F490603
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1134 | 438 | 2268 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0426544|Ga0496126_0426544_429_986 |
| Length | 185 |
| Sequence | MVVNASQDDPEKARRFRDAALPYLDDAYTLARYLLRDAADAEDAVQECYLRAYKHFDSYRGPAMKPWLFAILRNVCRAEYARRKTAPTAVEELPEGGEQAPLWNEAPETPEKQLLRRFDGDTVRKLVAALAEPFRETFVLREIQNLSYREIADVAAVPVGTVMSRLARARAMLRSAWLAEQEHVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 130 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 131 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 269 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 365 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 368 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 374 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 375 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 376 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 377 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 381 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 408 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 419 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 422 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 423 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 428 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 429 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 430 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 431 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 432 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 433 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 434 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 435 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 436 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 437 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 438 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.12 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 0.53 |
| Rhizoplane | 8.29 |
| Rhizosphere | 79.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496126_0426544 | 3300048929 | Bacteria | 1071 |
| 2 | JGI24746J21847_1001317 | 3300001977 | Bacteria | 3957 |
| 3 | JGI24743J22301_10003273 | 3300001991 | Bacteria | 2548 |
| 4 | JGI24748J21848_1023147 | 3300002074 | Bacteria | 753 |
| 5 | JGI24749J21850_1001469 | 3300002076 | Bacteria | 3331 |
| 6 | JGI24744J21845_10012247 | 3300002077 | Bacteria | 1744 |
| 7 | JGI24034J26672_10010225 | 3300002239 | Bacteria | 1391 |
| 8 | JGI24742J22300_10002785 | 3300002244 | Bacteria | 2820 |
| 9 | JGI24751J29686_10006717 | 3300002459 | Bacteria | 2345 |
| 10 | JGI25406J46586_10000034 | 3300003203 | Bacteria | 64645 |
| 11 | JGI25153J46596_10017828 | 3300003215 | Bacteria | 2780 |
| 12 | rootH2_10203984 | 3300003320 | Bacteria | 1389 |
| 13 | rootH1_10036963 | 3300003323 | Bacteria | 1277 |
| 14 | Ga0070658_10102993 | 3300005327 | Bacteria | 2361 |
| 15 | Ga0070676_10134406 | 3300005328 | Bacteria | 1567 |
| 16 | Ga0070676_10228397 | 3300005328 | Bacteria | 1233 |
| 17 | Ga0070676_10372446 | 3300005328 | Bacteria | 987 |
| 18 | Ga0070683_100155781 | 3300005329 | Bacteria | 2166 |
| 19 | Ga0070683_100468213 | 3300005329 | Bacteria | 1203 |
| 20 | Ga0070683_101046387 | 3300005329 | Bacteria | 784 |
| 21 | Ga0070690_100053581 | 3300005330 | Bacteria | 2581 |
| 22 | Ga0070690_100139306 | 3300005330 | Bacteria | 1646 |
| 23 | Ga0070670_100007025 | 3300005331 | Bacteria | 9538 |
| 24 | Ga0070670_100050801 | 3300005331 | Bacteria | 3562 |
| 25 | Ga0070670_100051489 | 3300005331 | Bacteria | 3536 |
| 26 | Ga0070670_100142493 | 3300005331 | Bacteria | 2073 |
| 27 | Ga0070670_100326773 | 3300005331 | Bacteria | 1344 |
| 28 | Ga0068869_100033241 | 3300005334 | Bacteria | 3641 |
| 29 | Ga0068869_100040310 | 3300005334 | Bacteria | 3339 |
| 30 | Ga0068869_100117592 | 3300005334 | Bacteria | 2029 |
| 31 | Ga0068869_100181402 | 3300005334 | Bacteria | 1650 |
| 32 | Ga0070666_10052370 | 3300005335 | Bacteria | 2751 |
| 33 | Ga0070666_10071932 | 3300005335 | Bacteria | 2354 |
| 34 | Ga0070680_100026227 | 3300005336 | Bacteria | 4660 |
| 35 | Ga0070680_100056750 | 3300005336 | Bacteria | 3201 |
| 36 | Ga0070680_100157997 | 3300005336 | Bacteria | 1905 |
| 37 | Ga0070680_100331013 | 3300005336 | Bacteria | 1294 |
| 38 | Ga0070680_100418593 | 3300005336 | Unclassified | 1143 |
| 39 | Ga0070682_100036227 | 3300005337 | Bacteria | 3015 |
| 40 | Ga0070682_100058817 | 3300005337 | Bacteria | 2425 |
| 41 | Ga0070682_100468700 | 3300005337 | Bacteria | 969 |
| 42 | Ga0068868_100003160 | 3300005338 | Bacteria | 11463 |
| 43 | Ga0068868_100003369 | 3300005338 | Bacteria | 11116 |
| 44 | Ga0068868_101363076 | 3300005338 | Bacteria | 660 |
| 45 | Ga0070660_100106382 | 3300005339 | Bacteria | 2228 |
| 46 | Ga0070660_100494141 | 3300005339 | Bacteria | 1018 |
| 47 | Ga0070689_100052258 | 3300005340 | Bacteria | 3160 |
| 48 | Ga0070689_100089648 | 3300005340 | Bacteria | 2422 |
| 49 | Ga0070689_100205296 | 3300005340 | Bacteria | 1611 |
| 50 | Ga0070689_100580831 | 3300005340 | Bacteria | 969 |
| 51 | Ga0070691_10086843 | 3300005341 | Bacteria | 1538 |
| 52 | Ga0070691_10213767 | 3300005341 | Unclassified | 1019 |
| 53 | Ga0070661_100142530 | 3300005344 | Bacteria | 1807 |
| 54 | Ga0070661_100157347 | 3300005344 | Bacteria | 1719 |
| 55 | Ga0070661_100174587 | 3300005344 | Bacteria | 1633 |
| 56 | Ga0070692_10015119 | 3300005345 | Bacteria | 3643 |
| 57 | Ga0070668_100037383 | 3300005347 | Bacteria | 3707 |
| 58 | Ga0070668_100076047 | 3300005347 | Bacteria | 2622 |
| 59 | Ga0070668_100797018 | 3300005347 | Bacteria | 839 |
| 60 | Ga0070669_100087524 | 3300005353 | Bacteria | 2329 |
| 61 | Ga0070669_100456390 | 3300005353 | Bacteria | 1054 |
| 62 | Ga0070675_100005711 | 3300005354 | Bacteria | 9519 |
| 63 | Ga0070671_100001331 | 3300005355 | Bacteria | 18540 |
| 64 | Ga0070671_100048277 | 3300005355 | Bacteria | 3539 |
| 65 | Ga0070671_100100508 | 3300005355 | Bacteria | 2427 |
| 66 | Ga0070671_100478701 | 3300005355 | Bacteria | 1070 |
| 67 | Ga0070671_100816417 | 3300005355 | Bacteria | 812 |
| 68 | Ga0070674_100020473 | 3300005356 | Bacteria | 4228 |
| 69 | Ga0070674_100374580 | 3300005356 | Bacteria | 1156 |
| 70 | Ga0070674_100413895 | 3300005356 | Bacteria | 1104 |
| 71 | Ga0070673_100001163 | 3300005364 | Bacteria | 15102 |
| 72 | Ga0070673_100002176 | 3300005364 | Bacteria | 11868 |
| 73 | Ga0070673_100006931 | 3300005364 | Bacteria | 7413 |
| 74 | Ga0070673_100450586 | 3300005364 | Bacteria | 1158 |
| 75 | Ga0070673_101217233 | 3300005364 | Bacteria | 706 |
| 76 | Ga0070688_100059515 | 3300005365 | Bacteria | 2409 |
| 77 | Ga0070688_100076094 | 3300005365 | Bacteria | 2159 |
| 78 | Ga0070688_100149997 | 3300005365 | Bacteria | 1593 |
| 79 | Ga0070688_100514863 | 3300005365 | Bacteria | 905 |
| 80 | Ga0070659_100035456 | 3300005366 | Bacteria | 3885 |
| 81 | Ga0070659_100086353 | 3300005366 | Bacteria | 2510 |
| 82 | Ga0070659_100115476 | 3300005366 | Bacteria | 2170 |
| 83 | Ga0070659_100127439 | 3300005366 | Bacteria | 2066 |
| 84 | Ga0070659_100316712 | 3300005366 | Bacteria | 1303 |
| 85 | Ga0070667_100020418 | 3300005367 | Bacteria | 5499 |
| 86 | Ga0070667_100172638 | 3300005367 | Bacteria | 1909 |
| 87 | Ga0070667_100767006 | 3300005367 | Bacteria | 895 |
| 88 | Ga0070667_100919963 | 3300005367 | Bacteria | 814 |
| 89 | Ga0070709_10012949 | 3300005434 | Bacteria | 4678 |
| 90 | Ga0070714_100043951 | 3300005435 | Bacteria | 3781 |
| 91 | Ga0070714_100074625 | 3300005435 | Bacteria | 2941 |
| 92 | Ga0070714_100170865 | 3300005435 | Bacteria | 1973 |
| 93 | Ga0070714_100177232 | 3300005435 | Bacteria | 1938 |
| 94 | Ga0070713_100012383 | 3300005436 | Bacteria | 6253 |
| 95 | Ga0070713_100016379 | 3300005436 | Bacteria | 5574 |
| 96 | Ga0070713_100017742 | 3300005436 | Bacteria | 5395 |
| 97 | Ga0070713_100019667 | 3300005436 | Bacteria | 5164 |
| 98 | Ga0070713_100556931 | 3300005436 | Bacteria | 1086 |
| 99 | Ga0070713_100959717 | 3300005436 | Bacteria | 824 |
| 100 | Ga0070710_10004585 | 3300005437 | Bacteria | 6528 |
| 101 | Ga0070710_10024250 | 3300005437 | Bacteria | 3198 |
| 102 | Ga0070710_10063463 | 3300005437 | Bacteria | 2110 |
| 103 | Ga0070711_100013093 | 3300005439 | Bacteria | 5202 |
| 104 | Ga0070711_100088479 | 3300005439 | Bacteria | 2225 |
| 105 | Ga0070711_100110947 | 3300005439 | Bacteria | 2013 |
| 106 | Ga0070711_100142854 | 3300005439 | Bacteria | 1796 |
| 107 | Ga0070711_100196443 | 3300005439 | Bacteria | 1554 |
| 108 | Ga0070705_100117187 | 3300005440 | Bacteria | 1713 |
| 109 | Ga0070700_100069247 | 3300005441 | Bacteria | 2246 |
| 110 | Ga0070700_100333471 | 3300005441 | Bacteria | 1119 |
| 111 | Ga0070708_100263899 | 3300005445 | Bacteria | 1619 |
| 112 | Ga0070663_100003656 | 3300005455 | Bacteria | 8909 |
| 113 | Ga0070663_100004111 | 3300005455 | Bacteria | 8499 |
| 114 | Ga0070663_100103355 | 3300005455 | Bacteria | 2130 |
| 115 | Ga0070663_100108146 | 3300005455 | Bacteria | 2085 |
| 116 | Ga0070663_100117737 | 3300005455 | Bacteria | 2003 |
| 117 | Ga0070663_100250112 | 3300005455 | Bacteria | 1402 |
| 118 | Ga0070663_100261970 | 3300005455 | Bacteria | 1372 |
| 119 | Ga0070663_100887112 | 3300005455 | Bacteria | 770 |
| 120 | Ga0070678_100005384 | 3300005456 | Bacteria | 7385 |
| 121 | Ga0070678_100034207 | 3300005456 | Bacteria | 3537 |
| 122 | Ga0070678_100153160 | 3300005456 | Bacteria | 1859 |
| 123 | Ga0070678_100173658 | 3300005456 | Bacteria | 1758 |
| 124 | Ga0070678_100455159 | 3300005456 | Bacteria | 1122 |
| 125 | Ga0070678_100864867 | 3300005456 | Bacteria | 824 |
| 126 | Ga0070662_100014566 | 3300005457 | Bacteria | 5257 |
| 127 | Ga0070662_100090547 | 3300005457 | Bacteria | 2296 |
| 128 | Ga0070662_100422775 | 3300005457 | Bacteria | 1103 |
| 129 | Ga0070681_10076110 | 3300005458 | Bacteria | 3315 |
| 130 | Ga0070681_10110910 | 3300005458 | Bacteria | 2683 |
| 131 | Ga0070681_10128657 | 3300005458 | Bacteria | 2465 |
| 132 | Ga0070681_10149452 | 3300005458 | Bacteria | 2263 |
| 133 | Ga0070681_10150332 | 3300005458 | Bacteria | 2255 |
| 134 | Ga0068867_100121343 | 3300005459 | Bacteria | 2021 |
| 135 | Ga0068867_100301697 | 3300005459 | Bacteria | 1321 |
| 136 | Ga0070685_10012017 | 3300005466 | Bacteria | 4539 |
| 137 | Ga0070685_10216031 | 3300005466 | Bacteria | 1254 |
| 138 | Ga0070707_100132939 | 3300005468 | Bacteria | 2420 |
| 139 | Ga0070698_100236774 | 3300005471 | Bacteria | 1759 |
| 140 | Ga0070698_100258194 | 3300005471 | Bacteria | 1675 |
| 141 | Ga0070698_100305096 | 3300005471 | Bacteria | 1523 |
| 142 | Ga0070699_100592119 | 3300005518 | Bacteria | 1011 |
| 143 | Ga0070699_100649839 | 3300005518 | Bacteria | 963 |
| 144 | Ga0070679_100003933 | 3300005530 | Bacteria | 13668 |
| 145 | Ga0070679_100005873 | 3300005530 | Bacteria | 11399 |
| 146 | Ga0070679_100027524 | 3300005530 | Bacteria | 5597 |
| 147 | Ga0070679_100030562 | 3300005530 | Bacteria | 5317 |
| 148 | Ga0070679_100145182 | 3300005530 | Bacteria | 2351 |
| 149 | Ga0070679_100181933 | 3300005530 | Bacteria | 2074 |
| 150 | Ga0070679_100614809 | 3300005530 | Bacteria | 1030 |
| 151 | Ga0070679_100891017 | 3300005530 | Bacteria | 833 |
| 152 | Ga0070684_100034666 | 3300005535 | Bacteria | 4316 |
| 153 | Ga0070684_100054648 | 3300005535 | Bacteria | 3479 |
| 154 | Ga0070684_100142084 | 3300005535 | Bacteria | 2171 |
| 155 | Ga0070684_100198510 | 3300005535 | Bacteria | 1827 |
| 156 | Ga0070684_100427650 | 3300005535 | Bacteria | 1223 |
| 157 | Ga0070697_100263148 | 3300005536 | Bacteria | 1477 |
| 158 | Ga0068853_100036895 | 3300005539 | Bacteria | 4157 |
| 159 | Ga0068853_100555795 | 3300005539 | Bacteria | 1088 |
| 160 | Ga0068853_100656480 | 3300005539 | Bacteria | 999 |
| 161 | Ga0070672_100120816 | 3300005543 | Bacteria | 2144 |
| 162 | Ga0070672_100455714 | 3300005543 | Bacteria | 1102 |
| 163 | Ga0070686_100003612 | 3300005544 | Bacteria | 8488 |
| 164 | Ga0070686_100040601 | 3300005544 | Bacteria | 2904 |
| 165 | Ga0070686_100072491 | 3300005544 | Bacteria | 2259 |
| 166 | Ga0070686_100693701 | 3300005544 | Bacteria | 811 |
| 167 | Ga0070696_100476719 | 3300005546 | Unclassified | 989 |
| 168 | Ga0070693_100201906 | 3300005547 | Bacteria | 1292 |
| 169 | Ga0070665_100025056 | 3300005548 | Bacteria | 6012 |
| 170 | Ga0070665_100089220 | 3300005548 | Bacteria | 3089 |
| 171 | Ga0070665_100103763 | 3300005548 | Bacteria | 2846 |
| 172 | Ga0070665_100155533 | 3300005548 | Bacteria | 2288 |
| 173 | Ga0070704_100055095 | 3300005549 | Bacteria | 2817 |
| 174 | Ga0068855_100040685 | 3300005563 | Bacteria | 5515 |
| 175 | Ga0068855_100109595 | 3300005563 | Bacteria | 3170 |
| 176 | Ga0068855_100165838 | 3300005563 | Bacteria | 2504 |
| 177 | Ga0068855_100261445 | 3300005563 | Bacteria | 1928 |
| 178 | Ga0068855_100294417 | 3300005563 | Bacteria | 1799 |
| 179 | Ga0068855_100795140 | 3300005563 | Bacteria | 1006 |
| 180 | Ga0070664_100011896 | 3300005564 | Bacteria | 7062 |
| 181 | Ga0070664_100235962 | 3300005564 | Bacteria | 1641 |
| 182 | Ga0070664_100293951 | 3300005564 | Bacteria | 1467 |
| 183 | Ga0070664_100421590 | 3300005564 | Unclassified | 1222 |
| 184 | Ga0068857_100177624 | 3300005577 | Bacteria | 1937 |
| 185 | Ga0068857_100796090 | 3300005577 | Bacteria | 902 |
| 186 | Ga0068854_100017570 | 3300005578 | Bacteria | 4786 |
| 187 | Ga0068854_100105262 | 3300005578 | Bacteria | 2121 |
| 188 | Ga0068854_100142458 | 3300005578 | Bacteria | 1841 |
| 189 | Ga0068854_100371937 | 3300005578 | Bacteria | 1175 |
| 190 | Ga0068854_100494685 | 3300005578 | Bacteria | 1029 |
