F490603

General Info

Members Datasets Scaffolds Average Seq Length
1134 438 2268 192

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0426544|Ga0496126_0426544_429_986
Length 185
Sequence MVVNASQDDPEKARRFRDAALPYLDDAYTLARYLLRDAADAEDAVQECYLRAYKHFDSYRGPAMKPWLFAILRNVCRAEYARRKTAPTAVEELPEGGEQAPLWNEAPETPEKQLLRRFDGDTVRKLVAALAEPFRETFVLREIQNLSYREIADVAAVPVGTVMSRLARARAMLRSAWLAEQEHVK

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
130 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
131 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
221 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
222 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
223 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
224 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
225 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
273 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
363 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
364 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
365 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
368 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
408 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
413 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
419 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
422 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
423 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
424 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
425 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
426 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
427 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
428 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
429 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
430 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
431 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
432 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
433 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
434 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
435 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
436 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
437 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
438 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.09
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0.53
Rhizoplane 8.29
Rhizosphere 79.98
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0426544 3300048929 Bacteria 1071
2 JGI24746J21847_1001317 3300001977 Bacteria 3957
3 JGI24743J22301_10003273 3300001991 Bacteria 2548
4 JGI24748J21848_1023147 3300002074 Bacteria 753
5 JGI24749J21850_1001469 3300002076 Bacteria 3331
6 JGI24744J21845_10012247 3300002077 Bacteria 1744
7 JGI24034J26672_10010225 3300002239 Bacteria 1391
8 JGI24742J22300_10002785 3300002244 Bacteria 2820
9 JGI24751J29686_10006717 3300002459 Bacteria 2345
10 JGI25406J46586_10000034 3300003203 Bacteria 64645
11 JGI25153J46596_10017828 3300003215 Bacteria 2780
12 rootH2_10203984 3300003320 Bacteria 1389
13 rootH1_10036963 3300003323 Bacteria 1277
14 Ga0070658_10102993 3300005327 Bacteria 2361
15 Ga0070676_10134406 3300005328 Bacteria 1567
16 Ga0070676_10228397 3300005328 Bacteria 1233
17 Ga0070676_10372446 3300005328 Bacteria 987
18 Ga0070683_100155781 3300005329 Bacteria 2166
19 Ga0070683_100468213 3300005329 Bacteria 1203
20 Ga0070683_101046387 3300005329 Bacteria 784
21 Ga0070690_100053581 3300005330 Bacteria 2581
22 Ga0070690_100139306 3300005330 Bacteria 1646
23 Ga0070670_100007025 3300005331 Bacteria 9538
24 Ga0070670_100050801 3300005331 Bacteria 3562
25 Ga0070670_100051489 3300005331 Bacteria 3536
26 Ga0070670_100142493 3300005331 Bacteria 2073
27 Ga0070670_100326773 3300005331 Bacteria 1344
28 Ga0068869_100033241 3300005334 Bacteria 3641
29 Ga0068869_100040310 3300005334 Bacteria 3339
30 Ga0068869_100117592 3300005334 Bacteria 2029
31 Ga0068869_100181402 3300005334 Bacteria 1650
32 Ga0070666_10052370 3300005335 Bacteria 2751
33 Ga0070666_10071932 3300005335 Bacteria 2354
34 Ga0070680_100026227 3300005336 Bacteria 4660
35 Ga0070680_100056750 3300005336 Bacteria 3201
36 Ga0070680_100157997 3300005336 Bacteria 1905
37 Ga0070680_100331013 3300005336 Bacteria 1294
38 Ga0070680_100418593 3300005336 Unclassified 1143
39 Ga0070682_100036227 3300005337 Bacteria 3015
40 Ga0070682_100058817 3300005337 Bacteria 2425
41 Ga0070682_100468700 3300005337 Bacteria 969
42 Ga0068868_100003160 3300005338 Bacteria 11463
43 Ga0068868_100003369 3300005338 Bacteria 11116
44 Ga0068868_101363076 3300005338 Bacteria 660
45 Ga0070660_100106382 3300005339 Bacteria 2228
46 Ga0070660_100494141 3300005339 Bacteria 1018
47 Ga0070689_100052258 3300005340 Bacteria 3160
48 Ga0070689_100089648 3300005340 Bacteria 2422
49 Ga0070689_100205296 3300005340 Bacteria 1611
50 Ga0070689_100580831 3300005340 Bacteria 969
51 Ga0070691_10086843 3300005341 Bacteria 1538
52 Ga0070691_10213767 3300005341 Unclassified 1019
53 Ga0070661_100142530 3300005344 Bacteria 1807
54 Ga0070661_100157347 3300005344 Bacteria 1719
55 Ga0070661_100174587 3300005344 Bacteria 1633
56 Ga0070692_10015119 3300005345 Bacteria 3643
57 Ga0070668_100037383 3300005347 Bacteria 3707
58 Ga0070668_100076047 3300005347 Bacteria 2622
59 Ga0070668_100797018 3300005347 Bacteria 839
60 Ga0070669_100087524 3300005353 Bacteria 2329
61 Ga0070669_100456390 3300005353 Bacteria 1054
62 Ga0070675_100005711 3300005354 Bacteria 9519
63 Ga0070671_100001331 3300005355 Bacteria 18540
64 Ga0070671_100048277 3300005355 Bacteria 3539
65 Ga0070671_100100508 3300005355 Bacteria 2427
66 Ga0070671_100478701 3300005355 Bacteria 1070
67 Ga0070671_100816417 3300005355 Bacteria 812
68 Ga0070674_100020473 3300005356 Bacteria 4228
69 Ga0070674_100374580 3300005356 Bacteria 1156
70 Ga0070674_100413895 3300005356 Bacteria 1104
71 Ga0070673_100001163 3300005364 Bacteria 15102
72 Ga0070673_100002176 3300005364 Bacteria 11868
73 Ga0070673_100006931 3300005364 Bacteria 7413
74 Ga0070673_100450586 3300005364 Bacteria 1158
75 Ga0070673_101217233 3300005364 Bacteria 706
76 Ga0070688_100059515 3300005365 Bacteria 2409
77 Ga0070688_100076094 3300005365 Bacteria 2159
78 Ga0070688_100149997 3300005365 Bacteria 1593
79 Ga0070688_100514863 3300005365 Bacteria 905
80 Ga0070659_100035456 3300005366 Bacteria 3885
81 Ga0070659_100086353 3300005366 Bacteria 2510
82 Ga0070659_100115476 3300005366 Bacteria 2170
83 Ga0070659_100127439 3300005366 Bacteria 2066
84 Ga0070659_100316712 3300005366 Bacteria 1303
85 Ga0070667_100020418 3300005367 Bacteria 5499
86 Ga0070667_100172638 3300005367 Bacteria 1909
87 Ga0070667_100767006 3300005367 Bacteria 895
88 Ga0070667_100919963 3300005367 Bacteria 814
89 Ga0070709_10012949 3300005434 Bacteria 4678
90 Ga0070714_100043951 3300005435 Bacteria 3781
91 Ga0070714_100074625 3300005435 Bacteria 2941
92 Ga0070714_100170865 3300005435 Bacteria 1973
93 Ga0070714_100177232 3300005435 Bacteria 1938
94 Ga0070713_100012383 3300005436 Bacteria 6253
95 Ga0070713_100016379 3300005436 Bacteria 5574
96 Ga0070713_100017742 3300005436 Bacteria 5395
97 Ga0070713_100019667 3300005436 Bacteria 5164
98 Ga0070713_100556931 3300005436 Bacteria 1086
99 Ga0070713_100959717 3300005436 Bacteria 824
100 Ga0070710_10004585 3300005437 Bacteria 6528
101 Ga0070710_10024250 3300005437 Bacteria 3198
102 Ga0070710_10063463 3300005437 Bacteria 2110
103 Ga0070711_100013093 3300005439 Bacteria 5202
104 Ga0070711_100088479 3300005439 Bacteria 2225
105 Ga0070711_100110947 3300005439 Bacteria 2013
106 Ga0070711_100142854 3300005439 Bacteria 1796
107 Ga0070711_100196443 3300005439 Bacteria 1554
108 Ga0070705_100117187 3300005440 Bacteria 1713
109 Ga0070700_100069247 3300005441 Bacteria 2246
110 Ga0070700_100333471 3300005441 Bacteria 1119
111 Ga0070708_100263899 3300005445 Bacteria 1619
112 Ga0070663_100003656 3300005455 Bacteria 8909
113 Ga0070663_100004111 3300005455 Bacteria 8499
114 Ga0070663_100103355 3300005455 Bacteria 2130
115 Ga0070663_100108146 3300005455 Bacteria 2085
116 Ga0070663_100117737 3300005455 Bacteria 2003
117 Ga0070663_100250112 3300005455 Bacteria 1402
118 Ga0070663_100261970 3300005455 Bacteria 1372
119 Ga0070663_100887112 3300005455 Bacteria 770
120 Ga0070678_100005384 3300005456 Bacteria 7385
121 Ga0070678_100034207 3300005456 Bacteria 3537
122 Ga0070678_100153160 3300005456 Bacteria 1859
123 Ga0070678_100173658 3300005456 Bacteria 1758
124 Ga0070678_100455159 3300005456 Bacteria 1122
125 Ga0070678_100864867 3300005456 Bacteria 824
126 Ga0070662_100014566 3300005457 Bacteria 5257
127 Ga0070662_100090547 3300005457 Bacteria 2296
128 Ga0070662_100422775 3300005457 Bacteria 1103
129 Ga0070681_10076110 3300005458 Bacteria 3315
130 Ga0070681_10110910 3300005458 Bacteria 2683
131 Ga0070681_10128657 3300005458 Bacteria 2465
132 Ga0070681_10149452 3300005458 Bacteria 2263
133 Ga0070681_10150332 3300005458 Bacteria 2255
134 Ga0068867_100121343 3300005459 Bacteria 2021
135 Ga0068867_100301697 3300005459 Bacteria 1321
136 Ga0070685_10012017 3300005466 Bacteria 4539
137 Ga0070685_10216031 3300005466 Bacteria 1254
138 Ga0070707_100132939 3300005468 Bacteria 2420
139 Ga0070698_100236774 3300005471 Bacteria 1759
140 Ga0070698_100258194 3300005471 Bacteria 1675
141 Ga0070698_100305096 3300005471 Bacteria 1523
142 Ga0070699_100592119 3300005518 Bacteria 1011
143 Ga0070699_100649839 3300005518 Bacteria 963
144 Ga0070679_100003933 3300005530 Bacteria 13668
145 Ga0070679_100005873 3300005530 Bacteria 11399
146 Ga0070679_100027524 3300005530 Bacteria 5597
147 Ga0070679_100030562 3300005530 Bacteria 5317
148 Ga0070679_100145182 3300005530 Bacteria 2351
149 Ga0070679_100181933 3300005530 Bacteria 2074
150 Ga0070679_100614809 3300005530 Bacteria 1030
151 Ga0070679_100891017 3300005530 Bacteria 833
152 Ga0070684_100034666 3300005535 Bacteria 4316
153 Ga0070684_100054648 3300005535 Bacteria 3479
154 Ga0070684_100142084 3300005535 Bacteria 2171
155 Ga0070684_100198510 3300005535 Bacteria 1827
156 Ga0070684_100427650 3300005535 Bacteria 1223
157 Ga0070697_100263148 3300005536 Bacteria 1477
158 Ga0068853_100036895 3300005539 Bacteria 4157
159 Ga0068853_100555795 3300005539 Bacteria 1088
160 Ga0068853_100656480 3300005539 Bacteria 999
161 Ga0070672_100120816 3300005543 Bacteria 2144
162 Ga0070672_100455714 3300005543 Bacteria 1102
163 Ga0070686_100003612 3300005544 Bacteria 8488
164 Ga0070686_100040601 3300005544 Bacteria 2904
165 Ga0070686_100072491 3300005544 Bacteria 2259
166 Ga0070686_100693701 3300005544 Bacteria 811
167 Ga0070696_100476719 3300005546 Unclassified 989
