F490512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1129 | 430 | 2258 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10021062|Ga0070658_100210624 |
| Length | 320 |
| Sequence | MTLTVRNIATAALFAALLLLPLYVQLTGDRFMLTLFTRIVIMALAAVSLNLILGFGGMMSFGHAAYLGIGGYAVGMLAHEGIVSGLVQWPVALAASALYALVIGALSLRTRGVYFIMITLAFAQMAYYIVSGIARYGGDDGLTIYKRSQFGILDLSNKVVFYYVCVALLLATVYLVWRLVNSRFGMVVQGARSNETRMRAIGFPTYRYKLVCFVIAGTLGGLAGALLANHNEFISPSTMYWTRSGDLIVMVVLGGMGSVAGPVFGAVALLVLEEVLSGITEYWPIILGPLLLLVVLFARGGIDGLLSAIKRPGRAGKEPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 138 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 242 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 287 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 288 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 289 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 416 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 421 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 426 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 429 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 430 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.54 |
| Nodule | 0 |
| Rhizoplane | 7.71 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10021062 | 3300005327 | Bacteria | 5223 |
| 2 | SwRhRL2b_contig_2220177 | 2162886007 | Bacteria | 2011 |
| 3 | 2214800767 | 2209111006 | Bacteria | 10478 |
| 4 | ARcpr5oldR_c000002 | 3300000041 | Bacteria | 79314 |
| 5 | ARSoilYngRDRAFT_c00455 | 3300000042 | Bacteria | 5023 |
| 6 | ARcpr5yngRDRAFT_c000078 | 3300000043 | Bacteria | 16068 |
| 7 | ARSoilOldRDRAFT_c000044 | 3300000044 | Bacteria | 26451 |
| 8 | ARCol0yngRDRAFT_1000006 | 3300000652 | Bacteria | 46794 |
| 9 | JGI24746J21847_1003527 | 3300001977 | Bacteria | 2465 |
| 10 | JGI24739J22299_10002045 | 3300001989 | Bacteria | 7727 |
| 11 | JGI24739J22299_10015336 | 3300001989 | Bacteria | 2782 |
| 12 | JGI24737J22298_10012349 | 3300001990 | Bacteria | 2785 |
| 13 | JGI24737J22298_10018004 | 3300001990 | Bacteria | 2271 |
| 14 | JGI24737J22298_10023143 | 3300001990 | Bacteria | 1971 |
| 15 | JGI24743J22301_10000159 | 3300001991 | Bacteria | 7006 |
| 16 | JGI24750J21931_1000490 | 3300002070 | Bacteria | 6209 |
| 17 | JGI24750J21931_1000735 | 3300002070 | Bacteria | 4686 |
| 18 | JGI24748J21848_1005336 | 3300002074 | Bacteria | 1490 |
| 19 | JGI24738J21930_10001088 | 3300002075 | Bacteria | 7686 |
| 20 | JGI24738J21930_10017649 | 3300002075 | Bacteria | 1498 |
| 21 | JGI24749J21850_1006217 | 3300002076 | Bacteria | 1664 |
| 22 | JGI24744J21845_10000795 | 3300002077 | Bacteria | 5917 |
| 23 | JGI24034J26672_10002532 | 3300002239 | Bacteria | 2511 |
| 24 | JGI24742J22300_10000719 | 3300002244 | Bacteria | 5024 |
| 25 | JGI24742J22300_10007598 | 3300002244 | Bacteria | 1789 |
| 26 | JGI24751J29686_10001890 | 3300002459 | Bacteria | 4278 |
| 27 | JGI24751J29686_10016923 | 3300002459 | Bacteria | 1505 |
| 28 | JGI25153J46596_10029783 | 3300003215 | Bacteria | 1868 |
| 29 | Ga0065704_10073537 | 3300005289 | Bacteria | 7045 |
| 30 | Ga0065712_10000525 | 3300005290 | Bacteria | 16096 |
| 31 | Ga0065712_10071643 | 3300005290 | Bacteria | 5139 |
| 32 | Ga0065715_10000786 | 3300005293 | Bacteria | 27945 |
| 33 | Ga0065715_10001618 | 3300005293 | Bacteria | 6523 |
| 34 | Ga0065715_10128721 | 3300005293 | Bacteria | 2060 |
| 35 | Ga0065707_10093700 | 3300005295 | Bacteria | 3591 |
| 36 | Ga0070676_10008636 | 3300005328 | Bacteria | 5494 |
| 37 | Ga0070676_10029492 | 3300005328 | Bacteria | 3121 |
| 38 | Ga0070676_10077970 | 3300005328 | Bacteria | 2004 |
| 39 | Ga0070690_100017544 | 3300005330 | Bacteria | 4307 |
| 40 | Ga0070690_100023985 | 3300005330 | Bacteria | 3748 |
| 41 | Ga0070670_100013972 | 3300005331 | Bacteria | 6886 |
| 42 | Ga0070670_100036840 | 3300005331 | Bacteria | 4208 |
| 43 | Ga0070670_100132744 | 3300005331 | Bacteria | 2151 |
| 44 | Ga0070677_10002021 | 3300005333 | Bacteria | 6446 |
| 45 | Ga0070677_10035037 | 3300005333 | Bacteria | 1943 |
| 46 | Ga0068869_100007722 | 3300005334 | Bacteria | 6894 |
| 47 | Ga0068869_100086402 | 3300005334 | Bacteria | 2351 |
| 48 | Ga0070666_10019359 | 3300005335 | Bacteria | 4394 |
| 49 | Ga0070680_100005003 | 3300005336 | Bacteria | 9989 |
| 50 | Ga0070680_100058564 | 3300005336 | Bacteria | 3150 |
| 51 | Ga0070680_100070455 | 3300005336 | Bacteria | 2871 |
| 52 | Ga0070680_100134244 | 3300005336 | Bacteria | 2072 |
| 53 | Ga0070682_100006121 | 3300005337 | Bacteria | 6738 |
| 54 | Ga0070682_100051056 | 3300005337 | Bacteria | 2584 |
| 55 | Ga0070682_100091409 | 3300005337 | Bacteria | 1992 |
| 56 | Ga0068868_100007371 | 3300005338 | Bacteria | 7836 |
| 57 | Ga0068868_100014393 | 3300005338 | Bacteria | 5831 |
| 58 | Ga0068868_100033675 | 3300005338 | Bacteria | 3950 |
| 59 | Ga0070660_100006708 | 3300005339 | Bacteria | 7988 |
| 60 | Ga0070660_100046308 | 3300005339 | Bacteria | 3333 |
| 61 | Ga0070660_100090012 | 3300005339 | Bacteria | 2419 |
| 62 | Ga0070660_100187939 | 3300005339 | Bacteria | 1673 |
| 63 | Ga0070689_100005971 | 3300005340 | Bacteria | 8379 |
| 64 | Ga0070689_100007754 | 3300005340 | Bacteria | 7520 |
| 65 | Ga0070689_100065721 | 3300005340 | Bacteria | 2825 |
| 66 | Ga0070691_10005815 | 3300005341 | Bacteria | 5630 |
| 67 | Ga0070687_100013422 | 3300005343 | Bacteria | 3651 |
| 68 | Ga0070661_100090705 | 3300005344 | Bacteria | 2263 |
| 69 | Ga0070692_10004117 | 3300005345 | Bacteria | 6017 |
| 70 | Ga0070692_10036509 | 3300005345 | Bacteria | 2494 |
| 71 | Ga0070668_100021658 | 3300005347 | Bacteria | 4856 |
| 72 | Ga0070668_100084052 | 3300005347 | Bacteria | 2499 |
| 73 | Ga0070669_100015804 | 3300005353 | Bacteria | 5382 |
| 74 | Ga0070669_100021880 | 3300005353 | Bacteria | 4572 |
| 75 | Ga0070675_100051528 | 3300005354 | Bacteria | 3382 |
| 76 | Ga0070671_100022260 | 3300005355 | Bacteria | 5177 |
| 77 | Ga0070671_100031865 | 3300005355 | Bacteria | 4357 |
| 78 | Ga0070671_100043050 | 3300005355 | Bacteria | 3754 |
| 79 | Ga0070671_100182331 | 3300005355 | Bacteria | 1778 |
| 80 | Ga0070674_100020621 | 3300005356 | Bacteria | 4216 |
| 81 | Ga0070674_100107515 | 3300005356 | Bacteria | 2042 |
| 82 | Ga0070674_100224366 | 3300005356 | Bacteria | 1463 |
| 83 | Ga0070673_100014487 | 3300005364 | Bacteria | 5496 |
| 84 | Ga0070673_100024611 | 3300005364 | Bacteria | 4418 |
| 85 | Ga0070673_100058891 | 3300005364 | Bacteria | 3039 |
| 86 | Ga0070688_100000988 | 3300005365 | Bacteria | 14250 |
| 87 | Ga0070659_100013688 | 3300005366 | Bacteria | 6046 |
| 88 | Ga0070659_100090687 | 3300005366 | Bacteria | 2449 |
| 89 | Ga0070667_100008782 | 3300005367 | Bacteria | 8374 |
| 90 | Ga0070667_100028199 | 3300005367 | Bacteria | 4673 |
| 91 | Ga0070667_100030348 | 3300005367 | Bacteria | 4509 |
| 92 | Ga0070667_100115175 | 3300005367 | Bacteria | 2334 |
| 93 | Ga0070703_10000974 | 3300005406 | Bacteria | 9051 |
| 94 | Ga0070703_10021515 | 3300005406 | Bacteria | 1886 |
| 95 | Ga0070709_10005670 | 3300005434 | Bacteria | 6765 |
| 96 | Ga0070714_100060740 | 3300005435 | Bacteria | 3245 |
| 97 | Ga0070714_100066662 | 3300005435 | Bacteria | 3103 |
| 98 | Ga0070713_100001193 | 3300005436 | Bacteria | 16600 |
| 99 | Ga0070713_100015115 | 3300005436 | Bacteria | 5754 |
| 100 | Ga0070713_100046278 | 3300005436 | Bacteria | 3569 |
| 101 | Ga0070713_100200070 | 3300005436 | Bacteria | 1804 |
| 102 | Ga0070713_100359523 | 3300005436 | Bacteria | 1352 |
| 103 | Ga0070710_10030475 | 3300005437 | Bacteria | 2902 |
| 104 | Ga0070701_10000183 | 3300005438 | Bacteria | 19456 |
| 105 | Ga0070701_10105651 | 3300005438 | Bacteria | 1566 |
| 106 | Ga0070711_100108148 | 3300005439 | Bacteria | 2036 |
| 107 | Ga0070711_100268855 | 3300005439 | Bacteria | 1344 |
| 108 | Ga0070705_100000072 | 3300005440 | Bacteria | 54271 |
| 109 | Ga0070705_100031359 | 3300005440 | Bacteria | 2943 |
| 110 | Ga0070700_100000962 | 3300005441 | Bacteria | 14227 |
| 111 | Ga0070700_100033730 | 3300005441 | Bacteria | 3085 |
| 112 | Ga0070694_100002401 | 3300005444 | Bacteria | 11074 |
| 113 | Ga0070694_100008532 | 3300005444 | Bacteria | 6270 |
| 114 | Ga0070694_100029178 | 3300005444 | Bacteria | 3598 |
| 115 | Ga0070694_100244774 | 3300005444 | Bacteria | 1354 |
| 116 | Ga0070694_100290179 | 3300005444 | Bacteria | 1250 |
| 117 | Ga0070708_100012927 | 3300005445 | Bacteria | 6821 |
| 118 | Ga0070663_100012889 | 3300005455 | Bacteria | 5307 |
| 119 | Ga0070663_100015673 | 3300005455 | Bacteria | 4901 |
| 120 | Ga0070678_100014088 | 3300005456 | Bacteria | 5032 |
| 121 | Ga0070678_100030148 | 3300005456 | Bacteria | 3725 |
| 122 | Ga0070678_100040679 | 3300005456 | Bacteria | 3290 |
| 123 | Ga0070662_100011551 | 3300005457 | Bacteria | 5827 |
| 124 | Ga0070662_100023409 | 3300005457 | Bacteria | 4242 |
| 125 | Ga0070681_10014164 | 3300005458 | Bacteria | 7937 |
| 126 | Ga0070681_10036206 | 3300005458 | Bacteria | 4957 |
| 127 | Ga0070681_10043334 | 3300005458 | Bacteria | 4508 |
| 128 | Ga0068867_100004925 | 3300005459 | Bacteria | 9408 |
| 129 | Ga0068867_100005981 | 3300005459 | Bacteria | 8627 |
| 130 | Ga0070685_10002466 | 3300005466 | Bacteria | 9501 |
| 131 | Ga0070706_100106155 | 3300005467 | Bacteria | 2613 |
| 132 | Ga0070698_100321522 | 3300005471 | Bacteria | 1478 |
| 133 | Ga0070698_100393484 | 3300005471 | Bacteria | 1319 |
| 134 | Ga0070699_100000250 | 3300005518 | Bacteria | 52788 |
| 135 | Ga0070699_100006065 | 3300005518 | Bacteria | 10567 |
| 136 | Ga0070679_100023403 | 3300005530 | Bacteria | 6046 |
| 137 | Ga0070679_100024333 | 3300005530 | Bacteria | 5934 |
| 138 | Ga0070679_100029480 | 3300005530 | Bacteria | 5414 |
| 139 | Ga0070679_100117275 | 3300005530 | Bacteria | 2647 |
| 140 | Ga0070679_100123265 | 3300005530 | Bacteria | 2575 |
| 141 | Ga0070679_100137832 | 3300005530 | Bacteria | 2421 |
| 142 | Ga0070679_100214453 | 3300005530 | Bacteria | 1888 |
| 143 | Ga0070679_100514701 | 3300005530 | Bacteria | 1141 |
| 144 | Ga0070684_100307329 | 3300005535 | Bacteria | 1456 |
| 145 | Ga0070697_100029834 | 3300005536 | Bacteria | 4377 |
| 146 | Ga0070697_100144326 | 3300005536 | Bacteria | 2003 |
| 147 | Ga0068853_100016210 | 3300005539 | Bacteria | 6130 |
| 148 | Ga0068853_100025687 | 3300005539 | Bacteria | 4943 |
| 149 | Ga0070672_100002019 | 3300005543 | Bacteria | 12765 |
| 150 | Ga0070672_100015771 | 3300005543 | Bacteria | 5395 |
| 151 | Ga0070672_100297185 | 3300005543 | Bacteria | 1368 |
| 152 | Ga0070686_100005478 | 3300005544 | Bacteria | 7029 |
| 153 | Ga0070686_100008947 | 3300005544 | Bacteria | 5611 |
| 154 | Ga0070686_100025369 | 3300005544 | Bacteria | 3566 |
| 155 | Ga0070686_100183754 | 3300005544 | Bacteria | 1487 |
| 156 | Ga0070686_100204506 | 3300005544 | Bacteria | 1418 |
| 157 | Ga0070695_100009154 | 3300005545 | Bacteria | 5888 |
| 158 | Ga0070695_100017290 | 3300005545 | Bacteria | 4371 |
| 159 | Ga0070696_100001222 | 3300005546 | Bacteria | 16680 |
| 160 | Ga0070696_100035450 | 3300005546 | Bacteria | 3435 |
| 161 | Ga0070696_100046601 | 3300005546 | Bacteria | 3006 |
| 162 | Ga0070696_100075905 | 3300005546 | Bacteria | 2372 |
| 163 | Ga0070704_100001627 | 3300005549 | Bacteria | 12176 |
| 164 | Ga0070704_100004758 | 3300005549 | Bacteria | 7854 |
| 165 | Ga0068855_100088921 | 3300005563 | Bacteria | 3567 |
| 166 | Ga0070664_100009499 | 3300005564 | Bacteria | 7887 |
| 167 | Ga0070664_100021829 | 3300005564 | Bacteria | 5278 |
| 168 | Ga0070664_100023695 | 3300005564 | Bacteria | 5070 |
| 169 | Ga0070664_100040276 | 3300005564 | Bacteria | 3939 |
| 170 | Ga0070664_100060326 | 3300005564 | Bacteria | 3229 |
| 171 | Ga0070664_100326367 | 3300005564 | Bacteria | 1392 |
| 172 | Ga0068857_100149832 | 3300005577 | Bacteria | 2113 |
| 173 | Ga0068857_100234081 | 3300005577 | Bacteria | 1681 |
| 174 | Ga0068854_100019786 | 3300005578 | Bacteria | 4543 |
| 175 | Ga0068856_100002357 | 3300005614 | Bacteria | 19427 |
| 176 | Ga0068856_100070913 | 3300005614 | Bacteria | 3448 |
| 177 | Ga0068856_100212296 | 3300005614 | Bacteria | 1951 |
| 178 | Ga0068856_100374532 | 3300005614 | Bacteria | 1443 |
| 179 | Ga0070702_100003696 | 3300005615 | Bacteria | 6894 |
| 180 | Ga0070702_100004151 | 3300005615 | Bacteria | 6583 |
| 181 | Ga0070702_100118622 | 3300005615 | Bacteria | 1653 |
| 182 | Ga0070702_100256213 | 3300005615 | Bacteria | 1189 |
| 183 | Ga0068852_100036741 | 3300005616 | Bacteria | 4102 |
| 184 | Ga0068859_100014663 | 3300005617 | Bacteria | 7876 |
| 185 | Ga0068859_100024405 | 3300005617 | Bacteria | 6065 |
| 186 | Ga0068859_100038786 | 3300005617 | Bacteria | 4779 |
| 187 | Ga0068859_100092893 | 3300005617 | Bacteria | 3069 |
| 188 | Ga0068859_100173439 | 3300005617 | Bacteria | 2238 |
| 189 | Ga0068864_100029805 | 3300005618 | Bacteria | 4624 |
| 190 | Ga0068864_100100018 | 3300005618 | Bacteria | 2570 |
| 191 | Ga0068864_100197848 | 3300005618 | Bacteria | 1845 |
| 192 | Ga0068864_100221260 | 3300005618 | Bacteria | 1747 |
| 193 | Ga0068864_100298528 | 3300005618 | Bacteria | 1507 |
| 194 | Ga0068866_10004536 | 3300005718 | Bacteria | 5696 |
| 195 | Ga0068866_10004841 | 3300005718 | Bacteria | 5527 |
| 196 | Ga0068861_100007422 | 3300005719 | Bacteria | 7515 |
| 197 | Ga0068861_100011543 | 3300005719 | Bacteria | 6147 |
| 198 | Ga0068870_10043393 | 3300005840 | Bacteria | 2345 |
| 199 | Ga0068870_10113076 | 3300005840 | Bacteria | 1553 |
| 200 | Ga0068863_100013447 | 3300005841 | Bacteria | 7892 |
| 201 | Ga0068863_100028939 | 3300005841 | Bacteria | 5291 |
| 202 | Ga0068863_100412605 | 3300005841 | Bacteria | 1322 |
| 203 | Ga0068858_100019603 | 3300005842 | Bacteria | 6324 |