| 191 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 192 | Ga0068856_100119855 | 3300005614 | Bacteria | 2633 |
| 193 | Ga0068856_100164062 | 3300005614 | Bacteria | 2233 |
| 194 | Ga0068856_100263946 | 3300005614 | Bacteria | 1738 |
| 195 | Ga0068856_100756567 | 3300005614 | Bacteria | 992 |
| 196 | Ga0070702_100005192 | 3300005615 | Bacteria | 6032 |
| 197 | Ga0070702_100051278 | 3300005615 | Bacteria | 2361 |
| 198 | Ga0070702_100149467 | 3300005615 | Bacteria | 1497 |
| 199 | Ga0068852_100162249 | 3300005616 | Bacteria | 2088 |
| 200 | Ga0068852_100292199 | 3300005616 | Bacteria | 1575 |
| 201 | Ga0068852_101250093 | 3300005616 | Bacteria | 764 |
| 202 | Ga0068859_100013198 | 3300005617 | Bacteria | 8294 |
| 203 | Ga0068859_100038214 | 3300005617 | Bacteria | 4816 |
| 204 | Ga0068859_100299145 | 3300005617 | Unclassified | 1702 |
| 205 | Ga0068859_100341157 | 3300005617 | Bacteria | 1592 |
| 206 | Ga0068859_100962691 | 3300005617 | Bacteria | 936 |
| 207 | Ga0068859_101560673 | 3300005617 | Bacteria | 729 |
| 208 | Ga0068864_100008218 | 3300005618 | Bacteria | 8606 |
| 209 | Ga0068864_100052894 | 3300005618 | Bacteria | 3501 |
| 210 | Ga0068866_10023345 | 3300005718 | Bacteria | 2876 |
| 211 | Ga0068866_10203735 | 3300005718 | Bacteria | 1184 |
| 212 | Ga0068861_100080957 | 3300005719 | Bacteria | 2541 |
| 213 | Ga0068861_100166781 | 3300005719 | Bacteria | 1821 |
| 214 | Ga0068851_10059509 | 3300005834 | Bacteria | 1954 |
| 215 | Ga0068870_10000819 | 3300005840 | Bacteria | 12082 |
| 216 | Ga0068870_10500430 | 3300005840 | Bacteria | 810 |
| 217 | Ga0068863_100008090 | 3300005841 | Bacteria | 10270 |
| 218 | Ga0068863_100135706 | 3300005841 | Bacteria | 2351 |
| 219 | Ga0068863_100179979 | 3300005841 | Bacteria | 2029 |
| 220 | Ga0068858_100091622 | 3300005842 | Bacteria | 2829 |
| 221 | Ga0068858_100150601 | 3300005842 | Bacteria | 2187 |
| 222 | Ga0068858_100227893 | 3300005842 | Bacteria | 1766 |
| 223 | Ga0068858_100392593 | 3300005842 | Bacteria | 1332 |
| 224 | Ga0068858_100864366 | 3300005842 | Bacteria | 884 |
| 225 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 226 | Ga0068860_100173161 | 3300005843 | Bacteria | 2085 |
| 227 | Ga0068860_100301975 | 3300005843 | Bacteria | 1568 |
| 228 | Ga0068860_100319594 | 3300005843 | Bacteria | 1523 |
| 229 | Ga0068860_100379375 | 3300005843 | Bacteria | 1395 |
| 230 | Ga0068860_100405930 | 3300005843 | Bacteria | 1348 |
| 231 | Ga0068862_100145047 | 3300005844 | Bacteria | 2109 |
| 232 | Ga0068862_100164141 | 3300005844 | Bacteria | 1984 |
| 233 | Ga0068862_100167638 | 3300005844 | Bacteria | 1964 |
| 234 | Ga0068862_100469245 | 3300005844 | Bacteria | 1189 |
| 235 | Ga0081455_10040362 | 3300005937 | Bacteria | 4116 |
| 236 | Ga0081455_10083231 | 3300005937 | Bacteria | 2615 |
| 237 | Ga0081540_1001760 | 3300005983 | Bacteria | 18218 |
| 238 | Ga0081540_1005540 | 3300005983 | Bacteria | 9406 |
| 239 | Ga0081540_1013929 | 3300005983 | Bacteria | 5191 |
| 240 | Ga0081540_1016188 | 3300005983 | Bacteria | 4681 |
| 241 | Ga0081540_1041342 | 3300005983 | Bacteria | 2392 |
| 242 | Ga0081540_1048993 | 3300005983 | Bacteria | 2111 |
| 243 | Ga0081540_1065533 | 3300005983 | Bacteria | 1707 |
| 244 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 245 | Ga0070717_10000208 | 3300006028 | Bacteria | 41212 |
| 246 | Ga0070717_10023506 | 3300006028 | Bacteria | 4885 |
| 247 | Ga0070717_10079019 | 3300006028 | Bacteria | 2758 |
| 248 | Ga0070717_10285023 | 3300006028 | Bacteria | 1466 |
| 249 | Ga0070717_10300223 | 3300006028 | Bacteria | 1428 |
| 250 | Ga0070717_10310672 | 3300006028 | Bacteria | 1403 |
| 251 | Ga0075365_10004575 | 3300006038 | Bacteria | 7356 |
| 252 | Ga0075365_10097763 | 3300006038 | Bacteria | 2007 |
| 253 | Ga0075365_10256084 | 3300006038 | Bacteria | 1230 |
| 254 | Ga0075368_10042765 | 3300006042 | Bacteria | 1784 |
| 255 | Ga0075368_10094199 | 3300006042 | Bacteria | 1226 |
| 256 | Ga0075368_10138416 | 3300006042 | Bacteria | 1014 |
| 257 | Ga0075368_10145757 | 3300006042 | Bacteria | 988 |
| 258 | Ga0075363_100003841 | 3300006048 | Bacteria | 6476 |
| 259 | Ga0075363_100055194 | 3300006048 | Bacteria | 2127 |
| 260 | Ga0075363_100072416 | 3300006048 | Bacteria | 1874 |
| 261 | Ga0075364_10039910 | 3300006051 | Bacteria | 3044 |
| 262 | Ga0075432_10013108 | 3300006058 | Bacteria | 2817 |
| 263 | Ga0070715_10004593 | 3300006163 | Bacteria | 4548 |
| 264 | Ga0070715_10044791 | 3300006163 | Bacteria | 1873 |
| 265 | Ga0070715_10126203 | 3300006163 | Bacteria | 1226 |
| 266 | Ga0070715_10230664 | 3300006163 | Bacteria | 957 |
| 267 | Ga0070716_100002237 | 3300006173 | Bacteria | 8916 |
| 268 | Ga0070716_100820874 | 3300006173 | Bacteria | 722 |
| 269 | Ga0070712_100003066 | 3300006175 | Bacteria | 10336 |
| 270 | Ga0070712_100034839 | 3300006175 | Bacteria | 3413 |
| 271 | Ga0070712_100073280 | 3300006175 | Bacteria | 2456 |
| 272 | Ga0070712_100201131 | 3300006175 | Bacteria | 1565 |
| 273 | Ga0075367_10005056 | 3300006178 | Bacteria | 6505 |
| 274 | Ga0075367_10018056 | 3300006178 | Bacteria | 3885 |
| 275 | Ga0075369_10021538 | 3300006186 | Bacteria | 2650 |
| 276 | Ga0075369_10146918 | 3300006186 | Bacteria | 1077 |
| 277 | Ga0075427_10001183 | 3300006194 | Bacteria | 3313 |
| 278 | Ga0075366_10022697 | 3300006195 | Bacteria | 3653 |
| 279 | Ga0075366_10036482 | 3300006195 | Bacteria | 2899 |
| 280 | Ga0075366_10111482 | 3300006195 | Bacteria | 1645 |
| 281 | Ga0097621_100016264 | 3300006237 | Bacteria | 5619 |
| 282 | Ga0097621_100021881 | 3300006237 | Bacteria | 4955 |
| 283 | Ga0097621_100134565 | 3300006237 | Bacteria | 2107 |
| 284 | Ga0075370_10030966 | 3300006353 | Bacteria | 2985 |
| 285 | Ga0075370_10164071 | 3300006353 | Bacteria | 1304 |
| 286 | Ga0068871_100007371 | 3300006358 | Bacteria | 7851 |
| 287 | Ga0068871_100190467 | 3300006358 | Bacteria | 1767 |
| 288 | Ga0068871_100977269 | 3300006358 | Bacteria | 788 |
| 289 | Ga0075428_100010200 | 3300006844 | Bacteria | 10427 |
| 290 | Ga0075428_100529691 | 3300006844 | Bacteria | 1260 |
| 291 | Ga0075430_100001483 | 3300006846 | Bacteria | 19129 |
| 292 | Ga0075431_100017410 | 3300006847 | Bacteria | 7302 |
| 293 | Ga0075433_10002052 | 3300006852 | Bacteria | 15222 |
| 294 | Ga0075434_100001473 | 3300006871 | Bacteria | 19815 |
| 295 | Ga0075434_100138061 | 3300006871 | Bacteria | 2457 |
| 296 | Ga0075434_100219840 | 3300006871 | Bacteria | 1919 |
| 297 | Ga0075429_100005294 | 3300006880 | Bacteria | 11102 |
| 298 | Ga0068865_100007918 | 3300006881 | Bacteria | 6558 |
| 299 | Ga0068865_100513813 | 3300006881 | Bacteria | 1001 |
| 300 | Ga0075436_100006832 | 3300006914 | Bacteria | 7805 |
| 301 | Ga0075436_100397551 | 3300006914 | Unclassified | 998 |
| 302 | Ga0075436_100598571 | 3300006914 | Bacteria | 812 |
| 303 | Ga0097620_100013200 | 3300006931 | Bacteria | 8294 |
| 304 | Ga0097620_100038215 | 3300006931 | Bacteria | 4816 |
| 305 | Ga0097620_100299155 | 3300006931 | Unclassified | 1702 |
| 306 | Ga0097620_100341155 | 3300006931 | Bacteria | 1592 |
| 307 | Ga0097620_100962645 | 3300006931 | Bacteria | 936 |
| 308 | Ga0097620_101560637 | 3300006931 | Bacteria | 729 |
| 309 | Ga0075435_100034905 | 3300007076 | Bacteria | 3989 |
| 310 | Ga0075435_100063487 | 3300007076 | Bacteria | 3000 |
| 311 | Ga0099794_10002268 | 3300007265 | Bacteria | 7059 |
| 312 | Ga0099795_10025328 | 3300007788 | Bacteria | 1989 |
| 313 | Ga0099795_10034929 | 3300007788 | Bacteria | 1755 |
| 314 | Ga0105244_10222873 | 3300009036 | Bacteria | 884 |
| 315 | Ga0105240_10128623 | 3300009093 | Bacteria | 3041 |
| 316 | Ga0105240_10157827 | 3300009093 | Bacteria | 2697 |
| 317 | Ga0105240_10167179 | 3300009093 | Bacteria | 2608 |
| 318 | Ga0105240_10291530 | 3300009093 | Bacteria | 1870 |
| 319 | Ga0105240_11093666 | 3300009093 | Bacteria | 848 |
| 320 | Ga0111539_10008538 | 3300009094 | Bacteria | 13014 |
| 321 | Ga0111539_10131557 | 3300009094 | Bacteria | 2930 |
| 322 | Ga0111539_10296445 | 3300009094 | Bacteria | 1882 |
| 323 | Ga0111539_10784390 | 3300009094 | Bacteria | 1109 |
| 324 | Ga0111539_11220365 | 3300009094 | Bacteria | 873 |
| 325 | Ga0105245_10041292 | 3300009098 | Bacteria | 4112 |
| 326 | Ga0105245_10060774 | 3300009098 | Bacteria | 3404 |
| 327 | Ga0105245_10669282 | 3300009098 | Bacteria | 1069 |
| 328 | Ga0105247_10108262 | 3300009101 | Bacteria | 1785 |
| 329 | Ga0105247_10140877 | 3300009101 | Bacteria | 1580 |
| 330 | Ga0105247_10159068 | 3300009101 | Bacteria | 1494 |
| 331 | Ga0105247_10309033 | 3300009101 | Bacteria | 1099 |
| 332 | Ga0114129_10042454 | 3300009147 | Bacteria | 6404 |
| 333 | Ga0114129_10046549 | 3300009147 | Bacteria | 6095 |
| 334 | Ga0114129_10272398 | 3300009147 | Bacteria | 2264 |
| 335 | Ga0114129_10275924 | 3300009147 | Bacteria | 2247 |
| 336 | Ga0105243_10430511 | 3300009148 | Bacteria | 1233 |
| 337 | Ga0105243_10952851 | 3300009148 | Bacteria | 857 |
| 338 | Ga0105241_10107391 | 3300009174 | Bacteria | 2229 |
| 339 | Ga0105241_10358120 | 3300009174 | Bacteria | 1269 |
| 340 | Ga0105241_10359512 | 3300009174 | Bacteria | 1267 |
| 341 | Ga0105241_10421750 | 3300009174 | Bacteria | 1174 |
| 342 | Ga0105242_10041657 | 3300009176 | Bacteria | 3705 |
| 343 | Ga0105242_10060616 | 3300009176 | Bacteria | 3110 |
| 344 | Ga0105242_10253475 | 3300009176 | Bacteria | 1587 |
| 345 | Ga0105242_10908151 | 3300009176 | Bacteria | 881 |
| 346 | Ga0105248_10180880 | 3300009177 | Bacteria | 2376 |
| 347 | Ga0105248_10504151 | 3300009177 | Bacteria | 1364 |
| 348 | Ga0105237_10097272 | 3300009545 | Bacteria | 2934 |
| 349 | Ga0105237_10115212 | 3300009545 | Bacteria | 2681 |
| 350 | Ga0105237_10673642 | 3300009545 | Bacteria | 1041 |
| 351 | Ga0105238_10028676 | 3300009551 | Bacteria | 5670 |
| 352 | Ga0105238_10430024 | 3300009551 | Bacteria | 1316 |
| 353 | Ga0105238_11756052 | 3300009551 | Bacteria | 652 |
| 354 | Ga0105249_10151920 | 3300009553 | Bacteria | 2230 |
| 355 | Ga0105249_10367537 | 3300009553 | Bacteria | 1461 |
| 356 | Ga0105249_10425526 | 3300009553 | Bacteria | 1362 |
| 357 | Ga0099796_10016123 | 3300010159 | Bacteria | 2200 |
| 358 | Ga0105239_10011139 | 3300010375 | Bacteria | 10039 |
| 359 | Ga0105239_10219918 | 3300010375 | Bacteria | 2130 |
| 360 | Ga0105239_10229696 | 3300010375 | Bacteria | 2082 |
| 361 | Ga0105239_10529683 | 3300010375 | Bacteria | 1341 |
| 362 | Ga0105239_11234141 | 3300010375 | Bacteria | 862 |
| 363 | Ga0105246_10021797 | 3300011119 | Bacteria | 4127 |
| 364 | Ga0105246_10273237 | 3300011119 | Unclassified | 1352 |
| 365 | Ga0105246_10354127 | 3300011119 | Bacteria | 1204 |
| 366 | Ga0157344_1002933 | 3300012476 | Bacteria | 934 |
| 367 | Ga0157341_1004823 | 3300012494 | Bacteria | 988 |
| 368 | Ga0157316_1000481 | 3300012510 | Bacteria | 2116 |
| 369 | Ga0157370_10030019 | 3300013104 | Bacteria | 5328 |
| 370 | Ga0157370_10114031 | 3300013104 | Bacteria | 2525 |
| 371 | Ga0157370_10785464 | 3300013104 | Bacteria | 867 |
| 372 | Ga0157369_10007421 | 3300013105 | Bacteria | 12626 |
| 373 | Ga0157369_10016145 | 3300013105 | Bacteria | 8405 |
| 374 | Ga0157369_10120105 | 3300013105 | Bacteria | 2789 |
| 375 | Ga0157369_10182692 | 3300013105 | Bacteria | 2206 |
| 376 | Ga0157369_10673579 | 3300013105 | Unclassified | 1066 |
| 377 | Ga0157369_10749128 | 3300013105 | Bacteria | 1005 |
| 378 | Ga0157374_10002946 | 3300013296 | Bacteria | 14253 |
| 379 | Ga0157374_10021619 | 3300013296 | Bacteria | 5729 |
| 380 | Ga0157374_10142292 | 3300013296 | Bacteria | 2329 |
| 381 | Ga0157374_10195141 | 3300013296 | Bacteria | 1981 |
| 382 | Ga0157374_11004924 | 3300013296 | Bacteria | 853 |
| 383 | Ga0157378_10009553 | 3300013297 | Bacteria | 8447 |
| 384 | Ga0157378_10052128 | 3300013297 | Bacteria | 3640 |
| 385 | Ga0157378_10054478 | 3300013297 | Bacteria | 3561 |
| 386 | Ga0157378_10172400 | 3300013297 | Bacteria | 2030 |
| 387 | Ga0163162_10089599 | 3300013306 | Bacteria | 3157 |
| 388 | Ga0163162_10322270 | 3300013306 | Bacteria | 1678 |
| 389 | Ga0163162_10370530 | 3300013306 | Bacteria | 1565 |
| 390 | Ga0163162_10745775 | 3300013306 | Bacteria | 1099 |
| 391 | Ga0157372_10065655 | 3300013307 | Bacteria | 4075 |
| 392 | Ga0157372_10306621 | 3300013307 | Bacteria | 1847 |
| 393 | Ga0157372_10555171 | 3300013307 | Bacteria | 1339 |
| 394 | Ga0157372_11596853 | 3300013307 | Bacteria | 751 |
| 395 | Ga0157375_10012564 | 3300013308 | Bacteria | 7516 |
| 396 | Ga0157375_10545597 | 3300013308 | Bacteria | 1321 |
| 397 | Ga0163163_10013378 | 3300014325 | Bacteria | 7511 |
| 398 | Ga0163163_10056723 | 3300014325 | Bacteria | 3871 |
| 399 | Ga0163163_10120257 | 3300014325 | Bacteria | 2660 |
| 400 | Ga0163163_10131190 | 3300014325 | Bacteria | 2546 |
| 401 | Ga0163163_11048759 | 3300014325 | Bacteria | 878 |
| 402 | Ga0157380_10281869 | 3300014326 | Bacteria | 1521 |
| 403 | Ga0157380_10960119 | 3300014326 | Bacteria | 885 |
| 404 | Ga0157377_10002479 | 3300014745 | Bacteria | 8165 |
| 405 | Ga0157377_10112765 | 3300014745 | Bacteria | 1636 |
| 406 | Ga0157377_10174155 | 3300014745 | Bacteria | 1348 |
| 407 | Ga0157379_10007369 | 3300014968 | Bacteria | 9526 |
| 408 | Ga0157379_10076935 | 3300014968 | Bacteria | 2988 |
| 409 | Ga0157379_10084510 | 3300014968 | Bacteria | 2844 |
| 410 | Ga0157379_10211016 | 3300014968 | Bacteria | 1758 |
| 411 | Ga0157379_10241666 | 3300014968 | Bacteria | 1638 |
| 412 | Ga0157379_10398711 | 3300014968 | Bacteria | 1264 |
| 413 | Ga0157379_10452070 | 3300014968 | Bacteria | 1186 |
| 414 | Ga0157376_10006417 | 3300014969 | Bacteria | 8309 |
| 415 | Ga0157376_10072518 | 3300014969 | Bacteria | 2929 |
| 416 | Ga0157376_10073211 | 3300014969 | Bacteria | 2917 |