168 Ga0070693_100201906 3300005547 Bacteria 1292
169 Ga0070665_100025056 3300005548 Bacteria 6012
170 Ga0070665_100089220 3300005548 Bacteria 3089
171 Ga0070665_100103763 3300005548 Bacteria 2846
172 Ga0070665_100155533 3300005548 Bacteria 2288
173 Ga0070704_100055095 3300005549 Bacteria 2817
174 Ga0068855_100040685 3300005563 Bacteria 5515
175 Ga0068855_100109595 3300005563 Bacteria 3170
176 Ga0068855_100165838 3300005563 Bacteria 2504
177 Ga0068855_100261445 3300005563 Bacteria 1928
178 Ga0068855_100294417 3300005563 Bacteria 1799
179 Ga0068855_100795140 3300005563 Bacteria 1006
180 Ga0070664_100011896 3300005564 Bacteria 7062
181 Ga0070664_100235962 3300005564 Bacteria 1641
182 Ga0070664_100293951 3300005564 Bacteria 1467
183 Ga0070664_100421590 3300005564 Unclassified 1222
184 Ga0068857_100177624 3300005577 Bacteria 1937
185 Ga0068857_100796090 3300005577 Bacteria 902
186 Ga0068854_100017570 3300005578 Bacteria 4786
187 Ga0068854_100105262 3300005578 Bacteria 2121
188 Ga0068854_100142458 3300005578 Bacteria 1841
189 Ga0068854_100371937 3300005578 Bacteria 1175
190 Ga0068854_100494685 3300005578 Bacteria 1029
191 Ga0068856_100000061 3300005614 Bacteria 100823
192 Ga0068856_100119855 3300005614 Bacteria 2633
193 Ga0068856_100164062 3300005614 Bacteria 2233
194 Ga0068856_100263946 3300005614 Bacteria 1738
195 Ga0068856_100756567 3300005614 Bacteria 992
196 Ga0070702_100005192 3300005615 Bacteria 6032
197 Ga0070702_100051278 3300005615 Bacteria 2361
198 Ga0070702_100149467 3300005615 Bacteria 1497
199 Ga0068852_100162249 3300005616 Bacteria 2088
200 Ga0068852_100292199 3300005616 Bacteria 1575
201 Ga0068852_101250093 3300005616 Bacteria 764
202 Ga0068859_100013198 3300005617 Bacteria 8294
203 Ga0068859_100038214 3300005617 Bacteria 4816
204 Ga0068859_100299145 3300005617 Unclassified 1702
205 Ga0068859_100341157 3300005617 Bacteria 1592
206 Ga0068859_100962691 3300005617 Bacteria 936
207 Ga0068859_101560673 3300005617 Bacteria 729
208 Ga0068864_100008218 3300005618 Bacteria 8606
209 Ga0068864_100052894 3300005618 Bacteria 3501
210 Ga0068866_10023345 3300005718 Bacteria 2876
211 Ga0068866_10203735 3300005718 Bacteria 1184
212 Ga0068861_100080957 3300005719 Bacteria 2541
213 Ga0068861_100166781 3300005719 Bacteria 1821
214 Ga0068851_10059509 3300005834 Bacteria 1954
215 Ga0068870_10000819 3300005840 Bacteria 12082
216 Ga0068870_10500430 3300005840 Bacteria 810
217 Ga0068863_100008090 3300005841 Bacteria 10270
218 Ga0068863_100135706 3300005841 Bacteria 2351
219 Ga0068863_100179979 3300005841 Bacteria 2029
220 Ga0068858_100091622 3300005842 Bacteria 2829
221 Ga0068858_100150601 3300005842 Bacteria 2187
222 Ga0068858_100227893 3300005842 Bacteria 1766
223 Ga0068858_100392593 3300005842 Bacteria 1332
224 Ga0068858_100864366 3300005842 Bacteria 884
225 Ga0068860_100000081 3300005843 Bacteria 170066
226 Ga0068860_100173161 3300005843 Bacteria 2085
227 Ga0068860_100301975 3300005843 Bacteria 1568
228 Ga0068860_100319594 3300005843 Bacteria 1523
229 Ga0068860_100379375 3300005843 Bacteria 1395
230 Ga0068860_100405930 3300005843 Bacteria 1348
231 Ga0068862_100145047 3300005844 Bacteria 2109
232 Ga0068862_100164141 3300005844 Bacteria 1984
233 Ga0068862_100167638 3300005844 Bacteria 1964
234 Ga0068862_100469245 3300005844 Bacteria 1189
235 Ga0081455_10040362 3300005937 Bacteria 4116
236 Ga0081455_10083231 3300005937 Bacteria 2615
237 Ga0081540_1001760 3300005983 Bacteria 18218
238 Ga0081540_1005540 3300005983 Bacteria 9406
239 Ga0081540_1013929 3300005983 Bacteria 5191
240 Ga0081540_1016188 3300005983 Bacteria 4681
241 Ga0081540_1041342 3300005983 Bacteria 2392
242 Ga0081540_1048993 3300005983 Bacteria 2111
243 Ga0081540_1065533 3300005983 Bacteria 1707
244 Ga0081539_10000113 3300005985 Bacteria 189418
245 Ga0070717_10000208 3300006028 Bacteria 41212
246 Ga0070717_10023506 3300006028 Bacteria 4885
247 Ga0070717_10079019 3300006028 Bacteria 2758
248 Ga0070717_10285023 3300006028 Bacteria 1466
249 Ga0070717_10300223 3300006028 Bacteria 1428
250 Ga0070717_10310672 3300006028 Bacteria 1403
251 Ga0075365_10004575 3300006038 Bacteria 7356
252 Ga0075365_10097763 3300006038 Bacteria 2007
253 Ga0075365_10256084 3300006038 Bacteria 1230
254 Ga0075368_10042765 3300006042 Bacteria 1784
255 Ga0075368_10094199 3300006042 Bacteria 1226
256 Ga0075368_10138416 3300006042 Bacteria 1014
257 Ga0075368_10145757 3300006042 Bacteria 988
258 Ga0075363_100003841 3300006048 Bacteria 6476
259 Ga0075363_100055194 3300006048 Bacteria 2127
260 Ga0075363_100072416 3300006048 Bacteria 1874
261 Ga0075364_10039910 3300006051 Bacteria 3044
262 Ga0075432_10013108 3300006058 Bacteria 2817
263 Ga0070715_10004593 3300006163 Bacteria 4548
264 Ga0070715_10044791 3300006163 Bacteria 1873
265 Ga0070715_10126203 3300006163 Bacteria 1226
266 Ga0070715_10230664 3300006163 Bacteria 957
267 Ga0070716_100002237 3300006173 Bacteria 8916
268 Ga0070716_100820874 3300006173 Bacteria 722
269 Ga0070712_100003066 3300006175 Bacteria 10336
270 Ga0070712_100034839 3300006175 Bacteria 3413
271 Ga0070712_100073280 3300006175 Bacteria 2456
272 Ga0070712_100201131 3300006175 Bacteria 1565
273 Ga0075367_10005056 3300006178 Bacteria 6505
274 Ga0075367_10018056 3300006178 Bacteria 3885
275 Ga0075369_10021538 3300006186 Bacteria 2650
276 Ga0075369_10146918 3300006186 Bacteria 1077
277 Ga0075427_10001183 3300006194 Bacteria 3313
278 Ga0075366_10022697 3300006195 Bacteria 3653
279 Ga0075366_10036482 3300006195 Bacteria 2899
280 Ga0075366_10111482 3300006195 Bacteria 1645
281 Ga0097621_100016264 3300006237 Bacteria 5619
282 Ga0097621_100021881 3300006237 Bacteria 4955
283 Ga0097621_100134565 3300006237 Bacteria 2107
284 Ga0075370_10030966 3300006353 Bacteria 2985
285 Ga0075370_10164071 3300006353 Bacteria 1304
286 Ga0068871_100007371 3300006358 Bacteria 7851
287 Ga0068871_100190467 3300006358 Bacteria 1767
288 Ga0068871_100977269 3300006358 Bacteria 788
289 Ga0075428_100010200 3300006844 Bacteria 10427
290 Ga0075428_100529691 3300006844 Bacteria 1260
291 Ga0075430_100001483 3300006846 Bacteria 19129
292 Ga0075431_100017410 3300006847 Bacteria 7302
293 Ga0075433_10002052 3300006852 Bacteria 15222
294 Ga0075434_100001473 3300006871 Bacteria 19815
295 Ga0075434_100138061 3300006871 Bacteria 2457
296 Ga0075434_100219840 3300006871 Bacteria 1919
297 Ga0075429_100005294 3300006880 Bacteria 11102
298 Ga0068865_100007918 3300006881 Bacteria 6558
299 Ga0068865_100513813 3300006881 Bacteria 1001
300 Ga0075436_100006832 3300006914 Bacteria 7805
301 Ga0075436_100397551 3300006914 Unclassified 998
302 Ga0075436_100598571 3300006914 Bacteria 812
303 Ga0097620_100013200 3300006931 Bacteria 8294
304 Ga0097620_100038215 3300006931 Bacteria 4816
305 Ga0097620_100299155 3300006931 Unclassified 1702
306 Ga0097620_100341155 3300006931 Bacteria 1592
307 Ga0097620_100962645 3300006931 Bacteria 936
308 Ga0097620_101560637 3300006931 Bacteria 729
309 Ga0075435_100034905 3300007076 Bacteria 3989
310 Ga0075435_100063487 3300007076 Bacteria 3000
311 Ga0099794_10002268 3300007265 Bacteria 7059
312 Ga0099795_10025328 3300007788 Bacteria 1989
313 Ga0099795_10034929 3300007788 Bacteria 1755
314 Ga0105244_10222873 3300009036 Bacteria 884
315 Ga0105240_10128623 3300009093 Bacteria 3041
316 Ga0105240_10157827 3300009093 Bacteria 2697
317 Ga0105240_10167179 3300009093 Bacteria 2608
318 Ga0105240_10291530 3300009093 Bacteria 1870
319 Ga0105240_11093666 3300009093 Bacteria 848
320 Ga0111539_10008538 3300009094 Bacteria 13014
321 Ga0111539_10131557 3300009094 Bacteria 2930
322 Ga0111539_10296445 3300009094 Bacteria 1882
323 Ga0111539_10784390 3300009094 Bacteria 1109
324 Ga0111539_11220365 3300009094 Bacteria 873
325 Ga0105245_10041292 3300009098 Bacteria 4112
326 Ga0105245_10060774 3300009098 Bacteria 3404
327 Ga0105245_10669282 3300009098 Bacteria 1069
328 Ga0105247_10108262 3300009101 Bacteria 1785
329 Ga0105247_10140877 3300009101 Bacteria 1580
330 Ga0105247_10159068 3300009101 Bacteria 1494
331 Ga0105247_10309033 3300009101 Bacteria 1099
332 Ga0114129_10042454 3300009147 Bacteria 6404
333 Ga0114129_10046549 3300009147 Bacteria 6095
334 Ga0114129_10272398 3300009147 Bacteria 2264
335 Ga0114129_10275924 3300009147 Bacteria 2247
336 Ga0105243_10430511 3300009148 Bacteria 1233
337 Ga0105243_10952851 3300009148 Bacteria 857
338 Ga0105241_10107391 3300009174 Bacteria 2229
339 Ga0105241_10358120 3300009174 Bacteria 1269
340 Ga0105241_10359512 3300009174 Bacteria 1267
341 Ga0105241_10421750 3300009174 Bacteria 1174
342 Ga0105242_10041657 3300009176 Bacteria 3705
343 Ga0105242_10060616 3300009176 Bacteria 3110
344 Ga0105242_10253475 3300009176 Bacteria 1587
345 Ga0105242_10908151 3300009176 Bacteria 881
346 Ga0105248_10180880 3300009177 Bacteria 2376
347 Ga0105248_10504151 3300009177 Bacteria 1364
348 Ga0105237_10097272 3300009545 Bacteria 2934
349 Ga0105237_10115212 3300009545 Bacteria 2681
350 Ga0105237_10673642 3300009545 Bacteria 1041
351 Ga0105238_10028676 3300009551 Bacteria 5670
352 Ga0105238_10430024 3300009551 Bacteria 1316
353 Ga0105238_11756052 3300009551 Bacteria 652
354 Ga0105249_10151920 3300009553 Bacteria 2230
355 Ga0105249_10367537 3300009553 Bacteria 1461
356 Ga0105249_10425526 3300009553 Bacteria 1362
357 Ga0099796_10016123 3300010159 Bacteria 2200
358 Ga0105239_10011139 3300010375 Bacteria 10039
359 Ga0105239_10219918 3300010375 Bacteria 2130
360 Ga0105239_10229696 3300010375 Bacteria 2082
361 Ga0105239_10529683 3300010375 Bacteria 1341
362 Ga0105239_11234141 3300010375 Bacteria 862
363 Ga0105246_10021797 3300011119 Bacteria 4127
364 Ga0105246_10273237 3300011119 Unclassified 1352
365 Ga0105246_10354127 3300011119 Bacteria 1204
366 Ga0157344_1002933 3300012476 Bacteria 934
367 Ga0157341_1004823 3300012494 Bacteria 988
368 Ga0157316_1000481 3300012510 Bacteria 2116
369 Ga0157370_10030019 3300013104 Bacteria 5328
370 Ga0157370_10114031 3300013104 Bacteria 2525
371 Ga0157370_10785464 3300013104 Bacteria 867
372 Ga0157369_10007421 3300013105 Bacteria 12626
373 Ga0157369_10016145 3300013105 Bacteria 8405
374 Ga0157369_10120105 3300013105 Bacteria 2789
375 Ga0157369_10182692 3300013105 Bacteria 2206
376 Ga0157369_10673579 3300013105 Unclassified 1066
377 Ga0157369_10749128 3300013105 Bacteria 1005
378 Ga0157374_10002946 3300013296 Bacteria 14253
379 Ga0157374_10021619 3300013296 Bacteria 5729
380 Ga0157374_10142292 3300013296 Bacteria 2329
381 Ga0157374_10195141 3300013296 Bacteria 1981
382 Ga0157374_11004924 3300013296 Bacteria 853
383 Ga0157378_10009553 3300013297 Bacteria 8447
384 Ga0157378_10052128 3300013297 Bacteria 3640