| 204 | Ga0068858_100041088 | 3300005842 | Bacteria | 4289 |
| 205 | Ga0068860_100013861 | 3300005843 | Bacteria | 7905 |
| 206 | Ga0068860_100024578 | 3300005843 | Bacteria | 5819 |
| 207 | Ga0068860_100025455 | 3300005843 | Bacteria | 5709 |
| 208 | Ga0068860_100042317 | 3300005843 | Bacteria | 4351 |
| 209 | Ga0068862_100002889 | 3300005844 | Bacteria | 15033 |
| 210 | Ga0068862_100009877 | 3300005844 | Bacteria | 7883 |
| 211 | Ga0068862_100012095 | 3300005844 | Bacteria | 7131 |
| 212 | Ga0068862_100027147 | 3300005844 | Bacteria | 4818 |
| 213 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 214 | Ga0081455_10003043 | 3300005937 | Bacteria | 19535 |
| 215 | Ga0081455_10017138 | 3300005937 | Bacteria | 6958 |
| 216 | Ga0081455_10032195 | 3300005937 | Bacteria | 4729 |
| 217 | Ga0081455_10102989 | 3300005937 | Bacteria | 2287 |
| 218 | Ga0081538_10016815 | 3300005981 | Bacteria | 5585 |
| 219 | Ga0081538_10026172 | 3300005981 | Bacteria | 4088 |
| 220 | Ga0070717_10000217 | 3300006028 | Bacteria | 39845 |
| 221 | Ga0070717_10331386 | 3300006028 | Bacteria | 1358 |
| 222 | Ga0075365_10029572 | 3300006038 | Bacteria | 3504 |
| 223 | Ga0075365_10059917 | 3300006038 | Bacteria | 2538 |
| 224 | Ga0075365_10062989 | 3300006038 | Bacteria | 2482 |
| 225 | Ga0075368_10016953 | 3300006042 | Bacteria | 2720 |
| 226 | Ga0075368_10050958 | 3300006042 | Bacteria | 1645 |
| 227 | Ga0075368_10084676 | 3300006042 | Bacteria | 1292 |
| 228 | Ga0075432_10004699 | 3300006058 | Bacteria | 4649 |
| 229 | Ga0070715_10001366 | 3300006163 | Bacteria | 7039 |
| 230 | Ga0070715_10102419 | 3300006163 | Bacteria | 1338 |
| 231 | Ga0070712_100002166 | 3300006175 | Bacteria | 12084 |
| 232 | Ga0070712_100050246 | 3300006175 | Bacteria | 2900 |
| 233 | Ga0070712_100158894 | 3300006175 | Bacteria | 1744 |
| 234 | Ga0070712_100241432 | 3300006175 | Bacteria | 1439 |
| 235 | Ga0075367_10060452 | 3300006178 | Bacteria | 2259 |
| 236 | Ga0075367_10082600 | 3300006178 | Bacteria | 1945 |
| 237 | Ga0075367_10113941 | 3300006178 | Bacteria | 1662 |
| 238 | Ga0075427_10007153 | 3300006194 | Bacteria | 1635 |
| 239 | Ga0075366_10012741 | 3300006195 | Bacteria | 4777 |
| 240 | Ga0075366_10022792 | 3300006195 | Bacteria | 3645 |
| 241 | Ga0097621_100008062 | 3300006237 | Bacteria | 7563 |
| 242 | Ga0097621_100009622 | 3300006237 | Bacteria | 7025 |
| 243 | Ga0097621_100103648 | 3300006237 | Bacteria | 2396 |
| 244 | Ga0075370_10017657 | 3300006353 | Bacteria | 3858 |
| 245 | Ga0068871_100002599 | 3300006358 | Bacteria | 12321 |
| 246 | Ga0068871_100199336 | 3300006358 | Bacteria | 1727 |
| 247 | Ga0075428_100018890 | 3300006844 | Bacteria | 7623 |
| 248 | Ga0075428_100152988 | 3300006844 | Bacteria | 2506 |
| 249 | Ga0075428_100175581 | 3300006844 | Bacteria | 2320 |
| 250 | Ga0075428_100339101 | 3300006844 | Bacteria | 1614 |
| 251 | Ga0075428_100491563 | 3300006844 | Bacteria | 1313 |
| 252 | Ga0075430_100000255 | 3300006846 | Bacteria | 37131 |
| 253 | Ga0075430_100016737 | 3300006846 | Bacteria | 6245 |
| 254 | Ga0075430_100020485 | 3300006846 | Bacteria | 5626 |
| 255 | Ga0075430_100044550 | 3300006846 | Bacteria | 3750 |
| 256 | Ga0075430_100082266 | 3300006846 | Bacteria | 2698 |
| 257 | Ga0075430_100099398 | 3300006846 | Bacteria | 2430 |
| 258 | Ga0075431_100025571 | 3300006847 | Bacteria | 6052 |
| 259 | Ga0075431_100025734 | 3300006847 | Bacteria | 6031 |
| 260 | Ga0075431_100042822 | 3300006847 | Bacteria | 4670 |
| 261 | Ga0075431_100062366 | 3300006847 | Bacteria | 3847 |
| 262 | Ga0075431_100138652 | 3300006847 | Bacteria | 2507 |
| 263 | Ga0075431_100210233 | 3300006847 | Bacteria | 1988 |
| 264 | Ga0075433_10008805 | 3300006852 | Bacteria | 8053 |
| 265 | Ga0075433_10017290 | 3300006852 | Bacteria | 5969 |
| 266 | Ga0075433_10306677 | 3300006852 | Bacteria | 1405 |
| 267 | Ga0075434_100017606 | 3300006871 | Bacteria | 6887 |
| 268 | Ga0075434_100028914 | 3300006871 | Bacteria | 5450 |
| 269 | Ga0075434_100122839 | 3300006871 | Bacteria | 2612 |
| 270 | Ga0075434_100176314 | 3300006871 | Bacteria | 2157 |
| 271 | Ga0075434_100284007 | 3300006871 | Bacteria | 1675 |
| 272 | Ga0075429_100001284 | 3300006880 | Bacteria | 20443 |
| 273 | Ga0075429_100013201 | 3300006880 | Bacteria | 7167 |
| 274 | Ga0075429_100054884 | 3300006880 | Bacteria | 3466 |
| 275 | Ga0068865_100043245 | 3300006881 | Bacteria | 3076 |
| 276 | Ga0075436_100011676 | 3300006914 | Bacteria | 6028 |
| 277 | Ga0075436_100093737 | 3300006914 | Bacteria | 2088 |
| 278 | Ga0075436_100140582 | 3300006914 | Bacteria | 1697 |
| 279 | Ga0097620_100014663 | 3300006931 | Bacteria | 7876 |
| 280 | Ga0097620_100024405 | 3300006931 | Bacteria | 6065 |
| 281 | Ga0097620_100038786 | 3300006931 | Bacteria | 4779 |
| 282 | Ga0097620_100092893 | 3300006931 | Bacteria | 3069 |
| 283 | Ga0097620_100173432 | 3300006931 | Bacteria | 2238 |
| 284 | Ga0075435_100075746 | 3300007076 | Bacteria | 2756 |
| 285 | Ga0075435_100093770 | 3300007076 | Bacteria | 2481 |
| 286 | Ga0075435_100147481 | 3300007076 | Bacteria | 1976 |
| 287 | Ga0105251_10095273 | 3300009011 | Bacteria | 1364 |
| 288 | Ga0105251_10151016 | 3300009011 | Bacteria | 1049 |
| 289 | Ga0105244_10084087 | 3300009036 | Bacteria | 1572 |
| 290 | Ga0105250_10050544 | 3300009092 | Bacteria | 1668 |
| 291 | Ga0105240_10144273 | 3300009093 | Bacteria | 2842 |
| 292 | Ga0105240_10189603 | 3300009093 | Bacteria | 2418 |
| 293 | Ga0111539_10000114 | 3300009094 | Bacteria | 88757 |
| 294 | Ga0111539_10040138 | 3300009094 | Bacteria | 5636 |
| 295 | Ga0111539_10041202 | 3300009094 | Bacteria | 5553 |
| 296 | Ga0111539_10094226 | 3300009094 | Bacteria | 3517 |
| 297 | Ga0111539_10156897 | 3300009094 | Bacteria | 2663 |
| 298 | Ga0111539_10194833 | 3300009094 | Bacteria | 2364 |
| 299 | Ga0111539_10207250 | 3300009094 | Bacteria | 2285 |
| 300 | Ga0105245_10044359 | 3300009098 | Bacteria | 3968 |
| 301 | Ga0105247_10009657 | 3300009101 | Bacteria | 5851 |
| 302 | Ga0105247_10014301 | 3300009101 | Bacteria | 4764 |
| 303 | Ga0105247_10021171 | 3300009101 | Bacteria | 3912 |
| 304 | Ga0105247_10105869 | 3300009101 | Bacteria | 1804 |
| 305 | Ga0114129_10022232 | 3300009147 | Bacteria | 9003 |
| 306 | Ga0114129_10037886 | 3300009147 | Bacteria | 6804 |
| 307 | Ga0114129_10892886 | 3300009147 | Bacteria | 1127 |
| 308 | Ga0105243_10013412 | 3300009148 | Bacteria | 6198 |
| 309 | Ga0105243_10017546 | 3300009148 | Bacteria | 5412 |
| 310 | Ga0105243_10020763 | 3300009148 | Bacteria | 4984 |
| 311 | Ga0105243_10031701 | 3300009148 | Bacteria | 4077 |
| 312 | Ga0105243_10104448 | 3300009148 | Bacteria | 2358 |
| 313 | Ga0105243_10364007 | 3300009148 | Bacteria | 1332 |
| 314 | Ga0105241_10008736 | 3300009174 | Bacteria | 7444 |
| 315 | Ga0105242_10006841 | 3300009176 | Bacteria | 8789 |
| 316 | Ga0105242_10019418 | 3300009176 | Bacteria | 5324 |
| 317 | Ga0105248_10001732 | 3300009177 | Bacteria | 24242 |
| 318 | Ga0105248_10005057 | 3300009177 | Bacteria | 14564 |
| 319 | Ga0105248_10135827 | 3300009177 | Bacteria | 2774 |
| 320 | Ga0105248_10179528 | 3300009177 | Bacteria | 2386 |
| 321 | Ga0105237_10017286 | 3300009545 | Bacteria | 7478 |
| 322 | Ga0105237_10024152 | 3300009545 | Bacteria | 6219 |
| 323 | Ga0105237_10382057 | 3300009545 | Bacteria | 1413 |
| 324 | Ga0105238_10023216 | 3300009551 | Bacteria | 6323 |
| 325 | Ga0105238_10059175 | 3300009551 | Bacteria | 3839 |
| 326 | Ga0105238_10106145 | 3300009551 | Bacteria | 2790 |
| 327 | Ga0105238_10181349 | 3300009551 | Bacteria | 2082 |
| 328 | Ga0105238_10392818 | 3300009551 | Bacteria | 1379 |
| 329 | Ga0105238_10404046 | 3300009551 | Bacteria | 1359 |
| 330 | Ga0105249_10006938 | 3300009553 | Bacteria | 9880 |
| 331 | Ga0105249_10026774 | 3300009553 | Bacteria | 5200 |
| 332 | Ga0105249_10075162 | 3300009553 | Bacteria | 3129 |
| 333 | Ga0105249_10079338 | 3300009553 | Bacteria | 3047 |
| 334 | Ga0099796_10053147 | 3300010159 | Bacteria | 1412 |
| 335 | Ga0099796_10066598 | 3300010159 | Bacteria | 1290 |
| 336 | Ga0105239_10030215 | 3300010375 | Bacteria | 5956 |
| 337 | Ga0105239_10044186 | 3300010375 | Bacteria | 4884 |
| 338 | Ga0105239_10252492 | 3300010375 | Bacteria | 1981 |
| 339 | Ga0105239_10299424 | 3300010375 | Bacteria | 1811 |
| 340 | Ga0105239_10356564 | 3300010375 | Bacteria | 1651 |
| 341 | Ga0105246_10009309 | 3300011119 | Bacteria | 6049 |
| 342 | Ga0105246_10015049 | 3300011119 | Bacteria | 4875 |
| 343 | Ga0105246_10021551 | 3300011119 | Bacteria | 4148 |
| 344 | Ga0105246_10312097 | 3300011119 | Bacteria | 1274 |
| 345 | Ga0157336_1002059 | 3300012477 | Bacteria | 1105 |
| 346 | Ga0157338_1000955 | 3300012515 | Bacteria | 1932 |
| 347 | Ga0157371_10008562 | 3300013102 | Bacteria | 8137 |
| 348 | Ga0157371_10070838 | 3300013102 | Bacteria | 2468 |
| 349 | Ga0157370_10030287 | 3300013104 | Bacteria | 5303 |
| 350 | Ga0157370_10187745 | 3300013104 | Bacteria | 1919 |
| 351 | Ga0157369_10351414 | 3300013105 | Bacteria | 1531 |
| 352 | Ga0157374_10034575 | 3300013296 | Bacteria | 4618 |
| 353 | Ga0157374_10160410 | 3300013296 | Bacteria | 2190 |
| 354 | Ga0157378_10016743 | 3300013297 | Bacteria | 6423 |
| 355 | Ga0157378_10234799 | 3300013297 | Bacteria | 1749 |
| 356 | Ga0157378_10401988 | 3300013297 | Bacteria | 1350 |
| 357 | Ga0163162_10066462 | 3300013306 | Bacteria | 3654 |
| 358 | Ga0163162_10158069 | 3300013306 | Bacteria | 2388 |
| 359 | Ga0163162_10216964 | 3300013306 | Bacteria | 2043 |
| 360 | Ga0163162_10358576 | 3300013306 | Bacteria | 1591 |
| 361 | Ga0157372_10027509 | 3300013307 | Bacteria | 6195 |
| 362 | Ga0157372_10424181 | 3300013307 | Bacteria | 1550 |
| 363 | Ga0157372_10476833 | 3300013307 | Bacteria | 1454 |
| 364 | Ga0157372_10501322 | 3300013307 | Bacteria | 1416 |
| 365 | Ga0157375_10036665 | 3300013308 | Bacteria | 4693 |
| 366 | Ga0157375_10037116 | 3300013308 | Bacteria | 4666 |
| 367 | Ga0157375_10145412 | 3300013308 | Bacteria | 2501 |
| 368 | Ga0157375_10258366 | 3300013308 | Bacteria | 1903 |
| 369 | Ga0157375_10330609 | 3300013308 | Bacteria | 1689 |
| 370 | Ga0163163_10005264 | 3300014325 | Bacteria | 11160 |
| 371 | Ga0163163_10013076 | 3300014325 | Bacteria | 7582 |
| 372 | Ga0163163_10016286 | 3300014325 | Bacteria | 6903 |
| 373 | Ga0163163_10020301 | 3300014325 | Bacteria | 6254 |
| 374 | Ga0163163_10029786 | 3300014325 | Bacteria | 5252 |
| 375 | Ga0182008_10071599 | 3300014497 | Bacteria | 1705 |
| 376 | Ga0157377_10006770 | 3300014745 | Bacteria | 5491 |
| 377 | Ga0157377_10017429 | 3300014745 | Bacteria | 3715 |
| 378 | Ga0157379_10005269 | 3300014968 | Bacteria | 11102 |
| 379 | Ga0157379_10045682 | 3300014968 | Bacteria | 3910 |
| 380 | Ga0157376_10044920 | 3300014969 | Bacteria | 3634 |
| 381 | Ga0163161_10014794 | 3300017792 | Bacteria | 5437 |
| 382 | Ga0163161_10050291 | 3300017792 | Bacteria | 3016 |
| 383 | Ga0213876_10030137 | 3300021384 | Bacteria | 2860 |
| 384 | Ga0213876_10057589 | 3300021384 | Bacteria | 2052 |
| 385 | Ga0213876_10127912 | 3300021384 | Bacteria | 1350 |
| 386 | Ga0228598_1001818 | 3300024227 | Bacteria | 4642 |
| 387 | Ga0209233_1006560 | 3300025261 | Bacteria | 3742 |
| 388 | Ga0207666_1000323 | 3300025271 | Bacteria | 6649 |
| 389 | Ga0207673_1004949 | 3300025290 | Bacteria | 1610 |
| 390 | Ga0209758_1000244 | 3300025297 | Bacteria | 112497 |
| 391 | Ga0209758_1039792 | 3300025297 | Bacteria | 1782 |
| 392 | Ga0207426_1035999 | 3300025302 | Bacteria | 1576 |
| 393 | Ga0207697_10008914 | 3300025315 | Bacteria | 4359 |
| 394 | Ga0207697_10015857 | 3300025315 | Bacteria | 3108 |
| 395 | Ga0207696_1035761 | 3300025711 | Bacteria | 1477 |
| 396 | Ga0207653_10004178 | 3300025885 | Bacteria | 4539 |
| 397 | Ga0207653_10005006 | 3300025885 | Bacteria | 4140 |
| 398 | Ga0207682_10003785 | 3300025893 | Bacteria | 6497 |
| 399 | Ga0207682_10022226 | 3300025893 | Bacteria | 2498 |
| 400 | Ga0207692_10053666 | 3300025898 | Bacteria | 2054 |
| 401 | Ga0207692_10054258 | 3300025898 | Bacteria | 2046 |
| 402 | Ga0207692_10075262 | 3300025898 | Bacteria | 1791 |
| 403 | Ga0207642_10000819 | 3300025899 | Bacteria | 9683 |
| 404 | Ga0207710_10003631 | 3300025900 | Bacteria | 6841 |
| 405 | Ga0207710_10121772 | 3300025900 | Bacteria | 1247 |
| 406 | Ga0207688_10000274 | 3300025901 | Bacteria | 23548 |
| 407 | Ga0207688_10001639 | 3300025901 | Bacteria | 11818 |
| 408 | Ga0207680_10009419 | 3300025903 | Bacteria | 4844 |
| 409 | Ga0207647_10013330 | 3300025904 | Bacteria | 5704 |
| 410 | Ga0207647_10014600 | 3300025904 | Bacteria | 5410 |
| 411 | Ga0207647_10018614 | 3300025904 | Bacteria | 4690 |
| 412 | Ga0207647_10176842 | 3300025904 | Bacteria | 1241 |
| 413 | Ga0207685_10034329 | 3300025905 | Bacteria | 1842 |
| 414 | Ga0207699_10000138 | 3300025906 | Bacteria | 49255 |
| 415 | Ga0207699_10008490 | 3300025906 | Bacteria | 5073 |
| 416 | Ga0207645_10008125 | 3300025907 | Bacteria | 7353 |
| 417 | Ga0207645_10011546 | 3300025907 | Bacteria | 6025 |
| 418 | Ga0207645_10038873 | 3300025907 | Bacteria | 3049 |
| 419 | Ga0207643_10000453 | 3300025908 | Bacteria | 26555 |
| 420 | Ga0207643_10000500 | 3300025908 | Bacteria | 25029 |
| 421 | Ga0207705_10013654 | 3300025909 | Bacteria | 5859 |
| 422 | Ga0207684_10059760 | 3300025910 | Bacteria | 3237 |
| 423 | Ga0207654_10022075 | 3300025911 | Bacteria | 3391 |
| 424 | Ga0207654_10036667 | 3300025911 | Bacteria | 2741 |
| 425 | Ga0207707_10016536 | 3300025912 | Bacteria | 6432 |
| 426 | Ga0207707_10018605 | 3300025912 | Bacteria | 6055 |
| 427 | Ga0207707_10227675 | 3300025912 | Bacteria | 1622 |
| 428 | Ga0207671_10031226 | 3300025914 | Bacteria | 3969 |