| 417 | Ga0157376_10079797 | 3300014969 | Bacteria | 2806 |
| 418 | Ga0157376_10282843 | 3300014969 | Bacteria | 1563 |
| 419 | Ga0157376_10330006 | 3300014969 | Bacteria | 1453 |
| 420 | Ga0157376_10882803 | 3300014969 | Bacteria | 911 |
| 421 | Ga0163161_10124563 | 3300017792 | Bacteria | 1939 |
| 422 | Ga0163161_10291676 | 3300017792 | Bacteria | 1282 |
| 423 | Ga0163161_10421923 | 3300017792 | Bacteria | 1073 |
| 424 | Ga0206354_10582287 | 3300020081 | Bacteria | 1750 |
| 425 | Ga0213871_10002616 | 3300021441 | Bacteria | 3336 |
| 426 | Ga0209758_1010882 | 3300025297 | Bacteria | 5362 |
| 427 | Ga0209758_1011390 | 3300025297 | Bacteria | 5158 |
| 428 | Ga0209758_1029404 | 3300025297 | Bacteria | 2299 |
| 429 | Ga0207697_10132322 | 3300025315 | Bacteria | 1078 |
| 430 | Ga0207653_10122163 | 3300025885 | Bacteria | 938 |
| 431 | Ga0207682_10085580 | 3300025893 | Bacteria | 1358 |
| 432 | Ga0207692_10060370 | 3300025898 | Bacteria | 1961 |
| 433 | Ga0207692_10114481 | 3300025898 | Bacteria | 1501 |
| 434 | Ga0207692_10136513 | 3300025898 | Bacteria | 1391 |
| 435 | Ga0207642_10127306 | 3300025899 | Bacteria | 1323 |
| 436 | Ga0207642_10387681 | 3300025899 | Bacteria | 833 |
| 437 | Ga0207710_10029549 | 3300025900 | Bacteria | 2386 |
| 438 | Ga0207710_10204619 | 3300025900 | Bacteria | 976 |
| 439 | Ga0207688_10010390 | 3300025901 | Bacteria | 5065 |
| 440 | Ga0207688_10056255 | 3300025901 | Bacteria | 2209 |
| 441 | Ga0207680_10074349 | 3300025903 | Bacteria | 2116 |
| 442 | Ga0207680_10108586 | 3300025903 | Bacteria | 1795 |
| 443 | Ga0207647_10022444 | 3300025904 | Bacteria | 4191 |
| 444 | Ga0207685_10128661 | 3300025905 | Bacteria | 1121 |
| 445 | Ga0207699_10022022 | 3300025906 | Bacteria | 3447 |
| 446 | Ga0207699_10034223 | 3300025906 | Bacteria | 2879 |
| 447 | Ga0207699_10073848 | 3300025906 | Bacteria | 2093 |
| 448 | Ga0207699_10097037 | 3300025906 | Bacteria | 1862 |
| 449 | Ga0207645_10121830 | 3300025907 | Bacteria | 1693 |
| 450 | Ga0207645_10393701 | 3300025907 | Bacteria | 931 |
| 451 | Ga0207645_10408175 | 3300025907 | Bacteria | 914 |
| 452 | Ga0207643_10000675 | 3300025908 | Bacteria | 21235 |
| 453 | Ga0207705_10630141 | 3300025909 | Bacteria | 834 |
| 454 | Ga0207684_10135572 | 3300025910 | Bacteria | 2114 |
| 455 | Ga0207654_10059170 | 3300025911 | Bacteria | 2233 |
| 456 | Ga0207654_10154524 | 3300025911 | Bacteria | 1476 |
| 457 | Ga0207654_10264310 | 3300025911 | Bacteria | 1158 |
| 458 | Ga0207707_10000916 | 3300025912 | Bacteria | 28696 |
| 459 | Ga0207707_10051186 | 3300025912 | Bacteria | 3597 |
| 460 | Ga0207707_10331608 | 3300025912 | Bacteria | 1313 |
| 461 | Ga0207707_10339495 | 3300025912 | Bacteria | 1295 |
| 462 | Ga0207695_10022496 | 3300025913 | Bacteria | 7152 |
| 463 | Ga0207695_10029844 | 3300025913 | Bacteria | 6016 |
| 464 | Ga0207695_10144086 | 3300025913 | Bacteria | 2328 |
| 465 | Ga0207695_10761756 | 3300025913 | Bacteria | 848 |
| 466 | Ga0207671_10072463 | 3300025914 | Bacteria | 2571 |
| 467 | Ga0207671_10095326 | 3300025914 | Bacteria | 2247 |
| 468 | Ga0207693_10001243 | 3300025915 | Bacteria | 22677 |
| 469 | Ga0207693_10100225 | 3300025915 | Bacteria | 2271 |
| 470 | Ga0207693_10136454 | 3300025915 | Bacteria | 1929 |
| 471 | Ga0207693_10512783 | 3300025915 | Bacteria | 936 |
| 472 | Ga0207663_10033274 | 3300025916 | Bacteria | 3069 |
| 473 | Ga0207663_10163892 | 3300025916 | Bacteria | 1572 |
| 474 | Ga0207663_10167426 | 3300025916 | Bacteria | 1558 |
| 475 | Ga0207663_10266894 | 3300025916 | Bacteria | 1266 |
| 476 | Ga0207660_10137959 | 3300025917 | Bacteria | 1862 |
| 477 | Ga0207660_10390920 | 3300025917 | Bacteria | 1119 |
| 478 | Ga0207657_10044555 | 3300025919 | Bacteria | 3899 |
| 479 | Ga0207657_10238644 | 3300025919 | Bacteria | 1452 |
| 480 | Ga0207657_10294645 | 3300025919 | Bacteria | 1286 |
| 481 | Ga0207649_10075548 | 3300025920 | Bacteria | 2166 |
| 482 | Ga0207649_10091894 | 3300025920 | Bacteria | 1989 |
| 483 | Ga0207649_10245769 | 3300025920 | Bacteria | 1286 |
| 484 | Ga0207649_10545699 | 3300025920 | Bacteria | 886 |
| 485 | Ga0207652_10027112 | 3300025921 | Bacteria | 4774 |
| 486 | Ga0207652_10038672 | 3300025921 | Bacteria | 4046 |
| 487 | Ga0207652_10069643 | 3300025921 | Bacteria | 3054 |
| 488 | Ga0207652_10118799 | 3300025921 | Bacteria | 2350 |
| 489 | Ga0207652_10136727 | 3300025921 | Bacteria | 2189 |
| 490 | Ga0207652_10180742 | 3300025921 | Bacteria | 1896 |
| 491 | Ga0207652_10240198 | 3300025921 | Bacteria | 1633 |
| 492 | Ga0207652_10730551 | 3300025921 | Bacteria | 882 |
| 493 | Ga0207646_10278678 | 3300025922 | Bacteria | 1511 |
| 494 | Ga0207681_10064244 | 3300025923 | Bacteria | 2534 |
| 495 | Ga0207681_10294518 | 3300025923 | Bacteria | 1282 |
| 496 | Ga0207650_10019497 | 3300025925 | Bacteria | 4767 |
| 497 | Ga0207650_10048647 | 3300025925 | Bacteria | 3128 |
| 498 | Ga0207650_10306308 | 3300025925 | Bacteria | 1298 |
| 499 | Ga0207659_10001651 | 3300025926 | Bacteria | 13260 |
| 500 | Ga0207659_10140108 | 3300025926 | Bacteria | 1877 |
| 501 | Ga0207687_10008249 | 3300025927 | Bacteria | 6815 |
| 502 | Ga0207687_10141916 | 3300025927 | Bacteria | 1823 |
| 503 | Ga0207687_10576398 | 3300025927 | Bacteria | 946 |
| 504 | Ga0207700_10002188 | 3300025928 | Bacteria | 11212 |
| 505 | Ga0207700_10003970 | 3300025928 | Bacteria | 8655 |
| 506 | Ga0207700_10022181 | 3300025928 | Bacteria | 4351 |
| 507 | Ga0207700_10055560 | 3300025928 | Bacteria | 2977 |
| 508 | Ga0207700_10057722 | 3300025928 | Bacteria | 2928 |
| 509 | Ga0207700_10108579 | 3300025928 | Bacteria | 2228 |
| 510 | Ga0207664_10198228 | 3300025929 | Bacteria | 1732 |
| 511 | Ga0207664_10201580 | 3300025929 | Bacteria | 1718 |
| 512 | Ga0207664_10269635 | 3300025929 | Bacteria | 1491 |
| 513 | Ga0207664_10563891 | 3300025929 | Bacteria | 1022 |
| 514 | Ga0207664_10662917 | 3300025929 | Bacteria | 938 |
| 515 | Ga0207644_10000779 | 3300025931 | Bacteria | 20223 |
| 516 | Ga0207644_10005962 | 3300025931 | Bacteria | 7945 |
| 517 | Ga0207690_10092344 | 3300025932 | Bacteria | 2142 |
| 518 | Ga0207690_10096636 | 3300025932 | Bacteria | 2101 |
| 519 | Ga0207690_10133309 | 3300025932 | Bacteria | 1821 |
| 520 | Ga0207706_10027569 | 3300025933 | Bacteria | 5078 |
| 521 | Ga0207706_10044372 | 3300025933 | Bacteria | 3940 |
| 522 | Ga0207706_10090585 | 3300025933 | Bacteria | 2689 |
| 523 | Ga0207706_10267208 | 3300025933 | Bacteria | 1493 |
| 524 | Ga0207686_10059601 | 3300025934 | Bacteria | 2412 |
| 525 | Ga0207709_10002129 | 3300025935 | Bacteria | 12726 |
| 526 | Ga0207670_10021477 | 3300025936 | Bacteria | 3984 |
| 527 | Ga0207670_10034654 | 3300025936 | Bacteria | 3265 |
| 528 | Ga0207670_10554377 | 3300025936 | Bacteria | 939 |
| 529 | Ga0207669_10011456 | 3300025937 | Bacteria | 4316 |
| 530 | Ga0207669_10037041 | 3300025937 | Bacteria | 2794 |
| 531 | Ga0207704_10016603 | 3300025938 | Bacteria | 3788 |
| 532 | Ga0207704_10035183 | 3300025938 | Bacteria | 2867 |
| 533 | Ga0207665_10082708 | 3300025939 | Bacteria | 2213 |
| 534 | Ga0207665_10112384 | 3300025939 | Bacteria | 1915 |
| 535 | Ga0207665_10120553 | 3300025939 | Bacteria | 1852 |
| 536 | Ga0207665_10329685 | 3300025939 | Bacteria | 1147 |
| 537 | Ga0207691_10001631 | 3300025940 | Bacteria | 22281 |
| 538 | Ga0207691_10103559 | 3300025940 | Bacteria | 2538 |
| 539 | Ga0207691_10232304 | 3300025940 | Bacteria | 1597 |
| 540 | Ga0207691_10449061 | 3300025940 | Bacteria | 1097 |
| 541 | Ga0207711_10457199 | 3300025941 | Bacteria | 1189 |
| 542 | Ga0207711_10480301 | 3300025941 | Bacteria | 1158 |
| 543 | Ga0207689_10013931 | 3300025942 | Bacteria | 6849 |
| 544 | Ga0207689_10045378 | 3300025942 | Bacteria | 3634 |
| 545 | Ga0207689_10132306 | 3300025942 | Bacteria | 2053 |
| 546 | Ga0207661_10002496 | 3300025944 | Bacteria | 12664 |
| 547 | Ga0207679_10017717 | 3300025945 | Bacteria | 4757 |
| 548 | Ga0207679_10406152 | 3300025945 | Bacteria | 1199 |
| 549 | Ga0207667_10018061 | 3300025949 | Bacteria | 7921 |
| 550 | Ga0207667_10201406 | 3300025949 | Bacteria | 2042 |
| 551 | Ga0207667_10461876 | 3300025949 | Bacteria | 1289 |
| 552 | Ga0207651_10002318 | 3300025960 | Bacteria | 9071 |
| 553 | Ga0207651_10008556 | 3300025960 | Bacteria | 5534 |
| 554 | Ga0207712_10015592 | 3300025961 | Bacteria | 4906 |
| 555 | Ga0207668_10011978 | 3300025972 | Bacteria | 5292 |
| 556 | Ga0207668_10174640 | 3300025972 | Bacteria | 1688 |
| 557 | Ga0207668_10719631 | 3300025972 | Bacteria | 878 |
| 558 | Ga0207668_10737940 | 3300025972 | Bacteria | 868 |
| 559 | Ga0207668_11258936 | 3300025972 | Bacteria | 665 |
| 560 | Ga0207640_10100676 | 3300025981 | Bacteria | 2025 |
| 561 | Ga0207640_10149366 | 3300025981 | Bacteria | 1715 |
| 562 | Ga0207640_10149549 | 3300025981 | Bacteria | 1714 |
| 563 | Ga0207658_10024734 | 3300025986 | Bacteria | 4202 |
| 564 | Ga0207658_10660120 | 3300025986 | Bacteria | 943 |
| 565 | Ga0207677_10010826 | 3300026023 | Bacteria | 5173 |
| 566 | Ga0207677_10028736 | 3300026023 | Bacteria | 3523 |
| 567 | Ga0207703_10034858 | 3300026035 | Bacteria | 3996 |
| 568 | Ga0207703_10070074 | 3300026035 | Bacteria | 2893 |
| 569 | Ga0207703_10643299 | 3300026035 | Bacteria | 1005 |
| 570 | Ga0207639_10486409 | 3300026041 | Bacteria | 1125 |
| 571 | Ga0207678_10064705 | 3300026067 | Bacteria | 3142 |
| 572 | Ga0207678_10068174 | 3300026067 | Bacteria | 3053 |
| 573 | Ga0207678_10088555 | 3300026067 | Bacteria | 2645 |
| 574 | Ga0207678_10285453 | 3300026067 | Bacteria | 1417 |
| 575 | Ga0207678_10301172 | 3300026067 | Bacteria | 1378 |
| 576 | Ga0207678_10302123 | 3300026067 | Bacteria | 1375 |
| 577 | Ga0207678_10307095 | 3300026067 | Bacteria | 1364 |
| 578 | Ga0207678_10346111 | 3300026067 | Bacteria | 1281 |
| 579 | Ga0207678_10563613 | 3300026067 | Bacteria | 997 |
| 580 | Ga0207708_10027447 | 3300026075 | Bacteria | 4310 |
| 581 | Ga0207708_10097594 | 3300026075 | Bacteria | 2271 |
| 582 | Ga0207702_10000674 | 3300026078 | Bacteria | 37110 |
| 583 | Ga0207702_10068488 | 3300026078 | Bacteria | 3049 |
| 584 | Ga0207702_10390666 | 3300026078 | Bacteria | 1340 |
| 585 | Ga0207641_10007853 | 3300026088 | Bacteria | 8856 |
| 586 | Ga0207641_11103700 | 3300026088 | Bacteria | 792 |
| 587 | Ga0207648_10044649 | 3300026089 | Bacteria | 3889 |
| 588 | Ga0207648_10293826 | 3300026089 | Bacteria | 1455 |
| 589 | Ga0207676_10001534 | 3300026095 | Bacteria | 17044 |
| 590 | Ga0207676_10091000 | 3300026095 | Bacteria | 2505 |
| 591 | Ga0207674_10271829 | 3300026116 | Bacteria | 1642 |
| 592 | Ga0207674_10273056 | 3300026116 | Bacteria | 1638 |
| 593 | Ga0207675_100028015 | 3300026118 | Bacteria | 5245 |
| 594 | Ga0207675_100039525 | 3300026118 | Bacteria | 4402 |
| 595 | Ga0207675_100053074 | 3300026118 | Bacteria | 3783 |
| 596 | Ga0207675_100082002 | 3300026118 | Bacteria | 3024 |
| 597 | Ga0207675_100636759 | 3300026118 | Bacteria | 1071 |
| 598 | Ga0207683_10003123 | 3300026121 | Bacteria | 14468 |
| 599 | Ga0207683_10010904 | 3300026121 | Bacteria | 7751 |
| 600 | Ga0207698_10001896 | 3300026142 | Bacteria | 12250 |
| 601 | Ga0207698_10042683 | 3300026142 | Bacteria | 3391 |
| 602 | Ga0207698_10250403 | 3300026142 | Bacteria | 1620 |
| 603 | Ga0209588_1000977 | 3300027671 | Bacteria | 7339 |
| 604 | Ga0209588_1067825 | 3300027671 | Bacteria | 1153 |
| 605 | Ga0209813_10033110 | 3300027866 | Bacteria | 1535 |
| 606 | Ga0209813_10245165 | 3300027866 | Bacteria | 679 |
| 607 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 608 | Ga0268266_10003344 | 3300028379 | Bacteria | 16058 |
| 609 | Ga0268266_10088513 | 3300028379 | Bacteria | 2709 |
| 610 | Ga0268266_10449763 | 3300028379 | Bacteria | 1224 |
| 611 | Ga0268266_10571521 | 3300028379 | Bacteria | 1084 |
| 612 | Ga0268266_10685092 | 3300028379 | Bacteria | 987 |
| 613 | Ga0268265_10003368 | 3300028380 | Bacteria | 11515 |
| 614 | Ga0268265_10130187 | 3300028380 | Bacteria | 2089 |
| 615 | Ga0268265_10653474 | 3300028380 | Bacteria | 1011 |
| 616 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 617 | Ga0268264_10008893 | 3300028381 | Bacteria | 8329 |
| 618 | Ga0268264_10197408 | 3300028381 | Bacteria | 1838 |
| 619 | Ga0268264_10247626 | 3300028381 | Bacteria | 1654 |
| 620 | Ga0268264_10730053 | 3300028381 | Bacteria | 986 |
| 621 | Ga0265337_1012788 | 3300028556 | Bacteria | 2839 |
| 622 | Ga0265326_10003400 | 3300028558 | Bacteria | 5215 |
| 623 | Ga0265319_1014589 | 3300028563 | Bacteria | 3078 |
| 624 | Ga0265334_10004112 | 3300028573 | Bacteria | 6519 |
| 625 | Ga0265334_10123280 | 3300028573 | Bacteria | 925 |
| 626 | Ga0265318_10041448 | 3300028577 | Bacteria | 1750 |
| 627 | Ga0265323_10004703 | 3300028653 | Bacteria | 5853 |
| 628 | Ga0265336_10001567 | 3300028666 | Bacteria | 10262 |
| 629 | Ga0307517_10143425 | 3300028786 | Bacteria | 1667 |
| 630 | Ga0307515_10611535 | 3300028794 | Bacteria | 701 |
| 631 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 632 | Ga0265324_10006370 | 3300029957 | Bacteria | 4930 |
| 633 | Ga0265325_10013213 | 3300031241 | Bacteria | 4705 |
| 634 | Ga0265339_10108484 | 3300031249 | Bacteria | 1439 |
| 635 | Ga0265331_10058077 | 3300031250 | Bacteria | 1833 |
| 636 | Ga0265316_10854117 | 3300031344 | Bacteria | 637 |
| 637 | Ga0307509_10074244 | 3300031507 | Bacteria | 3537 |
| 638 | Ga0307509_10182360 | 3300031507 | Bacteria | 1962 |
| 639 | Ga0307509_10711080 | 3300031507 | Bacteria | 671 |
| 640 | Ga0307508_10076043 | 3300031616 | Bacteria | 2935 |
| 641 | Ga0307508_10135286 | 3300031616 | Bacteria | 2068 |
| 642 | Ga0307508_10487525 | 3300031616 | Bacteria | 827 |