385 Ga0157378_10054478 3300013297 Bacteria 3561
386 Ga0157378_10172400 3300013297 Bacteria 2030
387 Ga0163162_10089599 3300013306 Bacteria 3157
388 Ga0163162_10322270 3300013306 Bacteria 1678
389 Ga0163162_10370530 3300013306 Bacteria 1565
390 Ga0163162_10745775 3300013306 Bacteria 1099
391 Ga0157372_10065655 3300013307 Bacteria 4075
392 Ga0157372_10306621 3300013307 Bacteria 1847
393 Ga0157372_10555171 3300013307 Bacteria 1339
394 Ga0157372_11596853 3300013307 Bacteria 751
395 Ga0157375_10012564 3300013308 Bacteria 7516
396 Ga0157375_10545597 3300013308 Bacteria 1321
397 Ga0163163_10013378 3300014325 Bacteria 7511
398 Ga0163163_10056723 3300014325 Bacteria 3871
399 Ga0163163_10120257 3300014325 Bacteria 2660
400 Ga0163163_10131190 3300014325 Bacteria 2546
401 Ga0163163_11048759 3300014325 Bacteria 878
402 Ga0157380_10281869 3300014326 Bacteria 1521
403 Ga0157380_10960119 3300014326 Bacteria 885
404 Ga0157377_10002479 3300014745 Bacteria 8165
405 Ga0157377_10112765 3300014745 Bacteria 1636
406 Ga0157377_10174155 3300014745 Bacteria 1348
407 Ga0157379_10007369 3300014968 Bacteria 9526
408 Ga0157379_10076935 3300014968 Bacteria 2988
409 Ga0157379_10084510 3300014968 Bacteria 2844
410 Ga0157379_10211016 3300014968 Bacteria 1758
411 Ga0157379_10241666 3300014968 Bacteria 1638
412 Ga0157379_10398711 3300014968 Bacteria 1264
413 Ga0157379_10452070 3300014968 Bacteria 1186
414 Ga0157376_10006417 3300014969 Bacteria 8309
415 Ga0157376_10072518 3300014969 Bacteria 2929
416 Ga0157376_10073211 3300014969 Bacteria 2917
417 Ga0157376_10079797 3300014969 Bacteria 2806
418 Ga0157376_10282843 3300014969 Bacteria 1563
419 Ga0157376_10330006 3300014969 Bacteria 1453
420 Ga0157376_10882803 3300014969 Bacteria 911
421 Ga0163161_10124563 3300017792 Bacteria 1939
422 Ga0163161_10291676 3300017792 Bacteria 1282
423 Ga0163161_10421923 3300017792 Bacteria 1073
424 Ga0206354_10582287 3300020081 Bacteria 1750
425 Ga0213871_10002616 3300021441 Bacteria 3336
426 Ga0209758_1010882 3300025297 Bacteria 5362
427 Ga0209758_1011390 3300025297 Bacteria 5158
428 Ga0209758_1029404 3300025297 Bacteria 2299
429 Ga0207697_10132322 3300025315 Bacteria 1078
430 Ga0207653_10122163 3300025885 Bacteria 938
431 Ga0207682_10085580 3300025893 Bacteria 1358
432 Ga0207692_10060370 3300025898 Bacteria 1961
433 Ga0207692_10114481 3300025898 Bacteria 1501
434 Ga0207692_10136513 3300025898 Bacteria 1391
435 Ga0207642_10127306 3300025899 Bacteria 1323
436 Ga0207642_10387681 3300025899 Bacteria 833
437 Ga0207710_10029549 3300025900 Bacteria 2386
438 Ga0207710_10204619 3300025900 Bacteria 976
439 Ga0207688_10010390 3300025901 Bacteria 5065
440 Ga0207688_10056255 3300025901 Bacteria 2209
441 Ga0207680_10074349 3300025903 Bacteria 2116
442 Ga0207680_10108586 3300025903 Bacteria 1795
443 Ga0207647_10022444 3300025904 Bacteria 4191
444 Ga0207685_10128661 3300025905 Bacteria 1121
445 Ga0207699_10022022 3300025906 Bacteria 3447
446 Ga0207699_10034223 3300025906 Bacteria 2879
447 Ga0207699_10073848 3300025906 Bacteria 2093
448 Ga0207699_10097037 3300025906 Bacteria 1862
449 Ga0207645_10121830 3300025907 Bacteria 1693
450 Ga0207645_10393701 3300025907 Bacteria 931
451 Ga0207645_10408175 3300025907 Bacteria 914
452 Ga0207643_10000675 3300025908 Bacteria 21235
453 Ga0207705_10630141 3300025909 Bacteria 834
454 Ga0207684_10135572 3300025910 Bacteria 2114
455 Ga0207654_10059170 3300025911 Bacteria 2233
456 Ga0207654_10154524 3300025911 Bacteria 1476
457 Ga0207654_10264310 3300025911 Bacteria 1158
458 Ga0207707_10000916 3300025912 Bacteria 28696
459 Ga0207707_10051186 3300025912 Bacteria 3597
460 Ga0207707_10331608 3300025912 Bacteria 1313
461 Ga0207707_10339495 3300025912 Bacteria 1295
462 Ga0207695_10022496 3300025913 Bacteria 7152
463 Ga0207695_10029844 3300025913 Bacteria 6016
464 Ga0207695_10144086 3300025913 Bacteria 2328
465 Ga0207695_10761756 3300025913 Bacteria 848
466 Ga0207671_10072463 3300025914 Bacteria 2571
467 Ga0207671_10095326 3300025914 Bacteria 2247
468 Ga0207693_10001243 3300025915 Bacteria 22677
469 Ga0207693_10100225 3300025915 Bacteria 2271
470 Ga0207693_10136454 3300025915 Bacteria 1929
471 Ga0207693_10512783 3300025915 Bacteria 936
472 Ga0207663_10033274 3300025916 Bacteria 3069
473 Ga0207663_10163892 3300025916 Bacteria 1572
474 Ga0207663_10167426 3300025916 Bacteria 1558
475 Ga0207663_10266894 3300025916 Bacteria 1266
476 Ga0207660_10137959 3300025917 Bacteria 1862
477 Ga0207660_10390920 3300025917 Bacteria 1119
478 Ga0207657_10044555 3300025919 Bacteria 3899
479 Ga0207657_10238644 3300025919 Bacteria 1452
480 Ga0207657_10294645 3300025919 Bacteria 1286
481 Ga0207649_10075548 3300025920 Bacteria 2166
482 Ga0207649_10091894 3300025920 Bacteria 1989
483 Ga0207649_10245769 3300025920 Bacteria 1286
484 Ga0207649_10545699 3300025920 Bacteria 886
485 Ga0207652_10027112 3300025921 Bacteria 4774
486 Ga0207652_10038672 3300025921 Bacteria 4046
487 Ga0207652_10069643 3300025921 Bacteria 3054
488 Ga0207652_10118799 3300025921 Bacteria 2350
489 Ga0207652_10136727 3300025921 Bacteria 2189
490 Ga0207652_10180742 3300025921 Bacteria 1896
491 Ga0207652_10240198 3300025921 Bacteria 1633
492 Ga0207652_10730551 3300025921 Bacteria 882
493 Ga0207646_10278678 3300025922 Bacteria 1511
494 Ga0207681_10064244 3300025923 Bacteria 2534
495 Ga0207681_10294518 3300025923 Bacteria 1282
496 Ga0207650_10019497 3300025925 Bacteria 4767
497 Ga0207650_10048647 3300025925 Bacteria 3128
498 Ga0207650_10306308 3300025925 Bacteria 1298
499 Ga0207659_10001651 3300025926 Bacteria 13260
500 Ga0207659_10140108 3300025926 Bacteria 1877
501 Ga0207687_10008249 3300025927 Bacteria 6815
502 Ga0207687_10141916 3300025927 Bacteria 1823
503 Ga0207687_10576398 3300025927 Bacteria 946
504 Ga0207700_10002188 3300025928 Bacteria 11212
505 Ga0207700_10003970 3300025928 Bacteria 8655
506 Ga0207700_10022181 3300025928 Bacteria 4351
507 Ga0207700_10055560 3300025928 Bacteria 2977
508 Ga0207700_10057722 3300025928 Bacteria 2928
509 Ga0207700_10108579 3300025928 Bacteria 2228
510 Ga0207664_10198228 3300025929 Bacteria 1732
511 Ga0207664_10201580 3300025929 Bacteria 1718
512 Ga0207664_10269635 3300025929 Bacteria 1491
513 Ga0207664_10563891 3300025929 Bacteria 1022
514 Ga0207664_10662917 3300025929 Bacteria 938
515 Ga0207644_10000779 3300025931 Bacteria 20223
516 Ga0207644_10005962 3300025931 Bacteria 7945
517 Ga0207690_10092344 3300025932 Bacteria 2142
518 Ga0207690_10096636 3300025932 Bacteria 2101
519 Ga0207690_10133309 3300025932 Bacteria 1821
520 Ga0207706_10027569 3300025933 Bacteria 5078
521 Ga0207706_10044372 3300025933 Bacteria 3940
522 Ga0207706_10090585 3300025933 Bacteria 2689
523 Ga0207706_10267208 3300025933 Bacteria 1493
524 Ga0207686_10059601 3300025934 Bacteria 2412
525 Ga0207709_10002129 3300025935 Bacteria 12726
526 Ga0207670_10021477 3300025936 Bacteria 3984
527 Ga0207670_10034654 3300025936 Bacteria 3265
528 Ga0207670_10554377 3300025936 Bacteria 939
529 Ga0207669_10011456 3300025937 Bacteria 4316
530 Ga0207669_10037041 3300025937 Bacteria 2794
531 Ga0207704_10016603 3300025938 Bacteria 3788
532 Ga0207704_10035183 3300025938 Bacteria 2867
533 Ga0207665_10082708 3300025939 Bacteria 2213
534 Ga0207665_10112384 3300025939 Bacteria 1915
535 Ga0207665_10120553 3300025939 Bacteria 1852
536 Ga0207665_10329685 3300025939 Bacteria 1147
537 Ga0207691_10001631 3300025940 Bacteria 22281
538 Ga0207691_10103559 3300025940 Bacteria 2538
539 Ga0207691_10232304 3300025940 Bacteria 1597
540 Ga0207691_10449061 3300025940 Bacteria 1097
541 Ga0207711_10457199 3300025941 Bacteria 1189
542 Ga0207711_10480301 3300025941 Bacteria 1158
543 Ga0207689_10013931 3300025942 Bacteria 6849
544 Ga0207689_10045378 3300025942 Bacteria 3634
545 Ga0207689_10132306 3300025942 Bacteria 2053
546 Ga0207661_10002496 3300025944 Bacteria 12664
547 Ga0207679_10017717 3300025945 Bacteria 4757
548 Ga0207679_10406152 3300025945 Bacteria 1199
549 Ga0207667_10018061 3300025949 Bacteria 7921
550 Ga0207667_10201406 3300025949 Bacteria 2042
551 Ga0207667_10461876 3300025949 Bacteria 1289
552 Ga0207651_10002318 3300025960 Bacteria 9071
553 Ga0207651_10008556 3300025960 Bacteria 5534
554 Ga0207712_10015592 3300025961 Bacteria 4906
555 Ga0207668_10011978 3300025972 Bacteria 5292
556 Ga0207668_10174640 3300025972 Bacteria 1688
557 Ga0207668_10719631 3300025972 Bacteria 878
558 Ga0207668_10737940 3300025972 Bacteria 868
559 Ga0207668_11258936 3300025972 Bacteria 665
560 Ga0207640_10100676 3300025981 Bacteria 2025
561 Ga0207640_10149366 3300025981 Bacteria 1715
562 Ga0207640_10149549 3300025981 Bacteria 1714
563 Ga0207658_10024734 3300025986 Bacteria 4202
564 Ga0207658_10660120 3300025986 Bacteria 943
565 Ga0207677_10010826 3300026023 Bacteria 5173
566 Ga0207677_10028736 3300026023 Bacteria 3523
567 Ga0207703_10034858 3300026035 Bacteria 3996
568 Ga0207703_10070074 3300026035 Bacteria 2893
569 Ga0207703_10643299 3300026035 Bacteria 1005
570 Ga0207639_10486409 3300026041 Bacteria 1125
571 Ga0207678_10064705 3300026067 Bacteria 3142
572 Ga0207678_10068174 3300026067 Bacteria 3053
573 Ga0207678_10088555 3300026067 Bacteria 2645
574 Ga0207678_10285453 3300026067 Bacteria 1417
575 Ga0207678_10301172 3300026067 Bacteria 1378
576 Ga0207678_10302123 3300026067 Bacteria 1375
577 Ga0207678_10307095 3300026067 Bacteria 1364
578 Ga0207678_10346111 3300026067 Bacteria 1281
579 Ga0207678_10563613 3300026067 Bacteria 997
580 Ga0207708_10027447 3300026075 Bacteria 4310
581 Ga0207708_10097594 3300026075 Bacteria 2271
582 Ga0207702_10000674 3300026078 Bacteria 37110
583 Ga0207702_10068488 3300026078 Bacteria 3049
584 Ga0207702_10390666 3300026078 Bacteria 1340
585 Ga0207641_10007853 3300026088 Bacteria 8856
586 Ga0207641_11103700 3300026088 Bacteria 792
587 Ga0207648_10044649 3300026089 Bacteria 3889
588 Ga0207648_10293826 3300026089 Bacteria 1455
589 Ga0207676_10001534 3300026095 Bacteria 17044
590 Ga0207676_10091000 3300026095 Bacteria 2505
591 Ga0207674_10271829 3300026116 Bacteria 1642
592 Ga0207674_10273056 3300026116 Bacteria 1638
593 Ga0207675_100028015 3300026118 Bacteria 5245
594 Ga0207675_100039525 3300026118 Bacteria 4402
595 Ga0207675_100053074 3300026118 Bacteria 3783
596 Ga0207675_100082002 3300026118 Bacteria 3024
597 Ga0207675_100636759 3300026118 Bacteria 1071
598 Ga0207683_10003123 3300026121 Bacteria 14468
599 Ga0207683_10010904 3300026121 Bacteria 7751
600 Ga0207698_10001896 3300026142 Bacteria 12250
601 Ga0207698_10042683 3300026142 Bacteria 3391
602 Ga0207698_10250403 3300026142 Bacteria 1620
603 Ga0209588_1000977 3300027671 Bacteria 7339
604 Ga0209588_1067825 3300027671 Bacteria 1153
605 Ga0209813_10033110 3300027866 Bacteria 1535
606 Ga0209813_10245165 3300027866 Bacteria 679
607 Ga0207428_10000082 3300027907 Bacteria 133684
608 Ga0268266_10003344 3300028379 Bacteria 16058
609 Ga0268266_10088513 3300028379 Bacteria 2709
610 Ga0268266_10449763 3300028379 Bacteria 1224
611 Ga0268266_10571521 3300028379 Bacteria 1084
612 Ga0268266_10685092 3300028379 Bacteria 987
613 Ga0268265_10003368 3300028380 Bacteria 11515
614 Ga0268265_10130187 3300028380 Bacteria 2089
615 Ga0268265_10653474 3300028380 Bacteria 1011
616 Ga0268264_10000048 3300028381 Bacteria 334457
617 Ga0268264_10008893 3300028381 Bacteria 8329
618 Ga0268264_10197408 3300028381 Bacteria 1838
619 Ga0268264_10247626 3300028381 Bacteria 1654
620 Ga0268264_10730053 3300028381 Bacteria 986
621 Ga0265337_1012788 3300028556 Bacteria 2839
622 Ga0265326_10003400 3300028558 Bacteria 5215
623 Ga0265319_1014589 3300028563 Bacteria 3078
624 Ga0265334_10004112 3300028573 Bacteria 6519
625 Ga0265334_10123280 3300028573 Bacteria 925
626 Ga0265318_10041448 3300028577 Bacteria 1750
627 Ga0265323_10004703 3300028653 Bacteria 5853
628 Ga0265336_10001567 3300028666 Bacteria 10262
629 Ga0307517_10143425 3300028786 Bacteria 1667
630 Ga0307515_10611535 3300028794 Bacteria 701
631 Ga0265338_10000034 3300028800 Bacteria 244623
632 Ga0265324_10006370 3300029957 Bacteria 4930
633 Ga0265325_10013213 3300031241 Bacteria 4705
634 Ga0265339_10108484 3300031249 Bacteria 1439
635 Ga0265331_10058077 3300031250 Bacteria 1833
636 Ga0265316_10854117 3300031344 Bacteria 637
637 Ga0307509_10074244 3300031507 Bacteria 3537
638 Ga0307509_10182360 3300031507 Bacteria 1962
639 Ga0307509_10711080 3300031507 Bacteria 671
640 Ga0307508_10076043 3300031616 Bacteria 2935
641 Ga0307508_10135286 3300031616 Bacteria 2068
642 Ga0307508_10487525 3300031616 Bacteria 827
643 Ga0307508_10633827 3300031616 Bacteria 673
644 Ga0265314_10005447 3300031711 Bacteria 11490
645 Ga0265314_10024001 3300031711 Bacteria 4634
646 Ga0265342_10128926 3300031712 Bacteria 1419
647 Ga0307516_10059573 3300031730 Bacteria 3713
648 Ga0307516_10265993 3300031730 Bacteria 1403
649 Ga0307415_100063520 3300032126 Bacteria 2566
650 Ga0307510_10003449 3300033180 Bacteria 18439
651 Ga0307510_10019293 3300033180 Bacteria 8001
652 Ga0373926_0010257 3300035083 Bacteria 3137
653 Ga0373926_0017225 3300035083 Bacteria 2478
654 Ga0373934_0013184 3300035086 Bacteria 3122
655 Ga0373934_0013852 3300035086 Bacteria 3051
656 Ga0373934_0033956 3300035086 Bacteria 2004
657 Ga0373940_0014198 3300035088 Bacteria 1940
658 Ga0373944_0006227 3300035089 Bacteria 3164
659 Ga0373944_0039244 3300035089 Bacteria 1457
660 Ga0373944_0095667 3300035089 Bacteria 998
661 Ga0373952_0064952 3300035092 Bacteria 901
662 Ga0373923_0006563 3300035111 Bacteria 4030
663 Ga0373923_0008416 3300035111 Bacteria 3677
664 Ga0373923_0042869 3300035111 Bacteria 1870
665 Ga0373932_0099651 3300035112 Bacteria 944
666 Ga0373936_0003229 3300035113 Bacteria 6115
667 Ga0373936_0004735 3300035113 Bacteria 5141
668 Ga0373936_0019424 3300035113 Bacteria 2633
669 Ga0373945_0001310 3300035116 Bacteria 7546
670 Ga0373945_0073354 3300035116 Bacteria 1299
671 Ga0373953_0015054 3300035117 Bacteria 2794
672 Ga0373953_0032257 3300035117 Bacteria 2042
673 Ga0373954_0002403 3300035118 Bacteria 7844
674 Ga0373954_0006338 3300035118 Bacteria 5158
675 Ga0373954_0013491 3300035118 Bacteria 3642
676 Ga0373956_0011739 3300035119 Bacteria 3615
677 Ga0373956_0016342 3300035119 Bacteria 3116
678 Ga0373956_0193556 3300035119 Bacteria 963
679 Ga0373957_0004788 3300035120 Bacteria 4145
680 Ga0373957_0047261 3300035120 Bacteria 1636
681 Ga0373943_0003753 3300035170 Bacteria 6905
682 Ga0373943_0008120 3300035170 Bacteria 4708
683 Ga0373943_0043789 3300035170 Bacteria 2175
684 Ga0373943_0086903 3300035170 Bacteria 1613
685 Ga0373946_0003292 3300035171 Bacteria 5739
686 Ga0373946_0010357 3300035171 Bacteria 3449
687 Ga0373946_0082281 3300035171 Bacteria 1412
688 Ga0373955_0058087 3300035172 Bacteria 2127
689 Ga0373955_0071709 3300035172 Bacteria 1938
690 Ga0373962_0139354 3300035242 Bacteria 787
691 Ga0373962_0161103 3300035242 Bacteria 740
692 Ga0373924_0006926 3300035410 Bacteria 4079
693 Ga0373924_0018912 3300035410 Bacteria 2663
694 Ga0373924_0042542 3300035410 Bacteria 1863
695 Ga0373924_0048895 3300035410 Bacteria 1748
696 Ga0373931_0083687 3300035691 Bacteria 1766
697 Ga0373931_0382456 3300035691 Bacteria 888
698 Ga0373935_0014513 3300035692 Bacteria 4754
699 Ga0373935_0076609 3300035692 Bacteria 2166
700 Ga0373927_0000121 3300035695 Bacteria 59449
701 Ga0373927_0017851 3300035695 Bacteria 4666
702 Ga0373927_0020402 3300035695 Bacteria 4345
703 Ga0373927_0028965 3300035695 Bacteria 3610
704 Ga0373927_0077200 3300035695 Bacteria 2157
705 Ga0373933_0016314 3300035724 Bacteria 4150
706 Ga0373933_0066179 3300035724 Bacteria 2189
707 Ga0373947_0002018 3300035725 Bacteria 12396
708 Ga0373947_0012161 3300035725 Bacteria 4928
709 Ga0373947_0048562 3300035725 Bacteria 2546
710 Ga0373937_0015887 3300036401 Bacteria 6676
711 Ga0373937_0132615 3300036401 Bacteria 2327
712 Ga0373937_0146362 3300036401 Bacteria 2211
713 Ga0373937_0858404 3300036401 Bacteria 856
714 Ga0373925_0002194 3300037068 Bacteria 15853
715 Ga0373925_0139202 3300037068 Bacteria 1898
716 Ga0373925_0177234 3300037068 Bacteria 1685
717 Ga0373925_0236614 3300037068 Bacteria 1461
718 Ga0373925_0376722 3300037068 Bacteria 1155
719 Ga0373925_0929676 3300037068 Bacteria 716
720 Ga0395900_0048549 3300037418 Bacteria 4373
721 Ga0395900_0163654 3300037418 Bacteria 2268
722 Ga0395901_0109506 3300038443 Bacteria 2900
723 Ga0436365_0227213 3300039437 Bacteria 2604
724 Ga0436365_0981833 3300039437 Bacteria 1184
725 Ga0436365_1414818 3300039437 Bacteria 1128
726 Ga0436365_1700201 3300039437 Bacteria 1401
727 Ga0436360_0181084 3300039438 Bacteria 1163
728 Ga0436360_0904398 3300039438 Bacteria 1992
729 Ga0436361_0248601 3300039447 Bacteria 2522
730 Ga0436361_0967620 3300039447 Bacteria 619
731 Ga0436362_1193065 3300039453 Bacteria 3700
732 Ga0451800_1097031 3300041459 Bacteria 681
733 Ga0451800_1530629 3300041459 Bacteria 960
734 Ga0451804_0681616 3300041463 Bacteria 1064
735 Ga0451807_1488698 3300041486 Bacteria 1054
736 Ga0451849_0839122 3300041505 Bacteria 844
737 Ga0451853_2095703 3300041512 Bacteria 810
738 Ga0466969_0171124 3300044656 Bacteria 996
739 Ga0466966_0267902 3300044684 Bacteria 1028
740 Ga0466963_0090475 3300044694 Bacteria 2084
741 Ga0466968_0227927 3300044735 Bacteria 879
742 Ga0466970_0024879 3300044765 Bacteria 3132
743 Ga0466957_0084528 3300044842 Bacteria 1981
744 Ga0466967_0070734 3300045976 Bacteria 3122
745 Ga0466967_0095054 3300045976 Bacteria 2715
746 Ga0466967_0132737 3300045976 Bacteria 2313
747 Ga0495617_076057 3300046452 Bacteria 1102
748 Ga0495592_0002856 3300046454 Bacteria 12273
749 Ga0495592_0016464 3300046454 Bacteria 5610
750 Ga0495592_0044107 3300046454 Bacteria 3333
751 Ga0495592_0051867 3300046454 Bacteria 3047
752 Ga0495603_0001782 3300046455 Bacteria 12698
753 Ga0495603_0021236 3300046455 Bacteria 3930
754 Ga0495603_0062365 3300046455 Bacteria 2201
755 Ga0495603_0153283 3300046455 Bacteria 1338
756 Ga0495629_0000242 3300046459 Bacteria 47556
757 Ga0495629_0016212 3300046459 Bacteria 5349
758 Ga0495629_0042588 3300046459 Bacteria 3190
759 Ga0495629_0095751 3300046459 Bacteria 2071
760 Ga0495629_0163904 3300046459 Bacteria 1544
761 Ga0495638_0032269 3300046460 Bacteria 3359
762 Ga0495641_0000994 3300046461 Bacteria 24305
763 Ga0495641_0062494 3300046461 Bacteria 1679
764 Ga0495641_0102668 3300046461 Bacteria 1276
765 Ga0495651_0325275 3300046462 Bacteria 1023
766 Ga0495653_0005558 3300046463 Bacteria 10277
767 Ga0495653_0106668 3300046463 Bacteria 2020
768 Ga0495653_0123174 3300046463 Bacteria 1844
769 Ga0495580_0004514 3300046472 Bacteria 11688
770 Ga0495580_0009026 3300046472 Bacteria 7872
771 Ga0495580_0363803 3300046472 Bacteria 979
772 Ga0495582_0000268 3300046473 Bacteria 29098
773 Ga0495582_0030573 3300046473 Bacteria 2956
774 Ga0495582_0041115 3300046473 Bacteria 2547
775 Ga0495605_0055182 3300046474 Bacteria 1921
776 Ga0495639_0000157 3300046475 Bacteria 35000
777 Ga0495639_0004971 3300046475 Bacteria 5703
778 Ga0495639_0027769 3300046475 Bacteria 2505
779 Ga0495639_0139619 3300046475 Bacteria 1164
780 Ga0495662_0007644 3300046476 Bacteria 5332
781 Ga0495664_0019517 3300046477 Bacteria 3898
782 Ga0495664_0022971 3300046477 Bacteria 3616
783 Ga0495664_0029640 3300046477 Bacteria 3202
784 Ga0495664_0131277 3300046477 Bacteria 1517
785 Ga0495664_0141546 3300046477 Bacteria 1458
786 Ga0495664_0489546 3300046477 Bacteria 735
787 Ga0495584_0005529 3300046491 Bacteria 6690
788 Ga0495584_0330211 3300046491 Bacteria 774
789 Ga0495584_0438691 3300046491 Bacteria 664
790 Ga0495585_0256373 3300046492 Bacteria 871
791 Ga0495594_0059340 3300046499 Bacteria 2115
792 Ga0495594_0059936 3300046499 Bacteria 2105
793 Ga0495594_0067294 3300046499 Bacteria 1988
794 Ga0495607_0102866 3300046501 Bacteria 1527
795 Ga0495606_0003626 3300046507 Bacteria 16225
796 Ga0495606_0061638 3300046507 Bacteria 2398
797 Ga0495608_0017348 3300046511 Bacteria 4980
798 Ga0495608_0147908 3300046511 Bacteria 1498
799 Ga0495616_0040759 3300046513 Bacteria 2371
800 Ga0495618_0046592 3300046514 Bacteria 2736
801 Ga0495618_0064109 3300046514 Bacteria 2334
802 Ga0495618_0177312 3300046514 Bacteria 1355
803 Ga0495618_0197387 3300046514 Bacteria 1274
804 Ga0495618_0323245 3300046514 Bacteria 955
805 Ga0495628_0065041 3300046516 Bacteria 2854
806 Ga0495628_0143907 3300046516 Bacteria 1818
807 Ga0495630_0001544 3300046517 Bacteria 15994
808 Ga0495630_0061693 3300046517 Bacteria 2815
809 Ga0495630_0229290 3300046517 Bacteria 1419
810 Ga0495631_0094192 3300046518 Bacteria 1289
811 Ga0495632_0130226 3300046519 Bacteria 1171
812 Ga0495637_0159743 3300046520 Bacteria 846
813 Ga0495644_0170698 3300046523 Bacteria 835
814 Ga0495666_0061310 3300046526 Bacteria 1797
815 Ga0495666_0076141 3300046526 Bacteria 1590
816 Ga0495666_0284240 3300046526 Bacteria 750
817 Ga0495652_0023483 3300046529 Bacteria 5466
818 Ga0495652_0063455 3300046529 Bacteria 3110
819 Ga0495652_0080346 3300046529 Bacteria 2693
820 Ga0495652_0110987 3300046529 Bacteria 2205
821 Ga0495665_0000656 3300046531 Bacteria 17748
822 Ga0495665_0010056 3300046531 Bacteria 5127
823 Ga0495640_0012228 3300046533 Bacteria 6569
824 Ga0495640_0029778 3300046533 Bacteria 3914
825 Ga0495640_0061328 3300046533 Bacteria 2555
826 Ga0495640_0070785 3300046533 Bacteria 2342
827 Ga0495640_0078660 3300046533 Bacteria 2196