| 429 | Ga0207693_10015786 | 3300025915 | Bacteria | 6051 |
| 430 | Ga0207693_10021823 | 3300025915 | Bacteria | 5091 |
| 431 | Ga0207663_10073000 | 3300025916 | Bacteria | 2219 |
| 432 | Ga0207663_10083464 | 3300025916 | Bacteria | 2099 |
| 433 | Ga0207663_10136257 | 3300025916 | Bacteria | 1704 |
| 434 | Ga0207660_10002540 | 3300025917 | Bacteria | 11980 |
| 435 | Ga0207660_10012737 | 3300025917 | Bacteria | 5506 |
| 436 | Ga0207660_10214032 | 3300025917 | Bacteria | 1510 |
| 437 | Ga0207662_10002496 | 3300025918 | Bacteria | 9248 |
| 438 | Ga0207662_10007651 | 3300025918 | Bacteria | 5888 |
| 439 | Ga0207657_10005739 | 3300025919 | Bacteria | 12948 |
| 440 | Ga0207657_10013896 | 3300025919 | Bacteria | 7879 |
| 441 | Ga0207657_10017981 | 3300025919 | Bacteria | 6764 |
| 442 | Ga0207657_10029015 | 3300025919 | Bacteria | 5042 |
| 443 | Ga0207657_10052437 | 3300025919 | Bacteria | 3540 |
| 444 | Ga0207657_10201003 | 3300025919 | Bacteria | 1603 |
| 445 | Ga0207649_10017686 | 3300025920 | Bacteria | 4040 |
| 446 | Ga0207652_10014386 | 3300025921 | Bacteria | 6411 |
| 447 | Ga0207652_10015702 | 3300025921 | Bacteria | 6168 |
| 448 | Ga0207652_10020472 | 3300025921 | Bacteria | 5447 |
| 449 | Ga0207652_10027682 | 3300025921 | Bacteria | 4725 |
| 450 | Ga0207652_10054048 | 3300025921 | Bacteria | 3451 |
| 451 | Ga0207652_10099026 | 3300025921 | Bacteria | 2572 |
| 452 | Ga0207652_10107427 | 3300025921 | Bacteria | 2472 |
| 453 | Ga0207681_10009102 | 3300025923 | Bacteria | 6066 |
| 454 | Ga0207681_10022271 | 3300025923 | Bacteria | 4040 |
| 455 | Ga0207694_10036268 | 3300025924 | Bacteria | 3784 |
| 456 | Ga0207694_10217293 | 3300025924 | Bacteria | 1558 |
| 457 | Ga0207650_10006026 | 3300025925 | Bacteria | 8271 |
| 458 | Ga0207650_10007377 | 3300025925 | Bacteria | 7483 |
| 459 | Ga0207650_10014950 | 3300025925 | Bacteria | 5400 |
| 460 | Ga0207650_10082521 | 3300025925 | Bacteria | 2440 |
| 461 | Ga0207659_10021913 | 3300025926 | Bacteria | 4249 |
| 462 | Ga0207687_10008300 | 3300025927 | Bacteria | 6795 |
| 463 | Ga0207687_10013380 | 3300025927 | Bacteria | 5358 |
| 464 | Ga0207700_10038128 | 3300025928 | Bacteria | 3486 |
| 465 | Ga0207700_10119122 | 3300025928 | Bacteria | 2137 |
| 466 | Ga0207700_10147035 | 3300025928 | Bacteria | 1943 |
| 467 | Ga0207700_10329490 | 3300025928 | Bacteria | 1325 |
| 468 | Ga0207664_10014759 | 3300025929 | Bacteria | 5653 |
| 469 | Ga0207664_10049035 | 3300025929 | Bacteria | 3323 |
| 470 | Ga0207664_10270133 | 3300025929 | Bacteria | 1489 |
| 471 | Ga0207644_10004262 | 3300025931 | Bacteria | 9279 |
| 472 | Ga0207644_10004301 | 3300025931 | Bacteria | 9242 |
| 473 | Ga0207644_10021955 | 3300025931 | Bacteria | 4354 |
| 474 | Ga0207644_10034640 | 3300025931 | Bacteria | 3534 |
| 475 | Ga0207644_10093566 | 3300025931 | Bacteria | 2244 |
| 476 | Ga0207690_10038216 | 3300025932 | Bacteria | 3123 |
| 477 | Ga0207690_10120889 | 3300025932 | Bacteria | 1902 |
| 478 | Ga0207706_10004619 | 3300025933 | Bacteria | 12913 |
| 479 | Ga0207706_10010128 | 3300025933 | Bacteria | 8629 |
| 480 | Ga0207706_10019952 | 3300025933 | Bacteria | 6025 |
| 481 | Ga0207706_10048059 | 3300025933 | Bacteria | 3774 |
| 482 | Ga0207686_10013012 | 3300025934 | Bacteria | 4592 |
| 483 | Ga0207686_10022966 | 3300025934 | Bacteria | 3596 |
| 484 | Ga0207686_10075727 | 3300025934 | Bacteria | 2179 |
| 485 | Ga0207686_10133420 | 3300025934 | Bacteria | 1706 |
| 486 | Ga0207709_10003222 | 3300025935 | Bacteria | 9799 |
| 487 | Ga0207709_10004517 | 3300025935 | Bacteria | 8024 |
| 488 | Ga0207709_10018404 | 3300025935 | Bacteria | 3913 |
| 489 | Ga0207709_10054919 | 3300025935 | Bacteria | 2458 |
| 490 | Ga0207709_10124412 | 3300025935 | Bacteria | 1747 |
| 491 | Ga0207670_10001217 | 3300025936 | Bacteria | 13596 |
| 492 | Ga0207670_10002536 | 3300025936 | Bacteria | 9592 |
| 493 | Ga0207670_10006412 | 3300025936 | Bacteria | 6523 |
| 494 | Ga0207670_10079681 | 3300025936 | Bacteria | 2287 |
| 495 | Ga0207669_10001081 | 3300025937 | Bacteria | 11625 |
| 496 | Ga0207669_10004872 | 3300025937 | Bacteria | 5960 |
| 497 | Ga0207669_10009349 | 3300025937 | Bacteria | 4662 |
| 498 | Ga0207669_10102396 | 3300025937 | Bacteria | 1897 |
| 499 | Ga0207704_10003970 | 3300025938 | Bacteria | 6731 |
| 500 | Ga0207704_10004552 | 3300025938 | Bacteria | 6345 |
| 501 | Ga0207704_10054563 | 3300025938 | Bacteria | 2437 |
| 502 | Ga0207704_10054943 | 3300025938 | Bacteria | 2431 |
| 503 | Ga0207665_10008609 | 3300025939 | Bacteria | 6715 |
| 504 | Ga0207691_10001917 | 3300025940 | Bacteria | 20311 |
| 505 | Ga0207691_10017174 | 3300025940 | Bacteria | 6865 |
| 506 | Ga0207691_10081543 | 3300025940 | Bacteria | 2907 |
| 507 | Ga0207711_10016990 | 3300025941 | Bacteria | 6044 |
| 508 | Ga0207711_10019748 | 3300025941 | Bacteria | 5613 |
| 509 | Ga0207711_10023214 | 3300025941 | Bacteria | 5191 |
| 510 | Ga0207711_10029753 | 3300025941 | Bacteria | 4607 |
| 511 | Ga0207711_10136405 | 3300025941 | Bacteria | 2204 |
| 512 | Ga0207689_10013251 | 3300025942 | Bacteria | 7034 |
| 513 | Ga0207689_10019992 | 3300025942 | Bacteria | 5640 |
| 514 | Ga0207689_10080850 | 3300025942 | Bacteria | 2671 |
| 515 | Ga0207661_10012621 | 3300025944 | Bacteria | 6148 |
| 516 | Ga0207661_10056890 | 3300025944 | Bacteria | 3142 |
| 517 | Ga0207661_10477116 | 3300025944 | Bacteria | 1138 |
| 518 | Ga0207679_10004642 | 3300025945 | Bacteria | 8548 |
| 519 | Ga0207679_10030410 | 3300025945 | Bacteria | 3770 |
| 520 | Ga0207679_10131528 | 3300025945 | Bacteria | 2008 |
| 521 | Ga0207679_10216152 | 3300025945 | Bacteria | 1611 |
| 522 | Ga0207667_10024097 | 3300025949 | Bacteria | 6690 |
| 523 | Ga0207667_10057316 | 3300025949 | Bacteria | 4089 |
| 524 | Ga0207667_10261630 | 3300025949 | Bacteria | 1769 |
| 525 | Ga0207667_10337016 | 3300025949 | Bacteria | 1539 |
| 526 | Ga0207651_10001940 | 3300025960 | Bacteria | 9715 |
| 527 | Ga0207651_10024835 | 3300025960 | Bacteria | 3714 |
| 528 | Ga0207651_10040262 | 3300025960 | Bacteria | 3089 |
| 529 | Ga0207712_10005147 | 3300025961 | Bacteria | 8274 |
| 530 | Ga0207712_10012219 | 3300025961 | Bacteria | 5487 |
| 531 | Ga0207712_10027706 | 3300025961 | Bacteria | 3785 |
| 532 | Ga0207668_10023269 | 3300025972 | Bacteria | 3978 |
| 533 | Ga0207668_10025367 | 3300025972 | Bacteria | 3836 |
| 534 | Ga0207668_10079969 | 3300025972 | Bacteria | 2366 |
| 535 | Ga0207668_10109093 | 3300025972 | Bacteria | 2073 |
| 536 | Ga0207640_10002303 | 3300025981 | Bacteria | 10260 |
| 537 | Ga0207640_10106398 | 3300025981 | Bacteria | 1979 |
| 538 | Ga0207658_10017474 | 3300025986 | Bacteria | 4944 |
| 539 | Ga0207658_10029450 | 3300025986 | Bacteria | 3878 |
| 540 | Ga0207658_10037986 | 3300025986 | Bacteria | 3465 |
| 541 | Ga0207677_10006117 | 3300026023 | Bacteria | 6572 |
| 542 | Ga0207703_10004180 | 3300026035 | Bacteria | 11899 |
| 543 | Ga0207703_10010048 | 3300026035 | Bacteria | 7419 |
| 544 | Ga0207703_10085057 | 3300026035 | Bacteria | 2646 |
| 545 | Ga0207639_10052011 | 3300026041 | Bacteria | 3119 |
| 546 | Ga0207639_10083155 | 3300026041 | Bacteria | 2540 |
| 547 | Ga0207639_10085118 | 3300026041 | Bacteria | 2514 |
| 548 | Ga0207678_10004077 | 3300026067 | Bacteria | 13141 |
| 549 | Ga0207678_10014823 | 3300026067 | Bacteria | 6859 |
| 550 | Ga0207678_10026799 | 3300026067 | Bacteria | 5027 |
| 551 | Ga0207678_10154254 | 3300026067 | Bacteria | 1961 |
| 552 | Ga0207678_10440925 | 3300026067 | Bacteria | 1131 |
| 553 | Ga0207708_10000770 | 3300026075 | Bacteria | 24151 |
| 554 | Ga0207708_10002274 | 3300026075 | Bacteria | 14164 |
| 555 | Ga0207708_10008025 | 3300026075 | Bacteria | 7825 |
| 556 | Ga0207708_10020164 | 3300026075 | Bacteria | 5027 |
| 557 | Ga0207702_10005849 | 3300026078 | Bacteria | 10697 |
| 558 | Ga0207702_10012149 | 3300026078 | Bacteria | 7164 |
| 559 | Ga0207702_10070783 | 3300026078 | Bacteria | 3001 |
| 560 | Ga0207702_10375272 | 3300026078 | Bacteria | 1366 |
| 561 | Ga0207641_10006517 | 3300026088 | Bacteria | 9824 |
| 562 | Ga0207641_10068449 | 3300026088 | Bacteria | 3044 |
| 563 | Ga0207641_10084754 | 3300026088 | Bacteria | 2759 |
| 564 | Ga0207641_10150272 | 3300026088 | Bacteria | 2109 |
| 565 | Ga0207641_10240428 | 3300026088 | Bacteria | 1687 |
| 566 | Ga0207648_10010742 | 3300026089 | Bacteria | 8654 |
| 567 | Ga0207648_10011212 | 3300026089 | Bacteria | 8451 |
| 568 | Ga0207648_10071023 | 3300026089 | Bacteria | 3035 |
| 569 | Ga0207676_10001447 | 3300026095 | Bacteria | 17652 |
| 570 | Ga0207676_10003488 | 3300026095 | Bacteria | 11136 |
| 571 | Ga0207676_10008505 | 3300026095 | Bacteria | 7298 |
| 572 | Ga0207676_10010089 | 3300026095 | Bacteria | 6720 |
| 573 | Ga0207674_10014465 | 3300026116 | Bacteria | 8713 |
| 574 | Ga0207674_10019438 | 3300026116 | Bacteria | 7356 |
| 575 | Ga0207674_10160729 | 3300026116 | Bacteria | 2201 |
| 576 | Ga0207674_10185149 | 3300026116 | Bacteria | 2033 |
| 577 | Ga0207675_100005913 | 3300026118 | Bacteria | 11677 |
| 578 | Ga0207675_100030445 | 3300026118 | Bacteria | 5027 |
| 579 | Ga0207675_100168965 | 3300026118 | Bacteria | 2090 |
| 580 | Ga0207683_10001479 | 3300026121 | Bacteria | 21177 |
| 581 | Ga0207683_10007199 | 3300026121 | Bacteria | 9537 |
| 582 | Ga0207683_10009426 | 3300026121 | Bacteria | 8319 |
| 583 | Ga0207683_10026254 | 3300026121 | Bacteria | 5027 |
| 584 | Ga0207698_10029691 | 3300026142 | Bacteria | 3919 |
| 585 | Ga0207698_10085756 | 3300026142 | Bacteria | 2558 |
| 586 | Ga0210002_1000366 | 3300027617 | Bacteria | 6135 |
| 587 | Ga0209588_1006089 | 3300027671 | Bacteria | 3485 |
| 588 | Ga0209998_10002028 | 3300027717 | Bacteria | 4749 |
| 589 | Ga0209998_10002086 | 3300027717 | Bacteria | 4673 |
| 590 | Ga0207428_10000312 | 3300027907 | Bacteria | 64494 |
| 591 | Ga0207428_10006151 | 3300027907 | Bacteria | 11086 |
| 592 | Ga0207428_10048320 | 3300027907 | Bacteria | 3414 |
| 593 | Ga0268266_10122714 | 3300028379 | Bacteria | 2313 |
| 594 | Ga0268265_10002768 | 3300028380 | Bacteria | 12939 |
| 595 | Ga0268265_10340954 | 3300028380 | Bacteria | 1365 |
| 596 | Ga0268264_10028003 | 3300028381 | Bacteria | 4608 |
| 597 | Ga0268264_10066523 | 3300028381 | Bacteria | 3039 |
| 598 | Ga0265337_1002158 | 3300028556 | Bacteria | 9252 |
| 599 | Ga0265338_10048070 | 3300028800 | Bacteria | 3886 |
| 600 | Ga0265330_10028814 | 3300031235 | Bacteria | 2500 |
| 601 | Ga0265325_10000172 | 3300031241 | Bacteria | 45954 |
| 602 | Ga0265325_10000759 | 3300031241 | Bacteria | 23397 |
| 603 | Ga0265325_10010987 | 3300031241 | Bacteria | 5214 |
| 604 | Ga0265325_10056018 | 3300031241 | Bacteria | 2014 |
| 605 | Ga0265339_10042932 | 3300031249 | Bacteria | 2502 |
| 606 | Ga0265339_10050280 | 3300031249 | Bacteria | 2280 |
| 607 | Ga0265331_10043063 | 3300031250 | Bacteria | 2188 |
| 608 | Ga0265331_10050341 | 3300031250 | Bacteria | 1998 |
| 609 | Ga0265316_10050600 | 3300031344 | Bacteria | 3267 |
| 610 | Ga0265313_10000345 | 3300031595 | Bacteria | 50388 |
| 611 | Ga0265313_10001066 | 3300031595 | Bacteria | 26560 |
| 612 | Ga0265313_10023347 | 3300031595 | Bacteria | 3332 |
| 613 | Ga0316575_10014978 | 3300031665 | Bacteria | 2920 |
| 614 | Ga0316579_10043138 | 3300031691 | Bacteria | 2097 |
| 615 | Ga0265314_10008415 | 3300031711 | Bacteria | 8841 |
| 616 | Ga0265342_10000510 | 3300031712 | Bacteria | 41579 |
| 617 | Ga0265342_10008960 | 3300031712 | Bacteria | 7108 |
| 618 | Ga0316583_10005017 | 3300032133 | Bacteria | 4736 |
| 619 | Ga0373930_0000163 | 3300034816 | Bacteria | 7694 |
| 620 | Ga0373930_0006388 | 3300034816 | Bacteria | 1992 |
| 621 | Ga0373950_0013101 | 3300034818 | Bacteria | 1378 |
| 622 | Ga0373958_0000109 | 3300034819 | Bacteria | 8787 |
| 623 | Ga0373958_0003895 | 3300034819 | Bacteria | 2181 |
| 624 | Ga0373959_0002173 | 3300034820 | Bacteria | 3127 |
| 625 | Ga0373938_0000044 | 3300034957 | Bacteria | 16525 |
| 626 | Ga0373938_0003249 | 3300034957 | Bacteria | 2648 |
| 627 | Ga0373926_0003841 | 3300035083 | Bacteria | 4904 |
| 628 | Ga0373928_0000075 | 3300035084 | Bacteria | 17387 |
| 629 | Ga0373928_0051340 | 3300035084 | Bacteria | 975 |
| 630 | Ga0373929_0000561 | 3300035085 | Bacteria | 7154 |
| 631 | Ga0373929_0000913 | 3300035085 | Bacteria | 5749 |
| 632 | Ga0373940_0000513 | 3300035088 | Bacteria | 6081 |
| 633 | Ga0373944_0002147 | 3300035089 | Bacteria | 5014 |
| 634 | Ga0373949_0002004 | 3300035090 | Bacteria | 5440 |
| 635 | Ga0373951_0000281 | 3300035091 | Bacteria | 16289 |
| 636 | Ga0373951_0023601 | 3300035091 | Bacteria | 1421 |
| 637 | Ga0373952_0000436 | 3300035092 | Bacteria | 7228 |
| 638 | Ga0373923_0025274 | 3300035111 | Bacteria | 2352 |
| 639 | Ga0373932_0000556 | 3300035112 | Bacteria | 11439 |
| 640 | Ga0373936_0004573 | 3300035113 | Bacteria | 5236 |
| 641 | Ga0373936_0009683 | 3300035113 | Bacteria | 3632 |
| 642 | Ga0373939_0000729 | 3300035114 | Bacteria | 8139 |
| 643 | Ga0373939_0001537 | 3300035114 | Bacteria | 5596 |
| 644 | Ga0373941_0001036 | 3300035115 | Bacteria | 5781 |
| 645 | Ga0373941_0001456 | 3300035115 | Bacteria | 5003 |
| 646 | Ga0373941_0003931 | 3300035115 | Bacteria | 3407 |
| 647 | Ga0373941_0058517 | 3300035115 | Bacteria | 1247 |
| 648 | Ga0373956_0025524 | 3300035119 | Bacteria | 2555 |
| 649 | Ga0373956_0069572 | 3300035119 | Bacteria | 1604 |
| 650 | Ga0373960_0025673 | 3300035121 | Bacteria | 1604 |
| 651 | Ga0373943_0003484 | 3300035170 | Bacteria | 7162 |
| 652 | Ga0373943_0011935 | 3300035170 | Bacteria | 3910 |
| 653 | Ga0373943_0017879 | 3300035170 | Bacteria | 3250 |
| 654 | Ga0373943_0111102 | 3300035170 | Bacteria | 1446 |
| 655 | Ga0373943_0127027 | 3300035170 | Bacteria | 1361 |