| 643 | Ga0307508_10633827 | 3300031616 | Bacteria | 673 |
| 644 | Ga0265314_10005447 | 3300031711 | Bacteria | 11490 |
| 645 | Ga0265314_10024001 | 3300031711 | Bacteria | 4634 |
| 646 | Ga0265342_10128926 | 3300031712 | Bacteria | 1419 |
| 647 | Ga0307516_10059573 | 3300031730 | Bacteria | 3713 |
| 648 | Ga0307516_10265993 | 3300031730 | Bacteria | 1403 |
| 649 | Ga0307415_100063520 | 3300032126 | Bacteria | 2566 |
| 650 | Ga0307510_10003449 | 3300033180 | Bacteria | 18439 |
| 651 | Ga0307510_10019293 | 3300033180 | Bacteria | 8001 |
| 652 | Ga0373926_0010257 | 3300035083 | Bacteria | 3137 |
| 653 | Ga0373926_0017225 | 3300035083 | Bacteria | 2478 |
| 654 | Ga0373934_0013184 | 3300035086 | Bacteria | 3122 |
| 655 | Ga0373934_0013852 | 3300035086 | Bacteria | 3051 |
| 656 | Ga0373934_0033956 | 3300035086 | Bacteria | 2004 |
| 657 | Ga0373940_0014198 | 3300035088 | Bacteria | 1940 |
| 658 | Ga0373944_0006227 | 3300035089 | Bacteria | 3164 |
| 659 | Ga0373944_0039244 | 3300035089 | Bacteria | 1457 |
| 660 | Ga0373944_0095667 | 3300035089 | Bacteria | 998 |
| 661 | Ga0373952_0064952 | 3300035092 | Bacteria | 901 |
| 662 | Ga0373923_0006563 | 3300035111 | Bacteria | 4030 |
| 663 | Ga0373923_0008416 | 3300035111 | Bacteria | 3677 |
| 664 | Ga0373923_0042869 | 3300035111 | Bacteria | 1870 |
| 665 | Ga0373932_0099651 | 3300035112 | Bacteria | 944 |
| 666 | Ga0373936_0003229 | 3300035113 | Bacteria | 6115 |
| 667 | Ga0373936_0004735 | 3300035113 | Bacteria | 5141 |
| 668 | Ga0373936_0019424 | 3300035113 | Bacteria | 2633 |
| 669 | Ga0373945_0001310 | 3300035116 | Bacteria | 7546 |
| 670 | Ga0373945_0073354 | 3300035116 | Bacteria | 1299 |
| 671 | Ga0373953_0015054 | 3300035117 | Bacteria | 2794 |
| 672 | Ga0373953_0032257 | 3300035117 | Bacteria | 2042 |
| 673 | Ga0373954_0002403 | 3300035118 | Bacteria | 7844 |
| 674 | Ga0373954_0006338 | 3300035118 | Bacteria | 5158 |
| 675 | Ga0373954_0013491 | 3300035118 | Bacteria | 3642 |
| 676 | Ga0373956_0011739 | 3300035119 | Bacteria | 3615 |
| 677 | Ga0373956_0016342 | 3300035119 | Bacteria | 3116 |
| 678 | Ga0373956_0193556 | 3300035119 | Bacteria | 963 |
| 679 | Ga0373957_0004788 | 3300035120 | Bacteria | 4145 |
| 680 | Ga0373957_0047261 | 3300035120 | Bacteria | 1636 |
| 681 | Ga0373943_0003753 | 3300035170 | Bacteria | 6905 |
| 682 | Ga0373943_0008120 | 3300035170 | Bacteria | 4708 |
| 683 | Ga0373943_0043789 | 3300035170 | Bacteria | 2175 |
| 684 | Ga0373943_0086903 | 3300035170 | Bacteria | 1613 |
| 685 | Ga0373946_0003292 | 3300035171 | Bacteria | 5739 |
| 686 | Ga0373946_0010357 | 3300035171 | Bacteria | 3449 |
| 687 | Ga0373946_0082281 | 3300035171 | Bacteria | 1412 |
| 688 | Ga0373955_0058087 | 3300035172 | Bacteria | 2127 |
| 689 | Ga0373955_0071709 | 3300035172 | Bacteria | 1938 |
| 690 | Ga0373962_0139354 | 3300035242 | Bacteria | 787 |
| 691 | Ga0373962_0161103 | 3300035242 | Bacteria | 740 |
| 692 | Ga0373924_0006926 | 3300035410 | Bacteria | 4079 |
| 693 | Ga0373924_0018912 | 3300035410 | Bacteria | 2663 |
| 694 | Ga0373924_0042542 | 3300035410 | Bacteria | 1863 |
| 695 | Ga0373924_0048895 | 3300035410 | Bacteria | 1748 |
| 696 | Ga0373931_0083687 | 3300035691 | Bacteria | 1766 |
| 697 | Ga0373931_0382456 | 3300035691 | Bacteria | 888 |
| 698 | Ga0373935_0014513 | 3300035692 | Bacteria | 4754 |
| 699 | Ga0373935_0076609 | 3300035692 | Bacteria | 2166 |
| 700 | Ga0373927_0000121 | 3300035695 | Bacteria | 59449 |
| 701 | Ga0373927_0017851 | 3300035695 | Bacteria | 4666 |
| 702 | Ga0373927_0020402 | 3300035695 | Bacteria | 4345 |
| 703 | Ga0373927_0028965 | 3300035695 | Bacteria | 3610 |
| 704 | Ga0373927_0077200 | 3300035695 | Bacteria | 2157 |
| 705 | Ga0373933_0016314 | 3300035724 | Bacteria | 4150 |
| 706 | Ga0373933_0066179 | 3300035724 | Bacteria | 2189 |
| 707 | Ga0373947_0002018 | 3300035725 | Bacteria | 12396 |
| 708 | Ga0373947_0012161 | 3300035725 | Bacteria | 4928 |
| 709 | Ga0373947_0048562 | 3300035725 | Bacteria | 2546 |
| 710 | Ga0373937_0015887 | 3300036401 | Bacteria | 6676 |
| 711 | Ga0373937_0132615 | 3300036401 | Bacteria | 2327 |
| 712 | Ga0373937_0146362 | 3300036401 | Bacteria | 2211 |
| 713 | Ga0373937_0858404 | 3300036401 | Bacteria | 856 |
| 714 | Ga0373925_0002194 | 3300037068 | Bacteria | 15853 |
| 715 | Ga0373925_0139202 | 3300037068 | Bacteria | 1898 |
| 716 | Ga0373925_0177234 | 3300037068 | Bacteria | 1685 |
| 717 | Ga0373925_0236614 | 3300037068 | Bacteria | 1461 |
| 718 | Ga0373925_0376722 | 3300037068 | Bacteria | 1155 |
| 719 | Ga0373925_0929676 | 3300037068 | Bacteria | 716 |
| 720 | Ga0395900_0048549 | 3300037418 | Bacteria | 4373 |
| 721 | Ga0395900_0163654 | 3300037418 | Bacteria | 2268 |
| 722 | Ga0395901_0109506 | 3300038443 | Bacteria | 2900 |
| 723 | Ga0436365_0227213 | 3300039437 | Bacteria | 2604 |
| 724 | Ga0436365_0981833 | 3300039437 | Bacteria | 1184 |
| 725 | Ga0436365_1414818 | 3300039437 | Bacteria | 1128 |
| 726 | Ga0436365_1700201 | 3300039437 | Bacteria | 1401 |
| 727 | Ga0436360_0181084 | 3300039438 | Bacteria | 1163 |
| 728 | Ga0436360_0904398 | 3300039438 | Bacteria | 1992 |
| 729 | Ga0436361_0248601 | 3300039447 | Bacteria | 2522 |
| 730 | Ga0436361_0967620 | 3300039447 | Bacteria | 619 |
| 731 | Ga0436362_1193065 | 3300039453 | Bacteria | 3700 |
| 732 | Ga0451800_1097031 | 3300041459 | Bacteria | 681 |
| 733 | Ga0451800_1530629 | 3300041459 | Bacteria | 960 |
| 734 | Ga0451804_0681616 | 3300041463 | Bacteria | 1064 |
| 735 | Ga0451807_1488698 | 3300041486 | Bacteria | 1054 |
| 736 | Ga0451849_0839122 | 3300041505 | Bacteria | 844 |
| 737 | Ga0451853_2095703 | 3300041512 | Bacteria | 810 |
| 738 | Ga0466969_0171124 | 3300044656 | Bacteria | 996 |
| 739 | Ga0466966_0267902 | 3300044684 | Bacteria | 1028 |
| 740 | Ga0466963_0090475 | 3300044694 | Bacteria | 2084 |
| 741 | Ga0466968_0227927 | 3300044735 | Bacteria | 879 |
| 742 | Ga0466970_0024879 | 3300044765 | Bacteria | 3132 |
| 743 | Ga0466957_0084528 | 3300044842 | Bacteria | 1981 |
| 744 | Ga0466967_0070734 | 3300045976 | Bacteria | 3122 |
| 745 | Ga0466967_0095054 | 3300045976 | Bacteria | 2715 |
| 746 | Ga0466967_0132737 | 3300045976 | Bacteria | 2313 |
| 747 | Ga0495617_076057 | 3300046452 | Bacteria | 1102 |
| 748 | Ga0495592_0002856 | 3300046454 | Bacteria | 12273 |
| 749 | Ga0495592_0016464 | 3300046454 | Bacteria | 5610 |
| 750 | Ga0495592_0044107 | 3300046454 | Bacteria | 3333 |
| 751 | Ga0495592_0051867 | 3300046454 | Bacteria | 3047 |
| 752 | Ga0495603_0001782 | 3300046455 | Bacteria | 12698 |
| 753 | Ga0495603_0021236 | 3300046455 | Bacteria | 3930 |
| 754 | Ga0495603_0062365 | 3300046455 | Bacteria | 2201 |
| 755 | Ga0495603_0153283 | 3300046455 | Bacteria | 1338 |
| 756 | Ga0495629_0000242 | 3300046459 | Bacteria | 47556 |
| 757 | Ga0495629_0016212 | 3300046459 | Bacteria | 5349 |
| 758 | Ga0495629_0042588 | 3300046459 | Bacteria | 3190 |
| 759 | Ga0495629_0095751 | 3300046459 | Bacteria | 2071 |
| 760 | Ga0495629_0163904 | 3300046459 | Bacteria | 1544 |
| 761 | Ga0495638_0032269 | 3300046460 | Bacteria | 3359 |
| 762 | Ga0495641_0000994 | 3300046461 | Bacteria | 24305 |
| 763 | Ga0495641_0062494 | 3300046461 | Bacteria | 1679 |
| 764 | Ga0495641_0102668 | 3300046461 | Bacteria | 1276 |
| 765 | Ga0495651_0325275 | 3300046462 | Bacteria | 1023 |
| 766 | Ga0495653_0005558 | 3300046463 | Bacteria | 10277 |
| 767 | Ga0495653_0106668 | 3300046463 | Bacteria | 2020 |
| 768 | Ga0495653_0123174 | 3300046463 | Bacteria | 1844 |
| 769 | Ga0495580_0004514 | 3300046472 | Bacteria | 11688 |
| 770 | Ga0495580_0009026 | 3300046472 | Bacteria | 7872 |
| 771 | Ga0495580_0363803 | 3300046472 | Bacteria | 979 |
| 772 | Ga0495582_0000268 | 3300046473 | Bacteria | 29098 |
| 773 | Ga0495582_0030573 | 3300046473 | Bacteria | 2956 |
| 774 | Ga0495582_0041115 | 3300046473 | Bacteria | 2547 |
| 775 | Ga0495605_0055182 | 3300046474 | Bacteria | 1921 |
| 776 | Ga0495639_0000157 | 3300046475 | Bacteria | 35000 |
| 777 | Ga0495639_0004971 | 3300046475 | Bacteria | 5703 |
| 778 | Ga0495639_0027769 | 3300046475 | Bacteria | 2505 |
| 779 | Ga0495639_0139619 | 3300046475 | Bacteria | 1164 |
| 780 | Ga0495662_0007644 | 3300046476 | Bacteria | 5332 |
| 781 | Ga0495664_0019517 | 3300046477 | Bacteria | 3898 |
| 782 | Ga0495664_0022971 | 3300046477 | Bacteria | 3616 |
| 783 | Ga0495664_0029640 | 3300046477 | Bacteria | 3202 |
| 784 | Ga0495664_0131277 | 3300046477 | Bacteria | 1517 |
| 785 | Ga0495664_0141546 | 3300046477 | Bacteria | 1458 |
| 786 | Ga0495664_0489546 | 3300046477 | Bacteria | 735 |
| 787 | Ga0495584_0005529 | 3300046491 | Bacteria | 6690 |
| 788 | Ga0495584_0330211 | 3300046491 | Bacteria | 774 |
| 789 | Ga0495584_0438691 | 3300046491 | Bacteria | 664 |
| 790 | Ga0495585_0256373 | 3300046492 | Bacteria | 871 |
| 791 | Ga0495594_0059340 | 3300046499 | Bacteria | 2115 |
| 792 | Ga0495594_0059936 | 3300046499 | Bacteria | 2105 |
| 793 | Ga0495594_0067294 | 3300046499 | Bacteria | 1988 |
| 794 | Ga0495607_0102866 | 3300046501 | Bacteria | 1527 |
| 795 | Ga0495606_0003626 | 3300046507 | Bacteria | 16225 |
| 796 | Ga0495606_0061638 | 3300046507 | Bacteria | 2398 |
| 797 | Ga0495608_0017348 | 3300046511 | Bacteria | 4980 |
| 798 | Ga0495608_0147908 | 3300046511 | Bacteria | 1498 |
| 799 | Ga0495616_0040759 | 3300046513 | Bacteria | 2371 |
| 800 | Ga0495618_0046592 | 3300046514 | Bacteria | 2736 |
| 801 | Ga0495618_0064109 | 3300046514 | Bacteria | 2334 |
| 802 | Ga0495618_0177312 | 3300046514 | Bacteria | 1355 |
| 803 | Ga0495618_0197387 | 3300046514 | Bacteria | 1274 |
| 804 | Ga0495618_0323245 | 3300046514 | Bacteria | 955 |
| 805 | Ga0495628_0065041 | 3300046516 | Bacteria | 2854 |
| 806 | Ga0495628_0143907 | 3300046516 | Bacteria | 1818 |
| 807 | Ga0495630_0001544 | 3300046517 | Bacteria | 15994 |
| 808 | Ga0495630_0061693 | 3300046517 | Bacteria | 2815 |
| 809 | Ga0495630_0229290 | 3300046517 | Bacteria | 1419 |
| 810 | Ga0495631_0094192 | 3300046518 | Bacteria | 1289 |
| 811 | Ga0495632_0130226 | 3300046519 | Bacteria | 1171 |
| 812 | Ga0495637_0159743 | 3300046520 | Bacteria | 846 |
| 813 | Ga0495644_0170698 | 3300046523 | Bacteria | 835 |
| 814 | Ga0495666_0061310 | 3300046526 | Bacteria | 1797 |
| 815 | Ga0495666_0076141 | 3300046526 | Bacteria | 1590 |
| 816 | Ga0495666_0284240 | 3300046526 | Bacteria | 750 |
| 817 | Ga0495652_0023483 | 3300046529 | Bacteria | 5466 |
| 818 | Ga0495652_0063455 | 3300046529 | Bacteria | 3110 |
| 819 | Ga0495652_0080346 | 3300046529 | Bacteria | 2693 |
| 820 | Ga0495652_0110987 | 3300046529 | Bacteria | 2205 |
| 821 | Ga0495665_0000656 | 3300046531 | Bacteria | 17748 |
| 822 | Ga0495665_0010056 | 3300046531 | Bacteria | 5127 |
| 823 | Ga0495640_0012228 | 3300046533 | Bacteria | 6569 |
| 824 | Ga0495640_0029778 | 3300046533 | Bacteria | 3914 |
| 825 | Ga0495640_0061328 | 3300046533 | Bacteria | 2555 |
| 826 | Ga0495640_0070785 | 3300046533 | Bacteria | 2342 |
| 827 | Ga0495640_0078660 | 3300046533 | Bacteria | 2196 |
| 828 | Ga0495586_0045531 | 3300046535 | Bacteria | 2364 |
| 829 | Ga0495586_0219048 | 3300046535 | Bacteria | 1081 |
| 830 | Ga0495587_0006060 | 3300046536 | Bacteria | 7887 |
| 831 | Ga0495587_0079818 | 3300046536 | Bacteria | 1897 |
| 832 | Ga0495598_0005003 | 3300046537 | Bacteria | 2909 |
| 833 | Ga0495609_0029646 | 3300046538 | Bacteria | 2491 |
| 834 | Ga0495621_0218771 | 3300046539 | Bacteria | 770 |
| 835 | Ga0495597_0133386 | 3300046542 | Bacteria | 1029 |
| 836 | Ga0495645_0031198 | 3300046543 | Bacteria | 3883 |
| 837 | Ga0495645_0093671 | 3300046543 | Bacteria | 2143 |
| 838 | Ga0495645_0135760 | 3300046543 | Bacteria | 1721 |
| 839 | Ga0495645_0178467 | 3300046543 | Bacteria | 1457 |
| 840 | Ga0495645_0203931 | 3300046543 | Bacteria | 1339 |
| 841 | Ga0495622_0002769 | 3300046557 | Bacteria | 8377 |
| 842 | Ga0495622_0007792 | 3300046557 | Bacteria | 4973 |
| 843 | Ga0495622_0142197 | 3300046557 | Bacteria | 1089 |
| 844 | Ga0495633_0111508 | 3300046558 | Bacteria | 1268 |
| 845 | Ga0495667_0022864 | 3300046559 | Bacteria | 4212 |
| 846 | Ga0495667_0026566 | 3300046559 | Bacteria | 3902 |
| 847 | Ga0495667_0068906 | 3300046559 | Bacteria | 2309 |
| 848 | Ga0495667_0240343 | 3300046559 | Bacteria | 1154 |
| 849 | Ga0495667_0431653 | 3300046559 | Bacteria | 829 |
| 850 | Ga0495656_0023643 | 3300046615 | Bacteria | 2420 |
| 851 | Ga0495656_0028075 | 3300046615 | Bacteria | 2254 |
| 852 | Ga0495656_0045722 | 3300046615 | Bacteria | 1849 |
| 853 | Ga0495668_0185537 | 3300046616 | Bacteria | 1139 |
| 854 | Ga0495634_0000206 | 3300046642 | Bacteria | 55145 |
| 855 | Ga0495634_0033435 | 3300046642 | Bacteria | 3534 |
| 856 | Ga0495634_0145843 | 3300046642 | Bacteria | 1499 |
| 857 | Ga0495634_0290298 | 3300046642 | Bacteria | 991 |
| 858 | Ga0495611_0032374 | 3300046648 | Bacteria | 2304 |
| 859 | Ga0495611_0329325 | 3300046648 | Bacteria | 702 |
| 860 | Ga0495635_0000723 | 3300046663 | Bacteria | 21319 |
| 861 | Ga0495635_0004976 | 3300046663 | Bacteria | 9253 |
| 862 | Ga0495635_0010817 | 3300046663 | Bacteria | 6392 |
| 863 | Ga0495635_0043607 | 3300046663 | Bacteria | 3095 |
| 864 | Ga0495635_0080868 | 3300046663 | Bacteria | 2224 |
| 865 | Ga0495635_0176195 | 3300046663 | Bacteria | 1454 |
| 866 | Ga0495659_0001310 | 3300046664 | Bacteria | 8543 |
| 867 | Ga0495659_0371714 | 3300046664 | Bacteria | 613 |
| 868 | Ga0495661_0411654 | 3300046665 | Bacteria | 656 |
| 869 | Ga0495588_0001039 | 3300046674 | Bacteria | 12085 |
| 870 | Ga0495588_0067908 | 3300046674 | Bacteria | 1851 |
| 871 | Ga0495657_0008675 | 3300046675 | Bacteria | 7759 |
| 872 | Ga0495599_0028396 | 3300046678 | Bacteria | 3506 |