828 Ga0495586_0045531 3300046535 Bacteria 2364
829 Ga0495586_0219048 3300046535 Bacteria 1081
830 Ga0495587_0006060 3300046536 Bacteria 7887
831 Ga0495587_0079818 3300046536 Bacteria 1897
832 Ga0495598_0005003 3300046537 Bacteria 2909
833 Ga0495609_0029646 3300046538 Bacteria 2491
834 Ga0495621_0218771 3300046539 Bacteria 770
835 Ga0495597_0133386 3300046542 Bacteria 1029
836 Ga0495645_0031198 3300046543 Bacteria 3883
837 Ga0495645_0093671 3300046543 Bacteria 2143
838 Ga0495645_0135760 3300046543 Bacteria 1721
839 Ga0495645_0178467 3300046543 Bacteria 1457
840 Ga0495645_0203931 3300046543 Bacteria 1339
841 Ga0495622_0002769 3300046557 Bacteria 8377
842 Ga0495622_0007792 3300046557 Bacteria 4973
843 Ga0495622_0142197 3300046557 Bacteria 1089
844 Ga0495633_0111508 3300046558 Bacteria 1268
845 Ga0495667_0022864 3300046559 Bacteria 4212
846 Ga0495667_0026566 3300046559 Bacteria 3902
847 Ga0495667_0068906 3300046559 Bacteria 2309
848 Ga0495667_0240343 3300046559 Bacteria 1154
849 Ga0495667_0431653 3300046559 Bacteria 829
850 Ga0495656_0023643 3300046615 Bacteria 2420
851 Ga0495656_0028075 3300046615 Bacteria 2254
852 Ga0495656_0045722 3300046615 Bacteria 1849
853 Ga0495668_0185537 3300046616 Bacteria 1139
854 Ga0495634_0000206 3300046642 Bacteria 55145
855 Ga0495634_0033435 3300046642 Bacteria 3534
856 Ga0495634_0145843 3300046642 Bacteria 1499
857 Ga0495634_0290298 3300046642 Bacteria 991
858 Ga0495611_0032374 3300046648 Bacteria 2304
859 Ga0495611_0329325 3300046648 Bacteria 702
860 Ga0495635_0000723 3300046663 Bacteria 21319
861 Ga0495635_0004976 3300046663 Bacteria 9253
862 Ga0495635_0010817 3300046663 Bacteria 6392
863 Ga0495635_0043607 3300046663 Bacteria 3095
864 Ga0495635_0080868 3300046663 Bacteria 2224
865 Ga0495635_0176195 3300046663 Bacteria 1454
866 Ga0495659_0001310 3300046664 Bacteria 8543
867 Ga0495659_0371714 3300046664 Bacteria 613
868 Ga0495661_0411654 3300046665 Bacteria 656
869 Ga0495588_0001039 3300046674 Bacteria 12085
870 Ga0495588_0067908 3300046674 Bacteria 1851
871 Ga0495657_0008675 3300046675 Bacteria 7759
872 Ga0495599_0028396 3300046678 Bacteria 3506
873 Ga0495599_0088224 3300046678 Bacteria 1936
874 Ga0495599_0486742 3300046678 Bacteria 727
875 Ga0495623_0011265 3300046679 Bacteria 5783
876 Ga0495623_0158719 3300046679 Bacteria 1331
877 Ga0495623_0158918 3300046679 Bacteria 1330
878 Ga0495623_0208408 3300046679 Bacteria 1120
879 Ga0495646_0001912 3300046680 Bacteria 12528
880 Ga0495646_0015182 3300046680 Bacteria 4892
881 Ga0495647_0001229 3300046681 Bacteria 7899
882 Ga0495647_0014983 3300046681 Bacteria 2709
883 Ga0495647_0038885 3300046681 Bacteria 1800
884 Ga0495658_0000188 3300046683 Bacteria 35609
885 Ga0495658_0024424 3300046683 Bacteria 3219
886 Ga0495658_0283737 3300046683 Bacteria 1045
887 Ga0495669_0015310 3300046684 Bacteria 3284
888 Ga0495669_0071113 3300046684 Bacteria 1586
889 Ga0495669_0247332 3300046684 Bacteria 856
890 Ga0495613_0013006 3300046689 Bacteria 6184
891 Ga0495613_0034342 3300046689 Bacteria 3767
892 Ga0495613_0054981 3300046689 Bacteria 2926
893 Ga0495613_0119721 3300046689 Bacteria 1891
894 Ga0495624_0007942 3300046690 Bacteria 7441
895 Ga0495624_0034608 3300046690 Bacteria 3266
896 Ga0495624_0083240 3300046690 Bacteria 1979
897 Ga0495670_0059669 3300046691 Bacteria 1915
898 Ga0495670_0093170 3300046691 Bacteria 1544
899 Ga0495670_0253800 3300046691 Bacteria 938
900 Ga0495649_0043160 3300046694 Bacteria 2462
901 Ga0495589_0211536 3300046794 Bacteria 913
902 Ga0495600_0001540 3300046809 Bacteria 12811
903 Ga0495600_0333028 3300046809 Bacteria 953
904 Ga0495581_0000166 3300047315 Bacteria 29591
905 Ga0495581_0041029 3300047315 Bacteria 2678
906 Ga0495581_0043324 3300047315 Bacteria 2603
907 Ga0495581_0107245 3300047315 Bacteria 1624
908 Ga0495581_0327316 3300047315 Bacteria 895
909 Ga0495604_0004097 3300047317 Bacteria 11579
910 Ga0495674_0009028 3300047319 Bacteria 9475
911 Ga0495674_0067364 3300047319 Bacteria 3102
912 Ga0495674_0136617 3300047319 Bacteria 2062
913 Ga0495672_0051317 3300047320 Bacteria 2430
914 Ga0495676_0175931 3300047321 Bacteria 1503
915 Ga0495680_0044358 3300047322 Bacteria 3516
916 Ga0495683_0135288 3300047323 Bacteria 1159
917 Ga0495685_095158 3300047447 Bacteria 985
918 Ga0495673_0098284 3300047469 Bacteria 1187
919 Ga0495684_0010530 3300047471 Bacteria 7149
920 Ga0495684_0019701 3300047471 Bacteria 5198
921 Ga0495684_0035546 3300047471 Bacteria 3820
922 Ga0495684_0077845 3300047471 Bacteria 2516
923 Ga0495686_0057072 3300047472 Bacteria 2438
924 Ga0495593_0000033 3300047673 Bacteria 58363
925 Ga0495593_0031403 3300047673 Bacteria 2901
926 Ga0495593_0043771 3300047673 Bacteria 2397
927 Ga0495593_0052159 3300047673 Bacteria 2162
928 Ga0495593_0070194 3300047673 Bacteria 1821
929 Ga0495602_0033120 3300048088 Bacteria 4853
930 Ga0495602_0073324 3300048088 Bacteria 2915
931 Ga0495614_0039242 3300048089 Bacteria 2032
932 Ga0495614_0136220 3300048089 Bacteria 1089
933 Ga0495615_0055784 3300048090 Bacteria 1029
934 Ga0496100_0079679 3300048903 Bacteria 2207
935 Ga0496100_0089884 3300048903 Bacteria 2093
936 Ga0496101_0000673 3300048904 Bacteria 20594
937 Ga0496101_0075626 3300048904 Bacteria 2479
938 Ga0496101_0099312 3300048904 Bacteria 2176
939 Ga0496101_0989764 3300048904 Bacteria 661
940 Ga0496102_0001987 3300048905 Bacteria 17654
941 Ga0496102_0058766 3300048905 Bacteria 3515
942 Ga0496102_0114298 3300048905 Bacteria 2518
943 Ga0496102_0282305 3300048905 Bacteria 1565
944 Ga0496103_0000999 3300048906 Bacteria 19887
945 Ga0496103_0020025 3300048906 Bacteria 4017
946 Ga0496103_0367871 3300048906 Bacteria 924
947 Ga0496104_0002145 3300048907 Bacteria 17127
948 Ga0496104_0018839 3300048907 Bacteria 6305
949 Ga0496104_0020301 3300048907 Bacteria 6088
950 Ga0496104_0128917 3300048907 Bacteria 2429
951 Ga0496104_0328843 3300048907 Bacteria 1441
952 Ga0496104_0374462 3300048907 Bacteria 1336
953 Ga0496104_0586981 3300048907 Bacteria 1025
954 Ga0496105_0016130 3300048908 Bacteria 5958
955 Ga0496105_0084907 3300048908 Bacteria 2615
956 Ga0496105_0120811 3300048908 Bacteria 2160
957 Ga0496105_0154921 3300048908 Bacteria 1882
958 Ga0496105_0278401 3300048908 Bacteria 1349
959 Ga0496105_0305849 3300048908 Bacteria 1277
960 Ga0496106_0003104 3300048909 Bacteria 12404
961 Ga0496106_0013936 3300048909 Bacteria 5944
962 Ga0496106_0172545 3300048909 Bacteria 1714
963 Ga0496107_0006959 3300048910 Bacteria 7794
964 Ga0496107_0016131 3300048910 Bacteria 5241
965 Ga0496107_0037872 3300048910 Bacteria 3461
966 Ga0496107_0050244 3300048910 Bacteria 3006
967 Ga0496107_0158058 3300048910 Bacteria 1679
968 Ga0496107_0927912 3300048910 Bacteria 634
969 Ga0496108_0001682 3300048911 Bacteria 17531
970 Ga0496108_0002900 3300048911 Bacteria 13769
971 Ga0496108_0015092 3300048911 Bacteria 6305
972 Ga0496108_0036158 3300048911 Bacteria 4108
973 Ga0496108_0041472 3300048911 Bacteria 3842
974 Ga0496108_0263732 3300048911 Bacteria 1499
975 Ga0496108_0301191 3300048911 Bacteria 1396
976 Ga0496109_0001620 3300048912 Bacteria 18810
977 Ga0496109_0002875 3300048912 Bacteria 14407
978 Ga0496109_0029417 3300048912 Bacteria 4919
979 Ga0496109_0202475 3300048912 Bacteria 1866
980 Ga0496109_0352381 3300048912 Bacteria 1390
981 Ga0496109_0578591 3300048912 Bacteria 1058
982 Ga0496109_0597428 3300048912 Bacteria 1040
983 Ga0496110_0005302 3300048913 Bacteria 10092
984 Ga0496110_0014112 3300048913 Bacteria 6624
985 Ga0496110_0034780 3300048913 Bacteria 4367
986 Ga0496110_0142471 3300048913 Bacteria 2167
987 Ga0496110_0182319 3300048913 Bacteria 1906
988 Ga0496110_0412970 3300048913 Bacteria 1230
989 Ga0496111_0018545 3300048914 Bacteria 4822
990 Ga0496111_0101097 3300048914 Bacteria 2118
991 Ga0496111_0104913 3300048914 Bacteria 2079
992 Ga0496111_0169225 3300048914 Bacteria 1623
993 Ga0496111_0274517 3300048914 Bacteria 1250
994 Ga0496111_0287837 3300048914 Bacteria 1218
995 Ga0496111_0662864 3300048914 Bacteria 761
996 Ga0496112_0000017 3300048915 Bacteria 191284
997 Ga0496112_0003453 3300048915 Bacteria 13054
998 Ga0496112_0004764 3300048915 Bacteria 11568
999 Ga0496112_0026862 3300048915 Bacteria 5547
1000 Ga0496112_0050391 3300048915 Bacteria 4083
1001 Ga0496112_0098996 3300048915 Bacteria 2885
1002 Ga0496112_0145251 3300048915 Bacteria 2340
1003 Ga0496112_0303145 3300048915 Bacteria 1543
1004 Ga0496112_0579652 3300048915 Bacteria 1054
1005 Ga0496112_0609296 3300048915 Bacteria 1023
1006 Ga0496112_0841080 3300048915 Bacteria 841
1007 Ga0496113_0002010 3300048916 Bacteria 11669
1008 Ga0496113_0005360 3300048916 Bacteria 7994
1009 Ga0496113_0020026 3300048916 Bacteria 4694
1010 Ga0496113_0042681 3300048916 Bacteria 3352
1011 Ga0496113_0200268 3300048916 Bacteria 1587
1012 Ga0496113_0316579 3300048916 Bacteria 1250
1013 Ga0496113_0533758 3300048916 Bacteria 941
1014 Ga0496114_0007584 3300048917 Bacteria 8579
1015 Ga0496114_0066871 3300048917 Bacteria 3014
1016 Ga0496114_0179193 3300048917 Bacteria 1850
1017 Ga0496114_0281580 3300048917 Bacteria 1466
1018 Ga0496115_0004354 3300048918 Bacteria 10246
1019 Ga0496115_0031524 3300048918 Bacteria 4178
1020 Ga0496115_0031615 3300048918 Bacteria 4170
1021 Ga0496115_0201858 3300048918 Bacteria 1642
1022 Ga0496115_0442714 3300048918 Bacteria 1050
1023 Ga0496115_0853194 3300048918 Bacteria 705
1024 Ga0496118_0137954 3300048921 Bacteria 1553
1025 Ga0496119_0173488 3300048922 Bacteria 1137
1026 Ga0496121_0070273 3300048924 Bacteria 2821
1027 Ga0496121_0080720 3300048924 Bacteria 2577
1028 Ga0496121_0099237 3300048924 Bacteria 2251
1029 Ga0496121_0125205 3300048924 Bacteria 1933
1030 Ga0496121_0562160 3300048924 Bacteria 711
1031 Ga0496121_0667301 3300048924 Bacteria 631
1032 Ga0496122_0202525 3300048925 Bacteria 1159
1033 Ga0496124_0087618 3300048927 Bacteria 2546
1034 Ga0496125_0000040 3300048928 Bacteria 314478
1035 Ga0496125_0088429 3300048928 Bacteria 2335
1036 Ga0496125_0183078 3300048928 Bacteria 1393
1037 Ga0496126_0005072 3300048929 Bacteria 15276
1038 Ga0496126_0005800 3300048929 Bacteria 13963
1039 Ga0496126_0007510 3300048929 Bacteria 11940
1040 Ga0496126_0035899 3300048929 Bacteria 4640
1041 Ga0496126_0096139 3300048929 Bacteria 2597
1042 Ga0496126_0098102 3300048929 Bacteria 2567
1043 Ga0496126_0337064 3300048929 Bacteria 1236
1044 Ga0496126_0368765 3300048929 Bacteria 1171
1045 Ga0495682_0249392 3300049460 Bacteria 628
1046 Ga0501069_0083026 3300049585 Bacteria 1806
1047 Ga0501073_0523555 3300049589 Bacteria 819
1048 nmdc:mga03683_11546_c1 3300050489 Bacteria 3200
1049 nmdc:mga03n38_286473_c1 3300050490 Bacteria 881