| 656 | Ga0373946_0003127 | 3300035171 | Bacteria | 5864 |
| 657 | Ga0373946_0019849 | 3300035171 | Bacteria | 2592 |
| 658 | Ga0373955_0002113 | 3300035172 | Bacteria | 8575 |
| 659 | Ga0373955_0009210 | 3300035172 | Bacteria | 4618 |
| 660 | Ga0373942_0000621 | 3300035207 | Bacteria | 9944 |
| 661 | Ga0373942_0005551 | 3300035207 | Bacteria | 2922 |
| 662 | Ga0373961_0000705 | 3300035241 | Bacteria | 11654 |
| 663 | Ga0373962_0001033 | 3300035242 | Bacteria | 6450 |
| 664 | Ga0373962_0001884 | 3300035242 | Bacteria | 4990 |
| 665 | Ga0373931_0003327 | 3300035691 | Bacteria | 7198 |
| 666 | Ga0373931_0004025 | 3300035691 | Bacteria | 6658 |
| 667 | Ga0373931_0024509 | 3300035691 | Bacteria | 3057 |
| 668 | Ga0373931_0024825 | 3300035691 | Bacteria | 3041 |
| 669 | Ga0373931_0025471 | 3300035691 | Bacteria | 3004 |
| 670 | Ga0373935_0015609 | 3300035692 | Bacteria | 4593 |
| 671 | Ga0373935_0089069 | 3300035692 | Bacteria | 2017 |
| 672 | Ga0373935_0138618 | 3300035692 | Bacteria | 1641 |
| 673 | Ga0373927_0035352 | 3300035695 | Bacteria | 3249 |
| 674 | Ga0373927_0108610 | 3300035695 | Bacteria | 1807 |
| 675 | Ga0373927_0155169 | 3300035695 | Bacteria | 1499 |
| 676 | Ga0373927_0245168 | 3300035695 | Bacteria | 1178 |
| 677 | Ga0373933_0028322 | 3300035724 | Bacteria | 3231 |
| 678 | Ga0373933_0065729 | 3300035724 | Bacteria | 2196 |
| 679 | Ga0373933_0068472 | 3300035724 | Bacteria | 2156 |
| 680 | Ga0373933_0117556 | 3300035724 | Bacteria | 1663 |
| 681 | Ga0373933_0252441 | 3300035724 | Bacteria | 1136 |
| 682 | Ga0373947_0007492 | 3300035725 | Bacteria | 6315 |
| 683 | Ga0373937_0001983 | 3300036401 | Bacteria | 17123 |
| 684 | Ga0373937_0017808 | 3300036401 | Bacteria | 6338 |
| 685 | Ga0373937_0074139 | 3300036401 | Bacteria | 3140 |
| 686 | Ga0373937_0181747 | 3300036401 | Bacteria | 1975 |
| 687 | Ga0316582_0029931 | 3300036647 | Bacteria | 3312 |
| 688 | Ga0373925_0007864 | 3300037068 | Bacteria | 7767 |
| 689 | Ga0373925_0009628 | 3300037068 | Bacteria | 7040 |
| 690 | Ga0373925_0017870 | 3300037068 | Bacteria | 5146 |
| 691 | Ga0373925_0247677 | 3300037068 | Bacteria | 1428 |
| 692 | Ga0395900_0163341 | 3300037418 | Bacteria | 2270 |
| 693 | Ga0395900_0233383 | 3300037418 | Bacteria | 1849 |
| 694 | Ga0395898_0037642 | 3300037466 | Bacteria | 4798 |
| 695 | Ga0395898_0109257 | 3300037466 | Bacteria | 2651 |
| 696 | Ga0395898_0149122 | 3300037466 | Bacteria | 2238 |
| 697 | Ga0436364_1140333 | 3300037853 | Bacteria | 1841 |
| 698 | Ga0395901_0174288 | 3300038443 | Bacteria | 2256 |
| 699 | Ga0242420_003562 | 3300038996 | Bacteria | 2305 |
| 700 | Ga0436365_0106793 | 3300039437 | Bacteria | 1213 |
| 701 | Ga0436365_0457267 | 3300039437 | Bacteria | 3060 |
| 702 | Ga0436365_0713236 | 3300039437 | Bacteria | 1164 |
| 703 | Ga0436365_0995234 | 3300039437 | Bacteria | 2908 |
| 704 | Ga0436365_1234286 | 3300039437 | Bacteria | 2853 |
| 705 | Ga0436365_1335625 | 3300039437 | Bacteria | 8170 |
| 706 | Ga0436365_1503980 | 3300039437 | Bacteria | 2104 |
| 707 | Ga0436362_1200667 | 3300039453 | Bacteria | 2520 |
| 708 | Ga0439453_0016835 | 3300041408 | Bacteria | 1278 |
| 709 | Ga0439434_0057662 | 3300042435 | Bacteria | 1211 |
| 710 | Ga0439435_0038188 | 3300042436 | Bacteria | 1334 |
| 711 | Ga0451577_0042708 | 3300042876 | Bacteria | 4065 |
| 712 | Ga0466961_0058815 | 3300044693 | Bacteria | 2445 |
| 713 | Ga0466961_0240721 | 3300044693 | Bacteria | 1112 |
| 714 | Ga0466963_0051507 | 3300044694 | Bacteria | 2729 |
| 715 | Ga0466963_0099238 | 3300044694 | Bacteria | 1991 |
| 716 | Ga0466968_0087836 | 3300044735 | Bacteria | 1374 |
| 717 | Ga0466957_0062480 | 3300044842 | Bacteria | 2287 |
| 718 | Ga0466957_0063788 | 3300044842 | Bacteria | 2265 |
| 719 | Ga0466957_0195324 | 3300044842 | Bacteria | 1327 |
| 720 | Ga0466959_0043859 | 3300045049 | Bacteria | 3296 |
| 721 | Ga0466959_0082414 | 3300045049 | Bacteria | 2317 |
| 722 | Ga0451576_0015043 | 3300045051 | Bacteria | 8594 |
| 723 | Ga0466967_0022056 | 3300045976 | Bacteria | 5187 |
| 724 | Ga0495592_0001227 | 3300046454 | Bacteria | 17791 |
| 725 | Ga0495592_0028308 | 3300046454 | Bacteria | 4244 |
| 726 | Ga0495592_0240258 | 3300046454 | Bacteria | 1202 |
| 727 | Ga0495629_0006223 | 3300046459 | Bacteria | 8857 |
| 728 | Ga0495629_0021624 | 3300046459 | Bacteria | 4590 |
| 729 | Ga0495629_0032196 | 3300046459 | Bacteria | 3713 |
| 730 | Ga0495629_0036482 | 3300046459 | Bacteria | 3469 |
| 731 | Ga0495651_0000661 | 3300046462 | Bacteria | 26738 |
| 732 | Ga0495651_0040822 | 3300046462 | Bacteria | 3605 |
| 733 | Ga0495651_0263308 | 3300046462 | Bacteria | 1172 |
| 734 | Ga0495653_0001029 | 3300046463 | Bacteria | 21492 |
| 735 | Ga0495653_0043769 | 3300046463 | Bacteria | 3478 |
| 736 | Ga0495653_0172224 | 3300046463 | Bacteria | 1493 |
| 737 | Ga0495580_0017620 | 3300046472 | Bacteria | 5335 |
| 738 | Ga0495580_0049602 | 3300046472 | Bacteria | 2970 |
| 739 | Ga0495580_0144409 | 3300046472 | Bacteria | 1649 |
| 740 | Ga0495582_0018382 | 3300046473 | Bacteria | 3823 |
| 741 | Ga0495582_0026546 | 3300046473 | Bacteria | 3174 |
| 742 | Ga0495582_0126937 | 3300046473 | Bacteria | 1440 |
| 743 | Ga0495582_0185100 | 3300046473 | Bacteria | 1187 |
| 744 | Ga0495639_0021824 | 3300046475 | Bacteria | 2805 |
| 745 | Ga0495639_0055269 | 3300046475 | Bacteria | 1810 |
| 746 | Ga0495662_0001450 | 3300046476 | Bacteria | 11729 |
| 747 | Ga0495662_0019329 | 3300046476 | Bacteria | 3294 |
| 748 | Ga0495662_0024645 | 3300046476 | Bacteria | 2903 |
| 749 | Ga0495664_0000364 | 3300046477 | Bacteria | 21965 |
| 750 | Ga0495664_0045216 | 3300046477 | Bacteria | 2611 |
| 751 | Ga0495585_0003727 | 3300046492 | Bacteria | 10179 |
| 752 | Ga0495585_0019697 | 3300046492 | Bacteria | 3888 |
| 753 | Ga0495608_0002135 | 3300046511 | Bacteria | 14265 |
| 754 | Ga0495608_0010859 | 3300046511 | Bacteria | 6348 |
| 755 | Ga0495608_0078462 | 3300046511 | Bacteria | 2148 |
| 756 | Ga0495608_0097985 | 3300046511 | Bacteria | 1892 |
| 757 | Ga0495618_0014406 | 3300046514 | Bacteria | 4818 |
| 758 | Ga0495618_0132842 | 3300046514 | Bacteria | 1592 |
| 759 | Ga0495618_0265671 | 3300046514 | Bacteria | 1073 |
| 760 | Ga0495628_0003003 | 3300046516 | Bacteria | 15128 |
| 761 | Ga0495628_0007741 | 3300046516 | Bacteria | 9267 |
| 762 | Ga0495628_0054407 | 3300046516 | Bacteria | 3156 |
| 763 | Ga0495628_0068012 | 3300046516 | Bacteria | 2780 |
| 764 | Ga0495630_0005321 | 3300046517 | Bacteria | 9084 |
| 765 | Ga0495630_0048437 | 3300046517 | Bacteria | 3180 |
| 766 | Ga0495644_0001708 | 3300046523 | Bacteria | 8889 |
| 767 | Ga0495663_0038693 | 3300046525 | Bacteria | 1443 |
| 768 | Ga0495666_0006389 | 3300046526 | Bacteria | 5936 |
| 769 | Ga0495652_0001763 | 3300046529 | Bacteria | 23231 |
| 770 | Ga0495652_0005848 | 3300046529 | Bacteria | 11516 |
| 771 | Ga0495652_0078225 | 3300046529 | Bacteria | 2739 |
| 772 | Ga0495665_0062128 | 3300046531 | Bacteria | 1972 |
| 773 | Ga0495665_0158744 | 3300046531 | Bacteria | 1179 |
| 774 | Ga0495640_0001062 | 3300046533 | Bacteria | 21365 |
| 775 | Ga0495640_0006334 | 3300046533 | Bacteria | 9380 |
| 776 | Ga0495640_0081111 | 3300046533 | Bacteria | 2156 |
| 777 | Ga0495586_0047016 | 3300046535 | Bacteria | 2328 |
| 778 | Ga0495587_0000339 | 3300046536 | Bacteria | 33290 |
| 779 | Ga0495587_0016313 | 3300046536 | Bacteria | 4622 |
| 780 | Ga0495587_0028392 | 3300046536 | Bacteria | 3402 |
| 781 | Ga0495645_0004632 | 3300046543 | Bacteria | 9384 |
| 782 | Ga0495645_0023936 | 3300046543 | Bacteria | 4427 |
| 783 | Ga0495633_0031217 | 3300046558 | Bacteria | 2585 |
| 784 | Ga0495667_0006028 | 3300046559 | Bacteria | 8202 |
| 785 | Ga0495667_0013521 | 3300046559 | Bacteria | 5522 |
| 786 | Ga0495667_0163879 | 3300046559 | Bacteria | 1429 |
| 787 | Ga0495668_0185417 | 3300046616 | Bacteria | 1140 |
| 788 | Ga0495634_0001363 | 3300046642 | Bacteria | 22160 |
| 789 | Ga0495634_0006327 | 3300046642 | Bacteria | 9011 |
| 790 | Ga0495634_0008637 | 3300046642 | Bacteria | 7559 |
| 791 | Ga0495634_0026669 | 3300046642 | Bacteria | 4030 |
| 792 | Ga0495634_0068240 | 3300046642 | Bacteria | 2350 |
| 793 | Ga0495635_0000813 | 3300046663 | Bacteria | 20461 |
| 794 | Ga0495635_0001322 | 3300046663 | Bacteria | 16499 |
| 795 | Ga0495635_0039347 | 3300046663 | Bacteria | 3271 |
| 796 | Ga0495635_0066125 | 3300046663 | Bacteria | 2479 |
| 797 | Ga0495635_0129470 | 3300046663 | Bacteria | 1721 |
| 798 | Ga0495661_0109233 | 3300046665 | Bacteria | 1544 |
| 799 | Ga0495588_0007311 | 3300046674 | Bacteria | 5020 |
| 800 | Ga0495657_0003526 | 3300046675 | Bacteria | 12759 |
| 801 | Ga0495657_0092733 | 3300046675 | Bacteria | 1934 |
| 802 | Ga0495599_0032392 | 3300046678 | Bacteria | 3282 |
| 803 | Ga0495599_0048669 | 3300046678 | Bacteria | 2657 |
| 804 | Ga0495599_0153719 | 3300046678 | Bacteria | 1424 |
| 805 | Ga0495623_0011272 | 3300046679 | Bacteria | 5782 |
| 806 | Ga0495623_0030566 | 3300046679 | Bacteria | 3465 |
| 807 | Ga0495646_0016867 | 3300046680 | Bacteria | 4639 |
| 808 | Ga0495647_0001559 | 3300046681 | Bacteria | 7072 |
| 809 | Ga0495658_0032134 | 3300046683 | Bacteria | 2864 |
| 810 | Ga0495658_0091158 | 3300046683 | Bacteria | 1805 |
| 811 | Ga0495658_0181069 | 3300046683 | Bacteria | 1307 |
| 812 | Ga0495613_0029898 | 3300046689 | Bacteria | 4048 |
| 813 | Ga0495613_0057490 | 3300046689 | Bacteria | 2856 |
| 814 | Ga0495624_0025722 | 3300046690 | Bacteria | 3862 |
| 815 | Ga0495624_0036751 | 3300046690 | Bacteria | 3156 |
| 816 | Ga0495670_0018272 | 3300046691 | Bacteria | 3452 |
| 817 | Ga0495649_0020109 | 3300046694 | Bacteria | 3746 |
| 818 | Ga0495600_0000568 | 3300046809 | Bacteria | 19159 |
| 819 | Ga0495600_0003882 | 3300046809 | Bacteria | 8871 |
| 820 | Ga0495600_0005746 | 3300046809 | Bacteria | 7495 |
| 821 | Ga0495600_0104072 | 3300046809 | Bacteria | 1850 |
| 822 | Ga0495604_0001130 | 3300047317 | Bacteria | 22166 |
| 823 | Ga0495604_0029420 | 3300047317 | Bacteria | 4370 |
| 824 | Ga0495604_0086523 | 3300047317 | Bacteria | 2336 |
| 825 | Ga0495604_0218067 | 3300047317 | Bacteria | 1315 |
| 826 | Ga0495674_0002947 | 3300047319 | Bacteria | 16544 |
| 827 | Ga0495674_0011063 | 3300047319 | Bacteria | 8518 |
| 828 | Ga0495674_0072102 | 3300047319 | Bacteria | 2979 |
| 829 | Ga0495674_0213365 | 3300047319 | Bacteria | 1598 |
| 830 | Ga0495680_0085519 | 3300047322 | Bacteria | 2374 |
| 831 | Ga0495680_0103288 | 3300047322 | Bacteria | 2121 |
| 832 | Ga0495680_0175491 | 3300047322 | Bacteria | 1550 |
| 833 | Ga0495675_0005425 | 3300047444 | Bacteria | 7775 |
| 834 | Ga0495677_0118380 | 3300047445 | Bacteria | 1009 |
| 835 | Ga0495684_0000075 | 3300047471 | Bacteria | 67922 |
| 836 | Ga0495684_0003709 | 3300047471 | Bacteria | 11908 |
| 837 | Ga0495684_0016814 | 3300047471 | Bacteria | 5636 |
| 838 | Ga0495684_0025902 | 3300047471 | Bacteria | 4507 |
| 839 | Ga0495684_0097810 | 3300047471 | Bacteria | 2220 |
| 840 | Ga0495684_0156495 | 3300047471 | Bacteria | 1702 |
| 841 | Ga0495593_0061081 | 3300047673 | Bacteria | 1972 |
| 842 | Ga0495593_0075442 | 3300047673 | Bacteria | 1748 |
| 843 | Ga0495602_0000961 | 3300048088 | Bacteria | 27859 |
| 844 | Ga0495602_0011124 | 3300048088 | Bacteria | 9316 |
| 845 | Ga0495602_0152867 | 3300048088 | Bacteria | 1811 |
| 846 | Ga0495614_0066554 | 3300048089 | Bacteria | 1550 |
| 847 | Ga0496100_0005647 | 3300048903 | Bacteria | 6761 |
| 848 | Ga0496100_0006368 | 3300048903 | Bacteria | 6432 |
| 849 | Ga0496100_0010870 | 3300048903 | Bacteria | 5166 |
| 850 | Ga0496100_0020419 | 3300048903 | Bacteria | 3971 |
| 851 | Ga0496100_0070628 | 3300048903 | Bacteria | 2329 |
| 852 | Ga0496101_0000546 | 3300048904 | Bacteria | 23085 |
| 853 | Ga0496101_0001493 | 3300048904 | Bacteria | 13985 |
| 854 | Ga0496101_0002221 | 3300048904 | Bacteria | 11860 |
| 855 | Ga0496101_0020971 | 3300048904 | Bacteria | 4484 |
| 856 | Ga0496102_0001781 | 3300048905 | Bacteria | 18686 |
| 857 | Ga0496102_0009878 | 3300048905 | Bacteria | 8206 |
| 858 | Ga0496102_0022952 | 3300048905 | Bacteria | 5535 |
| 859 | Ga0496102_0045105 | 3300048905 | Bacteria | 4001 |
| 860 | Ga0496102_0089160 | 3300048905 | Bacteria | 2853 |
| 861 | Ga0496102_0089579 | 3300048905 | Bacteria | 2846 |
| 862 | Ga0496102_0212970 | 3300048905 | Bacteria | 1821 |
| 863 | Ga0496103_0001408 | 3300048906 | Bacteria | 16140 |
| 864 | Ga0496103_0008195 | 3300048906 | Bacteria | 6202 |
| 865 | Ga0496103_0030002 | 3300048906 | Bacteria | 3307 |
| 866 | Ga0496103_0032222 | 3300048906 | Bacteria | 3197 |
| 867 | Ga0496103_0152960 | 3300048906 | Bacteria | 1478 |
| 868 | Ga0496104_0000061 | 3300048907 | Bacteria | 117394 |
| 869 | Ga0496104_0001668 | 3300048907 | Bacteria | 19171 |
| 870 | Ga0496104_0003575 | 3300048907 | Bacteria | 13418 |
| 871 | Ga0496104_0041734 | 3300048907 | Bacteria | 4303 |
| 872 | Ga0496104_0066397 | 3300048907 | Bacteria | 3425 |
| 873 | Ga0496104_0084840 | 3300048907 | Bacteria | 3022 |
| 874 | Ga0496104_0088102 | 3300048907 | Bacteria | 2965 |
| 875 | Ga0496104_0123032 | 3300048907 | Bacteria | 2491 |
| 876 | Ga0496104_0136511 | 3300048907 | Bacteria | 2356 |
| 877 | Ga0496104_0179074 | 3300048907 | Bacteria | 2030 |
| 878 | Ga0496105_0001465 | 3300048908 | Bacteria | 16650 |
| 879 | Ga0496105_0003662 | 3300048908 | Bacteria | 11422 |
| 880 | Ga0496105_0008016 | 3300048908 | Bacteria | 8205 |
| 881 | Ga0496105_0010336 | 3300048908 | Bacteria | 7338 |
| 882 | Ga0496105_0227856 | 3300048908 | Bacteria | 1515 |
| 883 | Ga0496106_0001113 | 3300048909 | Bacteria | 19902 |
| 884 | Ga0496106_0001992 | 3300048909 | Bacteria | 15367 |
| 885 | Ga0496106_0004790 | 3300048909 | Bacteria | 10008 |