| 873 | Ga0495599_0088224 | 3300046678 | Bacteria | 1936 |
| 874 | Ga0495599_0486742 | 3300046678 | Bacteria | 727 |
| 875 | Ga0495623_0011265 | 3300046679 | Bacteria | 5783 |
| 876 | Ga0495623_0158719 | 3300046679 | Bacteria | 1331 |
| 877 | Ga0495623_0158918 | 3300046679 | Bacteria | 1330 |
| 878 | Ga0495623_0208408 | 3300046679 | Bacteria | 1120 |
| 879 | Ga0495646_0001912 | 3300046680 | Bacteria | 12528 |
| 880 | Ga0495646_0015182 | 3300046680 | Bacteria | 4892 |
| 881 | Ga0495647_0001229 | 3300046681 | Bacteria | 7899 |
| 882 | Ga0495647_0014983 | 3300046681 | Bacteria | 2709 |
| 883 | Ga0495647_0038885 | 3300046681 | Bacteria | 1800 |
| 884 | Ga0495658_0000188 | 3300046683 | Bacteria | 35609 |
| 885 | Ga0495658_0024424 | 3300046683 | Bacteria | 3219 |
| 886 | Ga0495658_0283737 | 3300046683 | Bacteria | 1045 |
| 887 | Ga0495669_0015310 | 3300046684 | Bacteria | 3284 |
| 888 | Ga0495669_0071113 | 3300046684 | Bacteria | 1586 |
| 889 | Ga0495669_0247332 | 3300046684 | Bacteria | 856 |
| 890 | Ga0495613_0013006 | 3300046689 | Bacteria | 6184 |
| 891 | Ga0495613_0034342 | 3300046689 | Bacteria | 3767 |
| 892 | Ga0495613_0054981 | 3300046689 | Bacteria | 2926 |
| 893 | Ga0495613_0119721 | 3300046689 | Bacteria | 1891 |
| 894 | Ga0495624_0007942 | 3300046690 | Bacteria | 7441 |
| 895 | Ga0495624_0034608 | 3300046690 | Bacteria | 3266 |
| 896 | Ga0495624_0083240 | 3300046690 | Bacteria | 1979 |
| 897 | Ga0495670_0059669 | 3300046691 | Bacteria | 1915 |
| 898 | Ga0495670_0093170 | 3300046691 | Bacteria | 1544 |
| 899 | Ga0495670_0253800 | 3300046691 | Bacteria | 938 |
| 900 | Ga0495649_0043160 | 3300046694 | Bacteria | 2462 |
| 901 | Ga0495589_0211536 | 3300046794 | Bacteria | 913 |
| 902 | Ga0495600_0001540 | 3300046809 | Bacteria | 12811 |
| 903 | Ga0495600_0333028 | 3300046809 | Bacteria | 953 |
| 904 | Ga0495581_0000166 | 3300047315 | Bacteria | 29591 |
| 905 | Ga0495581_0041029 | 3300047315 | Bacteria | 2678 |
| 906 | Ga0495581_0043324 | 3300047315 | Bacteria | 2603 |
| 907 | Ga0495581_0107245 | 3300047315 | Bacteria | 1624 |
| 908 | Ga0495581_0327316 | 3300047315 | Bacteria | 895 |
| 909 | Ga0495604_0004097 | 3300047317 | Bacteria | 11579 |
| 910 | Ga0495674_0009028 | 3300047319 | Bacteria | 9475 |
| 911 | Ga0495674_0067364 | 3300047319 | Bacteria | 3102 |
| 912 | Ga0495674_0136617 | 3300047319 | Bacteria | 2062 |
| 913 | Ga0495672_0051317 | 3300047320 | Bacteria | 2430 |
| 914 | Ga0495676_0175931 | 3300047321 | Bacteria | 1503 |
| 915 | Ga0495680_0044358 | 3300047322 | Bacteria | 3516 |
| 916 | Ga0495683_0135288 | 3300047323 | Bacteria | 1159 |
| 917 | Ga0495685_095158 | 3300047447 | Bacteria | 985 |
| 918 | Ga0495673_0098284 | 3300047469 | Bacteria | 1187 |
| 919 | Ga0495684_0010530 | 3300047471 | Bacteria | 7149 |
| 920 | Ga0495684_0019701 | 3300047471 | Bacteria | 5198 |
| 921 | Ga0495684_0035546 | 3300047471 | Bacteria | 3820 |
| 922 | Ga0495684_0077845 | 3300047471 | Bacteria | 2516 |
| 923 | Ga0495686_0057072 | 3300047472 | Bacteria | 2438 |
| 924 | Ga0495593_0000033 | 3300047673 | Bacteria | 58363 |
| 925 | Ga0495593_0031403 | 3300047673 | Bacteria | 2901 |
| 926 | Ga0495593_0043771 | 3300047673 | Bacteria | 2397 |
| 927 | Ga0495593_0052159 | 3300047673 | Bacteria | 2162 |
| 928 | Ga0495593_0070194 | 3300047673 | Bacteria | 1821 |
| 929 | Ga0495602_0033120 | 3300048088 | Bacteria | 4853 |
| 930 | Ga0495602_0073324 | 3300048088 | Bacteria | 2915 |
| 931 | Ga0495614_0039242 | 3300048089 | Bacteria | 2032 |
| 932 | Ga0495614_0136220 | 3300048089 | Bacteria | 1089 |
| 933 | Ga0495615_0055784 | 3300048090 | Bacteria | 1029 |
| 934 | Ga0496100_0079679 | 3300048903 | Bacteria | 2207 |
| 935 | Ga0496100_0089884 | 3300048903 | Bacteria | 2093 |
| 936 | Ga0496101_0000673 | 3300048904 | Bacteria | 20594 |
| 937 | Ga0496101_0075626 | 3300048904 | Bacteria | 2479 |
| 938 | Ga0496101_0099312 | 3300048904 | Bacteria | 2176 |
| 939 | Ga0496101_0989764 | 3300048904 | Bacteria | 661 |
| 940 | Ga0496102_0001987 | 3300048905 | Bacteria | 17654 |
| 941 | Ga0496102_0058766 | 3300048905 | Bacteria | 3515 |
| 942 | Ga0496102_0114298 | 3300048905 | Bacteria | 2518 |
| 943 | Ga0496102_0282305 | 3300048905 | Bacteria | 1565 |
| 944 | Ga0496103_0000999 | 3300048906 | Bacteria | 19887 |
| 945 | Ga0496103_0020025 | 3300048906 | Bacteria | 4017 |
| 946 | Ga0496103_0367871 | 3300048906 | Bacteria | 924 |
| 947 | Ga0496104_0002145 | 3300048907 | Bacteria | 17127 |
| 948 | Ga0496104_0018839 | 3300048907 | Bacteria | 6305 |
| 949 | Ga0496104_0020301 | 3300048907 | Bacteria | 6088 |
| 950 | Ga0496104_0128917 | 3300048907 | Bacteria | 2429 |
| 951 | Ga0496104_0328843 | 3300048907 | Bacteria | 1441 |
| 952 | Ga0496104_0374462 | 3300048907 | Bacteria | 1336 |
| 953 | Ga0496104_0586981 | 3300048907 | Bacteria | 1025 |
| 954 | Ga0496105_0016130 | 3300048908 | Bacteria | 5958 |
| 955 | Ga0496105_0084907 | 3300048908 | Bacteria | 2615 |
| 956 | Ga0496105_0120811 | 3300048908 | Bacteria | 2160 |
| 957 | Ga0496105_0154921 | 3300048908 | Bacteria | 1882 |
| 958 | Ga0496105_0278401 | 3300048908 | Bacteria | 1349 |
| 959 | Ga0496105_0305849 | 3300048908 | Bacteria | 1277 |
| 960 | Ga0496106_0003104 | 3300048909 | Bacteria | 12404 |
| 961 | Ga0496106_0013936 | 3300048909 | Bacteria | 5944 |
| 962 | Ga0496106_0172545 | 3300048909 | Bacteria | 1714 |
| 963 | Ga0496107_0006959 | 3300048910 | Bacteria | 7794 |
| 964 | Ga0496107_0016131 | 3300048910 | Bacteria | 5241 |
| 965 | Ga0496107_0037872 | 3300048910 | Bacteria | 3461 |
| 966 | Ga0496107_0050244 | 3300048910 | Bacteria | 3006 |
| 967 | Ga0496107_0158058 | 3300048910 | Bacteria | 1679 |
| 968 | Ga0496107_0927912 | 3300048910 | Bacteria | 634 |
| 969 | Ga0496108_0001682 | 3300048911 | Bacteria | 17531 |
| 970 | Ga0496108_0002900 | 3300048911 | Bacteria | 13769 |
| 971 | Ga0496108_0015092 | 3300048911 | Bacteria | 6305 |
| 972 | Ga0496108_0036158 | 3300048911 | Bacteria | 4108 |
| 973 | Ga0496108_0041472 | 3300048911 | Bacteria | 3842 |
| 974 | Ga0496108_0263732 | 3300048911 | Bacteria | 1499 |
| 975 | Ga0496108_0301191 | 3300048911 | Bacteria | 1396 |
| 976 | Ga0496109_0001620 | 3300048912 | Bacteria | 18810 |
| 977 | Ga0496109_0002875 | 3300048912 | Bacteria | 14407 |
| 978 | Ga0496109_0029417 | 3300048912 | Bacteria | 4919 |
| 979 | Ga0496109_0202475 | 3300048912 | Bacteria | 1866 |
| 980 | Ga0496109_0352381 | 3300048912 | Bacteria | 1390 |
| 981 | Ga0496109_0578591 | 3300048912 | Bacteria | 1058 |
| 982 | Ga0496109_0597428 | 3300048912 | Bacteria | 1040 |
| 983 | Ga0496110_0005302 | 3300048913 | Bacteria | 10092 |
| 984 | Ga0496110_0014112 | 3300048913 | Bacteria | 6624 |
| 985 | Ga0496110_0034780 | 3300048913 | Bacteria | 4367 |
| 986 | Ga0496110_0142471 | 3300048913 | Bacteria | 2167 |
| 987 | Ga0496110_0182319 | 3300048913 | Bacteria | 1906 |
| 988 | Ga0496110_0412970 | 3300048913 | Bacteria | 1230 |
| 989 | Ga0496111_0018545 | 3300048914 | Bacteria | 4822 |
| 990 | Ga0496111_0101097 | 3300048914 | Bacteria | 2118 |
| 991 | Ga0496111_0104913 | 3300048914 | Bacteria | 2079 |
| 992 | Ga0496111_0169225 | 3300048914 | Bacteria | 1623 |
| 993 | Ga0496111_0274517 | 3300048914 | Bacteria | 1250 |
| 994 | Ga0496111_0287837 | 3300048914 | Bacteria | 1218 |
| 995 | Ga0496111_0662864 | 3300048914 | Bacteria | 761 |
| 996 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 997 | Ga0496112_0003453 | 3300048915 | Bacteria | 13054 |
| 998 | Ga0496112_0004764 | 3300048915 | Bacteria | 11568 |
| 999 | Ga0496112_0026862 | 3300048915 | Bacteria | 5547 |
| 1000 | Ga0496112_0050391 | 3300048915 | Bacteria | 4083 |
| 1001 | Ga0496112_0098996 | 3300048915 | Bacteria | 2885 |
| 1002 | Ga0496112_0145251 | 3300048915 | Bacteria | 2340 |
| 1003 | Ga0496112_0303145 | 3300048915 | Bacteria | 1543 |
| 1004 | Ga0496112_0579652 | 3300048915 | Bacteria | 1054 |
| 1005 | Ga0496112_0609296 | 3300048915 | Bacteria | 1023 |
| 1006 | Ga0496112_0841080 | 3300048915 | Bacteria | 841 |
| 1007 | Ga0496113_0002010 | 3300048916 | Bacteria | 11669 |
| 1008 | Ga0496113_0005360 | 3300048916 | Bacteria | 7994 |
| 1009 | Ga0496113_0020026 | 3300048916 | Bacteria | 4694 |
| 1010 | Ga0496113_0042681 | 3300048916 | Bacteria | 3352 |
| 1011 | Ga0496113_0200268 | 3300048916 | Bacteria | 1587 |
| 1012 | Ga0496113_0316579 | 3300048916 | Bacteria | 1250 |
| 1013 | Ga0496113_0533758 | 3300048916 | Bacteria | 941 |
| 1014 | Ga0496114_0007584 | 3300048917 | Bacteria | 8579 |
| 1015 | Ga0496114_0066871 | 3300048917 | Bacteria | 3014 |
| 1016 | Ga0496114_0179193 | 3300048917 | Bacteria | 1850 |
| 1017 | Ga0496114_0281580 | 3300048917 | Bacteria | 1466 |
| 1018 | Ga0496115_0004354 | 3300048918 | Bacteria | 10246 |
| 1019 | Ga0496115_0031524 | 3300048918 | Bacteria | 4178 |
| 1020 | Ga0496115_0031615 | 3300048918 | Bacteria | 4170 |
| 1021 | Ga0496115_0201858 | 3300048918 | Bacteria | 1642 |
| 1022 | Ga0496115_0442714 | 3300048918 | Bacteria | 1050 |
| 1023 | Ga0496115_0853194 | 3300048918 | Bacteria | 705 |
| 1024 | Ga0496118_0137954 | 3300048921 | Bacteria | 1553 |
| 1025 | Ga0496119_0173488 | 3300048922 | Bacteria | 1137 |
| 1026 | Ga0496121_0070273 | 3300048924 | Bacteria | 2821 |
| 1027 | Ga0496121_0080720 | 3300048924 | Bacteria | 2577 |
| 1028 | Ga0496121_0099237 | 3300048924 | Bacteria | 2251 |
| 1029 | Ga0496121_0125205 | 3300048924 | Bacteria | 1933 |
| 1030 | Ga0496121_0562160 | 3300048924 | Bacteria | 711 |
| 1031 | Ga0496121_0667301 | 3300048924 | Bacteria | 631 |
| 1032 | Ga0496122_0202525 | 3300048925 | Bacteria | 1159 |
| 1033 | Ga0496124_0087618 | 3300048927 | Bacteria | 2546 |
| 1034 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 1035 | Ga0496125_0088429 | 3300048928 | Bacteria | 2335 |
| 1036 | Ga0496125_0183078 | 3300048928 | Bacteria | 1393 |
| 1037 | Ga0496126_0005072 | 3300048929 | Bacteria | 15276 |
| 1038 | Ga0496126_0005800 | 3300048929 | Bacteria | 13963 |
| 1039 | Ga0496126_0007510 | 3300048929 | Bacteria | 11940 |
| 1040 | Ga0496126_0035899 | 3300048929 | Bacteria | 4640 |
| 1041 | Ga0496126_0096139 | 3300048929 | Bacteria | 2597 |
| 1042 | Ga0496126_0098102 | 3300048929 | Bacteria | 2567 |
| 1043 | Ga0496126_0337064 | 3300048929 | Bacteria | 1236 |
| 1044 | Ga0496126_0368765 | 3300048929 | Bacteria | 1171 |
| 1045 | Ga0495682_0249392 | 3300049460 | Bacteria | 628 |
| 1046 | Ga0501069_0083026 | 3300049585 | Bacteria | 1806 |
| 1047 | Ga0501073_0523555 | 3300049589 | Bacteria | 819 |
| 1048 | nmdc:mga03683_11546_c1 | 3300050489 | Bacteria | 3200 |
| 1049 | nmdc:mga03n38_286473_c1 | 3300050490 | Bacteria | 881 |
| 1050 | nmdc:mga03n38_2872_c1 | 3300050490 | Bacteria | 5425 |
| 1051 | nmdc:mga03n38_422423_c1 | 3300050490 | Bacteria | 737 |
| 1052 | nmdc:mga03n38_88211_c1 | 3300050490 | Bacteria | 1471 |
| 1053 | nmdc:mga00v17_143671_c1 | 3300050491 | Bacteria | 1531 |
| 1054 | nmdc:mga00v17_226482_c1 | 3300050491 | Bacteria | 1211 |
| 1055 | nmdc:mga00v17_26363_c1 | 3300050491 | Bacteria | 3386 |
| 1056 | nmdc:mga00v17_285251_c1 | 3300050491 | Bacteria | 1072 |
| 1057 | nmdc:mga00v17_340057_c1 | 3300050491 | Bacteria | 976 |
| 1058 | nmdc:mga0yw44_190669_c1 | 3300050492 | Bacteria | 1352 |
| 1059 | nmdc:mga0yw44_2368_c1 | 3300050492 | Bacteria | 8005 |
| 1060 | nmdc:mga0yw44_71559_c1 | 3300050492 | Bacteria | 2153 |
| 1061 | nmdc:mga0yw44_8974_c1 | 3300050492 | Bacteria | 5019 |
| 1062 | nmdc:mga0k408_328580_c1 | 3300050493 | Bacteria | 912 |
| 1063 | nmdc:mga0k408_354434_c1 | 3300050493 | Bacteria | 875 |
| 1064 | nmdc:mga0k408_82113_c1 | 3300050493 | Bacteria | 1888 |
| 1065 | nmdc:mga0k408_8246_c1 | 3300050493 | Bacteria | 5589 |
| 1066 | nmdc:mga06z11_226934_c1 | 3300050494 | Bacteria | 1093 |
| 1067 | nmdc:mga06z11_46757_c1 | 3300050494 | Bacteria | 2195 |
| 1068 | nmdc:mga06z11_53381_c1 | 3300050494 | Bacteria | 2079 |
| 1069 | nmdc:mga06z11_5617_c1 | 3300050494 | Bacteria | 2105 |
| 1070 | nmdc:mga04h51_22634_c1 | 3300050495 | Bacteria | 1904 |
| 1071 | nmdc:mga04h51_277694_c1 | 3300050495 | Bacteria | 678 |
| 1072 | nmdc:mga04h51_50490_c1 | 3300050495 | Bacteria | 1394 |
| 1073 | nmdc:mga07m45_1086_c1 | 3300050496 | Bacteria | 12118 |
| 1074 | nmdc:mga07m45_55058_c1 | 3300050496 | Bacteria | 2248 |
| 1075 | nmdc:mga05p37_161675_c1 | 3300050507 | Bacteria | 2734 |
| 1076 | nmdc:mga05p37_19_c3 | 3300050507 | Bacteria | 27587 |
| 1077 | nmdc:mga05p37_282535_c1 | 3300050507 | Bacteria | 1979 |
| 1078 | nmdc:mga05p37_722819_c1 | 3300050507 | Bacteria | 1102 |
| 1079 | nmdc:mga09592_758_c1 | 3300050508 | Bacteria | 24836 |
| 1080 | nmdc:mga0qj67_1779_c1 | 3300050509 | Bacteria | 15251 |
| 1081 | nmdc:mga06r32_4145_c1 | 3300050510 | Bacteria | 12980 |
| 1082 | nmdc:mga08y16_13453_c1 | 3300050511 | Bacteria | 8611 |
| 1083 | nmdc:mga08y16_141563_c1 | 3300050511 | Bacteria | 2500 |
| 1084 | nmdc:mga0n895_1573_c1 | 3300050512 | Bacteria | 17177 |
| 1085 | nmdc:mga0rr50_223249_c1 | 3300050513 | Bacteria | 1556 |
| 1086 | nmdc:mga0rr50_390_c1 | 3300050513 | Bacteria | 23898 |
| 1087 | nmdc:mga08x19_108485_c1 | 3300050514 | Bacteria | 1849 |
| 1088 | nmdc:mga0a205_681_c1 | 3300050515 | Bacteria | 27171 |
| 1089 | nmdc:mga0sz30_289645_c1 | 3300050516 | Bacteria | 730 |
| 1090 | nmdc:mga0sz30_46587_c1 | 3300050516 | Bacteria | 1831 |
| 1091 | Ga0495601_0032597 | 3300053077 | Bacteria | 3244 |
| 1092 | Ga0495612_0004388 | 3300053078 | Bacteria | 5851 |
| 1093 | Ga0495612_0055763 | 3300053078 | Bacteria | 1630 |
| 1094 | Ga0500635_0174104 | 3300053080 | Bacteria | 829 |
| 1095 | Ga0495655_0017726 | 3300053083 | Bacteria | 1555 |
| 1096 | Ga0495595_0034010 | 3300053084 | Bacteria | 2303 |
| 1097 | Ga0495619_0000557 | 3300053085 | Bacteria | 24670 |