1050 nmdc:mga03n38_2872_c1 3300050490 Bacteria 5425
1051 nmdc:mga03n38_422423_c1 3300050490 Bacteria 737
1052 nmdc:mga03n38_88211_c1 3300050490 Bacteria 1471
1053 nmdc:mga00v17_143671_c1 3300050491 Bacteria 1531
1054 nmdc:mga00v17_226482_c1 3300050491 Bacteria 1211
1055 nmdc:mga00v17_26363_c1 3300050491 Bacteria 3386
1056 nmdc:mga00v17_285251_c1 3300050491 Bacteria 1072
1057 nmdc:mga00v17_340057_c1 3300050491 Bacteria 976
1058 nmdc:mga0yw44_190669_c1 3300050492 Bacteria 1352
1059 nmdc:mga0yw44_2368_c1 3300050492 Bacteria 8005
1060 nmdc:mga0yw44_71559_c1 3300050492 Bacteria 2153
1061 nmdc:mga0yw44_8974_c1 3300050492 Bacteria 5019
1062 nmdc:mga0k408_328580_c1 3300050493 Bacteria 912
1063 nmdc:mga0k408_354434_c1 3300050493 Bacteria 875
1064 nmdc:mga0k408_82113_c1 3300050493 Bacteria 1888
1065 nmdc:mga0k408_8246_c1 3300050493 Bacteria 5589
1066 nmdc:mga06z11_226934_c1 3300050494 Bacteria 1093
1067 nmdc:mga06z11_46757_c1 3300050494 Bacteria 2195
1068 nmdc:mga06z11_53381_c1 3300050494 Bacteria 2079
1069 nmdc:mga06z11_5617_c1 3300050494 Bacteria 2105
1070 nmdc:mga04h51_22634_c1 3300050495 Bacteria 1904
1071 nmdc:mga04h51_277694_c1 3300050495 Bacteria 678
1072 nmdc:mga04h51_50490_c1 3300050495 Bacteria 1394
1073 nmdc:mga07m45_1086_c1 3300050496 Bacteria 12118
1074 nmdc:mga07m45_55058_c1 3300050496 Bacteria 2248
1075 nmdc:mga05p37_161675_c1 3300050507 Bacteria 2734
1076 nmdc:mga05p37_19_c3 3300050507 Bacteria 27587
1077 nmdc:mga05p37_282535_c1 3300050507 Bacteria 1979
1078 nmdc:mga05p37_722819_c1 3300050507 Bacteria 1102
1079 nmdc:mga09592_758_c1 3300050508 Bacteria 24836
1080 nmdc:mga0qj67_1779_c1 3300050509 Bacteria 15251
1081 nmdc:mga06r32_4145_c1 3300050510 Bacteria 12980
1082 nmdc:mga08y16_13453_c1 3300050511 Bacteria 8611
1083 nmdc:mga08y16_141563_c1 3300050511 Bacteria 2500
1084 nmdc:mga0n895_1573_c1 3300050512 Bacteria 17177
1085 nmdc:mga0rr50_223249_c1 3300050513 Bacteria 1556
1086 nmdc:mga0rr50_390_c1 3300050513 Bacteria 23898
1087 nmdc:mga08x19_108485_c1 3300050514 Bacteria 1849
1088 nmdc:mga0a205_681_c1 3300050515 Bacteria 27171
1089 nmdc:mga0sz30_289645_c1 3300050516 Bacteria 730
1090 nmdc:mga0sz30_46587_c1 3300050516 Bacteria 1831
1091 Ga0495601_0032597 3300053077 Bacteria 3244
1092 Ga0495612_0004388 3300053078 Bacteria 5851
1093 Ga0495612_0055763 3300053078 Bacteria 1630
1094 Ga0500635_0174104 3300053080 Bacteria 829
1095 Ga0495655_0017726 3300053083 Bacteria 1555
1096 Ga0495595_0034010 3300053084 Bacteria 2303
1097 Ga0495619_0000557 3300053085 Bacteria 24670
1098 Ga0495619_0010203 3300053085 Bacteria 5917
1099 Ga0495619_0140888 3300053085 Bacteria 1660
1100 Ga0495619_0211656 3300053085 Bacteria 1342
1101 Ga0500646_0250429 3300053090 Bacteria 623
1102 Ga0500566_0001048 3300053094 Bacteria 16009
1103 Ga0500566_0021105 3300053094 Bacteria 3831
1104 Ga0500640_000214 3300053095 Bacteria 12549
1105 Ga0500641_0099596 3300053096 Bacteria 1246
1106 Ga0500554_002627 3300053102 Bacteria 3568
1107 Ga0500554_065642 3300053102 Bacteria 1172
1108 Ga0500572_000175 3300053111 Bacteria 22657
1109 Ga0500595_000715 3300053119 Bacteria 19771
1110 Ga0500608_006744 3300053122 Bacteria 4703
1111 Ga0500614_001781 3300053123 Bacteria 4996
1112 Ga0500559_0028447 3300053136 Bacteria 2388
1113 Ga0500589_130597 3300053147 Bacteria 1050
1114 Ga0500590_097380 3300053148 Bacteria 1418
1115 Ga0500603_000394 3300053150 Bacteria 11457
1116 Ga0500603_002027 3300053150 Bacteria 4486
1117 Ga0500603_050322 3300053150 Bacteria 1138
1118 Ga0500630_000213 3300053159 Bacteria 22563
1119 Ga0500638_001677 3300053162 Bacteria 7185
1120 Ga0500638_005668 3300053162 Bacteria 5012
1121 Ga0500639_000239 3300053163 Bacteria 27228
1122 Ga0500637_0000265 3300053178 Bacteria 19602
1123 Ga0500637_0007251 3300053178 Bacteria 5532
1124 Ga0500596_000367 3300053735 Bacteria 8162
1125 Ga0500601_021336 3300053737 Bacteria 747
1126 2509149351 2508501128 Bacteria 8613869
1127 2513677418 2513237098 Bacteria 9902361
1128 2513891308 2513237141 Bacteria 8496279
1129 2524470441 2524023210 Bacteria 9029266
1130 2643758298 2643221547 Bacteria 4740017
1131 2885392470 2885383462 Bacteria 9473874
1132 2903769666 2903768456 Bacteria 9749579
1133 2922368631 2922361189 Bacteria 7436256
1134 8056684875 8056681323 Bacteria 8472857
1135 Ga0496126_0426544
1136 JGI24746J21847_1001317
1137 JGI24743J22301_10003273
1138 JGI24748J21848_1023147
1139 JGI24749J21850_1001469
1140 JGI24744J21845_10012247
1141 JGI24034J26672_10010225
1142 JGI24742J22300_10002785
1143 JGI24751J29686_10006717
1144 JGI25406J46586_10000034
1145 JGI25153J46596_10017828
1146 rootH2_10203984
1147 rootH1_10036963
1148 Ga0070658_10102993
1149 Ga0070676_10134406
1150 Ga0070676_10228397
1151 Ga0070676_10372446
1152 Ga0070683_100155781
1153 Ga0070683_100468213
1154 Ga0070683_101046387
1155 Ga0070690_100053581
1156 Ga0070690_100139306
1157 Ga0070670_100007025
1158 Ga0070670_100050801
1159 Ga0070670_100051489
1160 Ga0070670_100142493
1161 Ga0070670_100326773
1162 Ga0068869_100033241
1163 Ga0068869_100040310
1164 Ga0068869_100117592
1165 Ga0068869_100181402
1166 Ga0070666_10052370
1167 Ga0070666_10071932
1168 Ga0070680_100026227
1169 Ga0070680_100056750
1170 Ga0070680_100157997
1171 Ga0070680_100331013
1172 Ga0070680_100418593
1173 Ga0070682_100036227
1174 Ga0070682_100058817
1175 Ga0070682_100468700
1176 Ga0068868_100003160
1177 Ga0068868_100003369
1178 Ga0068868_101363076
1179 Ga0070660_100106382
1180 Ga0070660_100494141
1181 Ga0070689_100052258
1182 Ga0070689_100089648
1183 Ga0070689_100205296
1184 Ga0070689_100580831
1185 Ga0070691_10086843
1186 Ga0070691_10213767
1187 Ga0070661_100142530
1188 Ga0070661_100157347
1189 Ga0070661_100174587
1190 Ga0070692_10015119
1191 Ga0070668_100037383
1192 Ga0070668_100076047
1193 Ga0070668_100797018
1194 Ga0070669_100087524
1195 Ga0070669_100456390
1196 Ga0070675_100005711
1197 Ga0070671_100001331
1198 Ga0070671_100048277
1199 Ga0070671_100100508
1200 Ga0070671_100478701
1201 Ga0070671_100816417
1202 Ga0070674_100020473
1203 Ga0070674_100374580
1204 Ga0070674_100413895
1205 Ga0070673_100001163
1206 Ga0070673_100002176
1207 Ga0070673_100006931
1208 Ga0070673_100450586
1209 Ga0070673_101217233
1210 Ga0070688_100059515
1211 Ga0070688_100076094
1212 Ga0070688_100149997
1213 Ga0070688_100514863
1214 Ga0070659_100035456
1215 Ga0070659_100086353
1216 Ga0070659_100115476
1217 Ga0070659_100127439
1218 Ga0070659_100316712
1219 Ga0070667_100020418
1220 Ga0070667_100172638
1221 Ga0070667_100767006
1222 Ga0070667_100919963
1223 Ga0070709_10012949
1224 Ga0070714_100043951
1225 Ga0070714_100074625
1226 Ga0070714_100170865
1227 Ga0070714_100177232
1228 Ga0070713_100012383
1229 Ga0070713_100016379
1230 Ga0070713_100017742
1231 Ga0070713_100019667
1232 Ga0070713_100556931
1233 Ga0070713_100959717
1234 Ga0070710_10004585
1235 Ga0070710_10024250
1236 Ga0070710_10063463
1237 Ga0070711_100013093
1238 Ga0070711_100088479
1239 Ga0070711_100110947
1240 Ga0070711_100142854
1241 Ga0070711_100196443
1242 Ga0070705_100117187
1243 Ga0070700_100069247
1244 Ga0070700_100333471
1245 Ga0070708_100263899
1246 Ga0070663_100003656
1247 Ga0070663_100004111
1248 Ga0070663_100103355
1249 Ga0070663_100108146
1250 Ga0070663_100117737
1251 Ga0070663_100250112
1252 Ga0070663_100261970
1253 Ga0070663_100887112
1254 Ga0070678_100005384
1255 Ga0070678_100034207
1256 Ga0070678_100153160
1257 Ga0070678_100173658
1258 Ga0070678_100455159
1259 Ga0070678_100864867
1260 Ga0070662_100014566
1261 Ga0070662_100090547
1262 Ga0070662_100422775
1263 Ga0070681_10076110
1264 Ga0070681_10110910
1265 Ga0070681_10128657
1266 Ga0070681_10149452
1267 Ga0070681_10150332
1268 Ga0068867_100121343
1269 Ga0068867_100301697
1270 Ga0070685_10012017
1271 Ga0070685_10216031
1272 Ga0070707_100132939
1273 Ga0070698_100236774
1274 Ga0070698_100258194
1275 Ga0070698_100305096
1276 Ga0070699_100592119
1277 Ga0070699_100649839
1278 Ga0070679_100003933
1279 Ga0070679_100005873
1280 Ga0070679_100027524
1281 Ga0070679_100030562
1282 Ga0070679_100145182
1283 Ga0070679_100181933
1284 Ga0070679_100614809
1285 Ga0070679_100891017
1286 Ga0070684_100034666
1287 Ga0070684_100054648
1288 Ga0070684_100142084
1289 Ga0070684_100198510
1290 Ga0070684_100427650
1291 Ga0070697_100263148
1292 Ga0068853_100036895
1293 Ga0068853_100555795
1294 Ga0068853_100656480
1295 Ga0070672_100120816
1296 Ga0070672_100455714
1297 Ga0070686_100003612
1298 Ga0070686_100040601
1299 Ga0070686_100072491
1300 Ga0070686_100693701
1301 Ga0070696_100476719
1302 Ga0070693_100201906
1303 Ga0070665_100025056
1304 Ga0070665_100089220
1305 Ga0070665_100103763
1306 Ga0070665_100155533
1307 Ga0070704_100055095
1308 Ga0068855_100040685
1309 Ga0068855_100109595
1310 Ga0068855_100165838
1311 Ga0068855_100261445
1312 Ga0068855_100294417
1313 Ga0068855_100795140
1314 Ga0070664_100011896
1315 Ga0070664_100235962
1316 Ga0070664_100293951
1317 Ga0070664_100421590
1318 Ga0068857_100177624
1319 Ga0068857_100796090
1320 Ga0068854_100017570
1321 Ga0068854_100105262
1322 Ga0068854_100142458
1323 Ga0068854_100371937
1324 Ga0068854_100494685
1325 Ga0068856_100000061
1326 Ga0068856_100119855
1327 Ga0068856_100164062
1328 Ga0068856_100263946
1329 Ga0068856_100756567
1330 Ga0070702_100005192
1331 Ga0070702_100051278
1332 Ga0070702_100149467
1333 Ga0068852_100162249
1334 Ga0068852_100292199
1335 Ga0068852_101250093
1336 Ga0068859_100013198
1337 Ga0068859_100038214
1338 Ga0068859_100299145
1339 Ga0068859_100341157
1340 Ga0068859_100962691
1341 Ga0068859_101560673
1342 Ga0068864_100008218
1343 Ga0068864_100052894
1344 Ga0068866_10023345
1345 Ga0068866_10203735
1346 Ga0068861_100080957
1347 Ga0068861_100166781
1348 Ga0068851_10059509
1349 Ga0068870_10000819
1350 Ga0068870_10500430
1351 Ga0068863_100008090
1352 Ga0068863_100135706
1353 Ga0068863_100179979
1354 Ga0068858_100091622
1355 Ga0068858_100150601
1356 Ga0068858_100227893
1357 Ga0068858_100392593
1358 Ga0068858_100864366
1359 Ga0068860_100000081
1360 Ga0068860_100173161
1361 Ga0068860_100301975
1362 Ga0068860_100319594
1363 Ga0068860_100379375
1364 Ga0068860_100405930
1365 Ga0068862_100145047
1366 Ga0068862_100164141
1367 Ga0068862_100167638
1368 Ga0068862_100469245
1369 Ga0081455_10040362
1370 Ga0081455_10083231
1371 Ga0081540_1001760
1372 Ga0081540_1005540
1373 Ga0081540_1013929
1374 Ga0081540_1016188
1375 Ga0081540_1041342
1376 Ga0081540_1048993
1377 Ga0081540_1065533
1378 Ga0081539_10000113
1379 Ga0070717_10000208
1380 Ga0070717_10023506
1381 Ga0070717_10079019
1382 Ga0070717_10285023
1383 Ga0070717_10300223
1384 Ga0070717_10310672
1385 Ga0075365_10004575
1386 Ga0075365_10097763
1387 Ga0075365_10256084
1388 Ga0075368_10042765
1389 Ga0075368_10094199
1390 Ga0075368_10138416
1391 Ga0075368_10145757
1392 Ga0075363_100003841
1393 Ga0075363_100055194
1394 Ga0075363_100072416
1395 Ga0075364_10039910
1396 Ga0075432_10013108
1397 Ga0070715_10004593
1398 Ga0070715_10044791
1399 Ga0070715_10126203
1400 Ga0070715_10230664
1401 Ga0070716_100002237
1402 Ga0070716_100820874
1403 Ga0070712_100003066
1404 Ga0070712_100034839
1405 Ga0070712_100073280
1406 Ga0070712_100201131
1407 Ga0075367_10005056
1408 Ga0075367_10018056
1409 Ga0075369_10021538
1410 Ga0075369_10146918
1411 Ga0075427_10001183
1412 Ga0075366_10022697
1413 Ga0075366_10036482
1414 Ga0075366_10111482
1415 Ga0097621_100016264
1416 Ga0097621_100021881
1417 Ga0097621_100134565
1418 Ga0075370_10030966
1419 Ga0075370_10164071
1420 Ga0068871_100007371
1421 Ga0068871_100190467
1422 Ga0068871_100977269
1423 Ga0075428_100010200
1424 Ga0075428_100529691
1425 Ga0075430_100001483
1426 Ga0075431_100017410
1427 Ga0075433_10002052
1428 Ga0075434_100001473
1429 Ga0075434_100138061
1430 Ga0075434_100219840
1431 Ga0075429_100005294
1432 Ga0068865_100007918
1433 Ga0068865_100513813
1434 Ga0075436_100006832
1435 Ga0075436_100397551
1436 Ga0075436_100598571
1437 Ga0097620_100013200
1438 Ga0097620_100038215
1439 Ga0097620_100299155
1440 Ga0097620_100341155
1441 Ga0097620_100962645
1442 Ga0097620_101560637
1443 Ga0075435_100034905
1444 Ga0075435_100063487
1445 Ga0099794_10002268
1446 Ga0099795_10025328
1447 Ga0099795_10034929
1448 Ga0105244_10222873
1449 Ga0105240_10128623
1450 Ga0105240_10157827
1451 Ga0105240_10167179
1452 Ga0105240_10291530
1453 Ga0105240_11093666
1454 Ga0111539_10008538
1455 Ga0111539_10131557
1456 Ga0111539_10296445
1457 Ga0111539_10784390
1458 Ga0111539_11220365
1459 Ga0105245_10041292
1460 Ga0105245_10060774
1461 Ga0105245_10669282
1462 Ga0105247_10108262
1463 Ga0105247_10140877
1464 Ga0105247_10159068
1465 Ga0105247_10309033
1466 Ga0114129_10042454
1467 Ga0114129_10046549
1468 Ga0114129_10272398
1469 Ga0114129_10275924
1470 Ga0105243_10430511
1471 Ga0105243_10952851
1472 Ga0105241_10107391
1473 Ga0105241_10358120
1474 Ga0105241_10359512
1475 Ga0105241_10421750
1476 Ga0105242_10041657
1477 Ga0105242_10060616
1478 Ga0105242_10253475
1479 Ga0105242_10908151
1480 Ga0105248_10180880
1481 Ga0105248_10504151
1482 Ga0105237_10097272
1483 Ga0105237_10115212
1484 Ga0105237_10673642
1485 Ga0105238_10028676
1486 Ga0105238_10430024
1487 Ga0105238_11756052
1488 Ga0105249_10151920
1489 Ga0105249_10367537
1490 Ga0105249_10425526
1491 Ga0099796_10016123
1492 Ga0105239_10011139
1493 Ga0105239_10219918
1494 Ga0105239_10229696
1495 Ga0105239_10529683
1496 Ga0105239_11234141
1497 Ga0105246_10021797
1498 Ga0105246_10273237
1499 Ga0105246_10354127
1500 Ga0157344_1002933
1501 Ga0157341_1004823
1502 Ga0157316_1000481
1503 Ga0157370_10030019
1504 Ga0157370_10114031
1505 Ga0157370_10785464
1506 Ga0157369_10007421
1507 Ga0157369_10016145
1508 Ga0157369_10120105
1509 Ga0157369_10182692
1510 Ga0157369_10673579
1511 Ga0157369_10749128
1512 Ga0157374_10002946
1513 Ga0157374_10021619
1514 Ga0157374_10142292
1515 Ga0157374_10195141
1516 Ga0157374_11004924
1517 Ga0157378_10009553
1518 Ga0157378_10052128
1519 Ga0157378_10054478
1520 Ga0157378_10172400
1521 Ga0163162_10089599
1522 Ga0163162_10322270
1523 Ga0163162_10370530
1524 Ga0163162_10745775
1525 Ga0157372_10065655
1526 Ga0157372_10306621
1527 Ga0157372_10555171
1528 Ga0157372_11596853
1529 Ga0157375_10012564
1530 Ga0157375_10545597
1531 Ga0163163_10013378
1532 Ga0163163_10056723
1533 Ga0163163_10120257
1534 Ga0163163_10131190
1535 Ga0163163_11048759
1536 Ga0157380_10281869
1537 Ga0157380_10960119
1538 Ga0157377_10002479
1539 Ga0157377_10112765
1540 Ga0157377_10174155
1541 Ga0157379_10007369
1542 Ga0157379_10076935
1543 Ga0157379_10084510
1544 Ga0157379_10211016
1545 Ga0157379_10241666
1546 Ga0157379_10398711
1547 Ga0157379_10452070
1548 Ga0157376_10006417
1549 Ga0157376_10072518
1550 Ga0157376_10073211
1551 Ga0157376_10079797
1552 Ga0157376_10282843
1553 Ga0157376_10330006
1554 Ga0157376_10882803
1555 Ga0163161_10124563
1556 Ga0163161_10291676
1557 Ga0163161_10421923
1558 Ga0206354_10582287
1559 Ga0213871_10002616
1560 Ga0209758_1010882
1561 Ga0209758_1011390
1562 Ga0209758_1029404
1563 Ga0207697_10132322
1564 Ga0207653_10122163
1565 Ga0207682_10085580
1566 Ga0207692_10060370
1567 Ga0207692_10114481
1568 Ga0207692_10136513
1569 Ga0207642_10127306
1570 Ga0207642_10387681
1571 Ga0207710_10029549
1572 Ga0207710_10204619
1573 Ga0207688_10010390
1574 Ga0207688_10056255
1575 Ga0207680_10074349
1576 Ga0207680_10108586
1577 Ga0207647_10022444
1578 Ga0207685_10128661
1579 Ga0207699_10022022
1580 Ga0207699_10034223
1581 Ga0207699_10073848
1582 Ga0207699_10097037
1583 Ga0207645_10121830
1584 Ga0207645_10393701
1585 Ga0207645_10408175
1586 Ga0207643_10000675
1587 Ga0207705_10630141
1588 Ga0207684_10135572
1589 Ga0207654_10059170
1590 Ga0207654_10154524
1591 Ga0207654_10264310
1592 Ga0207707_10000916
1593 Ga0207707_10051186
1594 Ga0207707_10331608
1595 Ga0207707_10339495
1596 Ga0207695_10022496
1597 Ga0207695_10029844
1598 Ga0207695_10144086
1599 Ga0207695_10761756
1600 Ga0207671_10072463
1601 Ga0207671_10095326
1602 Ga0207693_10001243
1603 Ga0207693_10100225
1604 Ga0207693_10136454
1605 Ga0207693_10512783
1606 Ga0207663_10033274
1607 Ga0207663_10163892
1608 Ga0207663_10167426
1609 Ga0207663_10266894
1610 Ga0207660_10137959
1611 Ga0207660_10390920
1612 Ga0207657_10044555
1613 Ga0207657_10238644
1614 Ga0207657_10294645
1615 Ga0207649_10075548
1616 Ga0207649_10091894
1617 Ga0207649_10245769
1618 Ga0207649_10545699
1619 Ga0207652_10027112
1620 Ga0207652_10038672
1621 Ga0207652_10069643
1622 Ga0207652_10118799
1623 Ga0207652_10136727
1624 Ga0207652_10180742
1625 Ga0207652_10240198
1626 Ga0207652_10730551
1627 Ga0207646_10278678
1628 Ga0207681_10064244
1629 Ga0207681_10294518
1630 Ga0207650_10019497
1631 Ga0207650_10048647
1632 Ga0207650_10306308
1633 Ga0207659_10001651
1634 Ga0207659_10140108
1635 Ga0207687_10008249
1636 Ga0207687_10141916
1637 Ga0207687_10576398
1638 Ga0207700_10002188
1639 Ga0207700_10003970
1640 Ga0207700_10022181
1641 Ga0207700_10055560
1642 Ga0207700_10057722
1643 Ga0207700_10108579
1644 Ga0207664_10198228
1645 Ga0207664_10201580
1646 Ga0207664_10269635
1647 Ga0207664_10563891
1648 Ga0207664_10662917
1649 Ga0207644_10000779
1650 Ga0207644_10005962
1651 Ga0207690_10092344
1652 Ga0207690_10096636
1653 Ga0207690_10133309
1654 Ga0207706_10027569
1655 Ga0207706_10044372
1656 Ga0207706_10090585
1657 Ga0207706_10267208
1658 Ga0207686_10059601
1659 Ga0207709_10002129
1660 Ga0207670_10021477
1661 Ga0207670_10034654
1662 Ga0207670_10554377
1663 Ga0207669_10011456
1664 Ga0207669_10037041
1665 Ga0207704_10016603
1666 Ga0207704_10035183
1667 Ga0207665_10082708
1668 Ga0207665_10112384
1669 Ga0207665_10120553
1670 Ga0207665_10329685
1671 Ga0207691_10001631
1672 Ga0207691_10103559
1673 Ga0207691_10232304
1674 Ga0207691_10449061
1675 Ga0207711_10457199
1676 Ga0207711_10480301
1677 Ga0207689_10013931
1678 Ga0207689_10045378
1679 Ga0207689_10132306
1680 Ga0207661_10002496
1681 Ga0207679_10017717
1682 Ga0207679_10406152
1683 Ga0207667_10018061
1684 Ga0207667_10201406
1685 Ga0207667_10461876
1686 Ga0207651_10002318
1687 Ga0207651_10008556
1688 Ga0207712_10015592
1689 Ga0207668_10011978
1690 Ga0207668_10174640
1691 Ga0207668_10719631
1692 Ga0207668_10737940
1693 Ga0207668_11258936
1694 Ga0207640_10100676
1695 Ga0207640_10149366
1696 Ga0207640_10149549
1697 Ga0207658_10024734
1698 Ga0207658_10660120
1699 Ga0207677_10010826
1700 Ga0207677_10028736
1701 Ga0207703_10034858
1702 Ga0207703_10070074
1703 Ga0207703_10643299
1704 Ga0207639_10486409
1705 Ga0207678_10064705
1706 Ga0207678_10068174
1707 Ga0207678_10088555
1708 Ga0207678_10285453
1709 Ga0207678_10301172
1710 Ga0207678_10302123
1711 Ga0207678_10307095
1712 Ga0207678_10346111
1713 Ga0207678_10563613
1714 Ga0207708_10027447
1715 Ga0207708_10097594
1716 Ga0207702_10000674
1717 Ga0207702_10068488
1718 Ga0207702_10390666
1719 Ga0207641_10007853
1720 Ga0207641_11103700
1721 Ga0207648_10044649
1722 Ga0207648_10293826
1723 Ga0207676_10001534
1724 Ga0207676_10091000
1725 Ga0207674_10271829
1726 Ga0207674_10273056
1727 Ga0207675_100028015
1728 Ga0207675_100039525
1729 Ga0207675_100053074
1730 Ga0207675_100082002
1731 Ga0207675_100636759
1732 Ga0207683_10003123
1733 Ga0207683_10010904
1734 Ga0207698_10001896
1735 Ga0207698_10042683
1736 Ga0207698_10250403
1737 Ga0209588_1000977
1738 Ga0209588_1067825
1739 Ga0209813_10033110
1740 Ga0209813_10245165
1741 Ga0207428_10000082
1742 Ga0268266_10003344
1743 Ga0268266_10088513
1744 Ga0268266_10449763
1745 Ga0268266_10571521
1746 Ga0268266_10685092
1747 Ga0268265_10003368
1748 Ga0268265_10130187
1749 Ga0268265_10653474
1750 Ga0268264_10000048
1751 Ga0268264_10008893
1752 Ga0268264_10197408
1753 Ga0268264_10247626
1754 Ga0268264_10730053
1755 Ga0265337_1012788
1756 Ga0265326_10003400
1757 Ga0265319_1014589
1758 Ga0265334_10004112
1759 Ga0265334_10123280
1760 Ga0265318_10041448
1761 Ga0265323_10004703
1762 Ga0265336_10001567
1763 Ga0307517_10143425
1764 Ga0307515_10611535
1765 Ga0265338_10000034
1766 Ga0265324_10006370
1767 Ga0265325_10013213
1768 Ga0265339_10108484
1769 Ga0265331_10058077
1770 Ga0265316_10854117
1771 Ga0307509_10074244
1772 Ga0307509_10182360
1773 Ga0307509_10711080
1774 Ga0307508_10076043
1775 Ga0307508_10135286
1776 Ga0307508_10487525
1777 Ga0307508_10633827
1778 Ga0265314_10005447
1779 Ga0265314_10024001
1780 Ga0265342_10128926
1781 Ga0307516_10059573
1782 Ga0307516_10265993
1783 Ga0307415_100063520
1784 Ga0307510_10003449
1785 Ga0307510_10019293
1786 Ga0373926_0010257
1787 Ga0373926_0017225
1788 Ga0373934_0013184
1789 Ga0373934_0013852
1790 Ga0373934_0033956
1791 Ga0373940_0014198
1792 Ga0373944_0006227
1793 Ga0373944_0039244
1794 Ga0373944_0095667
1795 Ga0373952_0064952
1796 Ga0373923_0006563
1797 Ga0373923_0008416
1798 Ga0373923_0042869
1799 Ga0373932_0099651
1800 Ga0373936_0003229
1801 Ga0373936_0004735
1802 Ga0373936_0019424
1803 Ga0373945_0001310
1804 Ga0373945_0073354
1805 Ga0373953_0015054
1806 Ga0373953_0032257
1807 Ga0373954_0002403
1808 Ga0373954_0006338
1809 Ga0373954_0013491
1810 Ga0373956_0011739
1811 Ga0373956_0016342
1812 Ga0373956_0193556
1813 Ga0373957_0004788
1814 Ga0373957_0047261
1815 Ga0373943_0003753
1816 Ga0373943_0008120
1817 Ga0373943_0043789
1818 Ga0373943_0086903
1819 Ga0373946_0003292
1820 Ga0373946_0010357
1821 Ga0373946_0082281
1822 Ga0373955_0058087
1823 Ga0373955_0071709
1824 Ga0373962_0139354
1825 Ga0373962_0161103
1826 Ga0373924_0006926
1827 Ga0373924_0018912
1828 Ga0373924_0042542
1829 Ga0373924_0048895
1830 Ga0373931_0083687
1831 Ga0373931_0382456
1832 Ga0373935_0014513
1833 Ga0373935_0076609
1834 Ga0373927_0000121
1835 Ga0373927_0017851
1836 Ga0373927_0020402
1837 Ga0373927_0028965
1838 Ga0373927_0077200
1839 Ga0373933_0016314
1840 Ga0373933_0066179
1841 Ga0373947_0002018
1842 Ga0373947_0012161
1843 Ga0373947_0048562
1844 Ga0373937_0015887
1845 Ga0373937_0132615
1846 Ga0373937_0146362
1847 Ga0373937_0858404
1848 Ga0373925_0002194
1849 Ga0373925_0139202
1850 Ga0373925_0177234
1851 Ga0373925_0236614
1852 Ga0373925_0376722
1853 Ga0373925_0929676
1854 Ga0395900_0048549
1855 Ga0395900_0163654
1856 Ga0395901_0109506
1857 Ga0436365_0227213
1858 Ga0436365_0981833
1859 Ga0436365_1414818
1860 Ga0436365_1700201
1861 Ga0436360_0181084
1862 Ga0436360_0904398
1863 Ga0436361_0248601
1864 Ga0436361_0967620
1865 Ga0436362_1193065
1866 Ga0451800_1097031
1867 Ga0451800_1530629
1868 Ga0451804_0681616
1869 Ga0451807_1488698
1870 Ga0451849_0839122
1871 Ga0451853_2095703
1872 Ga0466969_0171124
1873 Ga0466966_0267902
1874 Ga0466963_0090475
1875 Ga0466968_0227927
1876 Ga0466970_0024879
1877 Ga0466957_0084528
1878 Ga0466967_0070734
1879 Ga0466967_0095054
1880 Ga0466967_0132737
1881 Ga0495617_076057
1882 Ga0495592_0002856
1883 Ga0495592_0016464
1884 Ga0495592_0044107
1885 Ga0495592_0051867
1886 Ga0495603_0001782
1887 Ga0495603_0021236
1888 Ga0495603_0062365
1889 Ga0495603_0153283
1890 Ga0495629_0000242
1891 Ga0495629_0016212
1892 Ga0495629_0042588
1893 Ga0495629_0095751
1894 Ga0495629_0163904
1895 Ga0495638_0032269
1896 Ga0495641_0000994
1897 Ga0495641_0062494
1898 Ga0495641_0102668
1899 Ga0495651_0325275
1900 Ga0495653_0005558
1901 Ga0495653_0106668
1902 Ga0495653_0123174
1903 Ga0495580_0004514
1904 Ga0495580_0009026
1905 Ga0495580_0363803
1906 Ga0495582_0000268
1907 Ga0495582_0030573
1908 Ga0495582_0041115
1909 Ga0495605_0055182
1910 Ga0495639_0000157
1911 Ga0495639_0004971
1912 Ga0495639_0027769
1913 Ga0495639_0139619
1914 Ga0495662_0007644
1915 Ga0495664_0019517
1916 Ga0495664_0022971
1917 Ga0495664_0029640
1918 Ga0495664_0131277
1919 Ga0495664_0141546
1920 Ga0495664_0489546
1921 Ga0495584_0005529
1922 Ga0495584_0330211
1923 Ga0495584_0438691
1924 Ga0495585_0256373
1925 Ga0495594_0059340
1926 Ga0495594_0059936
1927 Ga0495594_0067294
1928 Ga0495607_0102866
1929 Ga0495606_0003626
1930 Ga0495606_0061638
1931 Ga0495608_0017348
1932 Ga0495608_0147908
1933 Ga0495616_0040759
1934 Ga0495618_0046592
1935 Ga0495618_0064109
1936 Ga0495618_0177312
1937 Ga0495618_0197387
1938 Ga0495618_0323245
1939 Ga0495628_0065041
1940 Ga0495628_0143907
1941 Ga0495630_0001544
1942 Ga0495630_0061693
1943 Ga0495630_0229290
1944 Ga0495631_0094192
1945 Ga0495632_0130226
1946 Ga0495637_0159743
1947 Ga0495644_0170698
1948 Ga0495666_0061310
1949 Ga0495666_0076141
1950 Ga0495666_0284240
1951 Ga0495652_0023483
1952 Ga0495652_0063455
1953 Ga0495652_0080346
1954 Ga0495652_0110987
1955 Ga0495665_0000656
1956 Ga0495665_0010056
1957 Ga0495640_0012228
1958 Ga0495640_0029778
1959 Ga0495640_0061328
1960 Ga0495640_0070785
1961 Ga0495640_0078660
1962 Ga0495586_0045531
1963 Ga0495586_0219048
1964 Ga0495587_0006060
1965 Ga0495587_0079818
1966 Ga0495598_0005003
1967 Ga0495609_0029646
1968 Ga0495621_0218771
1969 Ga0495597_0133386
1970 Ga0495645_0031198
1971 Ga0495645_0093671
1972 Ga0495645_0135760
1973 Ga0495645_0178467
1974 Ga0495645_0203931
1975 Ga0495622_0002769
1976 Ga0495622_0007792
1977 Ga0495622_0142197
1978 Ga0495633_0111508
1979 Ga0495667_0022864
1980 Ga0495667_0026566
1981 Ga0495667_0068906
1982 Ga0495667_0240343
1983 Ga0495667_0431653
1984 Ga0495656_0023643
1985 Ga0495656_0028075
1986 Ga0495656_0045722
1987 Ga0495668_0185537
1988 Ga0495634_0000206
1989 Ga0495634_0033435
1990 Ga0495634_0145843
1991 Ga0495634_0290298
1992 Ga0495611_0032374
1993 Ga0495611_0329325
1994 Ga0495635_0000723
1995 Ga0495635_0004976
1996 Ga0495635_0010817
1997 Ga0495635_0043607
1998 Ga0495635_0080868
1999 Ga0495635_0176195
2000 Ga0495659_0001310
2001 Ga0495659_0371714
2002 Ga0495661_0411654
2003 Ga0495588_0001039
2004 Ga0495588_0067908
2005 Ga0495657_0008675
2006 Ga0495599_0028396
2007 Ga0495599_0088224
2008 Ga0495599_0486742
2009 Ga0495623_0011265
2010 Ga0495623_0158719
2011 Ga0495623_0158918
2012 Ga0495623_0208408
2013 Ga0495646_0001912
2014 Ga0495646_0015182
2015 Ga0495647_0001229
2016 Ga0495647_0014983
2017 Ga0495647_0038885
2018 Ga0495658_0000188
2019 Ga0495658_0024424
2020 Ga0495658_0283737
2021 Ga0495669_0015310
2022 Ga0495669_0071113
2023 Ga0495669_0247332
2024 Ga0495613_0013006
2025 Ga0495613_0034342
2026 Ga0495613_0054981
2027 Ga0495613_0119721
2028 Ga0495624_0007942
2029 Ga0495624_0034608
2030 Ga0495624_0083240
2031 Ga0495670_0059669
2032 Ga0495670_0093170
2033 Ga0495670_0253800
2034 Ga0495649_0043160
2035 Ga0495589_0211536
2036 Ga0495600_0001540
2037 Ga0495600_0333028
2038 Ga0495581_0000166
2039 Ga0495581_0041029
2040 Ga0495581_0043324
2041 Ga0495581_0107245
2042 Ga0495581_0327316
2043 Ga0495604_0004097
2044 Ga0495674_0009028
2045 Ga0495674_0067364
2046 Ga0495674_0136617
2047 Ga0495672_0051317
2048 Ga0495676_0175931
2049 Ga0495680_0044358
2050 Ga0495683_0135288
2051 Ga0495685_095158
2052 Ga0495673_0098284
2053 Ga0495684_0010530
2054 Ga0495684_0019701
2055 Ga0495684_0035546
2056 Ga0495684_0077845
2057 Ga0495686_0057072
2058 Ga0495593_0000033
2059 Ga0495593_0031403
2060 Ga0495593_0043771
2061 Ga0495593_0052159
2062 Ga0495593_0070194
2063 Ga0495602_0033120
2064 Ga0495602_0073324
2065 Ga0495614_0039242
2066 Ga0495614_0136220
2067 Ga0495615_0055784
2068 Ga0496100_0079679
2069 Ga0496100_0089884
2070 Ga0496101_0000673
2071 Ga0496101_0075626
2072 Ga0496101_0099312
2073 Ga0496101_0989764
2074 Ga0496102_0001987
2075 Ga0496102_0058766
2076 Ga0496102_0114298
2077 Ga0496102_0282305
2078 Ga0496103_0000999
2079 Ga0496103_0020025
2080 Ga0496103_0367871
2081 Ga0496104_0002145
2082 Ga0496104_0018839
2083 Ga0496104_0020301
2084 Ga0496104_0128917
2085 Ga0496104_0328843
2086 Ga0496104_0374462
2087 Ga0496104_0586981
2088 Ga0496105_0016130
2089 Ga0496105_0084907
2090 Ga0496105_0120811
2091 Ga0496105_0154921
2092 Ga0496105_0278401
2093 Ga0496105_0305849
2094 Ga0496106_0003104
2095 Ga0496106_0013936
2096 Ga0496106_0172545
2097 Ga0496107_0006959
2098 Ga0496107_0016131
2099 Ga0496107_0037872
2100 Ga0496107_0050244
2101 Ga0496107_0158058
2102 Ga0496107_0927912
2103 Ga0496108_0001682
2104 Ga0496108_0002900
2105 Ga0496108_0015092
2106 Ga0496108_0036158
2107 Ga0496108_0041472
2108 Ga0496108_0263732
2109 Ga0496108_0301191
2110 Ga0496109_0001620
2111 Ga0496109_0002875
2112 Ga0496109_0029417
2113 Ga0496109_0202475
2114 Ga0496109_0352381
2115 Ga0496109_0578591
2116 Ga0496109_0597428
2117 Ga0496110_0005302
2118 Ga0496110_0014112
2119 Ga0496110_0034780
2120 Ga0496110_0142471
2121 Ga0496110_0182319
2122 Ga0496110_0412970
2123 Ga0496111_0018545
2124 Ga0496111_0101097
2125 Ga0496111_0104913
2126 Ga0496111_0169225
2127 Ga0496111_0274517
2128 Ga0496111_0287837
2129 Ga0496111_0662864
2130 Ga0496112_0000017
2131 Ga0496112_0003453
2132 Ga0496112_0004764
2133 Ga0496112_0026862
2134 Ga0496112_0050391
2135 Ga0496112_0098996
2136 Ga0496112_0145251
2137 Ga0496112_0303145
2138 Ga0496112_0579652
2139 Ga0496112_0609296
2140 Ga0496112_0841080
2141 Ga0496113_0002010
2142 Ga0496113_0005360
2143 Ga0496113_0020026
2144 Ga0496113_0042681
2145 Ga0496113_0200268
2146 Ga0496113_0316579
2147 Ga0496113_0533758
2148 Ga0496114_0007584
2149 Ga0496114_0066871
2150 Ga0496114_0179193
2151 Ga0496114_0281580
2152 Ga0496115_0004354
2153 Ga0496115_0031524
2154 Ga0496115_0031615
2155 Ga0496115_0201858
2156 Ga0496115_0442714
2157 Ga0496115_0853194
2158 Ga0496118_0137954
2159 Ga0496119_0173488
2160 Ga0496121_0070273
2161 Ga0496121_0080720
2162 Ga0496121_0099237
2163 Ga0496121_0125205
2164 Ga0496121_0562160
2165 Ga0496121_0667301
2166 Ga0496122_0202525
2167 Ga0496124_0087618
2168 Ga0496125_0000040
2169 Ga0496125_0088429
2170 Ga0496125_0183078
2171 Ga0496126_0005072
2172 Ga0496126_0005800
2173 Ga0496126_0007510
2174 Ga0496126_0035899
2175 Ga0496126_0096139
2176 Ga0496126_0098102
2177 Ga0496126_0337064
2178 Ga0496126_0368765
2179 Ga0495682_0249392
2180 Ga0501069_0083026
2181 Ga0501073_0523555
2182 nmdc:mga03683_11546_c1
2183 nmdc:mga03n38_286473_c1
2184 nmdc:mga03n38_2872_c1
2185 nmdc:mga03n38_422423_c1
2186 nmdc:mga03n38_88211_c1
2187 nmdc:mga00v17_143671_c1
2188 nmdc:mga00v17_226482_c1
2189 nmdc:mga00v17_26363_c1
2190 nmdc:mga00v17_285251_c1
2191 nmdc:mga00v17_340057_c1
2192 nmdc:mga0yw44_190669_c1
2193 nmdc:mga0yw44_2368_c1
2194 nmdc:mga0yw44_71559_c1
2195 nmdc:mga0yw44_8974_c1
2196 nmdc:mga0k408_328580_c1
2197 nmdc:mga0k408_354434_c1
2198 nmdc:mga0k408_82113_c1
2199 nmdc:mga0k408_8246_c1
2200 nmdc:mga06z11_226934_c1
2201 nmdc:mga06z11_46757_c1
2202 nmdc:mga06z11_53381_c1
2203 nmdc:mga06z11_5617_c1
2204 nmdc:mga04h51_22634_c1
2205 nmdc:mga04h51_277694_c1
2206 nmdc:mga04h51_50490_c1
2207 nmdc:mga07m45_1086_c1
2208 nmdc:mga07m45_55058_c1
2209 nmdc:mga05p37_161675_c1
2210 nmdc:mga05p37_19_c3
2211 nmdc:mga05p37_282535_c1
2212 nmdc:mga05p37_722819_c1
2213 nmdc:mga09592_758_c1
2214 nmdc:mga0qj67_1779_c1
2215 nmdc:mga06r32_4145_c1
2216 nmdc:mga08y16_13453_c1
2217 nmdc:mga08y16_141563_c1
2218 nmdc:mga0n895_1573_c1
2219 nmdc:mga0rr50_223249_c1
2220 nmdc:mga0rr50_390_c1
2221 nmdc:mga08x19_108485_c1
2222 nmdc:mga0a205_681_c1
2223 nmdc:mga0sz30_289645_c1
2224 nmdc:mga0sz30_46587_c1
2225 Ga0495601_0032597
2226 Ga0495612_0004388
2227 Ga0495612_0055763
2228 Ga0500635_0174104
2229 Ga0495655_0017726
2230 Ga0495595_0034010
2231 Ga0495619_0000557
2232 Ga0495619_0010203
2233 Ga0495619_0140888
2234 Ga0495619_0211656
2235 Ga0500646_0250429
2236 Ga0500566_0001048
2237 Ga0500566_0021105
2238 Ga0500640_000214
2239 Ga0500641_0099596
2240 Ga0500554_002627
2241 Ga0500554_065642
2242 Ga0500572_000175
2243 Ga0500595_000715
2244 Ga0500608_006744
2245 Ga0500614_001781
2246 Ga0500559_0028447
2247 Ga0500589_130597
2248 Ga0500590_097380
2249 Ga0500603_000394
2250 Ga0500603_002027
2251 Ga0500603_050322
2252 Ga0500630_000213
2253 Ga0500638_001677
2254 Ga0500638_005668
2255 Ga0500639_000239
2256 Ga0500637_0000265
2257 Ga0500637_0007251
2258 Ga0500596_000367
2259 Ga0500601_021336
2260 2509149351
2261 2513677418
2262 2513891308
2263 2524470441
2264 2643758298
2265 2885392470
2266 2903769666
2267 2922368631
2268 8056684875

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

121

173

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

20

86

0.93

PF04545

Sigma70_r4

Sigma-70, region 4

126

175

0.92

Map