| 886 | Ga0496106_0009427 | 3300048909 | Bacteria | 7216 |
| 887 | Ga0496106_0044366 | 3300048909 | Bacteria | 3337 |
| 888 | Ga0496106_0054703 | 3300048909 | Bacteria | 3015 |
| 889 | Ga0496107_0002763 | 3300048910 | Bacteria | 11556 |
| 890 | Ga0496107_0007523 | 3300048910 | Bacteria | 7515 |
| 891 | Ga0496107_0029402 | 3300048910 | Bacteria | 3908 |
| 892 | Ga0496107_0121018 | 3300048910 | Bacteria | 1928 |
| 893 | Ga0496107_0255320 | 3300048910 | Bacteria | 1304 |
| 894 | Ga0496108_0005596 | 3300048911 | Bacteria | 10167 |
| 895 | Ga0496108_0013672 | 3300048911 | Bacteria | 6626 |
| 896 | Ga0496108_0019991 | 3300048911 | Bacteria | 5502 |
| 897 | Ga0496108_0051926 | 3300048911 | Bacteria | 3434 |
| 898 | Ga0496108_0076111 | 3300048911 | Bacteria | 2836 |
| 899 | Ga0496108_0305319 | 3300048911 | Bacteria | 1386 |
| 900 | Ga0496109_0003609 | 3300048912 | Bacteria | 12934 |
| 901 | Ga0496109_0007566 | 3300048912 | Bacteria | 9206 |
| 902 | Ga0496109_0008250 | 3300048912 | Bacteria | 8845 |
| 903 | Ga0496109_0022690 | 3300048912 | Bacteria | 5559 |
| 904 | Ga0496109_0123936 | 3300048912 | Bacteria | 2408 |
| 905 | Ga0496109_0150856 | 3300048912 | Bacteria | 2176 |
| 906 | Ga0496109_0205265 | 3300048912 | Bacteria | 1853 |
| 907 | Ga0496109_0517239 | 3300048912 | Bacteria | 1126 |
| 908 | Ga0496110_0022948 | 3300048913 | Bacteria | 5303 |
| 909 | Ga0496110_0023702 | 3300048913 | Bacteria | 5221 |
| 910 | Ga0496110_0027700 | 3300048913 | Bacteria | 4860 |
| 911 | Ga0496110_0048177 | 3300048913 | Bacteria | 3735 |
| 912 | Ga0496110_0134332 | 3300048913 | Bacteria | 2235 |
| 913 | Ga0496110_0156749 | 3300048913 | Bacteria | 2063 |
| 914 | Ga0496111_0001147 | 3300048914 | Bacteria | 14708 |
| 915 | Ga0496111_0048639 | 3300048914 | Bacteria | 3055 |
| 916 | Ga0496112_0000320 | 3300048915 | Bacteria | 30902 |
| 917 | Ga0496112_0014243 | 3300048915 | Bacteria | 7370 |
| 918 | Ga0496112_0017770 | 3300048915 | Bacteria | 6692 |
| 919 | Ga0496112_0173897 | 3300048915 | Bacteria | 2119 |
| 920 | Ga0496112_0250113 | 3300048915 | Bacteria | 1724 |
| 921 | Ga0496112_0633654 | 3300048915 | Bacteria | 999 |
| 922 | Ga0496113_0001355 | 3300048916 | Bacteria | 13563 |
| 923 | Ga0496113_0017914 | 3300048916 | Bacteria | 4924 |
| 924 | Ga0496113_0038012 | 3300048916 | Bacteria | 3536 |
| 925 | Ga0496113_0058187 | 3300048916 | Bacteria | 2908 |
| 926 | Ga0496114_0004710 | 3300048917 | Bacteria | 10613 |
| 927 | Ga0496114_0023421 | 3300048917 | Bacteria | 5039 |
| 928 | Ga0496114_0074900 | 3300048917 | Bacteria | 2850 |
| 929 | Ga0496115_0013034 | 3300048918 | Bacteria | 6275 |
| 930 | Ga0496115_0014471 | 3300048918 | Bacteria | 5973 |
| 931 | Ga0496115_0019748 | 3300048918 | Bacteria | 5189 |
| 932 | Ga0496115_0033471 | 3300048918 | Bacteria | 4058 |
| 933 | Ga0496115_0059396 | 3300048918 | Bacteria | 3079 |
| 934 | Ga0501031_0128852 | 3300049568 | Bacteria | 1653 |
| 935 | Ga0501032_0034378 | 3300049569 | Bacteria | 3471 |
| 936 | Ga0501032_0039313 | 3300049569 | Bacteria | 3218 |
| 937 | Ga0501033_0024529 | 3300049570 | Bacteria | 4549 |
| 938 | Ga0501033_0094249 | 3300049570 | Bacteria | 2189 |
| 939 | Ga0501034_0000994 | 3300049571 | Bacteria | 40719 |
| 940 | Ga0501034_0028437 | 3300049571 | Bacteria | 5689 |
| 941 | Ga0501034_0044874 | 3300049571 | Bacteria | 4468 |
| 942 | Ga0501034_0143131 | 3300049571 | Bacteria | 2370 |
| 943 | Ga0501036_0006289 | 3300049572 | Bacteria | 9636 |
| 944 | Ga0501036_0018260 | 3300049572 | Bacteria | 5873 |
| 945 | Ga0501036_0235265 | 3300049572 | Bacteria | 1537 |
| 946 | Ga0501037_0024831 | 3300049573 | Bacteria | 4430 |
| 947 | Ga0501037_0087457 | 3300049573 | Bacteria | 2255 |
| 948 | Ga0501037_0092803 | 3300049573 | Bacteria | 2183 |
| 949 | Ga0501038_0004102 | 3300049574 | Bacteria | 13549 |
| 950 | Ga0501038_0018601 | 3300049574 | Bacteria | 6275 |
| 951 | Ga0501038_0135375 | 3300049574 | Bacteria | 2019 |
| 952 | Ga0501038_0294533 | 3300049574 | Bacteria | 1274 |
| 953 | Ga0501039_0033993 | 3300049575 | Bacteria | 3933 |
| 954 | Ga0501039_0093456 | 3300049575 | Bacteria | 2344 |
| 955 | Ga0501040_0072904 | 3300049576 | Bacteria | 2372 |
| 956 | Ga0501040_0077521 | 3300049576 | Bacteria | 2299 |
| 957 | Ga0501040_0226647 | 3300049576 | Bacteria | 1330 |
| 958 | Ga0501043_0012441 | 3300049579 | Bacteria | 6656 |
| 959 | Ga0501043_0028758 | 3300049579 | Bacteria | 4363 |
| 960 | Ga0501043_0032442 | 3300049579 | Bacteria | 4107 |
| 961 | Ga0501043_0048955 | 3300049579 | Bacteria | 3322 |
| 962 | Ga0501046_0008307 | 3300049580 | Bacteria | 9060 |
| 963 | Ga0501046_0049541 | 3300049580 | Bacteria | 3322 |
| 964 | Ga0501046_0151411 | 3300049580 | Bacteria | 1750 |
| 965 | Ga0501046_0189229 | 3300049580 | Bacteria | 1536 |
| 966 | Ga0501047_0000659 | 3300049581 | Bacteria | 36048 |
| 967 | Ga0501047_0006456 | 3300049581 | Bacteria | 11031 |
| 968 | Ga0501047_0058466 | 3300049581 | Bacteria | 3725 |
| 969 | Ga0501047_0116873 | 3300049581 | Bacteria | 2548 |
| 970 | Ga0501047_0304826 | 3300049581 | Bacteria | 1434 |
| 971 | Ga0501048_0019853 | 3300049582 | Bacteria | 4927 |
| 972 | Ga0501048_0046366 | 3300049582 | Bacteria | 3103 |
| 973 | Ga0501067_0037391 | 3300049583 | Bacteria | 2696 |
| 974 | Ga0501067_0093105 | 3300049583 | Bacteria | 1673 |
| 975 | Ga0501068_0004565 | 3300049584 | Bacteria | 7529 |
| 976 | Ga0501068_0200865 | 3300049584 | Bacteria | 1264 |
| 977 | Ga0501069_0001905 | 3300049585 | Bacteria | 10413 |
| 978 | Ga0501069_0012024 | 3300049585 | Bacteria | 4595 |
| 979 | Ga0501069_0043531 | 3300049585 | Bacteria | 2485 |
| 980 | Ga0501069_0087480 | 3300049585 | Bacteria | 1760 |
| 981 | Ga0501070_0012950 | 3300049586 | Bacteria | 7029 |
| 982 | Ga0501070_0013312 | 3300049586 | Bacteria | 6937 |
| 983 | Ga0501070_0054239 | 3300049586 | Bacteria | 3324 |
| 984 | Ga0501070_0086090 | 3300049586 | Bacteria | 2601 |
| 985 | Ga0501070_0092483 | 3300049586 | Bacteria | 2503 |
| 986 | Ga0501071_0000889 | 3300049587 | Bacteria | 16169 |
| 987 | Ga0501071_0155575 | 3300049587 | Bacteria | 1707 |
| 988 | Ga0501071_0263813 | 3300049587 | Bacteria | 1301 |
| 989 | Ga0501071_0393404 | 3300049587 | Bacteria | 1058 |
| 990 | Ga0501072_0028671 | 3300049588 | Bacteria | 4346 |
| 991 | Ga0501072_0036785 | 3300049588 | Bacteria | 3839 |
| 992 | Ga0501072_0068853 | 3300049588 | Bacteria | 2793 |
| 993 | Ga0501072_0188738 | 3300049588 | Bacteria | 1644 |
| 994 | Ga0501073_0009892 | 3300049589 | Bacteria | 7020 |
| 995 | Ga0501073_0012757 | 3300049589 | Bacteria | 6130 |
| 996 | Ga0501073_0014945 | 3300049589 | Bacteria | 5631 |
| 997 | Ga0501073_0047522 | 3300049589 | Bacteria | 3016 |
| 998 | Ga0501074_0001224 | 3300049590 | Bacteria | 16927 |
| 999 | Ga0501074_0009389 | 3300049590 | Bacteria | 7108 |
| 1000 | Ga0501074_0015569 | 3300049590 | Bacteria | 5527 |
| 1001 | Ga0501074_0098080 | 3300049590 | Bacteria | 2098 |
| 1002 | Ga0501075_0035666 | 3300049591 | Bacteria | 3710 |
| 1003 | Ga0501076_0070557 | 3300049592 | Bacteria | 2794 |
| 1004 | Ga0501076_0082137 | 3300049592 | Bacteria | 2587 |
| 1005 | Ga0501076_0324052 | 3300049592 | Bacteria | 1264 |
| 1006 | Ga0501077_0009190 | 3300049593 | Bacteria | 6138 |
| 1007 | Ga0501077_0019113 | 3300049593 | Bacteria | 4332 |
| 1008 | Ga0501077_0112722 | 3300049593 | Bacteria | 1724 |
| 1009 | Ga0501077_0130568 | 3300049593 | Bacteria | 1593 |
| 1010 | Ga0501079_0038441 | 3300049741 | Bacteria | 3690 |
| 1011 | Ga0501079_0116246 | 3300049741 | Bacteria | 2079 |
| 1012 | Ga0501080_0000406 | 3300049742 | Bacteria | 33113 |
| 1013 | Ga0501080_0046258 | 3300049742 | Bacteria | 4052 |
| 1014 | Ga0501080_0064255 | 3300049742 | Bacteria | 3414 |
| 1015 | Ga0501080_0142880 | 3300049742 | Bacteria | 2213 |
| 1016 | Ga0501080_0209308 | 3300049742 | Bacteria | 1787 |
| 1017 | Ga0501081_0004836 | 3300049743 | Bacteria | 8656 |
| 1018 | Ga0501081_0006251 | 3300049743 | Bacteria | 7723 |
| 1019 | Ga0501083_0000497 | 3300049744 | Bacteria | 25179 |
| 1020 | Ga0501083_0026846 | 3300049744 | Bacteria | 3978 |
| 1021 | Ga0501083_0044417 | 3300049744 | Bacteria | 3008 |
| 1022 | Ga0501083_0079706 | 3300049744 | Bacteria | 2171 |
| 1023 | Ga0501035_0005717 | 3300049822 | Bacteria | 11729 |
| 1024 | Ga0501035_0012534 | 3300049822 | Bacteria | 7831 |
| 1025 | Ga0501035_0051269 | 3300049822 | Bacteria | 3695 |
| 1026 | Ga0501044_0000260 | 3300049823 | Bacteria | 67087 |
| 1027 | Ga0501044_0268741 | 3300049823 | Bacteria | 1642 |
| 1028 | Ga0501045_0066270 | 3300049824 | Bacteria | 2652 |
| 1029 | Ga0501045_0067881 | 3300049824 | Bacteria | 2619 |
| 1030 | Ga0501045_0174144 | 3300049824 | Bacteria | 1603 |
| 1031 | Ga0501045_0227312 | 3300049824 | Bacteria | 1389 |
| 1032 | Ga0501045_0252446 | 3300049824 | Bacteria | 1313 |
| 1033 | nmdc:mga03n38_85540_c1 | 3300050490 | Bacteria | 1491 |
| 1034 | nmdc:mga0yw44_41036_c1 | 3300050492 | Bacteria | 2753 |
| 1035 | nmdc:mga0yw44_50014_c1 | 3300050492 | Bacteria | 2525 |
| 1036 | nmdc:mga0yw44_72288_c1 | 3300050492 | Bacteria | 2144 |
| 1037 | nmdc:mga0k408_2679_c1 | 3300050493 | Bacteria | 9439 |
| 1038 | nmdc:mga07m45_36008_c1 | 3300050496 | Bacteria | 2754 |
| 1039 | nmdc:mga05p37_29092_c1 | 3300050507 | Bacteria | 6744 |
| 1040 | nmdc:mga05p37_30389_c1 | 3300050507 | Bacteria | 6592 |
| 1041 | nmdc:mga05p37_52025_c1 | 3300050507 | Bacteria | 5036 |
| 1042 | nmdc:mga09592_149403_c1 | 3300050508 | Bacteria | 2015 |
| 1043 | nmdc:mga09592_15144_c1 | 3300050508 | Bacteria | 6300 |
| 1044 | nmdc:mga09592_15888_c1 | 3300050508 | Bacteria | 6151 |
| 1045 | nmdc:mga09592_23614_c1 | 3300050508 | Bacteria | 5080 |
| 1046 | nmdc:mga0qj67_16351_c1 | 3300050509 | Bacteria | 5626 |
| 1047 | nmdc:mga0qj67_219_c1 | 3300050509 | Bacteria | 39116 |
| 1048 | nmdc:mga0qj67_38298_c1 | 3300050509 | Bacteria | 3761 |
| 1049 | nmdc:mga0qj67_9429_c1 | 3300050509 | Bacteria | 7265 |
| 1050 | nmdc:mga06r32_19261_c1 | 3300050510 | Bacteria | 6263 |
| 1051 | nmdc:mga06r32_269143_c1 | 3300050510 | Bacteria | 1691 |
| 1052 | nmdc:mga06r32_300291_c1 | 3300050510 | Bacteria | 1592 |
| 1053 | nmdc:mga06r32_33398_c1 | 3300050510 | Bacteria | 4845 |
| 1054 | nmdc:mga06r32_3354_c1 | 3300050510 | Bacteria | 14335 |
| 1055 | nmdc:mga06r32_35431_c1 | 3300050510 | Bacteria | 4709 |
| 1056 | nmdc:mga08y16_100943_c1 | 3300050511 | Bacteria | 3004 |
| 1057 | nmdc:mga08y16_148034_c1 | 3300050511 | Bacteria | 2441 |
| 1058 | nmdc:mga08y16_15457_c1 | 3300050511 | Bacteria | 8028 |
| 1059 | nmdc:mga08y16_199413_c1 | 3300050511 | Bacteria | 2074 |
| 1060 | nmdc:mga08y16_203019_c1 | 3300050511 | Bacteria | 2054 |
| 1061 | nmdc:mga08y16_36679_c1 | 3300050511 | Bacteria | 5148 |
| 1062 | nmdc:mga08y16_513316_c1 | 3300050511 | Bacteria | 1216 |
| 1063 | nmdc:mga08y16_59066_c1 | 3300050511 | Bacteria | 4007 |
| 1064 | nmdc:mga0n895_14993_c1 | 3300050512 | Bacteria | 7060 |
| 1065 | nmdc:mga0n895_30924_c1 | 3300050512 | Bacteria | 5121 |
| 1066 | nmdc:mga0n895_59427_c1 | 3300050512 | Bacteria | 3771 |
| 1067 | nmdc:mga0rr50_120532_c1 | 3300050513 | Bacteria | 2087 |
| 1068 | nmdc:mga0rr50_13944_c1 | 3300050513 | Bacteria | 5252 |
| 1069 | nmdc:mga08x19_84104_c1 | 3300050514 | Bacteria | 2093 |
| 1070 | nmdc:mga0a205_2194_c1 | 3300050515 | Bacteria | 17183 |
| 1071 | nmdc:mga0a205_478926_c1 | 3300050515 | Bacteria | 1103 |
| 1072 | nmdc:mga0a205_69021_c1 | 3300050515 | Bacteria | 3414 |
| 1073 | nmdc:mga0a205_98737_c1 | 3300050515 | Bacteria | 2818 |
| 1074 | Ga0495601_0000153 | 3300053077 | Bacteria | 38651 |
| 1075 | Ga0495601_0000924 | 3300053077 | Bacteria | 16022 |
| 1076 | Ga0495601_0003815 | 3300053077 | Bacteria | 8670 |
| 1077 | Ga0495601_0005347 | 3300053077 | Bacteria | 7479 |
| 1078 | Ga0495601_0088642 | 3300053077 | Bacteria | 1989 |
| 1079 | Ga0495601_0094744 | 3300053077 | Bacteria | 1924 |
| 1080 | Ga0495612_0001641 | 3300053078 | Bacteria | 9209 |
| 1081 | Ga0495612_0004940 | 3300053078 | Bacteria | 5517 |
| 1082 | Ga0495612_0009449 | 3300053078 | Bacteria | 3956 |
| 1083 | Ga0495612_0010177 | 3300053078 | Bacteria | 3804 |
| 1084 | Ga0495612_0015909 | 3300053078 | Bacteria | 3015 |
| 1085 | Ga0495655_0024730 | 3300053083 | Bacteria | 1398 |
| 1086 | Ga0495595_0001072 | 3300053084 | Bacteria | 10580 |
| 1087 | Ga0495595_0008421 | 3300053084 | Bacteria | 4231 |
| 1088 | Ga0495595_0020239 | 3300053084 | Bacteria | 2895 |
| 1089 | Ga0495595_0033278 | 3300053084 | Bacteria | 2325 |
| 1090 | Ga0495595_0042888 | 3300053084 | Bacteria | 2073 |
| 1091 | Ga0495619_0001259 | 3300053085 | Bacteria | 16607 |
| 1092 | Ga0495619_0003278 | 3300053085 | Bacteria | 10467 |
| 1093 | Ga0495619_0004023 | 3300053085 | Bacteria | 9413 |
| 1094 | Ga0495619_0011833 | 3300053085 | Bacteria | 5497 |
| 1095 | Ga0495619_0033058 | 3300053085 | Bacteria | 3358 |
| 1096 | Ga0495619_0046270 | 3300053085 | Bacteria | 2860 |
| 1097 | Ga0495619_0066068 | 3300053085 | Bacteria | 2414 |
| 1098 | Ga0495619_0096294 | 3300053085 | Bacteria | 2009 |
| 1099 | Ga0500643_007922 | 3300053087 | Bacteria | 4229 |
| 1100 | Ga0500644_0000537 | 3300053088 | Bacteria | 15651 |
| 1101 | Ga0500651_0015314 | 3300053093 | Bacteria | 4706 |
| 1102 | Ga0500566_0049155 | 3300053094 | Bacteria | 2416 |
| 1103 | Ga0500593_014669 | 3300053117 | Bacteria | 3363 |
| 1104 | Ga0500594_0037817 | 3300053118 | Bacteria | 1305 |
| 1105 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1106 | Ga0500642_0112683 | 3300053130 | Bacteria | 1271 |
| 1107 | Ga0500652_002646 | 3300053131 | Bacteria | 5411 |
| 1108 | Ga0500568_0083565 | 3300053139 | Bacteria | 1210 |
| 1109 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1110 | Ga0500616_0003402 | 3300053153 | Bacteria | 12208 |
| 1111 | Ga0500616_0042777 | 3300053153 | Bacteria | 2424 |
| 1112 | Ga0500616_0072775 | 3300053153 | Bacteria | 1747 |
| 1113 | Ga0500616_0075225 | 3300053153 | Bacteria | 1710 |
| 1114 | Ga0500627_0013903 | 3300053158 | Bacteria | 3069 |
| 1115 | Ga0500645_000619 | 3300053730 | Bacteria | 22779 |
| 1116 | Ga0501084_0034551 | 3300054114 | Bacteria | 4228 |
| 1117 | Ga0501084_0038965 | 3300054114 | Bacteria | 3975 |
| 1118 | Ga0501084_0064578 | 3300054114 | Bacteria | 3063 |
| 1119 | Ga0501084_0375554 | 3300054114 | Bacteria | 1201 |
| 1120 | Ga0501082_0071690 | 3300060353 | Bacteria | 2983 |
| 1121 | Ga0501082_0084220 | 3300060353 | Bacteria | 2743 |
| 1122 | Ga0501082_0088494 | 3300060353 | Bacteria | 2672 |
| 1123 | Ga0501082_0148127 | 3300060353 | Bacteria | 2038 |
| 1124 | Ga0501082_0293249 | 3300060353 | Bacteria | 1416 |
| 1125 | Ga0466962_0045933 | 3300061719 | Bacteria | 2088 |
| 1126 | Ga0530510_0041307 | 3300061734 | Bacteria | 3330 |
| 1127 | Ga0530510_0215897 | 3300061734 | Bacteria | 1425 |
| 1128 | Ga0530510_0288136 | 3300061734 | Bacteria | 1227 |
| 1129 | 2643758437 | 2643221547 | Bacteria | 4740017 |
| 1130 | Ga0070658_10021062 | |||
| 1131 | SwRhRL2b_contig_2220177 | |||
| 1132 | 2214800767 | |||
| 1133 | ARcpr5oldR_c000002 | |||
| 1134 | ARSoilYngRDRAFT_c00455 | |||
| 1135 | ARcpr5yngRDRAFT_c000078 | |||
| 1136 | ARSoilOldRDRAFT_c000044 | |||
| 1137 | ARCol0yngRDRAFT_1000006 | |||
| 1138 | JGI24746J21847_1003527 | |||
| 1139 | JGI24739J22299_10002045 | |||
| 1140 | JGI24739J22299_10015336 | |||
| 1141 | JGI24737J22298_10012349 | |||
| 1142 | JGI24737J22298_10018004 | |||
| 1143 | JGI24737J22298_10023143 | |||
| 1144 | JGI24743J22301_10000159 | |||
| 1145 | JGI24750J21931_1000490 | |||
| 1146 | JGI24750J21931_1000735 | |||
| 1147 | JGI24748J21848_1005336 | |||
| 1148 | JGI24738J21930_10001088 | |||
| 1149 | JGI24738J21930_10017649 | |||
| 1150 | JGI24749J21850_1006217 | |||
| 1151 | JGI24744J21845_10000795 | |||
| 1152 | JGI24034J26672_10002532 | |||
| 1153 | JGI24742J22300_10000719 | |||
| 1154 | JGI24742J22300_10007598 | |||
| 1155 | JGI24751J29686_10001890 | |||
| 1156 | JGI24751J29686_10016923 | |||
| 1157 | JGI25153J46596_10029783 | |||
| 1158 | Ga0065704_10073537 | |||
| 1159 | Ga0065712_10000525 | |||
| 1160 | Ga0065712_10071643 | |||
| 1161 | Ga0065715_10000786 | |||
| 1162 | Ga0065715_10001618 | |||
| 1163 | Ga0065715_10128721 | |||
| 1164 | Ga0065707_10093700 | |||
| 1165 | Ga0070676_10008636 | |||
| 1166 | Ga0070676_10029492 | |||
| 1167 | Ga0070676_10077970 | |||
| 1168 | Ga0070690_100017544 | |||
| 1169 | Ga0070690_100023985 | |||
| 1170 | Ga0070670_100013972 | |||
| 1171 | Ga0070670_100036840 | |||
| 1172 | Ga0070670_100132744 | |||
| 1173 | Ga0070677_10002021 | |||
| 1174 | Ga0070677_10035037 | |||
| 1175 | Ga0068869_100007722 | |||
| 1176 | Ga0068869_100086402 | |||
| 1177 | Ga0070666_10019359 | |||
| 1178 | Ga0070680_100005003 | |||
| 1179 | Ga0070680_100058564 | |||
| 1180 | Ga0070680_100070455 | |||
| 1181 | Ga0070680_100134244 | |||
| 1182 | Ga0070682_100006121 | |||
| 1183 | Ga0070682_100051056 | |||
| 1184 | Ga0070682_100091409 | |||
| 1185 | Ga0068868_100007371 | |||
| 1186 | Ga0068868_100014393 | |||
| 1187 | Ga0068868_100033675 | |||
| 1188 | Ga0070660_100006708 | |||
| 1189 | Ga0070660_100046308 | |||
| 1190 | Ga0070660_100090012 | |||
| 1191 | Ga0070660_100187939 | |||
| 1192 | Ga0070689_100005971 | |||
| 1193 | Ga0070689_100007754 | |||
| 1194 | Ga0070689_100065721 | |||
| 1195 | Ga0070691_10005815 | |||
| 1196 | Ga0070687_100013422 | |||
| 1197 | Ga0070661_100090705 | |||
| 1198 | Ga0070692_10004117 | |||
| 1199 | Ga0070692_10036509 | |||
| 1200 | Ga0070668_100021658 | |||
| 1201 | Ga0070668_100084052 | |||
| 1202 | Ga0070669_100015804 | |||
| 1203 | Ga0070669_100021880 | |||
| 1204 | Ga0070675_100051528 | |||
| 1205 | Ga0070671_100022260 | |||
| 1206 | Ga0070671_100031865 | |||
| 1207 | Ga0070671_100043050 | |||
| 1208 | Ga0070671_100182331 | |||
| 1209 | Ga0070674_100020621 | |||
| 1210 | Ga0070674_100107515 | |||
| 1211 | Ga0070674_100224366 | |||
| 1212 | Ga0070673_100014487 | |||
| 1213 | Ga0070673_100024611 | |||
| 1214 | Ga0070673_100058891 | |||
| 1215 | Ga0070688_100000988 | |||
| 1216 | Ga0070659_100013688 | |||
| 1217 | Ga0070659_100090687 | |||
| 1218 | Ga0070667_100008782 | |||
| 1219 | Ga0070667_100028199 | |||
| 1220 | Ga0070667_100030348 | |||
| 1221 | Ga0070667_100115175 | |||
| 1222 | Ga0070703_10000974 | |||
| 1223 | Ga0070703_10021515 | |||
| 1224 | Ga0070709_10005670 | |||
| 1225 | Ga0070714_100060740 | |||
| 1226 | Ga0070714_100066662 | |||
| 1227 | Ga0070713_100001193 | |||
| 1228 | Ga0070713_100015115 | |||
| 1229 | Ga0070713_100046278 | |||
| 1230 | Ga0070713_100200070 | |||
| 1231 | Ga0070713_100359523 | |||
| 1232 | Ga0070710_10030475 | |||
| 1233 | Ga0070701_10000183 | |||
| 1234 | Ga0070701_10105651 | |||
| 1235 | Ga0070711_100108148 | |||
| 1236 | Ga0070711_100268855 | |||
| 1237 | Ga0070705_100000072 | |||
| 1238 | Ga0070705_100031359 | |||
| 1239 | Ga0070700_100000962 | |||
| 1240 | Ga0070700_100033730 | |||
| 1241 | Ga0070694_100002401 | |||
| 1242 | Ga0070694_100008532 | |||
| 1243 | Ga0070694_100029178 | |||
| 1244 | Ga0070694_100244774 | |||
| 1245 | Ga0070694_100290179 | |||
| 1246 | Ga0070708_100012927 | |||
| 1247 | Ga0070663_100012889 | |||
| 1248 | Ga0070663_100015673 | |||
| 1249 | Ga0070678_100014088 | |||
| 1250 | Ga0070678_100030148 | |||
| 1251 | Ga0070678_100040679 | |||
| 1252 | Ga0070662_100011551 | |||
| 1253 | Ga0070662_100023409 | |||
| 1254 | Ga0070681_10014164 | |||
| 1255 | Ga0070681_10036206 | |||
| 1256 | Ga0070681_10043334 | |||
| 1257 | Ga0068867_100004925 | |||
| 1258 | Ga0068867_100005981 | |||
| 1259 | Ga0070685_10002466 | |||
| 1260 | Ga0070706_100106155 | |||
| 1261 | Ga0070698_100321522 | |||
| 1262 | Ga0070698_100393484 | |||
| 1263 | Ga0070699_100000250 | |||
| 1264 | Ga0070699_100006065 | |||
| 1265 | Ga0070679_100023403 | |||
| 1266 | Ga0070679_100024333 | |||
| 1267 | Ga0070679_100029480 | |||
| 1268 | Ga0070679_100117275 | |||
| 1269 | Ga0070679_100123265 | |||
| 1270 | Ga0070679_100137832 | |||
| 1271 | Ga0070679_100214453 | |||
| 1272 | Ga0070679_100514701 | |||
| 1273 | Ga0070684_100307329 | |||
| 1274 | Ga0070697_100029834 | |||
| 1275 | Ga0070697_100144326 | |||
| 1276 | Ga0068853_100016210 | |||
| 1277 | Ga0068853_100025687 | |||
| 1278 | Ga0070672_100002019 | |||
| 1279 | Ga0070672_100015771 | |||
| 1280 | Ga0070672_100297185 | |||
| 1281 | Ga0070686_100005478 | |||
| 1282 | Ga0070686_100008947 | |||
| 1283 | Ga0070686_100025369 | |||
| 1284 | Ga0070686_100183754 | |||
| 1285 | Ga0070686_100204506 | |||
| 1286 | Ga0070695_100009154 | |||
| 1287 | Ga0070695_100017290 | |||
| 1288 | Ga0070696_100001222 | |||
| 1289 | Ga0070696_100035450 | |||
| 1290 | Ga0070696_100046601 | |||
| 1291 | Ga0070696_100075905 | |||
| 1292 | Ga0070704_100001627 | |||
| 1293 | Ga0070704_100004758 | |||
| 1294 | Ga0068855_100088921 | |||
| 1295 | Ga0070664_100009499 | |||
| 1296 | Ga0070664_100021829 | |||
| 1297 | Ga0070664_100023695 | |||
| 1298 | Ga0070664_100040276 | |||
| 1299 | Ga0070664_100060326 | |||
| 1300 | Ga0070664_100326367 | |||
| 1301 | Ga0068857_100149832 | |||
| 1302 | Ga0068857_100234081 | |||
| 1303 | Ga0068854_100019786 | |||
| 1304 | Ga0068856_100002357 | |||
| 1305 | Ga0068856_100070913 | |||
| 1306 | Ga0068856_100212296 | |||
| 1307 | Ga0068856_100374532 | |||
| 1308 | Ga0070702_100003696 | |||
| 1309 | Ga0070702_100004151 | |||
| 1310 | Ga0070702_100118622 | |||
| 1311 | Ga0070702_100256213 | |||
| 1312 | Ga0068852_100036741 | |||
| 1313 | Ga0068859_100014663 | |||
| 1314 | Ga0068859_100024405 | |||
| 1315 | Ga0068859_100038786 | |||
| 1316 | Ga0068859_100092893 | |||
| 1317 | Ga0068859_100173439 | |||
| 1318 | Ga0068864_100029805 | |||
| 1319 | Ga0068864_100100018 | |||
| 1320 | Ga0068864_100197848 | |||
| 1321 | Ga0068864_100221260 | |||
| 1322 | Ga0068864_100298528 | |||
| 1323 | Ga0068866_10004536 | |||
| 1324 | Ga0068866_10004841 | |||
| 1325 | Ga0068861_100007422 | |||
| 1326 | Ga0068861_100011543 | |||
| 1327 | Ga0068870_10043393 | |||
| 1328 | Ga0068870_10113076 | |||
| 1329 | Ga0068863_100013447 | |||
| 1330 | Ga0068863_100028939 | |||
| 1331 | Ga0068863_100412605 | |||
| 1332 | Ga0068858_100019603 | |||
| 1333 | Ga0068858_100041088 | |||
| 1334 | Ga0068860_100013861 | |||
| 1335 | Ga0068860_100024578 | |||
| 1336 | Ga0068860_100025455 | |||
| 1337 | Ga0068860_100042317 | |||
| 1338 | Ga0068862_100002889 | |||
| 1339 | Ga0068862_100009877 | |||
| 1340 | Ga0068862_100012095 | |||
| 1341 | Ga0068862_100027147 | |||
| 1342 | Ga0081455_10000012 | |||
| 1343 | Ga0081455_10003043 | |||
| 1344 | Ga0081455_10017138 | |||
| 1345 | Ga0081455_10032195 | |||
| 1346 | Ga0081455_10102989 | |||
| 1347 | Ga0081538_10016815 | |||
| 1348 | Ga0081538_10026172 | |||
| 1349 | Ga0070717_10000217 | |||
| 1350 | Ga0070717_10331386 | |||
| 1351 | Ga0075365_10029572 | |||
| 1352 | Ga0075365_10059917 | |||
| 1353 | Ga0075365_10062989 | |||
| 1354 | Ga0075368_10016953 | |||
| 1355 | Ga0075368_10050958 | |||
| 1356 | Ga0075368_10084676 | |||
| 1357 | Ga0075432_10004699 | |||
| 1358 | Ga0070715_10001366 | |||
| 1359 | Ga0070715_10102419 | |||
| 1360 | Ga0070712_100002166 | |||
| 1361 | Ga0070712_100050246 | |||
| 1362 | Ga0070712_100158894 | |||
| 1363 | Ga0070712_100241432 | |||
| 1364 | Ga0075367_10060452 | |||
| 1365 | Ga0075367_10082600 | |||
| 1366 | Ga0075367_10113941 | |||
| 1367 | Ga0075427_10007153 | |||
| 1368 | Ga0075366_10012741 | |||
| 1369 | Ga0075366_10022792 | |||
| 1370 | Ga0097621_100008062 | |||
| 1371 | Ga0097621_100009622 | |||
| 1372 | Ga0097621_100103648 | |||
| 1373 | Ga0075370_10017657 | |||
| 1374 | Ga0068871_100002599 | |||
| 1375 | Ga0068871_100199336 | |||
| 1376 | Ga0075428_100018890 | |||
| 1377 | Ga0075428_100152988 | |||
| 1378 | Ga0075428_100175581 | |||
| 1379 | Ga0075428_100339101 | |||
| 1380 | Ga0075428_100491563 | |||
| 1381 | Ga0075430_100000255 | |||
| 1382 | Ga0075430_100016737 | |||
| 1383 | Ga0075430_100020485 | |||
| 1384 | Ga0075430_100044550 | |||
| 1385 | Ga0075430_100082266 | |||
| 1386 | Ga0075430_100099398 | |||
| 1387 | Ga0075431_100025571 | |||
| 1388 | Ga0075431_100025734 | |||
| 1389 | Ga0075431_100042822 | |||
| 1390 | Ga0075431_100062366 | |||
| 1391 | Ga0075431_100138652 | |||
| 1392 | Ga0075431_100210233 | |||
| 1393 | Ga0075433_10008805 | |||
| 1394 | Ga0075433_10017290 | |||
| 1395 | Ga0075433_10306677 | |||
| 1396 | Ga0075434_100017606 | |||
| 1397 | Ga0075434_100028914 | |||
| 1398 | Ga0075434_100122839 | |||
| 1399 | Ga0075434_100176314 | |||
| 1400 | Ga0075434_100284007 | |||
| 1401 | Ga0075429_100001284 | |||
| 1402 | Ga0075429_100013201 | |||
| 1403 | Ga0075429_100054884 | |||
| 1404 | Ga0068865_100043245 | |||
| 1405 | Ga0075436_100011676 | |||
| 1406 | Ga0075436_100093737 | |||
| 1407 | Ga0075436_100140582 | |||
| 1408 | Ga0097620_100014663 | |||
| 1409 | Ga0097620_100024405 | |||
| 1410 | Ga0097620_100038786 | |||
| 1411 | Ga0097620_100092893 | |||
| 1412 | Ga0097620_100173432 | |||
| 1413 | Ga0075435_100075746 | |||
| 1414 | Ga0075435_100093770 | |||
| 1415 | Ga0075435_100147481 | |||
| 1416 | Ga0105251_10095273 | |||
| 1417 | Ga0105251_10151016 | |||
| 1418 | Ga0105244_10084087 | |||
| 1419 | Ga0105250_10050544 | |||
| 1420 | Ga0105240_10144273 | |||
| 1421 | Ga0105240_10189603 | |||
| 1422 | Ga0111539_10000114 | |||
| 1423 | Ga0111539_10040138 | |||
| 1424 | Ga0111539_10041202 | |||
| 1425 | Ga0111539_10094226 | |||
| 1426 | Ga0111539_10156897 | |||
| 1427 | Ga0111539_10194833 | |||
| 1428 | Ga0111539_10207250 | |||
| 1429 | Ga0105245_10044359 | |||
| 1430 | Ga0105247_10009657 | |||
| 1431 | Ga0105247_10014301 | |||
| 1432 | Ga0105247_10021171 | |||
| 1433 | Ga0105247_10105869 | |||
| 1434 | Ga0114129_10022232 | |||
| 1435 | Ga0114129_10037886 | |||
| 1436 | Ga0114129_10892886 | |||
| 1437 | Ga0105243_10013412 | |||
| 1438 | Ga0105243_10017546 | |||
| 1439 | Ga0105243_10020763 | |||
| 1440 | Ga0105243_10031701 | |||
| 1441 | Ga0105243_10104448 | |||
| 1442 | Ga0105243_10364007 | |||
| 1443 | Ga0105241_10008736 | |||
| 1444 | Ga0105242_10006841 | |||
| 1445 | Ga0105242_10019418 | |||
| 1446 | Ga0105248_10001732 | |||
| 1447 | Ga0105248_10005057 | |||
| 1448 | Ga0105248_10135827 | |||
| 1449 | Ga0105248_10179528 | |||
| 1450 | Ga0105237_10017286 | |||
| 1451 | Ga0105237_10024152 | |||
| 1452 | Ga0105237_10382057 | |||
| 1453 | Ga0105238_10023216 | |||
| 1454 | Ga0105238_10059175 | |||
| 1455 | Ga0105238_10106145 | |||
| 1456 | Ga0105238_10181349 | |||
| 1457 | Ga0105238_10392818 | |||
| 1458 | Ga0105238_10404046 | |||
| 1459 | Ga0105249_10006938 | |||
| 1460 | Ga0105249_10026774 | |||
| 1461 | Ga0105249_10075162 | |||
| 1462 | Ga0105249_10079338 | |||
| 1463 | Ga0099796_10053147 | |||
| 1464 | Ga0099796_10066598 | |||
| 1465 | Ga0105239_10030215 | |||
| 1466 | Ga0105239_10044186 | |||
| 1467 | Ga0105239_10252492 | |||
| 1468 | Ga0105239_10299424 | |||
| 1469 | Ga0105239_10356564 | |||
| 1470 | Ga0105246_10009309 | |||
| 1471 | Ga0105246_10015049 | |||
| 1472 | Ga0105246_10021551 | |||
| 1473 | Ga0105246_10312097 | |||
| 1474 | Ga0157336_1002059 | |||
| 1475 | Ga0157338_1000955 | |||
| 1476 | Ga0157371_10008562 | |||
| 1477 | Ga0157371_10070838 | |||
| 1478 | Ga0157370_10030287 | |||
| 1479 | Ga0157370_10187745 | |||
| 1480 | Ga0157369_10351414 | |||
| 1481 | Ga0157374_10034575 | |||
| 1482 | Ga0157374_10160410 | |||
| 1483 | Ga0157378_10016743 | |||
| 1484 | Ga0157378_10234799 | |||
| 1485 | Ga0157378_10401988 | |||
| 1486 | Ga0163162_10066462 | |||
| 1487 | Ga0163162_10158069 | |||
| 1488 | Ga0163162_10216964 | |||
| 1489 | Ga0163162_10358576 | |||
| 1490 | Ga0157372_10027509 | |||
| 1491 | Ga0157372_10424181 | |||
| 1492 | Ga0157372_10476833 | |||
| 1493 | Ga0157372_10501322 | |||
| 1494 | Ga0157375_10036665 | |||
| 1495 | Ga0157375_10037116 | |||
| 1496 | Ga0157375_10145412 | |||
| 1497 | Ga0157375_10258366 | |||
| 1498 | Ga0157375_10330609 | |||
| 1499 | Ga0163163_10005264 | |||
| 1500 | Ga0163163_10013076 | |||
| 1501 | Ga0163163_10016286 | |||
| 1502 | Ga0163163_10020301 | |||
| 1503 | Ga0163163_10029786 | |||
| 1504 | Ga0182008_10071599 | |||
| 1505 | Ga0157377_10006770 | |||
| 1506 | Ga0157377_10017429 | |||
| 1507 | Ga0157379_10005269 | |||
| 1508 | Ga0157379_10045682 | |||
| 1509 | Ga0157376_10044920 | |||
| 1510 | Ga0163161_10014794 | |||
| 1511 | Ga0163161_10050291 | |||
| 1512 | Ga0213876_10030137 | |||
| 1513 | Ga0213876_10057589 | |||
| 1514 | Ga0213876_10127912 | |||
| 1515 | Ga0228598_1001818 | |||
| 1516 | Ga0209233_1006560 | |||
| 1517 | Ga0207666_1000323 | |||
| 1518 | Ga0207673_1004949 | |||
| 1519 | Ga0209758_1000244 | |||
| 1520 | Ga0209758_1039792 | |||
| 1521 | Ga0207426_1035999 | |||
| 1522 | Ga0207697_10008914 | |||
| 1523 | Ga0207697_10015857 | |||
| 1524 | Ga0207696_1035761 | |||
| 1525 | Ga0207653_10004178 | |||
| 1526 | Ga0207653_10005006 | |||
| 1527 | Ga0207682_10003785 | |||
| 1528 | Ga0207682_10022226 | |||
| 1529 | Ga0207692_10053666 | |||
| 1530 | Ga0207692_10054258 | |||
| 1531 | Ga0207692_10075262 | |||
| 1532 | Ga0207642_10000819 | |||
| 1533 | Ga0207710_10003631 | |||
| 1534 | Ga0207710_10121772 | |||
| 1535 | Ga0207688_10000274 | |||
| 1536 | Ga0207688_10001639 | |||
| 1537 | Ga0207680_10009419 | |||
| 1538 | Ga0207647_10013330 | |||
| 1539 | Ga0207647_10014600 | |||
| 1540 | Ga0207647_10018614 | |||
| 1541 | Ga0207647_10176842 | |||
| 1542 | Ga0207685_10034329 | |||
| 1543 | Ga0207699_10000138 | |||
| 1544 | Ga0207699_10008490 | |||
| 1545 | Ga0207645_10008125 | |||
| 1546 | Ga0207645_10011546 | |||
| 1547 | Ga0207645_10038873 | |||
| 1548 | Ga0207643_10000453 | |||
| 1549 | Ga0207643_10000500 | |||
| 1550 | Ga0207705_10013654 | |||
| 1551 | Ga0207684_10059760 | |||
| 1552 | Ga0207654_10022075 | |||
| 1553 | Ga0207654_10036667 | |||
| 1554 | Ga0207707_10016536 | |||
| 1555 | Ga0207707_10018605 | |||
| 1556 | Ga0207707_10227675 | |||
| 1557 | Ga0207671_10031226 | |||
| 1558 | Ga0207693_10015786 | |||
| 1559 | Ga0207693_10021823 | |||
| 1560 | Ga0207663_10073000 | |||
| 1561 | Ga0207663_10083464 | |||
| 1562 | Ga0207663_10136257 | |||
| 1563 | Ga0207660_10002540 | |||
| 1564 | Ga0207660_10012737 | |||
| 1565 | Ga0207660_10214032 | |||
| 1566 | Ga0207662_10002496 | |||
| 1567 | Ga0207662_10007651 | |||
| 1568 | Ga0207657_10005739 | |||
| 1569 | Ga0207657_10013896 | |||
| 1570 | Ga0207657_10017981 | |||
| 1571 | Ga0207657_10029015 | |||
| 1572 | Ga0207657_10052437 | |||
| 1573 | Ga0207657_10201003 | |||
| 1574 | Ga0207649_10017686 | |||
| 1575 | Ga0207652_10014386 | |||
| 1576 | Ga0207652_10015702 | |||
| 1577 | Ga0207652_10020472 | |||
| 1578 | Ga0207652_10027682 | |||
| 1579 | Ga0207652_10054048 | |||
| 1580 | Ga0207652_10099026 | |||
| 1581 | Ga0207652_10107427 | |||
| 1582 | Ga0207681_10009102 | |||
| 1583 | Ga0207681_10022271 | |||
| 1584 | Ga0207694_10036268 | |||
| 1585 | Ga0207694_10217293 | |||
| 1586 | Ga0207650_10006026 | |||
| 1587 | Ga0207650_10007377 | |||
| 1588 | Ga0207650_10014950 | |||
| 1589 | Ga0207650_10082521 | |||
| 1590 | Ga0207659_10021913 | |||
| 1591 | Ga0207687_10008300 | |||
| 1592 | Ga0207687_10013380 | |||
| 1593 | Ga0207700_10038128 | |||
| 1594 | Ga0207700_10119122 | |||
| 1595 | Ga0207700_10147035 | |||
| 1596 | Ga0207700_10329490 | |||
| 1597 | Ga0207664_10014759 | |||
| 1598 | Ga0207664_10049035 | |||
| 1599 | Ga0207664_10270133 | |||
| 1600 | Ga0207644_10004262 | |||
| 1601 | Ga0207644_10004301 | |||
| 1602 | Ga0207644_10021955 | |||
| 1603 | Ga0207644_10034640 | |||
| 1604 | Ga0207644_10093566 | |||
| 1605 | Ga0207690_10038216 | |||
| 1606 | Ga0207690_10120889 | |||
| 1607 | Ga0207706_10004619 | |||
| 1608 | Ga0207706_10010128 | |||
| 1609 | Ga0207706_10019952 | |||
| 1610 | Ga0207706_10048059 | |||
| 1611 | Ga0207686_10013012 | |||
| 1612 | Ga0207686_10022966 | |||
| 1613 | Ga0207686_10075727 | |||
| 1614 | Ga0207686_10133420 | |||
| 1615 | Ga0207709_10003222 | |||
| 1616 | Ga0207709_10004517 | |||
| 1617 | Ga0207709_10018404 | |||
| 1618 | Ga0207709_10054919 | |||
| 1619 | Ga0207709_10124412 | |||
| 1620 | Ga0207670_10001217 | |||
| 1621 | Ga0207670_10002536 | |||
| 1622 | Ga0207670_10006412 | |||
| 1623 | Ga0207670_10079681 | |||
| 1624 | Ga0207669_10001081 | |||
| 1625 | Ga0207669_10004872 | |||
| 1626 | Ga0207669_10009349 | |||
| 1627 | Ga0207669_10102396 | |||
| 1628 | Ga0207704_10003970 | |||
| 1629 | Ga0207704_10004552 | |||
| 1630 | Ga0207704_10054563 | |||
| 1631 | Ga0207704_10054943 | |||
| 1632 | Ga0207665_10008609 | |||
| 1633 | Ga0207691_10001917 | |||
| 1634 | Ga0207691_10017174 | |||
| 1635 | Ga0207691_10081543 | |||
| 1636 | Ga0207711_10016990 | |||
| 1637 | Ga0207711_10019748 | |||
| 1638 | Ga0207711_10023214 | |||
| 1639 | Ga0207711_10029753 | |||
| 1640 | Ga0207711_10136405 | |||
| 1641 | Ga0207689_10013251 | |||
| 1642 | Ga0207689_10019992 | |||
| 1643 | Ga0207689_10080850 | |||
| 1644 | Ga0207661_10012621 | |||
| 1645 | Ga0207661_10056890 | |||
| 1646 | Ga0207661_10477116 | |||
| 1647 | Ga0207679_10004642 | |||
| 1648 | Ga0207679_10030410 | |||
| 1649 | Ga0207679_10131528 | |||
| 1650 | Ga0207679_10216152 | |||
| 1651 | Ga0207667_10024097 | |||
| 1652 | Ga0207667_10057316 | |||
| 1653 | Ga0207667_10261630 | |||
| 1654 | Ga0207667_10337016 | |||
| 1655 | Ga0207651_10001940 | |||
| 1656 | Ga0207651_10024835 | |||
| 1657 | Ga0207651_10040262 | |||
| 1658 | Ga0207712_10005147 | |||
| 1659 | Ga0207712_10012219 | |||
| 1660 | Ga0207712_10027706 | |||
| 1661 | Ga0207668_10023269 | |||
| 1662 | Ga0207668_10025367 | |||
| 1663 | Ga0207668_10079969 | |||
| 1664 | Ga0207668_10109093 | |||
| 1665 | Ga0207640_10002303 | |||
| 1666 | Ga0207640_10106398 | |||
| 1667 | Ga0207658_10017474 | |||
| 1668 | Ga0207658_10029450 | |||
| 1669 | Ga0207658_10037986 | |||
| 1670 | Ga0207677_10006117 | |||
| 1671 | Ga0207703_10004180 | |||
| 1672 | Ga0207703_10010048 | |||
| 1673 | Ga0207703_10085057 | |||
| 1674 | Ga0207639_10052011 | |||
| 1675 | Ga0207639_10083155 | |||
| 1676 | Ga0207639_10085118 | |||
| 1677 | Ga0207678_10004077 | |||
| 1678 | Ga0207678_10014823 | |||
| 1679 | Ga0207678_10026799 | |||
| 1680 | Ga0207678_10154254 | |||
| 1681 | Ga0207678_10440925 | |||
| 1682 | Ga0207708_10000770 | |||
| 1683 | Ga0207708_10002274 | |||
| 1684 | Ga0207708_10008025 | |||
| 1685 | Ga0207708_10020164 | |||
| 1686 | Ga0207702_10005849 | |||
| 1687 | Ga0207702_10012149 | |||
| 1688 | Ga0207702_10070783 | |||
| 1689 | Ga0207702_10375272 | |||
| 1690 | Ga0207641_10006517 | |||
| 1691 | Ga0207641_10068449 | |||
| 1692 | Ga0207641_10084754 | |||
| 1693 | Ga0207641_10150272 | |||
| 1694 | Ga0207641_10240428 | |||
| 1695 | Ga0207648_10010742 | |||
| 1696 | Ga0207648_10011212 | |||
| 1697 | Ga0207648_10071023 | |||
| 1698 | Ga0207676_10001447 | |||
| 1699 | Ga0207676_10003488 | |||
| 1700 | Ga0207676_10008505 | |||
| 1701 | Ga0207676_10010089 | |||
| 1702 | Ga0207674_10014465 | |||
| 1703 | Ga0207674_10019438 | |||
| 1704 | Ga0207674_10160729 | |||
| 1705 | Ga0207674_10185149 | |||
| 1706 | Ga0207675_100005913 | |||
| 1707 | Ga0207675_100030445 | |||
| 1708 | Ga0207675_100168965 | |||
| 1709 | Ga0207683_10001479 | |||
| 1710 | Ga0207683_10007199 | |||
| 1711 | Ga0207683_10009426 | |||
| 1712 | Ga0207683_10026254 | |||
| 1713 | Ga0207698_10029691 | |||
| 1714 | Ga0207698_10085756 | |||
| 1715 | Ga0210002_1000366 | |||
| 1716 | Ga0209588_1006089 | |||
| 1717 | Ga0209998_10002028 | |||
| 1718 | Ga0209998_10002086 | |||
| 1719 | Ga0207428_10000312 | |||
| 1720 | Ga0207428_10006151 | |||
| 1721 | Ga0207428_10048320 | |||
| 1722 | Ga0268266_10122714 | |||
| 1723 | Ga0268265_10002768 | |||
| 1724 | Ga0268265_10340954 | |||
| 1725 | Ga0268264_10028003 | |||
| 1726 | Ga0268264_10066523 | |||
| 1727 | Ga0265337_1002158 | |||
| 1728 | Ga0265338_10048070 | |||
| 1729 | Ga0265330_10028814 | |||
| 1730 | Ga0265325_10000172 | |||
| 1731 | Ga0265325_10000759 | |||
| 1732 | Ga0265325_10010987 | |||
| 1733 | Ga0265325_10056018 | |||
| 1734 | Ga0265339_10042932 | |||
| 1735 | Ga0265339_10050280 | |||
| 1736 | Ga0265331_10043063 | |||
| 1737 | Ga0265331_10050341 | |||
| 1738 | Ga0265316_10050600 | |||
| 1739 | Ga0265313_10000345 | |||
| 1740 | Ga0265313_10001066 | |||
| 1741 | Ga0265313_10023347 | |||
| 1742 | Ga0316575_10014978 | |||
| 1743 | Ga0316579_10043138 | |||
| 1744 | Ga0265314_10008415 | |||
| 1745 | Ga0265342_10000510 | |||
| 1746 | Ga0265342_10008960 | |||
| 1747 | Ga0316583_10005017 | |||
| 1748 | Ga0373930_0000163 | |||
| 1749 | Ga0373930_0006388 | |||
| 1750 | Ga0373950_0013101 | |||
| 1751 | Ga0373958_0000109 | |||
| 1752 | Ga0373958_0003895 | |||
| 1753 | Ga0373959_0002173 | |||
| 1754 | Ga0373938_0000044 | |||
| 1755 | Ga0373938_0003249 | |||
| 1756 | Ga0373926_0003841 | |||
| 1757 | Ga0373928_0000075 | |||
| 1758 | Ga0373928_0051340 | |||
| 1759 | Ga0373929_0000561 | |||
| 1760 | Ga0373929_0000913 | |||
| 1761 | Ga0373940_0000513 | |||
| 1762 | Ga0373944_0002147 | |||
| 1763 | Ga0373949_0002004 | |||
| 1764 | Ga0373951_0000281 | |||
| 1765 | Ga0373951_0023601 | |||
| 1766 | Ga0373952_0000436 | |||
| 1767 | Ga0373923_0025274 | |||
| 1768 | Ga0373932_0000556 | |||
| 1769 | Ga0373936_0004573 | |||
| 1770 | Ga0373936_0009683 | |||
| 1771 | Ga0373939_0000729 | |||
| 1772 | Ga0373939_0001537 | |||
| 1773 | Ga0373941_0001036 | |||
| 1774 | Ga0373941_0001456 | |||
| 1775 | Ga0373941_0003931 | |||
| 1776 | Ga0373941_0058517 | |||
| 1777 | Ga0373956_0025524 | |||
| 1778 | Ga0373956_0069572 | |||
| 1779 | Ga0373960_0025673 | |||
| 1780 | Ga0373943_0003484 | |||
| 1781 | Ga0373943_0011935 | |||
| 1782 | Ga0373943_0017879 | |||
| 1783 | Ga0373943_0111102 | |||
| 1784 | Ga0373943_0127027 | |||
| 1785 | Ga0373946_0003127 | |||
| 1786 | Ga0373946_0019849 | |||
| 1787 | Ga0373955_0002113 | |||
| 1788 | Ga0373955_0009210 | |||
| 1789 | Ga0373942_0000621 | |||
| 1790 | Ga0373942_0005551 | |||
| 1791 | Ga0373961_0000705 | |||
| 1792 | Ga0373962_0001033 | |||
| 1793 | Ga0373962_0001884 | |||
| 1794 | Ga0373931_0003327 | |||
| 1795 | Ga0373931_0004025 | |||
| 1796 | Ga0373931_0024509 | |||
| 1797 | Ga0373931_0024825 | |||
| 1798 | Ga0373931_0025471 | |||
| 1799 | Ga0373935_0015609 | |||
| 1800 | Ga0373935_0089069 | |||
| 1801 | Ga0373935_0138618 | |||
| 1802 | Ga0373927_0035352 | |||
| 1803 | Ga0373927_0108610 | |||
| 1804 | Ga0373927_0155169 | |||
| 1805 | Ga0373927_0245168 | |||
| 1806 | Ga0373933_0028322 | |||
| 1807 | Ga0373933_0065729 | |||
| 1808 | Ga0373933_0068472 | |||
| 1809 | Ga0373933_0117556 | |||
| 1810 | Ga0373933_0252441 | |||
| 1811 | Ga0373947_0007492 | |||
| 1812 | Ga0373937_0001983 | |||
| 1813 | Ga0373937_0017808 | |||
| 1814 | Ga0373937_0074139 | |||
| 1815 | Ga0373937_0181747 | |||
| 1816 | Ga0316582_0029931 | |||
| 1817 | Ga0373925_0007864 | |||
| 1818 | Ga0373925_0009628 | |||
| 1819 | Ga0373925_0017870 | |||
| 1820 | Ga0373925_0247677 | |||
| 1821 | Ga0395900_0163341 | |||
| 1822 | Ga0395900_0233383 | |||
| 1823 | Ga0395898_0037642 | |||
| 1824 | Ga0395898_0109257 | |||
| 1825 | Ga0395898_0149122 | |||
| 1826 | Ga0436364_1140333 | |||
| 1827 | Ga0395901_0174288 | |||
| 1828 | Ga0242420_003562 | |||
| 1829 | Ga0436365_0106793 | |||
| 1830 | Ga0436365_0457267 | |||
| 1831 | Ga0436365_0713236 | |||
| 1832 | Ga0436365_0995234 | |||
| 1833 | Ga0436365_1234286 | |||
| 1834 | Ga0436365_1335625 | |||
| 1835 | Ga0436365_1503980 | |||
| 1836 | Ga0436362_1200667 | |||
| 1837 | Ga0439453_0016835 | |||
| 1838 | Ga0439434_0057662 | |||
| 1839 | Ga0439435_0038188 | |||
| 1840 | Ga0451577_0042708 | |||
| 1841 | Ga0466961_0058815 | |||
| 1842 | Ga0466961_0240721 | |||
| 1843 | Ga0466963_0051507 | |||
| 1844 | Ga0466963_0099238 | |||
| 1845 | Ga0466968_0087836 | |||
| 1846 | Ga0466957_0062480 | |||
| 1847 | Ga0466957_0063788 | |||
| 1848 | Ga0466957_0195324 | |||
| 1849 | Ga0466959_0043859 | |||
| 1850 | Ga0466959_0082414 | |||
| 1851 | Ga0451576_0015043 | |||
| 1852 | Ga0466967_0022056 | |||
| 1853 | Ga0495592_0001227 | |||
| 1854 | Ga0495592_0028308 | |||
| 1855 | Ga0495592_0240258 | |||
| 1856 | Ga0495629_0006223 | |||
| 1857 | Ga0495629_0021624 | |||
| 1858 | Ga0495629_0032196 | |||
| 1859 | Ga0495629_0036482 | |||
| 1860 | Ga0495651_0000661 | |||
| 1861 | Ga0495651_0040822 | |||
| 1862 | Ga0495651_0263308 | |||
| 1863 | Ga0495653_0001029 | |||
| 1864 | Ga0495653_0043769 | |||
| 1865 | Ga0495653_0172224 | |||
| 1866 | Ga0495580_0017620 | |||
| 1867 | Ga0495580_0049602 | |||
| 1868 | Ga0495580_0144409 | |||
| 1869 | Ga0495582_0018382 | |||
| 1870 | Ga0495582_0026546 | |||
| 1871 | Ga0495582_0126937 | |||
| 1872 | Ga0495582_0185100 | |||
| 1873 | Ga0495639_0021824 | |||
| 1874 | Ga0495639_0055269 | |||
| 1875 | Ga0495662_0001450 | |||
| 1876 | Ga0495662_0019329 | |||
| 1877 | Ga0495662_0024645 | |||
| 1878 | Ga0495664_0000364 | |||
| 1879 | Ga0495664_0045216 | |||
| 1880 | Ga0495585_0003727 | |||
| 1881 | Ga0495585_0019697 | |||
| 1882 | Ga0495608_0002135 | |||
| 1883 | Ga0495608_0010859 | |||
| 1884 | Ga0495608_0078462 | |||
| 1885 | Ga0495608_0097985 | |||
| 1886 | Ga0495618_0014406 | |||
| 1887 | Ga0495618_0132842 | |||
| 1888 | Ga0495618_0265671 | |||