| 1098 | Ga0495619_0010203 | 3300053085 | Bacteria | 5917 |
| 1099 | Ga0495619_0140888 | 3300053085 | Bacteria | 1660 |
| 1100 | Ga0495619_0211656 | 3300053085 | Bacteria | 1342 |
| 1101 | Ga0500646_0250429 | 3300053090 | Bacteria | 623 |
| 1102 | Ga0500566_0001048 | 3300053094 | Bacteria | 16009 |
| 1103 | Ga0500566_0021105 | 3300053094 | Bacteria | 3831 |
| 1104 | Ga0500640_000214 | 3300053095 | Bacteria | 12549 |
| 1105 | Ga0500641_0099596 | 3300053096 | Bacteria | 1246 |
| 1106 | Ga0500554_002627 | 3300053102 | Bacteria | 3568 |
| 1107 | Ga0500554_065642 | 3300053102 | Bacteria | 1172 |
| 1108 | Ga0500572_000175 | 3300053111 | Bacteria | 22657 |
| 1109 | Ga0500595_000715 | 3300053119 | Bacteria | 19771 |
| 1110 | Ga0500608_006744 | 3300053122 | Bacteria | 4703 |
| 1111 | Ga0500614_001781 | 3300053123 | Bacteria | 4996 |
| 1112 | Ga0500559_0028447 | 3300053136 | Bacteria | 2388 |
| 1113 | Ga0500589_130597 | 3300053147 | Bacteria | 1050 |
| 1114 | Ga0500590_097380 | 3300053148 | Bacteria | 1418 |
| 1115 | Ga0500603_000394 | 3300053150 | Bacteria | 11457 |
| 1116 | Ga0500603_002027 | 3300053150 | Bacteria | 4486 |
| 1117 | Ga0500603_050322 | 3300053150 | Bacteria | 1138 |
| 1118 | Ga0500630_000213 | 3300053159 | Bacteria | 22563 |
| 1119 | Ga0500638_001677 | 3300053162 | Bacteria | 7185 |
| 1120 | Ga0500638_005668 | 3300053162 | Bacteria | 5012 |
| 1121 | Ga0500639_000239 | 3300053163 | Bacteria | 27228 |
| 1122 | Ga0500637_0000265 | 3300053178 | Bacteria | 19602 |
| 1123 | Ga0500637_0007251 | 3300053178 | Bacteria | 5532 |
| 1124 | Ga0500596_000367 | 3300053735 | Bacteria | 8162 |
| 1125 | Ga0500601_021336 | 3300053737 | Bacteria | 747 |
| 1126 | 2509149351 | 2508501128 | Bacteria | 8613869 |
| 1127 | 2513677418 | 2513237098 | Bacteria | 9902361 |
| 1128 | 2513891308 | 2513237141 | Bacteria | 8496279 |
| 1129 | 2524470441 | 2524023210 | Bacteria | 9029266 |
| 1130 | 2643758298 | 2643221547 | Bacteria | 4740017 |
| 1131 | 2885392470 | 2885383462 | Bacteria | 9473874 |
| 1132 | 2903769666 | 2903768456 | Bacteria | 9749579 |
| 1133 | 2922368631 | 2922361189 | Bacteria | 7436256 |
| 1134 | 8056684875 | 8056681323 | Bacteria | 8472857 |
| 1135 | Ga0496126_0426544 | |||
| 1136 | JGI24746J21847_1001317 | |||
| 1137 | JGI24743J22301_10003273 | |||
| 1138 | JGI24748J21848_1023147 | |||
| 1139 | JGI24749J21850_1001469 | |||
| 1140 | JGI24744J21845_10012247 | |||
| 1141 | JGI24034J26672_10010225 | |||
| 1142 | JGI24742J22300_10002785 | |||
| 1143 | JGI24751J29686_10006717 | |||
| 1144 | JGI25406J46586_10000034 | |||
| 1145 | JGI25153J46596_10017828 | |||
| 1146 | rootH2_10203984 | |||
| 1147 | rootH1_10036963 | |||
| 1148 | Ga0070658_10102993 | |||
| 1149 | Ga0070676_10134406 | |||
| 1150 | Ga0070676_10228397 | |||
| 1151 | Ga0070676_10372446 | |||
| 1152 | Ga0070683_100155781 | |||
| 1153 | Ga0070683_100468213 | |||
| 1154 | Ga0070683_101046387 | |||
| 1155 | Ga0070690_100053581 | |||
| 1156 | Ga0070690_100139306 | |||
| 1157 | Ga0070670_100007025 | |||
| 1158 | Ga0070670_100050801 | |||
| 1159 | Ga0070670_100051489 | |||
| 1160 | Ga0070670_100142493 | |||
| 1161 | Ga0070670_100326773 | |||
| 1162 | Ga0068869_100033241 | |||
| 1163 | Ga0068869_100040310 | |||
| 1164 | Ga0068869_100117592 | |||
| 1165 | Ga0068869_100181402 | |||
| 1166 | Ga0070666_10052370 | |||
| 1167 | Ga0070666_10071932 | |||
| 1168 | Ga0070680_100026227 | |||
| 1169 | Ga0070680_100056750 | |||
| 1170 | Ga0070680_100157997 | |||
| 1171 | Ga0070680_100331013 | |||
| 1172 | Ga0070680_100418593 | |||
| 1173 | Ga0070682_100036227 | |||
| 1174 | Ga0070682_100058817 | |||
| 1175 | Ga0070682_100468700 | |||
| 1176 | Ga0068868_100003160 | |||
| 1177 | Ga0068868_100003369 | |||
| 1178 | Ga0068868_101363076 | |||
| 1179 | Ga0070660_100106382 | |||
| 1180 | Ga0070660_100494141 | |||
| 1181 | Ga0070689_100052258 | |||
| 1182 | Ga0070689_100089648 | |||
| 1183 | Ga0070689_100205296 | |||
| 1184 | Ga0070689_100580831 | |||
| 1185 | Ga0070691_10086843 | |||
| 1186 | Ga0070691_10213767 | |||
| 1187 | Ga0070661_100142530 | |||
| 1188 | Ga0070661_100157347 | |||
| 1189 | Ga0070661_100174587 | |||
| 1190 | Ga0070692_10015119 | |||
| 1191 | Ga0070668_100037383 | |||
| 1192 | Ga0070668_100076047 | |||
| 1193 | Ga0070668_100797018 | |||
| 1194 | Ga0070669_100087524 | |||
| 1195 | Ga0070669_100456390 | |||
| 1196 | Ga0070675_100005711 | |||
| 1197 | Ga0070671_100001331 | |||
| 1198 | Ga0070671_100048277 | |||
| 1199 | Ga0070671_100100508 | |||
| 1200 | Ga0070671_100478701 | |||
| 1201 | Ga0070671_100816417 | |||
| 1202 | Ga0070674_100020473 | |||
| 1203 | Ga0070674_100374580 | |||
| 1204 | Ga0070674_100413895 | |||
| 1205 | Ga0070673_100001163 | |||
| 1206 | Ga0070673_100002176 | |||
| 1207 | Ga0070673_100006931 | |||
| 1208 | Ga0070673_100450586 | |||
| 1209 | Ga0070673_101217233 | |||
| 1210 | Ga0070688_100059515 | |||
| 1211 | Ga0070688_100076094 | |||
| 1212 | Ga0070688_100149997 | |||
| 1213 | Ga0070688_100514863 | |||
| 1214 | Ga0070659_100035456 | |||
| 1215 | Ga0070659_100086353 | |||
| 1216 | Ga0070659_100115476 | |||
| 1217 | Ga0070659_100127439 | |||
| 1218 | Ga0070659_100316712 | |||
| 1219 | Ga0070667_100020418 | |||
| 1220 | Ga0070667_100172638 | |||
| 1221 | Ga0070667_100767006 | |||
| 1222 | Ga0070667_100919963 | |||
| 1223 | Ga0070709_10012949 | |||
| 1224 | Ga0070714_100043951 | |||
| 1225 | Ga0070714_100074625 | |||
| 1226 | Ga0070714_100170865 | |||
| 1227 | Ga0070714_100177232 | |||
| 1228 | Ga0070713_100012383 | |||
| 1229 | Ga0070713_100016379 | |||
| 1230 | Ga0070713_100017742 | |||
| 1231 | Ga0070713_100019667 | |||
| 1232 | Ga0070713_100556931 | |||
| 1233 | Ga0070713_100959717 | |||
| 1234 | Ga0070710_10004585 | |||
| 1235 | Ga0070710_10024250 | |||
| 1236 | Ga0070710_10063463 | |||
| 1237 | Ga0070711_100013093 | |||
| 1238 | Ga0070711_100088479 | |||
| 1239 | Ga0070711_100110947 | |||
| 1240 | Ga0070711_100142854 | |||
| 1241 | Ga0070711_100196443 | |||
| 1242 | Ga0070705_100117187 | |||
| 1243 | Ga0070700_100069247 | |||
| 1244 | Ga0070700_100333471 | |||
| 1245 | Ga0070708_100263899 | |||
| 1246 | Ga0070663_100003656 | |||
| 1247 | Ga0070663_100004111 | |||
| 1248 | Ga0070663_100103355 | |||
| 1249 | Ga0070663_100108146 | |||
| 1250 | Ga0070663_100117737 | |||
| 1251 | Ga0070663_100250112 | |||
| 1252 | Ga0070663_100261970 | |||
| 1253 | Ga0070663_100887112 | |||
| 1254 | Ga0070678_100005384 | |||
| 1255 | Ga0070678_100034207 | |||
| 1256 | Ga0070678_100153160 | |||
| 1257 | Ga0070678_100173658 | |||
| 1258 | Ga0070678_100455159 | |||
| 1259 | Ga0070678_100864867 | |||
| 1260 | Ga0070662_100014566 | |||
| 1261 | Ga0070662_100090547 | |||
| 1262 | Ga0070662_100422775 | |||
| 1263 | Ga0070681_10076110 | |||
| 1264 | Ga0070681_10110910 | |||
| 1265 | Ga0070681_10128657 | |||
| 1266 | Ga0070681_10149452 | |||
| 1267 | Ga0070681_10150332 | |||
| 1268 | Ga0068867_100121343 | |||
| 1269 | Ga0068867_100301697 | |||
| 1270 | Ga0070685_10012017 | |||
| 1271 | Ga0070685_10216031 | |||
| 1272 | Ga0070707_100132939 | |||
| 1273 | Ga0070698_100236774 | |||
| 1274 | Ga0070698_100258194 | |||
| 1275 | Ga0070698_100305096 | |||
| 1276 | Ga0070699_100592119 | |||
| 1277 | Ga0070699_100649839 | |||
| 1278 | Ga0070679_100003933 | |||
| 1279 | Ga0070679_100005873 | |||
| 1280 | Ga0070679_100027524 | |||
| 1281 | Ga0070679_100030562 | |||
| 1282 | Ga0070679_100145182 | |||
| 1283 | Ga0070679_100181933 | |||
| 1284 | Ga0070679_100614809 | |||
| 1285 | Ga0070679_100891017 | |||
| 1286 | Ga0070684_100034666 | |||
| 1287 | Ga0070684_100054648 | |||
| 1288 | Ga0070684_100142084 | |||
| 1289 | Ga0070684_100198510 | |||
| 1290 | Ga0070684_100427650 | |||
| 1291 | Ga0070697_100263148 | |||
| 1292 | Ga0068853_100036895 | |||
| 1293 | Ga0068853_100555795 | |||
| 1294 | Ga0068853_100656480 | |||
| 1295 | Ga0070672_100120816 | |||
| 1296 | Ga0070672_100455714 | |||
| 1297 | Ga0070686_100003612 | |||
| 1298 | Ga0070686_100040601 | |||
| 1299 | Ga0070686_100072491 | |||
| 1300 | Ga0070686_100693701 | |||
| 1301 | Ga0070696_100476719 | |||
| 1302 | Ga0070693_100201906 | |||
| 1303 | Ga0070665_100025056 | |||
| 1304 | Ga0070665_100089220 | |||
| 1305 | Ga0070665_100103763 | |||
| 1306 | Ga0070665_100155533 | |||
| 1307 | Ga0070704_100055095 | |||
| 1308 | Ga0068855_100040685 | |||
| 1309 | Ga0068855_100109595 | |||
| 1310 | Ga0068855_100165838 | |||
| 1311 | Ga0068855_100261445 | |||
| 1312 | Ga0068855_100294417 | |||
| 1313 | Ga0068855_100795140 | |||
| 1314 | Ga0070664_100011896 | |||
| 1315 | Ga0070664_100235962 | |||
| 1316 | Ga0070664_100293951 | |||
| 1317 | Ga0070664_100421590 | |||
| 1318 | Ga0068857_100177624 | |||
| 1319 | Ga0068857_100796090 | |||
| 1320 | Ga0068854_100017570 | |||
| 1321 | Ga0068854_100105262 | |||
| 1322 | Ga0068854_100142458 | |||
| 1323 | Ga0068854_100371937 | |||
| 1324 | Ga0068854_100494685 | |||
| 1325 | Ga0068856_100000061 | |||
| 1326 | Ga0068856_100119855 | |||
| 1327 | Ga0068856_100164062 | |||
| 1328 | Ga0068856_100263946 | |||
| 1329 | Ga0068856_100756567 | |||
| 1330 | Ga0070702_100005192 | |||
| 1331 | Ga0070702_100051278 | |||
| 1332 | Ga0070702_100149467 | |||
| 1333 | Ga0068852_100162249 | |||
| 1334 | Ga0068852_100292199 | |||
| 1335 | Ga0068852_101250093 | |||
| 1336 | Ga0068859_100013198 | |||
| 1337 | Ga0068859_100038214 | |||
| 1338 | Ga0068859_100299145 | |||
| 1339 | Ga0068859_100341157 | |||
| 1340 | Ga0068859_100962691 | |||
| 1341 | Ga0068859_101560673 | |||
| 1342 | Ga0068864_100008218 | |||
| 1343 | Ga0068864_100052894 | |||
| 1344 | Ga0068866_10023345 | |||
| 1345 | Ga0068866_10203735 | |||
| 1346 | Ga0068861_100080957 | |||
| 1347 | Ga0068861_100166781 | |||
| 1348 | Ga0068851_10059509 | |||
| 1349 | Ga0068870_10000819 | |||
| 1350 | Ga0068870_10500430 | |||
| 1351 | Ga0068863_100008090 | |||
| 1352 | Ga0068863_100135706 | |||
| 1353 | Ga0068863_100179979 | |||
| 1354 | Ga0068858_100091622 | |||
| 1355 | Ga0068858_100150601 | |||
| 1356 | Ga0068858_100227893 | |||
| 1357 | Ga0068858_100392593 | |||
| 1358 | Ga0068858_100864366 | |||
| 1359 | Ga0068860_100000081 | |||
| 1360 | Ga0068860_100173161 | |||
| 1361 | Ga0068860_100301975 | |||
| 1362 | Ga0068860_100319594 | |||
| 1363 | Ga0068860_100379375 | |||
| 1364 | Ga0068860_100405930 | |||
| 1365 | Ga0068862_100145047 | |||
| 1366 | Ga0068862_100164141 | |||
| 1367 | Ga0068862_100167638 | |||
| 1368 | Ga0068862_100469245 | |||
| 1369 | Ga0081455_10040362 | |||
| 1370 | Ga0081455_10083231 | |||
| 1371 | Ga0081540_1001760 | |||
| 1372 | Ga0081540_1005540 | |||
| 1373 | Ga0081540_1013929 | |||
| 1374 | Ga0081540_1016188 | |||
| 1375 | Ga0081540_1041342 | |||
| 1376 | Ga0081540_1048993 | |||
| 1377 | Ga0081540_1065533 | |||
| 1378 | Ga0081539_10000113 | |||
| 1379 | Ga0070717_10000208 | |||
| 1380 | Ga0070717_10023506 | |||
| 1381 | Ga0070717_10079019 | |||
| 1382 | Ga0070717_10285023 | |||
| 1383 | Ga0070717_10300223 | |||
| 1384 | Ga0070717_10310672 | |||
| 1385 | Ga0075365_10004575 | |||
| 1386 | Ga0075365_10097763 | |||
| 1387 | Ga0075365_10256084 | |||
| 1388 | Ga0075368_10042765 | |||
| 1389 | Ga0075368_10094199 | |||
| 1390 | Ga0075368_10138416 | |||
| 1391 | Ga0075368_10145757 | |||
| 1392 | Ga0075363_100003841 | |||
| 1393 | Ga0075363_100055194 | |||
| 1394 | Ga0075363_100072416 | |||
| 1395 | Ga0075364_10039910 | |||
| 1396 | Ga0075432_10013108 | |||
| 1397 | Ga0070715_10004593 | |||
| 1398 | Ga0070715_10044791 | |||
| 1399 | Ga0070715_10126203 | |||
| 1400 | Ga0070715_10230664 | |||
| 1401 | Ga0070716_100002237 | |||
| 1402 | Ga0070716_100820874 | |||
| 1403 | Ga0070712_100003066 | |||
| 1404 | Ga0070712_100034839 | |||
| 1405 | Ga0070712_100073280 | |||
| 1406 | Ga0070712_100201131 | |||
| 1407 | Ga0075367_10005056 | |||
| 1408 | Ga0075367_10018056 | |||
| 1409 | Ga0075369_10021538 | |||
| 1410 | Ga0075369_10146918 | |||
| 1411 | Ga0075427_10001183 | |||
| 1412 | Ga0075366_10022697 | |||
| 1413 | Ga0075366_10036482 | |||
| 1414 | Ga0075366_10111482 | |||
| 1415 | Ga0097621_100016264 | |||
| 1416 | Ga0097621_100021881 | |||
| 1417 | Ga0097621_100134565 | |||
| 1418 | Ga0075370_10030966 | |||
| 1419 | Ga0075370_10164071 | |||
| 1420 | Ga0068871_100007371 | |||
| 1421 | Ga0068871_100190467 | |||
| 1422 | Ga0068871_100977269 | |||
| 1423 | Ga0075428_100010200 | |||
| 1424 | Ga0075428_100529691 | |||
| 1425 | Ga0075430_100001483 | |||
| 1426 | Ga0075431_100017410 | |||
| 1427 | Ga0075433_10002052 | |||
| 1428 | Ga0075434_100001473 | |||
| 1429 | Ga0075434_100138061 | |||
| 1430 | Ga0075434_100219840 | |||
| 1431 | Ga0075429_100005294 | |||
| 1432 | Ga0068865_100007918 | |||
| 1433 | Ga0068865_100513813 | |||
| 1434 | Ga0075436_100006832 | |||
| 1435 | Ga0075436_100397551 | |||
| 1436 | Ga0075436_100598571 | |||
| 1437 | Ga0097620_100013200 | |||
| 1438 | Ga0097620_100038215 | |||
| 1439 | Ga0097620_100299155 | |||
| 1440 | Ga0097620_100341155 | |||
| 1441 | Ga0097620_100962645 | |||
| 1442 | Ga0097620_101560637 | |||
| 1443 | Ga0075435_100034905 | |||
| 1444 | Ga0075435_100063487 | |||
| 1445 | Ga0099794_10002268 | |||
| 1446 | Ga0099795_10025328 | |||
| 1447 | Ga0099795_10034929 | |||
| 1448 | Ga0105244_10222873 | |||
| 1449 | Ga0105240_10128623 | |||
| 1450 | Ga0105240_10157827 | |||
| 1451 | Ga0105240_10167179 | |||
| 1452 | Ga0105240_10291530 | |||
| 1453 | Ga0105240_11093666 | |||
| 1454 | Ga0111539_10008538 | |||
| 1455 | Ga0111539_10131557 | |||
| 1456 | Ga0111539_10296445 | |||
| 1457 | Ga0111539_10784390 | |||
| 1458 | Ga0111539_11220365 | |||
| 1459 | Ga0105245_10041292 | |||
| 1460 | Ga0105245_10060774 | |||
| 1461 | Ga0105245_10669282 | |||
