960_0001914 Ga0373960_0001914_210_1223 330
947 3300035170 Ga0373943_0010040 Ga0373943_0010040_2822_3835 330
948 3300035170 Ga0373943_0035046 Ga0373943_0035046_58_1074 330
949 3300035171 Ga0373946_0010279 Ga0373946_0010279_2165_3178 330
950 3300035171 Ga0373946_0021423 Ga0373946_0021423_1375_2391 330
951 3300035172 Ga0373955_0001108 Ga0373955_0001108_10148_11161 330
952 3300035172 Ga0373955_0010682 Ga0373955_0010682_2509_3525 330
953 3300035172 Ga0373955_0155450 Ga0373955_0155450_282_1298 330
954 3300035207 Ga0373942_0001717 Ga0373942_0001717_820_1833 330
955 3300035241 Ga0373961_0002411 Ga0373961_0002411_1303_2316 330
956 3300035241 Ga0373961_0018064 Ga0373961_0018064_375_1388 330
957 3300035242 Ga0373962_0000682 Ga0373962_0000682_3738_4751 330
958 3300035691 Ga0373931_0000082 Ga0373931_0000082_22255_23268 330
959 3300035691 Ga0373931_0021215 Ga0373931_0021215_83_1096 330
960 3300035691 Ga0373931_0079083 Ga0373931_0079083_520_1533 330
961 3300035692 Ga0373935_0017917 Ga0373935_0017917_284_1297 330
962 3300035692 Ga0373935_0025526 Ga0373935_0025526_2237_3250 330
963 3300035695 Ga0373927_0012717 Ga0373927_0012717_1155_2168 330
964 3300035724 Ga0373933_0004823 Ga0373933_0004823_4183_5196 330
965 3300035724 Ga0373933_0011958 Ga0373933_0011958_3114_4130 330
966 3300035724 Ga0373933_0083697 Ga0373933_0083697_860_1876 330
967 3300035725 Ga0373947_0003242 Ga0373947_0003242_5676_6689 330
968 3300035725 Ga0373947_0223803 Ga0373947_0223803_76_1089 330
969 3300036401 Ga0373937_0001536 Ga0373937_0001536_6600_7613 330
970 3300036401 Ga0373937_0002909 Ga0373937_0002909_8115_9131 330
971 3300037068 Ga0373925_0001065 Ga0373925_0001065_19897_20910 330
972 3300037068 Ga0373925_0063161 Ga0373925_0063161_505_1518 330
973 3300037068 Ga0373925_0091160 Ga0373925_0091160_40_1056 330
974 3300037068 Ga0373925_0120338 Ga0373925_0120338_237_1253 330
975 3300038996 Ga0242420_007484 Ga0242420_007484_504_1517 330
976 3300042001 Ga0439441_017869 Ga0439441_017869_145_1158 330
977 3300042008 Ga0439450_005184 Ga0439450_005184_491_1504 330
978 3300042012 Ga0439455_0019453 Ga0439455_0019453_67_1080 330
979 3300042876 Ga0451577_0046357 Ga0451577_0046357_922_1935 330
980 3300045051 Ga0451576_0024813 Ga0451576_0024813_4478_5491 330
981 3300046452 Ga0495617_007534 Ga0495617_007534_2200_3213 330
982 3300046454 Ga0495592_0000766 Ga0495592_0000766_5155_6168 330
983 3300046454 Ga0495592_0140235 Ga0495592_0140235_52_1068 330
984 3300046455 Ga0495603_0079883 Ga0495603_0079883_407_1420 330
985 3300046455 Ga0495603_0122000 Ga0495603_0122000_256_1269 330
986 3300046459 Ga0495629_0001979 Ga0495629_0001979_9462_10475 330
987 3300046459 Ga0495629_0036597 Ga0495629_0036597_2039_3052 330
988 3300046459 Ga0495629_0067753 Ga0495629_0067753_13_1029 330
989 3300046461 Ga0495641_0000380 Ga0495641_0000380_14252_15265 330
990 3300046462 Ga0495651_0000929 Ga0495651_0000929_10337_11350 330
991 3300046462 Ga0495651_0001721 Ga0495651_0001721_13099_14115 330
992 3300046462 Ga0495651_0032645 Ga0495651_0032645_771_1787 330
993 3300046463 Ga0495653_0000209 Ga0495653_0000209_33901_34914 330
994 3300046463 Ga0495653_0026185 Ga0495653_0026185_489_1505 330
995 3300046472 Ga0495580_0004313 Ga0495580_0004313_7941_8954 330
996 3300046473 Ga0495582_0001370 Ga0495582_0001370_10553_11566 330
997 3300046473 Ga0495582_0005359 Ga0495582_0005359_860_1873 330
998 3300046473 Ga0495582_0045180 Ga0495582_0045180_631_1647 330
999 3300046475 Ga0495639_0001523 Ga0495639_0001523_2464_3477 330
1000 3300046476 Ga0495662_0000197 Ga0495662_0000197_21654_22667 330
1001 3300046477 Ga0495664_0045914 Ga0495664_0045914_608_1624 330
1002 3300046492 Ga0495585_0001361 Ga0495585_0001361_13204_14217 330
1003 3300046499 Ga0495594_0015737 Ga0495594_0015737_1902_2915 330
1004 3300046499 Ga0495594_0111878 Ga0495594_0111878_264_1277 330
1005 3300046501 Ga0495607_0003799 Ga0495607_0003799_8107_9120 330
1006 3300046511 Ga0495608_0001204 Ga0495608_0001204_5803_6816 330
1007 3300046511 Ga0495608_0007880 Ga0495608_0007880_4104_5120 330
1008 3300046514 Ga0495618_0004273 Ga0495618_0004273_6696_7709 330
1009 3300046514 Ga0495618_0107713 Ga0495618_0107713_404_1420 330
1010 3300046516 Ga0495628_0001791 Ga0495628_0001791_6694_7707 330
1011 3300046516 Ga0495628_0008193 Ga0495628_0008193_4831_5847 330
1012 3300046516 Ga0495628_0048331 Ga0495628_0048331_1695_2711 330
1013 3300046517 Ga0495630_0003296 Ga0495630_0003296_4520_5533 330
1014 3300046517 Ga0495630_0016592 Ga0495630_0016592_3732_4748 330
1015 3300046526 Ga0495666_0000462 Ga0495666_0000462_15298_16311 330
1016 3300046526 Ga0495666_0014951 Ga0495666_0014951_980_1996 330
1017 3300046529 Ga0495652_0205483 Ga0495652_0205483_99_1115 330
1018 3300046531 Ga0495665_0013406 Ga0495665_0013406_3008_4021 330
1019 3300046533 Ga0495640_0082886 Ga0495640_0082886_859_1875 330
1020 3300046533 Ga0495640_0108325 Ga0495640_0108325_426_1442 330
1021 3300046535 Ga0495586_0001093 Ga0495586_0001093_4317_5330 330
1022 3300046535 Ga0495586_0009710 Ga0495586_0009710_2558_3574 330
1023 3300046536 Ga0495587_0000604 Ga0495587_0000604_12391_13407 330
1024 3300046536 Ga0495587_0002926 Ga0495587_0002926_3843_4856 330
1025 3300046538 Ga0495609_0035685 Ga0495609_0035685_1148_2161 330
1026 3300046557 Ga0495622_0001441 Ga0495622_0001441_255_1268 330
1027 3300046558 Ga0495633_0015044 Ga0495633_0015044_1847_2860 330
1028 3300046559 Ga0495667_0002395 Ga0495667_0002395_7899_8915 330
1029 3300046559 Ga0495667_0003934 Ga0495667_0003934_5708_6721 330
1030 3300046615 Ga0495656_0000553 Ga0495656_0000553_8131_9144 330
1031 3300046663 Ga0495635_0010999 Ga0495635_0010999_5224_6237 330
1032 3300046663 Ga0495635_0070427 Ga0495635_0070427_884_1900 330
1033 3300046664 Ga0495659_0002101 Ga0495659_0002101_2327_3340 330
1034 3300046665 Ga0495661_0065836 Ga0495661_0065836_584_1597 330
1035 3300046674 Ga0495588_0000313 Ga0495588_0000313_28317_29330 330
1036 3300046674 Ga0495588_0017173 Ga0495588_0017173_732_1748 330
1037 3300046675 Ga0495657_0062003 Ga0495657_0062003_1198_2214 330
1038 3300046678 Ga0495599_0000261 Ga0495599_0000261_5547_6560 330
1039 3300046678 Ga0495599_0108531 Ga0495599_0108531_62_1078 330
1040 3300046679 Ga0495623_0067807 Ga0495623_0067807_388_1404 330
1041 3300046680 Ga0495646_0000800 Ga0495646_0000800_6959_7972 330
1042 3300046681 Ga0495647_0001490 Ga0495647_0001490_2823_3836 330
1043 3300046681 Ga0495647_0022808 Ga0495647_0022808_319_1332 330
1044 3300046683 Ga0495658_0001933 Ga0495658_0001933_8045_9058 330
1045 3300046683 Ga0495658_0018886 Ga0495658_0018886_412_1425 330
1046 3300046689 Ga0495613_0002928 Ga0495613_0002928_7716_8729 330
1047 3300046689 Ga0495613_0006502 Ga0495613_0006502_5095_6108 330
1048 3300046690 Ga0495624_0006114 Ga0495624_0006114_4064_5077 330
1049 3300046691 Ga0495670_0008663 Ga0495670_0008663_2314_3327 330
1050 3300046809 Ga0495600_0000309 Ga0495600_0000309_19676_20689 330
1051 3300046809 Ga0495600_0001591 Ga0495600_0001591_3687_4703 330
1052 3300047315 Ga0495581_0001406 Ga0495581_0001406_7019_8032 330
1053 3300047317 Ga0495604_0003597 Ga0495604_0003597_2121_3137 330
1054 3300047317 Ga0495604_0042374 Ga0495604_0042374_301_1317 330
1055 3300047319 Ga0495674_0020806 Ga0495674_0020806_3044_4057 330
1056 3300047321 Ga0495676_0021514 Ga0495676_0021514_2152_3165 330
1057 3300047321 Ga0495676_0141704 Ga0495676_0141704_657_1670 330
1058 3300047322 Ga0495680_0001830 Ga0495680_0001830_18845_19861 330
1059 3300047322 Ga0495680_0002274 Ga0495680_0002274_17096_18109 330
1060 3300047322 Ga0495680_0020443 Ga0495680_0020443_2215_3231 330
1061 3300047322 Ga0495680_0058878 Ga0495680_0058878_216_1229 330
1062 3300047446 Ga0495679_017725 Ga0495679_017725_795_1808 330
1063 3300047471 Ga0495684_0000338 Ga0495684_0000338_5729_6742 330
1064 3300047673 Ga0495593_0000170 Ga0495593_0000170_19682_20695 330
1065 3300048088 Ga0495602_0002915 Ga0495602_0002915_2170_3186 330
1066 3300048089 Ga0495614_0000184 Ga0495614_0000184_16689_17702 330
1067 3300048089 Ga0495614_0082697 Ga0495614_0082697_126_1142 330
1068 3300048903 Ga0496100_0000189 Ga0496100_0000189_25360_26373 330
1069 3300048903 Ga0496100_0015415 Ga0496100_0015415_909_1922 330
1070 3300048904 Ga0496101_0000215 Ga0496101_0000215_6147_7160 330
1071 3300048904 Ga0496101_0026571 Ga0496101_0026571_2191_3207 330
1072 3300048904 Ga0496101_0059573 Ga0496101_0059573_982_1995 330
1073 3300048905 Ga0496102_0001555 Ga0496102_0001555_6147_7160 330
1074 3300048906 Ga0496103_0000191 Ga0496103_0000191_13585_14598 330
1075 3300048906 Ga0496103_0051584 Ga0496103_0051584_933_1946 330
1076 3300048907 Ga0496104_0000170 Ga0496104_0000170_12161_13177 330
1077 3300048907 Ga0496104_0049524 Ga0496104_0049524_1489_2502 330
1078 3300048907 Ga0496104_0290416 Ga0496104_0290416_348_1361 330
1079 3300048908 Ga0496105_0002931 Ga0496105_0002931_2795_3811 330
1080 3300048908 Ga0496105_0006803 Ga0496105_0006803_2450_3466 330
1081 3300048908 Ga0496105_0030995 Ga0496105_0030995_2542_3555 330
1082 3300048909 Ga0496106_0000190 Ga0496106_0000190_7942_8955 330
1083 3300048909 Ga0496106_0019239 Ga0496106_0019239_3913_4926 330
1084 3300048909 Ga0496106_0026457 Ga0496106_0026457_683_1699 330
1085 3300048909 Ga0496106_0144739 Ga0496106_0144739_817_1830 330
1086 3300048909 Ga0496106_0331159 Ga0496106_0331159_131_1144 330
1087 3300048910 Ga0496107_0000080 Ga0496107_0000080_30124_31137 330
1088 3300048910 Ga0496107_0012647 Ga0496107_0012647_346_1359 330
1089 3300048910 Ga0496107_0023716 Ga0496107_0023716_2171_3184 330
1090 3300048910 Ga0496107_0067884 Ga0496107_0067884_738_1754 330
1091 3300048910 Ga0496107_0108930 Ga0496107_0108930_500_1513 330
1092 3300048910 Ga0496107_0293323 Ga0496107_0293323_125_1138 330
1093 3300048911 Ga0496108_0023975 Ga0496108_0023975_3160_4173 330
1094 3300048911 Ga0496108_0076002 Ga0496108_0076002_1084_2097 330
1095 3300048911 Ga0496108_0077908 Ga0496108_0077908_479_1495 330
1096 3300048912 Ga0496109_0000737 Ga0496109_0000737_7911_8924 330
1097 3300048912 Ga0496109_0025231 Ga0496109_0025231_1968_2981 330
1098 3300048912 Ga0496109_0059327 Ga0496109_0059327_2400_3413 330
1099 3300048912 Ga0496109_0232398 Ga0496109_0232398_701_1717 330
1100 3300048912 Ga0496109_0330773 Ga0496109_0330773_216_1229 330
1101 3300048913 Ga0496110_0038526 Ga0496110_0038526_2173_3186 330
1102 3300048914 Ga0496111_0077613 Ga0496111_0077613_850_1863 330
1103 3300048914 Ga0496111_0101454 Ga0496111_0101454_805_1818 330
1104 3300048915 Ga0496112_0165771 Ga0496112_0165771_11_1024 330
1105 3300048915 Ga0496112_0165858 Ga0496112_0165858_910_1926 330
1106 3300048916 Ga0496113_0000721 Ga0496113_0000721_15552_16565 330
1107 3300048916 Ga0496113_0011762 Ga0496113_0011762_1694_2707 330
1108 3300048916 Ga0496113_0027156 Ga0496113_0027156_481_1494 330
1109 3300048916 Ga0496113_0117750 Ga0496113_0117750_210_1223 330
1110 3300048917 Ga0496114_0005702 Ga0496114_0005702_1623_2636 330
1111 3300048917 Ga0496114_0006768 Ga0496114_0006768_3783_4796 330
1112 3300048918 Ga0496115_0007097 Ga0496115_0007097_1139_2152 330
1113 3300048918 Ga0496115_0066247 Ga0496115_0066247_1775_2791 330
1114 3300048918 Ga0496115_0069353 Ga0496115_0069353_861_1874 330
1115 3300048918 Ga0496115_0109483 Ga0496115_0109483_677_1693 330
1116 3300049592 Ga0501076_0044755 Ga0501076_0044755_2365_3378 330
1117 3300049593 Ga0501077_0053699 Ga0501077_0053699_560_1573 330
1118 3300050494 nmdc:mga06z11_62988_c1 nmdc:mga06z11_62988_c1_190_1203 330
1119 3300050511 nmdc:mga08y16_1835_c1 nmdc:mga08y16_1835_c1_11279_12292 330
1120 3300050512 nmdc:mga0n895_164089_c1 nmdc:mga0n895_164089_c1_304_1317 330
1121 3300050512 nmdc:mga0n895_459048_c1 nmdc:mga0n895_459048_c1_152_1165 330
1122 3300050512 nmdc:mga0n895_57339_c1 nmdc:mga0n895_57339_c1_2125_3138 330
1123 3300050513 nmdc:mga0rr50_64430_c1 nmdc:mga0rr50_64430_c1_1619_2632 330
1124 3300050515 nmdc:mga0a205_24709_c1 nmdc:mga0a205_24709_c1_616_1629 330
1125 3300053077 Ga0495601_0000829 Ga0495601_0000829_4540_5556 330
1126 3300053078 Ga0495612_0000396 Ga0495612_0000396_9531_10544 330
1127 3300053078 Ga0495612_0019470 Ga0495612_0019470_807_1823 330
1128 3300053084 Ga0495595_0000489 Ga0495595_0000489_9640_10656 330
1129 3300053084 Ga0495595_0001055 Ga0495595_0001055_5569_6582 330
1130 3300053084 Ga0495595_0007407 Ga0495595_0007407_3157_4173 330
1131 3300053084 Ga0495595_0155002 Ga0495595_0155002_47_1081 330
1132 3300053085 Ga0495619_0000265 Ga0495619_0000265_12282_13295 330
1133 3300053085 Ga0495619_0000423 Ga0495619_0000423_18268_19284 330
1134 3300053085 Ga0495619_0004854 Ga0495619_0004854_6550_7563 330
1135 3300053085 Ga0495619_0036496 Ga0495619_0036496_602_1618 330
1136 3300054114 Ga0501084_0097542 Ga0501084_0097542_22_1035 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

47

319

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5649 33 310
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5606 33 310
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5604 26 306
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5538 22 310
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.537 22 310
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8163 37 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7929 38 305 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7844 39 305 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7791 38 305 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7768 36 305 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A847A9G8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9241 13 327 GO:0005886
GO:0015658
AF-A0A537NJW4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9228 16 326 GO:0005886
GO:0015658
AF-A0A2V6USM8-F1-model_v4 ABC transporter domain-containing protein 0.9224 15 277 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-A0A2N2FS50-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9198 14 282 GO:0005886
GO:0015658
AF-A0A7C3S3N1-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9197 10 322 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
79.44 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map