| 1889 | Ga0495628_0003003 | |||
| 1890 | Ga0495628_0007741 | |||
| 1891 | Ga0495628_0054407 | |||
| 1892 | Ga0495628_0068012 | |||
| 1893 | Ga0495630_0005321 | |||
| 1894 | Ga0495630_0048437 | |||
| 1895 | Ga0495644_0001708 | |||
| 1896 | Ga0495663_0038693 | |||
| 1897 | Ga0495666_0006389 | |||
| 1898 | Ga0495652_0001763 | |||
| 1899 | Ga0495652_0005848 | |||
| 1900 | Ga0495652_0078225 | |||
| 1901 | Ga0495665_0062128 | |||
| 1902 | Ga0495665_0158744 | |||
| 1903 | Ga0495640_0001062 | |||
| 1904 | Ga0495640_0006334 | |||
| 1905 | Ga0495640_0081111 | |||
| 1906 | Ga0495586_0047016 | |||
| 1907 | Ga0495587_0000339 | |||
| 1908 | Ga0495587_0016313 | |||
| 1909 | Ga0495587_0028392 | |||
| 1910 | Ga0495645_0004632 | |||
| 1911 | Ga0495645_0023936 | |||
| 1912 | Ga0495633_0031217 | |||
| 1913 | Ga0495667_0006028 | |||
| 1914 | Ga0495667_0013521 | |||
| 1915 | Ga0495667_0163879 | |||
| 1916 | Ga0495668_0185417 | |||
| 1917 | Ga0495634_0001363 | |||
| 1918 | Ga0495634_0006327 | |||
| 1919 | Ga0495634_0008637 | |||
| 1920 | Ga0495634_0026669 | |||
| 1921 | Ga0495634_0068240 | |||
| 1922 | Ga0495635_0000813 | |||
| 1923 | Ga0495635_0001322 | |||
| 1924 | Ga0495635_0039347 | |||
| 1925 | Ga0495635_0066125 | |||
| 1926 | Ga0495635_0129470 | |||
| 1927 | Ga0495661_0109233 | |||
| 1928 | Ga0495588_0007311 | |||
| 1929 | Ga0495657_0003526 | |||
| 1930 | Ga0495657_0092733 | |||
| 1931 | Ga0495599_0032392 | |||
| 1932 | Ga0495599_0048669 | |||
| 1933 | Ga0495599_0153719 | |||
| 1934 | Ga0495623_0011272 | |||
| 1935 | Ga0495623_0030566 | |||
| 1936 | Ga0495646_0016867 | |||
| 1937 | Ga0495647_0001559 | |||
| 1938 | Ga0495658_0032134 | |||
| 1939 | Ga0495658_0091158 | |||
| 1940 | Ga0495658_0181069 | |||
| 1941 | Ga0495613_0029898 | |||
| 1942 | Ga0495613_0057490 | |||
| 1943 | Ga0495624_0025722 | |||
| 1944 | Ga0495624_0036751 | |||
| 1945 | Ga0495670_0018272 | |||
| 1946 | Ga0495649_0020109 | |||
| 1947 | Ga0495600_0000568 | |||
| 1948 | Ga0495600_0003882 | |||
| 1949 | Ga0495600_0005746 | |||
| 1950 | Ga0495600_0104072 | |||
| 1951 | Ga0495604_0001130 | |||
| 1952 | Ga0495604_0029420 | |||
| 1953 | Ga0495604_0086523 | |||
| 1954 | Ga0495604_0218067 | |||
| 1955 | Ga0495674_0002947 | |||
| 1956 | Ga0495674_0011063 | |||
| 1957 | Ga0495674_0072102 | |||
| 1958 | Ga0495674_0213365 | |||
| 1959 | Ga0495680_0085519 | |||
| 1960 | Ga0495680_0103288 | |||
| 1961 | Ga0495680_0175491 | |||
| 1962 | Ga0495675_0005425 | |||
| 1963 | Ga0495677_0118380 | |||
| 1964 | Ga0495684_0000075 | |||
| 1965 | Ga0495684_0003709 | |||
| 1966 | Ga0495684_0016814 | |||
| 1967 | Ga0495684_0025902 | |||
| 1968 | Ga0495684_0097810 | |||
| 1969 | Ga0495684_0156495 | |||
| 1970 | Ga0495593_0061081 | |||
| 1971 | Ga0495593_0075442 | |||
| 1972 | Ga0495602_0000961 | |||
| 1973 | Ga0495602_0011124 | |||
| 1974 | Ga0495602_0152867 | |||
| 1975 | Ga0495614_0066554 | |||
| 1976 | Ga0496100_0005647 | |||
| 1977 | Ga0496100_0006368 | |||
| 1978 | Ga0496100_0010870 | |||
| 1979 | Ga0496100_0020419 | |||
| 1980 | Ga0496100_0070628 | |||
| 1981 | Ga0496101_0000546 | |||
| 1982 | Ga0496101_0001493 | |||
| 1983 | Ga0496101_0002221 | |||
| 1984 | Ga0496101_0020971 | |||
| 1985 | Ga0496102_0001781 | |||
| 1986 | Ga0496102_0009878 | |||
| 1987 | Ga0496102_0022952 | |||
| 1988 | Ga0496102_0045105 | |||
| 1989 | Ga0496102_0089160 | |||
| 1990 | Ga0496102_0089579 | |||
| 1991 | Ga0496102_0212970 | |||
| 1992 | Ga0496103_0001408 | |||
| 1993 | Ga0496103_0008195 | |||
| 1994 | Ga0496103_0030002 | |||
| 1995 | Ga0496103_0032222 | |||
| 1996 | Ga0496103_0152960 | |||
| 1997 | Ga0496104_0000061 | |||
| 1998 | Ga0496104_0001668 | |||
| 1999 | Ga0496104_0003575 | |||
| 2000 | Ga0496104_0041734 | |||
| 2001 | Ga0496104_0066397 | |||
| 2002 | Ga0496104_0084840 | |||
| 2003 | Ga0496104_0088102 | |||
| 2004 | Ga0496104_0123032 | |||
| 2005 | Ga0496104_0136511 | |||
| 2006 | Ga0496104_0179074 | |||
| 2007 | Ga0496105_0001465 | |||
| 2008 | Ga0496105_0003662 | |||
| 2009 | Ga0496105_0008016 | |||
| 2010 | Ga0496105_0010336 | |||
| 2011 | Ga0496105_0227856 | |||
| 2012 | Ga0496106_0001113 | |||
| 2013 | Ga0496106_0001992 | |||
| 2014 | Ga0496106_0004790 | |||
| 2015 | Ga0496106_0009427 | |||
| 2016 | Ga0496106_0044366 | |||
| 2017 | Ga0496106_0054703 | |||
| 2018 | Ga0496107_0002763 | |||
| 2019 | Ga0496107_0007523 | |||
| 2020 | Ga0496107_0029402 | |||
| 2021 | Ga0496107_0121018 | |||
| 2022 | Ga0496107_0255320 | |||
| 2023 | Ga0496108_0005596 | |||
| 2024 | Ga0496108_0013672 | |||
| 2025 | Ga0496108_0019991 | |||
| 2026 | Ga0496108_0051926 | |||
| 2027 | Ga0496108_0076111 | |||
| 2028 | Ga0496108_0305319 | |||
| 2029 | Ga0496109_0003609 | |||
| 2030 | Ga0496109_0007566 | |||
| 2031 | Ga0496109_0008250 | |||
| 2032 | Ga0496109_0022690 | |||
| 2033 | Ga0496109_0123936 | |||
| 2034 | Ga0496109_0150856 | |||
| 2035 | Ga0496109_0205265 | |||
| 2036 | Ga0496109_0517239 | |||
| 2037 | Ga0496110_0022948 | |||
| 2038 | Ga0496110_0023702 | |||
| 2039 | Ga0496110_0027700 | |||
| 2040 | Ga0496110_0048177 | |||
| 2041 | Ga0496110_0134332 | |||
| 2042 | Ga0496110_0156749 | |||
| 2043 | Ga0496111_0001147 | |||
| 2044 | Ga0496111_0048639 | |||
| 2045 | Ga0496112_0000320 | |||
| 2046 | Ga0496112_0014243 | |||
| 2047 | Ga0496112_0017770 | |||
| 2048 | Ga0496112_0173897 | |||
| 2049 | Ga0496112_0250113 | |||
| 2050 | Ga0496112_0633654 | |||
| 2051 | Ga0496113_0001355 | |||
| 2052 | Ga0496113_0017914 | |||
| 2053 | Ga0496113_0038012 | |||
| 2054 | Ga0496113_0058187 | |||
| 2055 | Ga0496114_0004710 | |||
| 2056 | Ga0496114_0023421 | |||
| 2057 | Ga0496114_0074900 | |||
| 2058 | Ga0496115_0013034 | |||
| 2059 | Ga0496115_0014471 | |||
| 2060 | Ga0496115_0019748 | |||
| 2061 | Ga0496115_0033471 | |||
| 2062 | Ga0496115_0059396 | |||
| 2063 | Ga0501031_0128852 | |||
| 2064 | Ga0501032_0034378 | |||
| 2065 | Ga0501032_0039313 | |||
| 2066 | Ga0501033_0024529 | |||
| 2067 | Ga0501033_0094249 | |||
| 2068 | Ga0501034_0000994 | |||
| 2069 | Ga0501034_0028437 | |||
| 2070 | Ga0501034_0044874 | |||
| 2071 | Ga0501034_0143131 | |||
| 2072 | Ga0501036_0006289 | |||
| 2073 | Ga0501036_0018260 | |||
| 2074 | Ga0501036_0235265 | |||
| 2075 | Ga0501037_0024831 | |||
| 2076 | Ga0501037_0087457 | |||
| 2077 | Ga0501037_0092803 | |||
| 2078 | Ga0501038_0004102 | |||
| 2079 | Ga0501038_0018601 | |||
| 2080 | Ga0501038_0135375 | |||
| 2081 | Ga0501038_0294533 | |||
| 2082 | Ga0501039_0033993 | |||
| 2083 | Ga0501039_0093456 | |||
| 2084 | Ga0501040_0072904 | |||
| 2085 | Ga0501040_0077521 | |||
| 2086 | Ga0501040_0226647 | |||
| 2087 | Ga0501043_0012441 | |||
| 2088 | Ga0501043_0028758 | |||
| 2089 | Ga0501043_0032442 | |||
| 2090 | Ga0501043_0048955 | |||
| 2091 | Ga0501046_0008307 | |||
| 2092 | Ga0501046_0049541 | |||
| 2093 | Ga0501046_0151411 | |||
| 2094 | Ga0501046_0189229 | |||
| 2095 | Ga0501047_0000659 | |||
| 2096 | Ga0501047_0006456 | |||
| 2097 | Ga0501047_0058466 | |||
| 2098 | Ga0501047_0116873 | |||
| 2099 | Ga0501047_0304826 | |||
| 2100 | Ga0501048_0019853 | |||
| 2101 | Ga0501048_0046366 | |||
| 2102 | Ga0501067_0037391 | |||
| 2103 | Ga0501067_0093105 | |||
| 2104 | Ga0501068_0004565 | |||
| 2105 | Ga0501068_0200865 | |||
| 2106 | Ga0501069_0001905 | |||
| 2107 | Ga0501069_0012024 | |||
| 2108 | Ga0501069_0043531 | |||
| 2109 | Ga0501069_0087480 | |||
| 2110 | Ga0501070_0012950 | |||
| 2111 | Ga0501070_0013312 | |||
| 2112 | Ga0501070_0054239 | |||
| 2113 | Ga0501070_0086090 | |||
| 2114 | Ga0501070_0092483 | |||
| 2115 | Ga0501071_0000889 | |||
| 2116 | Ga0501071_0155575 | |||
| 2117 | Ga0501071_0263813 | |||
| 2118 | Ga0501071_0393404 | |||
| 2119 | Ga0501072_0028671 | |||
| 2120 | Ga0501072_0036785 | |||
| 2121 | Ga0501072_0068853 | |||
| 2122 | Ga0501072_0188738 | |||
| 2123 | Ga0501073_0009892 | |||
| 2124 | Ga0501073_0012757 | |||
| 2125 | Ga0501073_0014945 | |||
| 2126 | Ga0501073_0047522 | |||
| 2127 | Ga0501074_0001224 | |||
| 2128 | Ga0501074_0009389 | |||
| 2129 | Ga0501074_0015569 | |||
| 2130 | Ga0501074_0098080 | |||
| 2131 | Ga0501075_0035666 | |||
| 2132 | Ga0501076_0070557 | |||
| 2133 | Ga0501076_0082137 | |||
| 2134 | Ga0501076_0324052 | |||
| 2135 | Ga0501077_0009190 | |||
| 2136 | Ga0501077_0019113 | |||
| 2137 | Ga0501077_0112722 | |||
| 2138 | Ga0501077_0130568 | |||
| 2139 | Ga0501079_0038441 | |||
| 2140 | Ga0501079_0116246 | |||
| 2141 | Ga0501080_0000406 | |||
| 2142 | Ga0501080_0046258 | |||
| 2143 | Ga0501080_0064255 | |||
| 2144 | Ga0501080_0142880 | |||
| 2145 | Ga0501080_0209308 | |||
| 2146 | Ga0501081_0004836 | |||
| 2147 | Ga0501081_0006251 | |||
| 2148 | Ga0501083_0000497 | |||
| 2149 | Ga0501083_0026846 | |||
| 2150 | Ga0501083_0044417 | |||
| 2151 | Ga0501083_0079706 | |||
| 2152 | Ga0501035_0005717 | |||
| 2153 | Ga0501035_0012534 | |||
| 2154 | Ga0501035_0051269 | |||
| 2155 | Ga0501044_0000260 | |||
| 2156 | Ga0501044_0268741 | |||
| 2157 | Ga0501045_0066270 | |||
| 2158 | Ga0501045_0067881 | |||
| 2159 | Ga0501045_0174144 | |||
| 2160 | Ga0501045_0227312 | |||
| 2161 | Ga0501045_0252446 | |||
| 2162 | nmdc:mga03n38_85540_c1 | |||
| 2163 | nmdc:mga0yw44_41036_c1 | |||
| 2164 | nmdc:mga0yw44_50014_c1 | |||
| 2165 | nmdc:mga0yw44_72288_c1 | |||
| 2166 | nmdc:mga0k408_2679_c1 | |||
| 2167 | nmdc:mga07m45_36008_c1 | |||
| 2168 | nmdc:mga05p37_29092_c1 | |||
| 2169 | nmdc:mga05p37_30389_c1 | |||
| 2170 | nmdc:mga05p37_52025_c1 | |||
| 2171 | nmdc:mga09592_149403_c1 | |||
| 2172 | nmdc:mga09592_15144_c1 | |||
| 2173 | nmdc:mga09592_15888_c1 | |||
| 2174 | nmdc:mga09592_23614_c1 | |||
| 2175 | nmdc:mga0qj67_16351_c1 | |||
| 2176 | nmdc:mga0qj67_219_c1 | |||
| 2177 | nmdc:mga0qj67_38298_c1 | |||
| 2178 | nmdc:mga0qj67_9429_c1 | |||
| 2179 | nmdc:mga06r32_19261_c1 | |||
| 2180 | nmdc:mga06r32_269143_c1 | |||
| 2181 | nmdc:mga06r32_300291_c1 | |||
| 2182 | nmdc:mga06r32_33398_c1 | |||
| 2183 | nmdc:mga06r32_3354_c1 | |||
| 2184 | nmdc:mga06r32_35431_c1 | |||
| 2185 | nmdc:mga08y16_100943_c1 | |||
| 2186 | nmdc:mga08y16_148034_c1 | |||
| 2187 | nmdc:mga08y16_15457_c1 | |||
| 2188 | nmdc:mga08y16_199413_c1 | |||
| 2189 | nmdc:mga08y16_203019_c1 | |||
| 2190 | nmdc:mga08y16_36679_c1 | |||
| 2191 | nmdc:mga08y16_513316_c1 | |||
| 2192 | nmdc:mga08y16_59066_c1 | |||
| 2193 | nmdc:mga0n895_14993_c1 | |||
| 2194 | nmdc:mga0n895_30924_c1 | |||
| 2195 | nmdc:mga0n895_59427_c1 | |||
| 2196 | nmdc:mga0rr50_120532_c1 | |||
| 2197 | nmdc:mga0rr50_13944_c1 | |||
| 2198 | nmdc:mga08x19_84104_c1 | |||
| 2199 | nmdc:mga0a205_2194_c1 | |||
| 2200 | nmdc:mga0a205_478926_c1 | |||
| 2201 | nmdc:mga0a205_69021_c1 | |||
| 2202 | nmdc:mga0a205_98737_c1 | |||
| 2203 | Ga0495601_0000153 | |||
| 2204 | Ga0495601_0000924 | |||
| 2205 | Ga0495601_0003815 | |||
| 2206 | Ga0495601_0005347 | |||
| 2207 | Ga0495601_0088642 | |||
| 2208 | Ga0495601_0094744 | |||
| 2209 | Ga0495612_0001641 | |||
| 2210 | Ga0495612_0004940 | |||
| 2211 | Ga0495612_0009449 | |||
| 2212 | Ga0495612_0010177 | |||
| 2213 | Ga0495612_0015909 | |||
| 2214 | Ga0495655_0024730 | |||
| 2215 | Ga0495595_0001072 | |||
| 2216 | Ga0495595_0008421 | |||
| 2217 | Ga0495595_0020239 | |||
| 2218 | Ga0495595_0033278 | |||
| 2219 | Ga0495595_0042888 | |||
| 2220 | Ga0495619_0001259 | |||
| 2221 | Ga0495619_0003278 | |||
| 2222 | Ga0495619_0004023 | |||
| 2223 | Ga0495619_0011833 | |||
| 2224 | Ga0495619_0033058 | |||
| 2225 | Ga0495619_0046270 | |||
| 2226 | Ga0495619_0066068 | |||
| 2227 | Ga0495619_0096294 | |||
| 2228 | Ga0500643_007922 | |||
| 2229 | Ga0500644_0000537 | |||
| 2230 | Ga0500651_0015314 | |||
| 2231 | Ga0500566_0049155 | |||
| 2232 | Ga0500593_014669 | |||
| 2233 | Ga0500594_0037817 | |||
| 2234 | Ga0500595_000001 | |||
| 2235 | Ga0500642_0112683 | |||
| 2236 | Ga0500652_002646 | |||
| 2237 | Ga0500568_0083565 | |||
| 2238 | Ga0500616_0000001 | |||
| 2239 | Ga0500616_0003402 | |||
| 2240 | Ga0500616_0042777 | |||
| 2241 | Ga0500616_0072775 | |||
| 2242 | Ga0500616_0075225 | |||
| 2243 | Ga0500627_0013903 | |||
| 2244 | Ga0500645_000619 | |||
| 2245 | Ga0501084_0034551 | |||
| 2246 | Ga0501084_0038965 | |||
| 2247 | Ga0501084_0064578 | |||
| 2248 | Ga0501084_0375554 | |||
| 2249 | Ga0501082_0071690 | |||
| 2250 | Ga0501082_0084220 | |||
| 2251 | Ga0501082_0088494 | |||
| 2252 | Ga0501082_0148127 | |||
| 2253 | Ga0501082_0293249 | |||
| 2254 | Ga0466962_0045933 | |||
| 2255 | Ga0530510_0041307 | |||
| 2256 | Ga0530510_0215897 | |||
| 2257 | Ga0530510_0288136 | |||
| 2258 | 2643758437 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5671 | 8 | 298 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.5546 | 8 | 298 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4968 | 8 | 300 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4884 | 8 | 300 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.4626 | 34 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8292 | 34 | 298 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8149 | 34 | 298 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8065 | 34 | 301 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7982 | 34 | 301 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.793 | 34 | 298 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7PIH4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9886 | 33 | 308 |
GO:0005886
GO:0015658 |
| AF-A0A1E3ZFE7-F1-model_v4 | deleted | 0.9874 | 6 | 315 |
|
| AF-A0A315BRP5-F1-model_v4 | deleted | 0.9869 | 1 | 309 |
|
| AF-A0A2E7I3F3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9863 | 16 | 314 |
GO:0005886
GO:0015658 |
| AF-A0A3B9V0U3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9853 | 1 | 276 |
GO:0005886
GO:0015658 |