| 1462 | Ga0105247_10108262 | |||
| 1463 | Ga0105247_10140877 | |||
| 1464 | Ga0105247_10159068 | |||
| 1465 | Ga0105247_10309033 | |||
| 1466 | Ga0114129_10042454 | |||
| 1467 | Ga0114129_10046549 | |||
| 1468 | Ga0114129_10272398 | |||
| 1469 | Ga0114129_10275924 | |||
| 1470 | Ga0105243_10430511 | |||
| 1471 | Ga0105243_10952851 | |||
| 1472 | Ga0105241_10107391 | |||
| 1473 | Ga0105241_10358120 | |||
| 1474 | Ga0105241_10359512 | |||
| 1475 | Ga0105241_10421750 | |||
| 1476 | Ga0105242_10041657 | |||
| 1477 | Ga0105242_10060616 | |||
| 1478 | Ga0105242_10253475 | |||
| 1479 | Ga0105242_10908151 | |||
| 1480 | Ga0105248_10180880 | |||
| 1481 | Ga0105248_10504151 | |||
| 1482 | Ga0105237_10097272 | |||
| 1483 | Ga0105237_10115212 | |||
| 1484 | Ga0105237_10673642 | |||
| 1485 | Ga0105238_10028676 | |||
| 1486 | Ga0105238_10430024 | |||
| 1487 | Ga0105238_11756052 | |||
| 1488 | Ga0105249_10151920 | |||
| 1489 | Ga0105249_10367537 | |||
| 1490 | Ga0105249_10425526 | |||
| 1491 | Ga0099796_10016123 | |||
| 1492 | Ga0105239_10011139 | |||
| 1493 | Ga0105239_10219918 | |||
| 1494 | Ga0105239_10229696 | |||
| 1495 | Ga0105239_10529683 | |||
| 1496 | Ga0105239_11234141 | |||
| 1497 | Ga0105246_10021797 | |||
| 1498 | Ga0105246_10273237 | |||
| 1499 | Ga0105246_10354127 | |||
| 1500 | Ga0157344_1002933 | |||
| 1501 | Ga0157341_1004823 | |||
| 1502 | Ga0157316_1000481 | |||
| 1503 | Ga0157370_10030019 | |||
| 1504 | Ga0157370_10114031 | |||
| 1505 | Ga0157370_10785464 | |||
| 1506 | Ga0157369_10007421 | |||
| 1507 | Ga0157369_10016145 | |||
| 1508 | Ga0157369_10120105 | |||
| 1509 | Ga0157369_10182692 | |||
| 1510 | Ga0157369_10673579 | |||
| 1511 | Ga0157369_10749128 | |||
| 1512 | Ga0157374_10002946 | |||
| 1513 | Ga0157374_10021619 | |||
| 1514 | Ga0157374_10142292 | |||
| 1515 | Ga0157374_10195141 | |||
| 1516 | Ga0157374_11004924 | |||
| 1517 | Ga0157378_10009553 | |||
| 1518 | Ga0157378_10052128 | |||
| 1519 | Ga0157378_10054478 | |||
| 1520 | Ga0157378_10172400 | |||
| 1521 | Ga0163162_10089599 | |||
| 1522 | Ga0163162_10322270 | |||
| 1523 | Ga0163162_10370530 | |||
| 1524 | Ga0163162_10745775 | |||
| 1525 | Ga0157372_10065655 | |||
| 1526 | Ga0157372_10306621 | |||
| 1527 | Ga0157372_10555171 | |||
| 1528 | Ga0157372_11596853 | |||
| 1529 | Ga0157375_10012564 | |||
| 1530 | Ga0157375_10545597 | |||
| 1531 | Ga0163163_10013378 | |||
| 1532 | Ga0163163_10056723 | |||
| 1533 | Ga0163163_10120257 | |||
| 1534 | Ga0163163_10131190 | |||
| 1535 | Ga0163163_11048759 | |||
| 1536 | Ga0157380_10281869 | |||
| 1537 | Ga0157380_10960119 | |||
| 1538 | Ga0157377_10002479 | |||
| 1539 | Ga0157377_10112765 | |||
| 1540 | Ga0157377_10174155 | |||
| 1541 | Ga0157379_10007369 | |||
| 1542 | Ga0157379_10076935 | |||
| 1543 | Ga0157379_10084510 | |||
| 1544 | Ga0157379_10211016 | |||
| 1545 | Ga0157379_10241666 | |||
| 1546 | Ga0157379_10398711 | |||
| 1547 | Ga0157379_10452070 | |||
| 1548 | Ga0157376_10006417 | |||
| 1549 | Ga0157376_10072518 | |||
| 1550 | Ga0157376_10073211 | |||
| 1551 | Ga0157376_10079797 | |||
| 1552 | Ga0157376_10282843 | |||
| 1553 | Ga0157376_10330006 | |||
| 1554 | Ga0157376_10882803 | |||
| 1555 | Ga0163161_10124563 | |||
| 1556 | Ga0163161_10291676 | |||
| 1557 | Ga0163161_10421923 | |||
| 1558 | Ga0206354_10582287 | |||
| 1559 | Ga0213871_10002616 | |||
| 1560 | Ga0209758_1010882 | |||
| 1561 | Ga0209758_1011390 | |||
| 1562 | Ga0209758_1029404 | |||
| 1563 | Ga0207697_10132322 | |||
| 1564 | Ga0207653_10122163 | |||
| 1565 | Ga0207682_10085580 | |||
| 1566 | Ga0207692_10060370 | |||
| 1567 | Ga0207692_10114481 | |||
| 1568 | Ga0207692_10136513 | |||
| 1569 | Ga0207642_10127306 | |||
| 1570 | Ga0207642_10387681 | |||
| 1571 | Ga0207710_10029549 | |||
| 1572 | Ga0207710_10204619 | |||
| 1573 | Ga0207688_10010390 | |||
| 1574 | Ga0207688_10056255 | |||
| 1575 | Ga0207680_10074349 | |||
| 1576 | Ga0207680_10108586 | |||
| 1577 | Ga0207647_10022444 | |||
| 1578 | Ga0207685_10128661 | |||
| 1579 | Ga0207699_10022022 | |||
| 1580 | Ga0207699_10034223 | |||
| 1581 | Ga0207699_10073848 | |||
| 1582 | Ga0207699_10097037 | |||
| 1583 | Ga0207645_10121830 | |||
| 1584 | Ga0207645_10393701 | |||
| 1585 | Ga0207645_10408175 | |||
| 1586 | Ga0207643_10000675 | |||
| 1587 | Ga0207705_10630141 | |||
| 1588 | Ga0207684_10135572 | |||
| 1589 | Ga0207654_10059170 | |||
| 1590 | Ga0207654_10154524 | |||
| 1591 | Ga0207654_10264310 | |||
| 1592 | Ga0207707_10000916 | |||
| 1593 | Ga0207707_10051186 | |||
| 1594 | Ga0207707_10331608 | |||
| 1595 | Ga0207707_10339495 | |||
| 1596 | Ga0207695_10022496 | |||
| 1597 | Ga0207695_10029844 | |||
| 1598 | Ga0207695_10144086 | |||
| 1599 | Ga0207695_10761756 | |||
| 1600 | Ga0207671_10072463 | |||
| 1601 | Ga0207671_10095326 | |||
| 1602 | Ga0207693_10001243 | |||
| 1603 | Ga0207693_10100225 | |||
| 1604 | Ga0207693_10136454 | |||
| 1605 | Ga0207693_10512783 | |||
| 1606 | Ga0207663_10033274 | |||
| 1607 | Ga0207663_10163892 | |||
| 1608 | Ga0207663_10167426 | |||
| 1609 | Ga0207663_10266894 | |||
| 1610 | Ga0207660_10137959 | |||
| 1611 | Ga0207660_10390920 | |||
| 1612 | Ga0207657_10044555 | |||
| 1613 | Ga0207657_10238644 | |||
| 1614 | Ga0207657_10294645 | |||
| 1615 | Ga0207649_10075548 | |||
| 1616 | Ga0207649_10091894 | |||
| 1617 | Ga0207649_10245769 | |||
| 1618 | Ga0207649_10545699 | |||
| 1619 | Ga0207652_10027112 | |||
| 1620 | Ga0207652_10038672 | |||
| 1621 | Ga0207652_10069643 | |||
| 1622 | Ga0207652_10118799 | |||
| 1623 | Ga0207652_10136727 | |||
| 1624 | Ga0207652_10180742 | |||
| 1625 | Ga0207652_10240198 | |||
| 1626 | Ga0207652_10730551 | |||
| 1627 | Ga0207646_10278678 | |||
| 1628 | Ga0207681_10064244 | |||
| 1629 | Ga0207681_10294518 | |||
| 1630 | Ga0207650_10019497 | |||
| 1631 | Ga0207650_10048647 | |||
| 1632 | Ga0207650_10306308 | |||
| 1633 | Ga0207659_10001651 | |||
| 1634 | Ga0207659_10140108 | |||
| 1635 | Ga0207687_10008249 | |||
| 1636 | Ga0207687_10141916 | |||
| 1637 | Ga0207687_10576398 | |||
| 1638 | Ga0207700_10002188 | |||
| 1639 | Ga0207700_10003970 | |||
| 1640 | Ga0207700_10022181 | |||
| 1641 | Ga0207700_10055560 | |||
| 1642 | Ga0207700_10057722 | |||
| 1643 | Ga0207700_10108579 | |||
| 1644 | Ga0207664_10198228 | |||
| 1645 | Ga0207664_10201580 | |||
| 1646 | Ga0207664_10269635 | |||
| 1647 | Ga0207664_10563891 | |||
| 1648 | Ga0207664_10662917 | |||
| 1649 | Ga0207644_10000779 | |||
| 1650 | Ga0207644_10005962 | |||
| 1651 | Ga0207690_10092344 | |||
| 1652 | Ga0207690_10096636 | |||
| 1653 | Ga0207690_10133309 | |||
| 1654 | Ga0207706_10027569 | |||
| 1655 | Ga0207706_10044372 | |||
| 1656 | Ga0207706_10090585 | |||
| 1657 | Ga0207706_10267208 | |||
| 1658 | Ga0207686_10059601 | |||
| 1659 | Ga0207709_10002129 | |||
| 1660 | Ga0207670_10021477 | |||
| 1661 | Ga0207670_10034654 | |||
| 1662 | Ga0207670_10554377 | |||
| 1663 | Ga0207669_10011456 | |||
| 1664 | Ga0207669_10037041 | |||
| 1665 | Ga0207704_10016603 | |||
| 1666 | Ga0207704_10035183 | |||
| 1667 | Ga0207665_10082708 | |||
| 1668 | Ga0207665_10112384 | |||
| 1669 | Ga0207665_10120553 | |||
| 1670 | Ga0207665_10329685 | |||
| 1671 | Ga0207691_10001631 | |||
| 1672 | Ga0207691_10103559 | |||
| 1673 | Ga0207691_10232304 | |||
| 1674 | Ga0207691_10449061 | |||
| 1675 | Ga0207711_10457199 | |||
| 1676 | Ga0207711_10480301 | |||
| 1677 | Ga0207689_10013931 | |||
| 1678 | Ga0207689_10045378 | |||
| 1679 | Ga0207689_10132306 | |||
| 1680 | Ga0207661_10002496 | |||
| 1681 | Ga0207679_10017717 | |||
| 1682 | Ga0207679_10406152 | |||
| 1683 | Ga0207667_10018061 | |||
| 1684 | Ga0207667_10201406 | |||
| 1685 | Ga0207667_10461876 | |||
| 1686 | Ga0207651_10002318 | |||
| 1687 | Ga0207651_10008556 | |||
| 1688 | Ga0207712_10015592 | |||
| 1689 | Ga0207668_10011978 | |||
| 1690 | Ga0207668_10174640 | |||
| 1691 | Ga0207668_10719631 | |||
| 1692 | Ga0207668_10737940 | |||
| 1693 | Ga0207668_11258936 | |||
| 1694 | Ga0207640_10100676 | |||
| 1695 | Ga0207640_10149366 | |||
| 1696 | Ga0207640_10149549 | |||
| 1697 | Ga0207658_10024734 | |||
| 1698 | Ga0207658_10660120 | |||
| 1699 | Ga0207677_10010826 | |||
| 1700 | Ga0207677_10028736 | |||
| 1701 | Ga0207703_10034858 | |||
| 1702 | Ga0207703_10070074 | |||
| 1703 | Ga0207703_10643299 | |||
| 1704 | Ga0207639_10486409 | |||
| 1705 | Ga0207678_10064705 | |||
| 1706 | Ga0207678_10068174 | |||
| 1707 | Ga0207678_10088555 | |||
| 1708 | Ga0207678_10285453 | |||
| 1709 | Ga0207678_10301172 | |||
| 1710 | Ga0207678_10302123 | |||
| 1711 | Ga0207678_10307095 | |||
| 1712 | Ga0207678_10346111 | |||
| 1713 | Ga0207678_10563613 | |||
| 1714 | Ga0207708_10027447 | |||
| 1715 | Ga0207708_10097594 | |||
| 1716 | Ga0207702_10000674 | |||
| 1717 | Ga0207702_10068488 | |||
| 1718 | Ga0207702_10390666 | |||
| 1719 | Ga0207641_10007853 | |||
| 1720 | Ga0207641_11103700 | |||
| 1721 | Ga0207648_10044649 | |||
| 1722 | Ga0207648_10293826 | |||
| 1723 | Ga0207676_10001534 | |||
| 1724 | Ga0207676_10091000 | |||
| 1725 | Ga0207674_10271829 | |||
| 1726 | Ga0207674_10273056 | |||
| 1727 | Ga0207675_100028015 | |||
| 1728 | Ga0207675_100039525 | |||
| 1729 | Ga0207675_100053074 | |||
| 1730 | Ga0207675_100082002 | |||
| 1731 | Ga0207675_100636759 | |||
| 1732 | Ga0207683_10003123 | |||
| 1733 | Ga0207683_10010904 | |||
| 1734 | Ga0207698_10001896 | |||
| 1735 | Ga0207698_10042683 | |||
| 1736 | Ga0207698_10250403 | |||
| 1737 | Ga0209588_1000977 | |||
| 1738 | Ga0209588_1067825 | |||
| 1739 | Ga0209813_10033110 | |||
| 1740 | Ga0209813_10245165 | |||
| 1741 | Ga0207428_10000082 | |||
| 1742 | Ga0268266_10003344 | |||
| 1743 | Ga0268266_10088513 | |||
| 1744 | Ga0268266_10449763 | |||
| 1745 | Ga0268266_10571521 | |||
| 1746 | Ga0268266_10685092 | |||
| 1747 | Ga0268265_10003368 | |||
| 1748 | Ga0268265_10130187 | |||
| 1749 | Ga0268265_10653474 | |||
| 1750 | Ga0268264_10000048 | |||
| 1751 | Ga0268264_10008893 | |||
| 1752 | Ga0268264_10197408 | |||
| 1753 | Ga0268264_10247626 | |||
| 1754 | Ga0268264_10730053 | |||
| 1755 | Ga0265337_1012788 | |||
| 1756 | Ga0265326_10003400 | |||
| 1757 | Ga0265319_1014589 | |||
| 1758 | Ga0265334_10004112 | |||
| 1759 | Ga0265334_10123280 | |||
| 1760 | Ga0265318_10041448 | |||
| 1761 | Ga0265323_10004703 | |||
| 1762 | Ga0265336_10001567 | |||
| 1763 | Ga0307517_10143425 | |||
| 1764 | Ga0307515_10611535 | |||
| 1765 | Ga0265338_10000034 | |||
| 1766 | Ga0265324_10006370 | |||
| 1767 | Ga0265325_10013213 | |||
| 1768 | Ga0265339_10108484 | |||
| 1769 | Ga0265331_10058077 | |||
| 1770 | Ga0265316_10854117 | |||
| 1771 | Ga0307509_10074244 | |||
| 1772 | Ga0307509_10182360 | |||
| 1773 | Ga0307509_10711080 | |||
| 1774 | Ga0307508_10076043 | |||
| 1775 | Ga0307508_10135286 | |||
| 1776 | Ga0307508_10487525 | |||
| 1777 | Ga0307508_10633827 | |||
| 1778 | Ga0265314_10005447 | |||
| 1779 | Ga0265314_10024001 | |||
| 1780 | Ga0265342_10128926 | |||
| 1781 | Ga0307516_10059573 | |||
| 1782 | Ga0307516_10265993 | |||
| 1783 | Ga0307415_100063520 | |||
| 1784 | Ga0307510_10003449 | |||
| 1785 | Ga0307510_10019293 | |||
| 1786 | Ga0373926_0010257 | |||
| 1787 | Ga0373926_0017225 | |||
| 1788 | Ga0373934_0013184 | |||
| 1789 | Ga0373934_0013852 | |||
| 1790 | Ga0373934_0033956 | |||
| 1791 | Ga0373940_0014198 | |||
| 1792 | Ga0373944_0006227 | |||
| 1793 | Ga0373944_0039244 | |||
| 1794 | Ga0373944_0095667 | |||
| 1795 | Ga0373952_0064952 | |||
| 1796 | Ga0373923_0006563 | |||
| 1797 | Ga0373923_0008416 | |||
| 1798 | Ga0373923_0042869 | |||
| 1799 | Ga0373932_0099651 | |||
| 1800 | Ga0373936_0003229 | |||
| 1801 | Ga0373936_0004735 | |||
| 1802 | Ga0373936_0019424 | |||
| 1803 | Ga0373945_0001310 | |||
| 1804 | Ga0373945_0073354 | |||
| 1805 | Ga0373953_0015054 | |||
| 1806 | Ga0373953_0032257 | |||
| 1807 | Ga0373954_0002403 | |||
| 1808 | Ga0373954_0006338 | |||
| 1809 | Ga0373954_0013491 | |||
| 1810 | Ga0373956_0011739 | |||
| 1811 | Ga0373956_0016342 | |||
| 1812 | Ga0373956_0193556 | |||
| 1813 | Ga0373957_0004788 | |||
| 1814 | Ga0373957_0047261 | |||
| 1815 | Ga0373943_0003753 | |||
| 1816 | Ga0373943_0008120 | |||
| 1817 | Ga0373943_0043789 | |||
| 1818 | Ga0373943_0086903 | |||
| 1819 | Ga0373946_0003292 | |||
| 1820 | Ga0373946_0010357 | |||
| 1821 | Ga0373946_0082281 | |||
| 1822 | Ga0373955_0058087 | |||
| 1823 | Ga0373955_0071709 | |||
| 1824 | Ga0373962_0139354 | |||
| 1825 | Ga0373962_0161103 | |||
| 1826 | Ga0373924_0006926 | |||
| 1827 | Ga0373924_0018912 | |||
| 1828 | Ga0373924_0042542 | |||
| 1829 | Ga0373924_0048895 | |||
| 1830 | Ga0373931_0083687 | |||
| 1831 | Ga0373931_0382456 | |||
| 1832 | Ga0373935_0014513 | |||
| 1833 | Ga0373935_0076609 | |||
| 1834 | Ga0373927_0000121 | |||
| 1835 | Ga0373927_0017851 | |||
| 1836 | Ga0373927_0020402 | |||
| 1837 | Ga0373927_0028965 | |||
| 1838 | Ga0373927_0077200 | |||
| 1839 | Ga0373933_0016314 | |||
| 1840 | Ga0373933_0066179 | |||
| 1841 | Ga0373947_0002018 | |||
| 1842 | Ga0373947_0012161 | |||
| 1843 | Ga0373947_0048562 | |||
| 1844 | Ga0373937_0015887 | |||
| 1845 | Ga0373937_0132615 | |||
| 1846 | Ga0373937_0146362 | |||
| 1847 | Ga0373937_0858404 | |||
| 1848 | Ga0373925_0002194 | |||
| 1849 | Ga0373925_0139202 | |||
| 1850 | Ga0373925_0177234 | |||
| 1851 | Ga0373925_0236614 | |||
| 1852 | Ga0373925_0376722 | |||
| 1853 | Ga0373925_0929676 | |||
| 1854 | Ga0395900_0048549 | |||
| 1855 | Ga0395900_0163654 | |||
| 1856 | Ga0395901_0109506 | |||
| 1857 | Ga0436365_0227213 | |||
| 1858 | Ga0436365_0981833 | |||
| 1859 | Ga0436365_1414818 | |||
| 1860 | Ga0436365_1700201 | |||
| 1861 | Ga0436360_0181084 | |||
| 1862 | Ga0436360_0904398 | |||
| 1863 | Ga0436361_0248601 | |||
| 1864 | Ga0436361_0967620 | |||
| 1865 | Ga0436362_1193065 | |||
| 1866 | Ga0451800_1097031 | |||
| 1867 | Ga0451800_1530629 | |||
| 1868 | Ga0451804_0681616 | |||
| 1869 | Ga0451807_1488698 | |||
| 1870 | Ga0451849_0839122 | |||
| 1871 | Ga0451853_2095703 | |||
| 1872 | Ga0466969_0171124 | |||
| 1873 | Ga0466966_0267902 | |||
| 1874 | Ga0466963_0090475 | |||
| 1875 | Ga0466968_0227927 | |||
| 1876 | Ga0466970_0024879 | |||
| 1877 | Ga0466957_0084528 | |||
| 1878 | Ga0466967_0070734 | |||
| 1879 | Ga0466967_0095054 | |||
| 1880 | Ga0466967_0132737 | |||
| 1881 | Ga0495617_076057 | |||
| 1882 | Ga0495592_0002856 | |||
| 1883 | Ga0495592_0016464 | |||
| 1884 | Ga0495592_0044107 | |||
| 1885 | Ga0495592_0051867 | |||
| 1886 | Ga0495603_0001782 | |||
| 1887 | Ga0495603_0021236 | |||
| 1888 | Ga0495603_0062365 | |||
| 1889 | Ga0495603_0153283 | |||
| 1890 | Ga0495629_0000242 | |||
| 1891 | Ga0495629_0016212 | |||
| 1892 | Ga0495629_0042588 | |||
| 1893 | Ga0495629_0095751 | |||
| 1894 | Ga0495629_0163904 | |||
| 1895 | Ga0495638_0032269 | |||
| 1896 | Ga0495641_0000994 | |||
| 1897 | Ga0495641_0062494 | |||
| 1898 | Ga0495641_0102668 | |||
| 1899 | Ga0495651_0325275 | |||
| 1900 | Ga0495653_0005558 | |||
| 1901 | Ga0495653_0106668 | |||
| 1902 | Ga0495653_0123174 | |||
| 1903 | Ga0495580_0004514 | |||
| 1904 | Ga0495580_0009026 | |||
| 1905 | Ga0495580_0363803 | |||
| 1906 | Ga0495582_0000268 | |||
| 1907 | Ga0495582_0030573 | |||
| 1908 | Ga0495582_0041115 | |||
| 1909 | Ga0495605_0055182 | |||
| 1910 | Ga0495639_0000157 | |||
| 1911 | Ga0495639_0004971 | |||
| 1912 | Ga0495639_0027769 | |||
| 1913 | Ga0495639_0139619 | |||
| 1914 | Ga0495662_0007644 | |||
| 1915 | Ga0495664_0019517 | |||
| 1916 | Ga0495664_0022971 | |||
| 1917 | Ga0495664_0029640 | |||
| 1918 | Ga0495664_0131277 | |||
| 1919 | Ga0495664_0141546 | |||
| 1920 | Ga0495664_0489546 | |||
| 1921 | Ga0495584_0005529 | |||
| 1922 | Ga0495584_0330211 | |||
| 1923 | Ga0495584_0438691 | |||
| 1924 | Ga0495585_0256373 | |||
| 1925 | Ga0495594_0059340 | |||
| 1926 | Ga0495594_0059936 | |||
| 1927 | Ga0495594_0067294 | |||
| 1928 | Ga0495607_0102866 | |||
| 1929 | Ga0495606_0003626 | |||
| 1930 | Ga0495606_0061638 | |||
| 1931 | Ga0495608_0017348 | |||
| 1932 | Ga0495608_0147908 | |||
| 1933 | Ga0495616_0040759 | |||
| 1934 | Ga0495618_0046592 | |||
| 1935 | Ga0495618_0064109 | |||
| 1936 | Ga0495618_0177312 | |||
| 1937 | Ga0495618_0197387 | |||
| 1938 | Ga0495618_0323245 | |||
| 1939 | Ga0495628_0065041 | |||
| 1940 | Ga0495628_0143907 | |||
| 1941 | Ga0495630_0001544 | |||
| 1942 | Ga0495630_0061693 | |||
| 1943 | Ga0495630_0229290 | |||
| 1944 | Ga0495631_0094192 | |||
| 1945 | Ga0495632_0130226 | |||
| 1946 | Ga0495637_0159743 | |||
| 1947 | Ga0495644_0170698 | |||
| 1948 | Ga0495666_0061310 | |||
| 1949 | Ga0495666_0076141 | |||
| 1950 | Ga0495666_0284240 | |||
| 1951 | Ga0495652_0023483 | |||
| 1952 | Ga0495652_0063455 | |||
| 1953 | Ga0495652_0080346 | |||
| 1954 | Ga0495652_0110987 | |||
| 1955 | Ga0495665_0000656 | |||
| 1956 | Ga0495665_0010056 | |||
| 1957 | Ga0495640_0012228 | |||
| 1958 | Ga0495640_0029778 | |||
| 1959 | Ga0495640_0061328 | |||
| 1960 | Ga0495640_0070785 | |||
| 1961 | Ga0495640_0078660 | |||
| 1962 | Ga0495586_0045531 | |||
| 1963 | Ga0495586_0219048 | |||
| 1964 | Ga0495587_0006060 | |||
| 1965 | Ga0495587_0079818 | |||
| 1966 | Ga0495598_0005003 | |||
| 1967 | Ga0495609_0029646 | |||
| 1968 | Ga0495621_0218771 | |||
| 1969 | Ga0495597_0133386 | |||
| 1970 | Ga0495645_0031198 | |||
| 1971 | Ga0495645_0093671 | |||
| 1972 | Ga0495645_0135760 | |||
| 1973 | Ga0495645_0178467 | |||
| 1974 | Ga0495645_0203931 | |||
| 1975 | Ga0495622_0002769 | |||
| 1976 | Ga0495622_0007792 | |||
| 1977 | Ga0495622_0142197 | |||
| 1978 | Ga0495633_0111508 | |||
| 1979 | Ga0495667_0022864 | |||
| 1980 | Ga0495667_0026566 | |||
| 1981 | Ga0495667_0068906 | |||
| 1982 | Ga0495667_0240343 | |||
| 1983 | Ga0495667_0431653 | |||
| 1984 | Ga0495656_0023643 | |||
| 1985 | Ga0495656_0028075 | |||
| 1986 | Ga0495656_0045722 | |||
| 1987 | Ga0495668_0185537 | |||
| 1988 | Ga0495634_0000206 | |||
| 1989 | Ga0495634_0033435 | |||
| 1990 | Ga0495634_0145843 | |||
| 1991 | Ga0495634_0290298 | |||
| 1992 | Ga0495611_0032374 | |||
| 1993 | Ga0495611_0329325 | |||
| 1994 | Ga0495635_0000723 | |||
| 1995 | Ga0495635_0004976 | |||
| 1996 | Ga0495635_0010817 | |||
| 1997 | Ga0495635_0043607 | |||
| 1998 | Ga0495635_0080868 | |||
| 1999 | Ga0495635_0176195 | |||
| 2000 | Ga0495659_0001310 | |||
| 2001 | Ga0495659_0371714 | |||
| 2002 | Ga0495661_0411654 | |||
| 2003 | Ga0495588_0001039 | |||
| 2004 | Ga0495588_0067908 | |||
| 2005 | Ga0495657_0008675 | |||
| 2006 | Ga0495599_0028396 | |||
| 2007 | Ga0495599_0088224 | |||
| 2008 | Ga0495599_0486742 | |||
| 2009 | Ga0495623_0011265 | |||
| 2010 | Ga0495623_0158719 | |||
| 2011 | Ga0495623_0158918 | |||
| 2012 | Ga0495623_0208408 | |||
| 2013 | Ga0495646_0001912 | |||
| 2014 | Ga0495646_0015182 | |||
| 2015 | Ga0495647_0001229 | |||
| 2016 | Ga0495647_0014983 | |||
| 2017 | Ga0495647_0038885 | |||
| 2018 | Ga0495658_0000188 | |||
| 2019 | Ga0495658_0024424 | |||
| 2020 | Ga0495658_0283737 | |||
| 2021 | Ga0495669_0015310 | |||
| 2022 | Ga0495669_0071113 | |||
| 2023 | Ga0495669_0247332 | |||
| 2024 | Ga0495613_0013006 | |||
| 2025 | Ga0495613_0034342 | |||
| 2026 | Ga0495613_0054981 | |||
| 2027 | Ga0495613_0119721 | |||
| 2028 | Ga0495624_0007942 | |||
| 2029 | Ga0495624_0034608 | |||
| 2030 | Ga0495624_0083240 | |||
| 2031 | Ga0495670_0059669 | |||
| 2032 | Ga0495670_0093170 | |||
| 2033 | Ga0495670_0253800 | |||
| 2034 | Ga0495649_0043160 | |||
| 2035 | Ga0495589_0211536 | |||
| 2036 | Ga0495600_0001540 | |||
| 2037 | Ga0495600_0333028 | |||
| 2038 | Ga0495581_0000166 | |||
| 2039 | Ga0495581_0041029 | |||
| 2040 | Ga0495581_0043324 | |||
| 2041 | Ga0495581_0107245 | |||
| 2042 | Ga0495581_0327316 | |||
| 2043 | Ga0495604_0004097 | |||
| 2044 | Ga0495674_0009028 | |||
| 2045 | Ga0495674_0067364 | |||
| 2046 | Ga0495674_0136617 | |||
| 2047 | Ga0495672_0051317 | |||
| 2048 | Ga0495676_0175931 | |||
| 2049 | Ga0495680_0044358 | |||
| 2050 | Ga0495683_0135288 | |||
| 2051 | Ga0495685_095158 | |||
| 2052 | Ga0495673_0098284 | |||
| 2053 | Ga0495684_0010530 | |||
| 2054 | Ga0495684_0019701 | |||
| 2055 | Ga0495684_0035546 | |||
| 2056 | Ga0495684_0077845 | |||
| 2057 | Ga0495686_0057072 | |||
| 2058 | Ga0495593_0000033 | |||
| 2059 | Ga0495593_0031403 | |||
| 2060 | Ga0495593_0043771 | |||
| 2061 | Ga0495593_0052159 | |||
| 2062 | Ga0495593_0070194 | |||
| 2063 | Ga0495602_0033120 | |||
| 2064 | Ga0495602_0073324 | |||
| 2065 | Ga0495614_0039242 | |||
| 2066 | Ga0495614_0136220 | |||
| 2067 | Ga0495615_0055784 | |||
| 2068 | Ga0496100_0079679 | |||
| 2069 | Ga0496100_0089884 | |||
| 2070 | Ga0496101_0000673 | |||
| 2071 | Ga0496101_0075626 | |||
| 2072 | Ga0496101_0099312 | |||
| 2073 | Ga0496101_0989764 | |||
| 2074 | Ga0496102_0001987 | |||
| 2075 | Ga0496102_0058766 | |||
| 2076 | Ga0496102_0114298 | |||
| 2077 | Ga0496102_0282305 | |||
| 2078 | Ga0496103_0000999 | |||
| 2079 | Ga0496103_0020025 | |||
| 2080 | Ga0496103_0367871 | |||
| 2081 | Ga0496104_0002145 | |||
| 2082 | Ga0496104_0018839 | |||
| 2083 | Ga0496104_0020301 | |||
| 2084 | Ga0496104_0128917 | |||
| 2085 | Ga0496104_0328843 | |||
| 2086 | Ga0496104_0374462 | |||
| 2087 | Ga0496104_0586981 | |||
| 2088 | Ga0496105_0016130 | |||
| 2089 | Ga0496105_0084907 | |||
| 2090 | Ga0496105_0120811 | |||
| 2091 | Ga0496105_0154921 | |||
| 2092 | Ga0496105_0278401 | |||
| 2093 | Ga0496105_0305849 | |||
| 2094 | Ga0496106_0003104 | |||
| 2095 | Ga0496106_0013936 | |||
| 2096 | Ga0496106_0172545 | |||
| 2097 | Ga0496107_0006959 | |||
| 2098 | Ga0496107_0016131 | |||
| 2099 | Ga0496107_0037872 | |||
| 2100 | Ga0496107_0050244 | |||
| 2101 | Ga0496107_0158058 | |||
| 2102 | Ga0496107_0927912 | |||
| 2103 | Ga0496108_0001682 | |||
| 2104 | Ga0496108_0002900 | |||
| 2105 | Ga0496108_0015092 | |||
| 2106 | Ga0496108_0036158 | |||
| 2107 | Ga0496108_0041472 | |||
| 2108 | Ga0496108_0263732 | |||
| 2109 | Ga0496108_0301191 | |||
| 2110 | Ga0496109_0001620 | |||
| 2111 | Ga0496109_0002875 | |||
| 2112 | Ga0496109_0029417 | |||
| 2113 | Ga0496109_0202475 | |||
| 2114 | Ga0496109_0352381 | |||
| 2115 | Ga0496109_0578591 | |||
| 2116 | Ga0496109_0597428 | |||
| 2117 | Ga0496110_0005302 | |||
| 2118 | Ga0496110_0014112 | |||
| 2119 | Ga0496110_0034780 | |||
| 2120 | Ga0496110_0142471 | |||
| 2121 | Ga0496110_0182319 | |||
| 2122 | Ga0496110_0412970 | |||
| 2123 | Ga0496111_0018545 | |||
| 2124 | Ga0496111_0101097 | |||
| 2125 | Ga0496111_0104913 | |||
| 2126 | Ga0496111_0169225 | |||
| 2127 | Ga0496111_0274517 | |||
| 2128 | Ga0496111_0287837 | |||
| 2129 | Ga0496111_0662864 | |||
| 2130 | Ga0496112_0000017 | |||
| 2131 | Ga0496112_0003453 | |||
| 2132 | Ga0496112_0004764 | |||
| 2133 | Ga0496112_0026862 | |||
| 2134 | Ga0496112_0050391 | |||
| 2135 | Ga0496112_0098996 | |||
| 2136 | Ga0496112_0145251 | |||
| 2137 | Ga0496112_0303145 | |||
| 2138 | Ga0496112_0579652 | |||
| 2139 | Ga0496112_0609296 | |||
| 2140 | Ga0496112_0841080 | |||
| 2141 | Ga0496113_0002010 | |||
| 2142 | Ga0496113_0005360 | |||
| 2143 | Ga0496113_0020026 | |||
| 2144 | Ga0496113_0042681 | |||
| 2145 | Ga0496113_0200268 | |||
| 2146 | Ga0496113_0316579 | |||
| 2147 | Ga0496113_0533758 | |||
| 2148 | Ga0496114_0007584 | |||
| 2149 | Ga0496114_0066871 | |||
| 2150 | Ga0496114_0179193 | |||
| 2151 | Ga0496114_0281580 | |||
| 2152 | Ga0496115_0004354 | |||
| 2153 | Ga0496115_0031524 | |||
| 2154 | Ga0496115_0031615 | |||
| 2155 | Ga0496115_0201858 | |||
| 2156 | Ga0496115_0442714 | |||
| 2157 | Ga0496115_0853194 | |||
| 2158 | Ga0496118_0137954 | |||
| 2159 | Ga0496119_0173488 | |||
| 2160 | Ga0496121_0070273 | |||
| 2161 | Ga0496121_0080720 | |||
| 2162 | Ga0496121_0099237 | |||
| 2163 | Ga0496121_0125205 | |||
| 2164 | Ga0496121_0562160 | |||
| 2165 | Ga0496121_0667301 | |||
| 2166 | Ga0496122_0202525 | |||
| 2167 | Ga0496124_0087618 | |||
| 2168 | Ga0496125_0000040 | |||
| 2169 | Ga0496125_0088429 | |||
| 2170 | Ga0496125_0183078 | |||
| 2171 | Ga0496126_0005072 | |||
| 2172 | Ga0496126_0005800 | |||
| 2173 | Ga0496126_0007510 | |||
| 2174 | Ga0496126_0035899 | |||
| 2175 | Ga0496126_0096139 | |||
| 2176 | Ga0496126_0098102 | |||
| 2177 | Ga0496126_0337064 | |||
| 2178 | Ga0496126_0368765 | |||
| 2179 | Ga0495682_0249392 | |||
| 2180 | Ga0501069_0083026 | |||
| 2181 | Ga0501073_0523555 | |||
| 2182 | nmdc:mga03683_11546_c1 | |||
| 2183 | nmdc:mga03n38_286473_c1 | |||
| 2184 | nmdc:mga03n38_2872_c1 | |||
| 2185 | nmdc:mga03n38_422423_c1 | |||
| 2186 | nmdc:mga03n38_88211_c1 | |||
| 2187 | nmdc:mga00v17_143671_c1 | |||
| 2188 | nmdc:mga00v17_226482_c1 | |||
| 2189 | nmdc:mga00v17_26363_c1 | |||
| 2190 | nmdc:mga00v17_285251_c1 | |||
| 2191 | nmdc:mga00v17_340057_c1 | |||
| 2192 | nmdc:mga0yw44_190669_c1 | |||
| 2193 | nmdc:mga0yw44_2368_c1 | |||
| 2194 | nmdc:mga0yw44_71559_c1 | |||
| 2195 | nmdc:mga0yw44_8974_c1 | |||
| 2196 | nmdc:mga0k408_328580_c1 | |||
| 2197 | nmdc:mga0k408_354434_c1 | |||
| 2198 | nmdc:mga0k408_82113_c1 | |||
| 2199 | nmdc:mga0k408_8246_c1 | |||
| 2200 | nmdc:mga06z11_226934_c1 | |||
| 2201 | nmdc:mga06z11_46757_c1 | |||
| 2202 | nmdc:mga06z11_53381_c1 | |||
| 2203 | nmdc:mga06z11_5617_c1 | |||
| 2204 | nmdc:mga04h51_22634_c1 | |||
| 2205 | nmdc:mga04h51_277694_c1 | |||
| 2206 | nmdc:mga04h51_50490_c1 | |||
| 2207 | nmdc:mga07m45_1086_c1 | |||
| 2208 | nmdc:mga07m45_55058_c1 | |||
| 2209 | nmdc:mga05p37_161675_c1 | |||
| 2210 | nmdc:mga05p37_19_c3 | |||
| 2211 | nmdc:mga05p37_282535_c1 | |||
| 2212 | nmdc:mga05p37_722819_c1 | |||
| 2213 | nmdc:mga09592_758_c1 | |||
| 2214 | nmdc:mga0qj67_1779_c1 | |||
| 2215 | nmdc:mga06r32_4145_c1 | |||
| 2216 | nmdc:mga08y16_13453_c1 | |||
| 2217 | nmdc:mga08y16_141563_c1 | |||
| 2218 | nmdc:mga0n895_1573_c1 | |||
| 2219 | nmdc:mga0rr50_223249_c1 | |||
| 2220 | nmdc:mga0rr50_390_c1 | |||
| 2221 | nmdc:mga08x19_108485_c1 | |||
| 2222 | nmdc:mga0a205_681_c1 | |||
| 2223 | nmdc:mga0sz30_289645_c1 | |||
| 2224 | nmdc:mga0sz30_46587_c1 | |||
| 2225 | Ga0495601_0032597 | |||
| 2226 | Ga0495612_0004388 | |||
| 2227 | Ga0495612_0055763 | |||
| 2228 | Ga0500635_0174104 | |||
| 2229 | Ga0495655_0017726 | |||
| 2230 | Ga0495595_0034010 | |||
| 2231 | Ga0495619_0000557 | |||
| 2232 | Ga0495619_0010203 | |||
| 2233 | Ga0495619_0140888 | |||
| 2234 | Ga0495619_0211656 | |||
| 2235 | Ga0500646_0250429 | |||
| 2236 | Ga0500566_0001048 | |||
| 2237 | Ga0500566_0021105 | |||
| 2238 | Ga0500640_000214 | |||
| 2239 | Ga0500641_0099596 | |||
| 2240 | Ga0500554_002627 | |||
| 2241 | Ga0500554_065642 | |||
| 2242 | Ga0500572_000175 | |||
| 2243 | Ga0500595_000715 | |||
| 2244 | Ga0500608_006744 | |||
| 2245 | Ga0500614_001781 | |||
| 2246 | Ga0500559_0028447 | |||
| 2247 | Ga0500589_130597 | |||
| 2248 | Ga0500590_097380 | |||
| 2249 | Ga0500603_000394 | |||
| 2250 | Ga0500603_002027 | |||
| 2251 | Ga0500603_050322 | |||
| 2252 | Ga0500630_000213 | |||
| 2253 | Ga0500638_001677 | |||
| 2254 | Ga0500638_005668 | |||
| 2255 | Ga0500639_000239 | |||
| 2256 | Ga0500637_0000265 | |||
| 2257 | Ga0500637_0007251 | |||
| 2258 | Ga0500596_000367 | |||
| 2259 | Ga0500601_021336 | |||
| 2260 | 2509149351 | |||
| 2261 | 2513677418 | |||
| 2262 | 2513891308 | |||
| 2263 | 2524470441 | |||
| 2264 | 2643758298 | |||
| 2265 | 2885392470 | |||
| 2266 | 2903769666 | |||
| 2267 | 2922368631 | |||
| 2268 | 8056684875 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy