F490482

General Info

Members Datasets Scaffolds Average Seq Length
1126 384 1113 252

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100042126|Ga0307409_1000421263
Length 281
Sequence VSVEVIRAGCLQGVTHGFLGRRGGVSTGEMAGLNVGTGSSDDREAIAENRRRAVAAVLPGAELATVHQVHSAVAVAVEKPWPHEQRPHADALVTDRPGLLLGVLTADCAPVLLAXAEAGWRGAIGGVTDAAIAEMERLGARRERIAAAVGPCIAQASYEVDEGFRERFIAEDAANARFFAEGPRFDLEGYVASRLAAAGIDRVEPLSLDTYADPERFFSYRRATHRGEADYGRQIALIGLSACRPRGRACGVAWRRSSRCWRFQRPRACRRRRGRPARSSC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
7 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
8 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
9 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
10 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
11 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
12 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
259 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
260 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
261 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
262 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
263 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
264 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
265 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
349 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
361 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
364 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
367 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
373 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
374 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
384 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.09
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 0.18
Rhizoplane 2.31
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1105262 2162886007 Bacteria 7671
2 SwRhRL2b_contig_3318283 2162886007 Bacteria 39515
3 JGI24736J21556_1003886 3300001904 Bacteria 2573
4 JGI24741J21665_1000617 3300001915 Bacteria 10730
5 JGI24741J21665_1002803 3300001915 Bacteria 4394
6 JGI24740J21852_10000474 3300001979 Bacteria 17287
7 JGI24740J21852_10003183 3300001979 Bacteria 7247
8 JGI24740J21852_10004741 3300001979 Bacteria 5812
9 JGI24740J21852_10010219 3300001979 Bacteria 3627
10 JGI24740J21852_10024992 3300001979 Bacteria 2019
11 JGI24740J21852_10026015 3300001979 Bacteria 1965
12 JGI24739J22299_10000035 3300001989 Bacteria 37844
13 JGI24739J22299_10001730 3300001989 Bacteria 8302
14 JGI24739J22299_10002626 3300001989 Bacteria 6925
15 JGI24739J22299_10002884 3300001989 Bacteria 6601
16 JGI24739J22299_10040361 3300001989 Bacteria 1558
17 JGI24737J22298_10000020 3300001990 Bacteria 46324
18 JGI24737J22298_10000167 3300001990 Bacteria 21119
19 JGI24737J22298_10002252 3300001990 Bacteria 6874
20 JGI24737J22298_10030293 3300001990 Bacteria 1693
21 JGI24743J22301_10021275 3300001991 Bacteria 1238
22 JGI24735J21928_10017959 3300002067 Bacteria 2185
23 JGI24735J21928_10054526 3300002067 Bacteria 1152
24 JGI24735J21928_10060453 3300002067 Bacteria 1089
25 JGI24738J21930_10000050 3300002075 Bacteria 24055
26 JGI24738J21930_10004991 3300002075 Bacteria 3210
27 JGI24742J22300_10007668 3300002244 Bacteria 1782
28 JGI25150J39212_1000658 3300002774 Bacteria 12817
29 JGI25165J46597_1000071 3300003214 Bacteria 193222
30 JGI25153J46596_10000008 3300003215 Bacteria 376808
31 JGI25153J46596_10000183 3300003215 Bacteria 61802
32 rootL2_10167713 3300003322 Bacteria 1909
33 rootL2_10211840 3300003322 Bacteria 2618
34 rootH1_10310960 3300003323 Bacteria 1190
35 Ga0055542_1000038 3300003762 Bacteria 224625
36 Ga0055529_1000002 3300003763 Bacteria 537914
37 Ga0055529_1000021 3300003763 Bacteria 321484
38 Ga0055526_1007617 3300003771 Bacteria 5587
39 Ga0055537_1003499 3300003773 Bacteria 4811
40 Ga0055530_10034994 3300003791 Bacteria 1278
41 Ga0055530_10037292 3300003791 Bacteria 1217
42 Ga0055530_10043565 3300003791 Bacteria 1081
43 Ga0055540_1006104 3300003792 Bacteria 4858
44 Ga0055531_10043203 3300003794 Bacteria 1278
45 Ga0055531_10045520 3300003794 Bacteria 1217
46 Ga0065165_1004893 3300005262 Bacteria 7917
47 Ga0065704_10006528 3300005289 Bacteria 4147
48 Ga0065704_10070200 3300005289 Bacteria 89591
49 Ga0065712_10131800 3300005290 Bacteria 1541
50 Ga0070658_10000246 3300005327 Bacteria 48141
51 Ga0070658_10001377 3300005327 Bacteria 20794
52 Ga0070658_10003252 3300005327 Bacteria 13413
53 Ga0070658_10009024 3300005327 Bacteria 8020
54 Ga0070658_10038444 3300005327 Bacteria 3859
55 Ga0070658_10142169 3300005327 Bacteria 2005
56 Ga0070658_10186874 3300005327 Bacteria 1745
57 Ga0070658_10345275 3300005327 Bacteria 1273
58 Ga0070676_10003530 3300005328 Bacteria 8176
59 Ga0070676_10025705 3300005328 Bacteria 3329
60 Ga0070676_10034049 3300005328 Bacteria 2923
61 Ga0070683_100020418 3300005329 Bacteria 5895
62 Ga0070683_100079286 3300005329 Bacteria 3073
63 Ga0070683_100492938 3300005329 Bacteria 1170
64 Ga0070690_100156555 3300005330 Bacteria 1558
65 Ga0070670_100007537 3300005331 Bacteria 9237
66 Ga0070670_100014177 3300005331 Bacteria 6839
67 Ga0070670_100016985 3300005331 Bacteria 6248
68 Ga0070670_100105231 3300005331 Bacteria 2431
69 Ga0070670_100160248 3300005331 Bacteria 1950
70 Ga0070670_100272071 3300005331 Bacteria 1478
71 Ga0070670_100526559 3300005331 Bacteria 1053
72 Ga0070677_10012331 3300005333 Bacteria 2968
73 Ga0070677_10021855 3300005333 Bacteria 2351
74 Ga0068869_100000043 3300005334 Bacteria 52392
75 Ga0070666_10000090 3300005335 Bacteria 64025
76 Ga0070666_10102257 3300005335 Bacteria 1976
77 Ga0070680_100001376 3300005336 Bacteria 17581
78 Ga0070680_100260340 3300005336 Bacteria 1467
79 Ga0070682_100079366 3300005337 Bacteria 2119
80 Ga0070682_100183702 3300005337 Bacteria 1463
81 Ga0068868_100000019 3300005338 Bacteria 92673
82 Ga0068868_100001402 3300005338 Bacteria 16620
83 Ga0068868_100096446 3300005338 Bacteria 2389
84 Ga0070660_100000415 3300005339 Bacteria 28402
85 Ga0070660_100014625 3300005339 Bacteria 5661
86 Ga0070660_100057475 3300005339 Bacteria 3013
87 Ga0070660_100061033 3300005339 Bacteria 2927
88 Ga0070660_100064868 3300005339 Bacteria 2842
89 Ga0070660_100092138 3300005339 Bacteria 2392
90 Ga0070660_100133185 3300005339 Bacteria 1990
91 Ga0070660_100154406 3300005339 Bacteria 1847
92 Ga0070687_100451623 3300005343 Bacteria 855
93 Ga0070661_100020380 3300005344 Bacteria 4727
94 Ga0070661_100159766 3300005344 Bacteria 1706
95 Ga0070661_100183768 3300005344 Bacteria 1592
96 Ga0070661_100350579 3300005344 Bacteria 1158
97 Ga0070692_10036243 3300005345 Bacteria 2502
98 Ga0070692_10115747 3300005345 Bacteria 1489
99 Ga0070668_100000062 3300005347 Bacteria 66612
100 Ga0070668_100050214 3300005347 Bacteria 3211
101 Ga0070668_100075301 3300005347 Bacteria 2635
102 Ga0070668_100183067 3300005347 Bacteria 1712
103 Ga0070669_100000024 3300005353 Bacteria 173107
104 Ga0070669_100000209 3300005353 Bacteria 48982
105 Ga0070669_100015859 3300005353 Bacteria 5375
106 Ga0070669_100017883 3300005353 Bacteria 5061
107 Ga0070669_100185643 3300005353 Bacteria 1629
108 Ga0070675_100016633 3300005354 Bacteria 5840
109 Ga0070675_100053030 3300005354 Bacteria 3335
110 Ga0070675_100184593 3300005354 Bacteria 1805
111 Ga0070675_100201011 3300005354 Bacteria 1729
112 Ga0070671_100000006 3300005355 Bacteria 250635
113 Ga0070671_100000174 3300005355 Bacteria 42612
114 Ga0070671_100005122 3300005355 Bacteria 10439
115 Ga0070671_100016942 3300005355 Bacteria 5894
116 Ga0070671_100023916 3300005355 Bacteria 4999
117 Ga0070671_100077682 3300005355 Bacteria 2775
118 Ga0070671_100167379 3300005355 Bacteria 1859
119 Ga0070671_100178291 3300005355 Bacteria 1798
120 Ga0070671_100305719 3300005355 Bacteria 1354
121 Ga0070671_100314227 3300005355 Bacteria 1335
122 Ga0070674_100000168 3300005356 Bacteria 30513
123 Ga0070674_100214774 3300005356 Bacteria 1493
124 Ga0070673_100000440 3300005364 Bacteria 21943
125 Ga0070673_100032130 3300005364 Bacteria 3947
126 Ga0070673_100161375 3300005364 Bacteria 1907
127 Ga0070673_100634640 3300005364 Bacteria 976
128 Ga0070659_100000009 3300005366 Bacteria 203891
129 Ga0070659_100000903 3300005366 Bacteria 21708
130 Ga0070659_100010016 3300005366 Bacteria 6976
131 Ga0070659_100038415 3300005366 Bacteria 3734
132 Ga0070659_100054821 3300005366 Bacteria 3141
133 Ga0070659_100070355 3300005366 Bacteria 2779
134 Ga0070659_100098436 3300005366 Bacteria 2352
135 Ga0070659_100117957 3300005366 Bacteria 2146
136 Ga0070659_100165523 3300005366 Bacteria 1809
137 Ga0070659_100197877 3300005366 Bacteria 1653
138 Ga0070667_100000160 3300005367 Bacteria 83754
139 Ga0070667_100002316 3300005367 Bacteria 16687
140 Ga0070667_100020111 3300005367 Bacteria 5542
141 Ga0070667_100235550 3300005367 Bacteria 1633
142 Ga0070667_100235951 3300005367 Bacteria 1632
143 Ga0070667_100239281 3300005367 Bacteria 1620
144 Ga0070667_100256563 3300005367 Bacteria 1564
145 Ga0070667_100484995 3300005367 Bacteria 1132
146 Ga0070667_100609669 3300005367 Bacteria 1006
147 Ga0070709_10070530 3300005434 Bacteria 2253
148 Ga0070714_100022690 3300005435 Bacteria 5148
149 Ga0070705_100257571 3300005440 Bacteria 1228
150 Ga0070708_100414317 3300005445 Bacteria 1271
151 Ga0070663_100084211 3300005455 Bacteria 2343
152 Ga0070663_100239551 3300005455 Bacteria 1431
153 Ga0070663_100382572 3300005455 Bacteria 1146
154 Ga0070678_100000122 3300005456 Bacteria 30750
155 Ga0070678_100120811 3300005456 Bacteria 2066
156 Ga0070662_100000324 3300005457 Bacteria 28542
157 Ga0070662_100004883 3300005457 Bacteria 8508
158 Ga0070662_100027482 3300005457 Bacteria 3950
159 Ga0070662_100032561 3300005457 Bacteria 3664
160 Ga0070662_100086703 3300005457 Bacteria 2342
161 Ga0070662_100088478 3300005457 Bacteria 2321
162 Ga0070662_100115832 3300005457 Bacteria 2047
163 Ga0070662_100249997 3300005457 Bacteria 1425
164 Ga0070681_10063149 3300005458 Bacteria 3676
165 Ga0070681_10090131 3300005458 Bacteria 3017
166 Ga0070681_10124657 3300005458 Bacteria 2509
167 Ga0070681_10433898 3300005458 Bacteria 1226
168 Ga0070681_10521002 3300005458 Bacteria 1102
169 Ga0070681_10599998 3300005458 Bacteria 1015
170 Ga0068867_100001209 3300005459 Bacteria 17732
171 Ga0068867_100012453 3300005459 Bacteria 6018
172 Ga0070698_100313275 3300005471 Bacteria 1500
173 Ga0070679_100000008 3300005530 Bacteria 194672
174 Ga0070679_100014028 3300005530 Bacteria 7682
175 Ga0070679_100038477 3300005530 Bacteria 4755
176 Ga0070679_100040229 3300005530 Bacteria 4651
177 Ga0070679_100304841 3300005530 Bacteria 1543
178 Ga0070679_100646299 3300005530 Bacteria 1000
179 Ga0070684_100033668 3300005535 Bacteria 4376
180 Ga0070684_100173397 3300005535 Bacteria 1959
181 Ga0070684_100257650 3300005535 Bacteria 1595
182 Ga0070684_100390431 3300005535 Bacteria 1282
183 Ga0068853_100004143 3300005539 Bacteria 11177
184 Ga0068853_100007960 3300005539 Bacteria 8500
185 Ga0068853_100008144 3300005539 Bacteria 8413
186 Ga0068853_100056439 3300005539 Bacteria 3386
187 Ga0068853_100078085 3300005539 Bacteria 2893
188 Ga0068853_100090181 3300005539 Bacteria 2694
189 Ga0068853_100102660 3300005539 Bacteria 2530
190 Ga0068853_100105004 3300005539 Bacteria 2502
191 Ga0068853_100108310 3300005539 Bacteria 2465
192 Ga0068853_100116760 3300005539 Bacteria 2376
193 Ga0068853_100136179 3300005539 Bacteria 2202
194 Ga0068853_100290209 3300005539 Bacteria 1510
195 Ga0068853_100510370 3300005539 Bacteria 1136
196 Ga0070672_100011310 3300005543 Bacteria 6225
197 Ga0070672_100275293 3300005543 Bacteria 1422
198 Ga0070672_100352458 3300005543 Bacteria 1255
199 Ga0070672_100359658 3300005543 Bacteria 1242
200 Ga0070672_100617201 3300005543 Bacteria 945
201 Ga0070686_100000059 3300005544 Bacteria 84781
202 Ga0070696_100006276 3300005546 Bacteria 7960
203 Ga0070696_100011558 3300005546 Bacteria 5915
204 Ga0070693_100093519 3300005547 Bacteria 1817
205 Ga0070693_100178794 3300005547 Bacteria 1364
206 Ga0070665_100000024 3300005548 Bacteria 374559
207 Ga0070665_100000049 3300005548 Bacteria 261123
208 Ga0070665_100000541 3300005548 Bacteria 53057
209 Ga0070665_100049678 3300005548 Bacteria 4208
210 Ga0070665_100053287 3300005548 Bacteria 4057
211 Ga0070665_100057319 3300005548 Bacteria 3906
212 Ga0070665_100557937 3300005548 Bacteria 1158
213 Ga0068855_100000780 3300005563 Bacteria 39315
214 Ga0068855_100002861 3300005563 Bacteria 21208
215 Ga0068855_100032263 3300005563 Bacteria 6254
216 Ga0068855_100064616 3300005563 Bacteria 4268
217 Ga0068855_100076235 3300005563 Bacteria 3892
218 Ga0068855_100104230 3300005563 Bacteria 3263
219 Ga0068855_100238315 3300005563 Bacteria 2034
220 Ga0070664_100000738 3300005564 Bacteria 25207
221 Ga0070664_100010085 3300005564 Bacteria 7658
222 Ga0070664_100139198 3300005564 Bacteria 2136
223 Ga0070664_100169999 3300005564 Bacteria 1933
224 Ga0070664_100242350 3300005564 Bacteria 1619
225 Ga0070664_100421340 3300005564 Bacteria 1223
226 Ga0070664_100447181 3300005564 Bacteria 1186
227 Ga0070664_100550870 3300005564 Bacteria 1066
228 Ga0068857_100001963 3300005577 Bacteria 16623
229 Ga0068857_100016345 3300005577 Bacteria 6501
230 Ga0068857_100019067 3300005577 Bacteria 6020
231 Ga0068857_100482959 3300005577 Bacteria 1161
232 Ga0068854_100004099 3300005578 Bacteria 9155
233 Ga0068854_100025243 3300005578 Bacteria 4077
234 Ga0068854_100072441 3300005578 Bacteria 2523
235 Ga0068854_100075843 3300005578 Bacteria 2470
236 Ga0068854_100325360 3300005578 Bacteria 1251
237 Ga0068856_100034050 3300005614 Bacteria 4989
238 Ga0068856_100085893 3300005614 Bacteria 3126
239 Ga0068852_100000562 3300005616 Bacteria 24464
240 Ga0068852_100022610 3300005616 Bacteria 5045
241 Ga0068852_100081967 3300005616 Bacteria 2865
242 Ga0068852_100186517 3300005616 Bacteria 1954
243 Ga0068852_100589012 3300005616 Bacteria 1116
244 Ga0068852_100628212 3300005616 Bacteria 1080
245 Ga0068852_100774218 3300005616 Bacteria 973
246 Ga0068859_100000934 3300005617 Bacteria 29961
247 Ga0068859_100003670 3300005617 Bacteria 15635
248 Ga0068859_100005706 3300005617 Bacteria 12662
249 Ga0068859_100006035 3300005617 Bacteria 12305
250 Ga0068859_100011213 3300005617 Bacteria 9013
251 Ga0068864_100000181 3300005618 Bacteria 58221
252 Ga0068864_100000560 3300005618 Bacteria 31787
253 Ga0068864_100000652 3300005618 Bacteria 28966
254 Ga0068864_100010323 3300005618 Bacteria 7713
255 Ga0068864_100020751 3300005618 Bacteria 5498
256 Ga0068864_100048137 3300005618 Bacteria 3664
257 Ga0068861_100000414 3300005719 Bacteria 24709
258 Ga0068861_100052916 3300005719 Bacteria 3087
259 Ga0068861_100536875 3300005719 Bacteria 1063
260 Ga0068851_10144683 3300005834 Bacteria 1295
261 Ga0068863_100000011 3300005841 Bacteria 232287
262 Ga0068863_100003320 3300005841 Bacteria 15888
263 Ga0068863_100015750 3300005841 Bacteria 7260
264 Ga0068863_100020361 3300005841 Bacteria 6343
265 Ga0068863_100028370 3300005841 Bacteria 5344
266 Ga0068863_100062424 3300005841 Bacteria 3524
267 Ga0068863_100078666 3300005841 Bacteria 3123
268 Ga0068863_100471478 3300005841 Bacteria 1234
269 Ga0068858_100000338 3300005842 Bacteria 49699
270 Ga0068858_100000986 3300005842 Bacteria 29374
271 Ga0068858_100002349 3300005842 Bacteria 19115
272 Ga0068858_100004683 3300005842 Bacteria 13409
273 Ga0068858_100188402 3300005842 Bacteria 1949
274 Ga0068860_100010006 3300005843 Bacteria 9401
275 Ga0068860_100014755 3300005843 Bacteria 7641
276 Ga0068860_100017212 3300005843 Bacteria 7046
277 Ga0068860_100028785 3300005843 Bacteria 5346
278 Ga0068860_100034629 3300005843 Bacteria 4845
279 Ga0068860_100036466 3300005843 Bacteria 4711
280 Ga0068860_100258680 3300005843 Bacteria 1696
281 Ga0068860_100483411 3300005843 Unclassified 1234
282 Ga0068862_100000307 3300005844 Bacteria 53788
283 Ga0068862_100003180 3300005844 Bacteria 14239
284 Ga0068862_100049721 3300005844 Bacteria 3581
285 Ga0068862_100130515 3300005844 Bacteria 2222
286 Ga0068862_100178377 3300005844 Bacteria 1905
287 Ga0081455_10000964 3300005937 Bacteria 36801
288 Ga0081455_10212806 3300005937 Bacteria 1439
289 Ga0081540_1065923 3300005983 Bacteria 1700
290 Ga0070717_10208178 3300006028 Bacteria 1716
291 Ga0075364_10170292 3300006051 Bacteria 1472
292 Ga0075432_10000082 3300006058 Bacteria 19252
293 Ga0070712_100203270 3300006175 Bacteria 1557
294 Ga0075362_10034249 3300006177 Bacteria 2213
295 Ga0075362_10141469 3300006177 Bacteria 1150
296 Ga0075369_10013769 3300006186 Bacteria 3218
297 Ga0075366_10101406 3300006195 Bacteria 1727
298 Ga0097621_100027264 3300006237 Bacteria 4491
299 Ga0097621_100074960 3300006237 Bacteria 2803
300 Ga0097621_100304594 3300006237 Bacteria 1408
301 Ga0075370_10002507 3300006353 Bacteria 8524
302 Ga0075370_10237265 3300006353 Bacteria 1079
303 Ga0075370_10260992 3300006353 Bacteria 1027
304 Ga0075430_100033702 3300006846 Bacteria 4346
305 Ga0075434_100301885 3300006871 Bacteria 1622
306 Ga0068865_100000775 3300006881 Bacteria 17940
307 Ga0097620_100000934 3300006931 Bacteria 29961
308 Ga0097620_100003670 3300006931 Bacteria 15635
309 Ga0097620_100005706 3300006931 Bacteria 12662
310 Ga0097620_100006035 3300006931 Bacteria 12305
311 Ga0097620_100011215 3300006931 Bacteria 9013
312 Ga0079104_1013431 3300006946 Bacteria 2522
313 Ga0105251_10019640 3300009011 Bacteria 3564
314 Ga0105240_10035590 3300009093 Bacteria 6415
315 Ga0105240_10074553 3300009093 Bacteria 4188
316 Ga0105240_10348809 3300009093 Bacteria 1680
317 Ga0111539_10043818 3300009094 Bacteria 5363
318 Ga0111539_10133704 3300009094 Bacteria 2904
319 Ga0111539_10260122 3300009094 Bacteria 2020
320 Ga0105245_10000120 3300009098 Bacteria 75923
321 Ga0105245_10001533 3300009098 Bacteria 20938
322 Ga0105245_10078423 3300009098 Bacteria 3014
323 Ga0105245_10235701 3300009098 Bacteria 1772
324 Ga0105245_10934896 3300009098 Bacteria 910
325 Ga0105247_10004401 3300009101 Bacteria 8986
326 Ga0105247_10137751 3300009101 Unclassified 1596
327 Ga0114129_10116412 3300009147 Bacteria 3684
328 Ga0114129_10293032 3300009147 Bacteria 2171
329 Ga0114129_10751408 3300009147 Bacteria 1248
330 Ga0105243_10000113 3300009148 Bacteria 93087
331 Ga0105243_10019774 3300009148 Bacteria 5105
332 Ga0105243_10082629 3300009148 Bacteria 2626
333 Ga0105241_10025707 3300009174 Bacteria 4377
334 Ga0105241_10120633 3300009174 Bacteria 2111
335 Ga0105242_10814588 3300009176 Bacteria 925
336 Ga0105248_10000256 3300009177 Bacteria 62138
337 Ga0105248_10000400 3300009177 Bacteria 50262
338 Ga0105248_10017191 3300009177 Bacteria 7969
339 Ga0105248_10019300 3300009177 Bacteria 7543
340 Ga0105248_10049925 3300009177 Bacteria 4691
341 Ga0105248_10146066 3300009177 Bacteria 2669
342 Ga0105248_10164291 3300009177 Bacteria 2503
343 Ga0105248_10168191 3300009177 Bacteria 2471
344 Ga0105237_10002575 3300009545 Bacteria 22351
345 Ga0105238_10058377 3300009551 Bacteria 3868
346 Ga0105249_10009644 3300009553 Bacteria 8462
347 Ga0105249_10011174 3300009553 Bacteria 7888
348 Ga0105249_10021020 3300009553 Bacteria 5841
349 Ga0105249_10190214 3300009553 Bacteria 2003
350 Ga0105249_10441162 3300009553 Bacteria 1339
351 Ga0105249_10730645 3300009553 Bacteria 1051
352 Ga0105239_10075291 3300010375 Bacteria 3711
353 Ga0105239_10622658 3300010375 Bacteria 1232
354 Ga0105246_10000160 3300011119 Bacteria 32154
355 Ga0105246_10001420 3300011119 Bacteria 14190
356 Ga0105246_10486402 3300011119 Bacteria 1045
357 Ga0157373_10002630 3300013100 Bacteria 13620
358 Ga0157373_10023182 3300013100 Bacteria 4502
359 Ga0157373_10038833 3300013100 Bacteria 3411
360 Ga0157373_10049331 3300013100 Bacteria 3000
361 Ga0157373_10128340 3300013100 Bacteria 1783
362 Ga0157373_10327634 3300013100 Bacteria 1090
363 Ga0157371_10000114 3300013102 Bacteria 122406
364 Ga0157371_10002108 3300013102 Bacteria 19391
365 Ga0157371_10013797 3300013102 Bacteria 6121
366 Ga0157371_10036127 3300013102 Bacteria 3538
367 Ga0157371_10061311 3300013102 Bacteria 2667
368 Ga0157371_10126617 3300013102 Bacteria 1817
369 Ga0157371_10373290 3300013102 Bacteria 1041
370 Ga0157370_10114356 3300013104 Bacteria 2521
371 Ga0157369_10032870 3300013105 Bacteria 5702
372 Ga0157369_10039817 3300013105 Bacteria 5135
373 Ga0157369_10060405 3300013105 Bacteria 4088
374 Ga0157369_10138316 3300013105 Bacteria 2578
375 Ga0157369_10453915 3300013105 Bacteria 1327
376 Ga0157374_10090243 3300013296 Bacteria 2921
377 Ga0157374_10225674 3300013296 Bacteria 1839
378 Ga0157378_10044452 3300013297 Bacteria 3945
379 Ga0157378_10203789 3300013297 Bacteria 1872
380 Ga0163162_10020908 3300013306 Bacteria 6437
381 Ga0163162_10102278 3300013306 Bacteria 2958
382 Ga0163162_10220426 3300013306 Bacteria 2027
383 Ga0157372_10028966 3300013307 Bacteria 6042
384 Ga0157375_10160157 3300013308 Bacteria 2392
385 Ga0157375_10198094 3300013308 Bacteria 2164
386 Ga0157375_10447835 3300013308 Bacteria 1457
387 Ga0157375_10501238 3300013308 Bacteria 1378
388 Ga0157375_10598194 3300013308 Bacteria 1262
389 Ga0157375_10712577 3300013308 Unclassified 1157
390 Ga0163163_10023225 3300014325 Bacteria 5883
391 Ga0163163_10111881 3300014325 Bacteria 2759
392 Ga0157380_10033099 3300014326 Bacteria 3979
393 Ga0157380_10507749 3300014326 Bacteria 1173
394 Ga0182008_10173442 3300014497 Bacteria 1089
395 Ga0157377_10181641 3300014745 Bacteria 1323
396 Ga0157377_10340657 3300014745 Bacteria 1003
397 Ga0157379_10002639 3300014968 Bacteria 15087
398 Ga0157379_10375636 3300014968 Bacteria 1304
399 Ga0157379_10520736 3300014968 Bacteria 1104
400 Ga0163161_10012240 3300017792 Bacteria 5952
401 Ga0163161_10088745 3300017792 Bacteria 2286
402 Ga0163161_10119588 3300017792 Bacteria 1978
403 Ga0163161_10282621 3300017792 Bacteria 1302
404 Ga0206356_11779621 3300020070 Bacteria 2004
405 Ga0209563_100081 3300025230 Bacteria 199455
406 Ga0209437_104409 3300025233 Bacteria 2483
407 Ga0207425_1000005 3300025245 Bacteria 900502
408 Ga0209148_1000008 3300025254 Bacteria 1504371
409 Ga0209129_1000526 3300025258 Bacteria 26748
410 Ga0209233_1000140 3300025261 Bacteria 193274
411 Ga0209233_1006894 3300025261 Bacteria 3634
412 Ga0209565_1000044 3300025263 Bacteria 229969
413 Ga0209455_1000002 3300025272 Bacteria 1505459
414 Ga0209673_1022156 3300025273 Bacteria 2200
415 Ga0209676_1006640 3300025292 Bacteria 5649
416 Ga0209676_1015467 3300025292 Bacteria 2807
417 Ga0209025_1000128 3300025294 Bacteria 198859
418 Ga0209564_1001630 3300025295 Bacteria 21749
419 Ga0209564_1004768 3300025295 Bacteria 8099
420 Ga0209758_1000002 3300025297 Bacteria 1400310
421 Ga0209758_1000017 3300025297 Bacteria 754393
422 Ga0209758_1037345 3300025297 Bacteria 1879
423 Ga0209050_1000001 3300025298 Bacteria 3563507
424 Ga0209050_1000140 3300025298 Bacteria 173241
425 Ga0209050_1011915 3300025298 Bacteria 4055
426 Ga0209050_1034182 3300025298 Bacteria 1527
427 Ga0207426_1013899 3300025302 Bacteria 2967
428 Ga0209051_1000797 3300025303 Bacteria 33107
429 Ga0209257_1002519 3300025304 Bacteria 18001
430 Ga0209257_1002670 3300025304 Bacteria 17111
431 Ga0209257_1010120 3300025304 Bacteria 4863
432 Ga0207697_10000244 3300025315 Bacteria 29795
433 Ga0207697_10000260 3300025315 Bacteria 29097
434 Ga0207697_10009084 3300025315 Bacteria 4306
435 Ga0207656_10161624 3300025321 Bacteria 1066
436 Ga0207682_10000110 3300025893 Bacteria 37556
437 Ga0207682_10037745 3300025893 Bacteria 1958
438 Ga0207682_10062222 3300025893 Bacteria 1564
439 Ga0207682_10171435 3300025893 Bacteria 987
440 Ga0207710_10011691 3300025900 Bacteria 3692
441 Ga0207688_10000225 3300025901 Bacteria 25468
442 Ga0207688_10068543 3300025901 Bacteria 2009
443 Ga0207688_10087540 3300025901 Bacteria 1786
444 Ga0207688_10135512 3300025901 Bacteria 1446
445 Ga0207680_10000439 3300025903 Bacteria 19657
446 Ga0207647_10000052 3300025904 Bacteria 87651
447 Ga0207647_10004308 3300025904 Bacteria 10553
448 Ga0207647_10048616 3300025904 Bacteria 2634
449 Ga0207647_10058442 3300025904 Bacteria 2362
450 Ga0207645_10011101 3300025907 Bacteria 6162
451 Ga0207645_10014890 3300025907 Bacteria 5187
452 Ga0207645_10081385 3300025907 Bacteria 2076
453 Ga0207705_10000658 3300025909 Bacteria 28794
454 Ga0207705_10002088 3300025909 Bacteria 15529
455 Ga0207705_10002734 3300025909 Bacteria 13521
456 Ga0207705_10003400 3300025909 Bacteria 12098
457 Ga0207705_10004744 3300025909 Bacteria 10238
458 Ga0207705_10019495 3300025909 Bacteria 4850
459 Ga0207705_10021171 3300025909 Bacteria 4638
460 Ga0207705_10158196 3300025909 Bacteria 1701
461 Ga0207705_10221527 3300025909 Bacteria 1437
462 Ga0207705_10260726 3300025909 Bacteria 1323
463 Ga0207705_10366033 3300025909 Bacteria 1112
464 Ga0207705_10410980 3300025909 Bacteria 1047
465 Ga0207654_10014233 3300025911 Bacteria 4108
466 Ga0207654_10276736 3300025911 Bacteria 1134
467 Ga0207654_10648483 3300025911 Bacteria 756
468 Ga0207707_10007643 3300025912 Bacteria 9417
469 Ga0207707_10011692 3300025912 Bacteria 7640
470 Ga0207707_10186703 3300025912 Bacteria 1809
471 Ga0207695_10031036 3300025913 Bacteria 5872
472 Ga0207695_10355166 3300025913 Bacteria 1352
473 Ga0207671_10001065 3300025914 Bacteria 33324
474 Ga0207671_10017233 3300025914 Bacteria 5580
475 Ga0207693_10026672 3300025915 Bacteria 4571
476 Ga0207660_10003179 3300025917 Bacteria 10739
477 Ga0207660_10008606 3300025917 Bacteria 6600
478 Ga0207660_10073175 3300025917 Bacteria 2498
479 Ga0207660_10570949 3300025917 Bacteria 920
480 Ga0207657_10002591 3300025919 Bacteria 19567
481 Ga0207657_10002788 3300025919 Bacteria 18798
482 Ga0207657_10004362 3300025919 Bacteria 14986
483 Ga0207657_10006324 3300025919 Bacteria 12306
484 Ga0207657_10014781 3300025919 Bacteria 7600
485 Ga0207657_10022552 3300025919 Bacteria 5886
486 Ga0207657_10023328 3300025919 Bacteria 5763
487 Ga0207657_10056280 3300025919 Bacteria 3394
488 Ga0207657_10173661 3300025919 Bacteria 1745
489 Ga0207657_10189914 3300025919 Bacteria 1658
490 Ga0207649_10000104 3300025920 Bacteria 69778
491 Ga0207649_10037876 3300025920 Bacteria 2916
492 Ga0207649_10055556 3300025920 Bacteria 2469
493 Ga0207649_10080584 3300025920 Bacteria 2106
494 Ga0207649_10318133 3300025920 Bacteria 1142
495 Ga0207649_10405868 3300025920 Bacteria 1020
496 Ga0207652_10000008 3300025921 Bacteria 286698
497 Ga0207652_10003272 3300025921 Bacteria 13421
498 Ga0207652_10011805 3300025921 Bacteria 7049
499 Ga0207652_10085290 3300025921 Bacteria 2768
500 Ga0207652_10087574 3300025921 Bacteria 2731
501 Ga0207652_10343906 3300025921 Bacteria 1346
502 Ga0207652_10505052 3300025921 Bacteria 1088
503 Ga0207681_10000004 3300025923 Bacteria 559005
504 Ga0207681_10002587 3300025923 Bacteria 11459
505 Ga0207681_10016147 3300025923 Bacteria 4665
506 Ga0207681_10025190 3300025923 Bacteria 3824
507 Ga0207681_10048992 3300025923 Bacteria 2854
508 Ga0207681_10110407 3300025923 Bacteria 1999
509 Ga0207694_10007740 3300025924 Bacteria 8135
510 Ga0207694_10093691 3300025924 Bacteria 2373
511 Ga0207694_10422429 3300025924 Bacteria 1111
512 Ga0207650_10004421 3300025925 Bacteria 9604
513 Ga0207650_10006658 3300025925 Bacteria 7881
514 Ga0207650_10058187 3300025925 Bacteria 2877
515 Ga0207650_10143679 3300025925 Bacteria 1878
516 Ga0207650_10187840 3300025925 Bacteria 1650
517 Ga0207650_10212543 3300025925 Bacteria 1554
518 Ga0207659_10233763 3300025926 Bacteria 1484
519 Ga0207659_10307988 3300025926 Bacteria 1303
520 Ga0207659_10416938 3300025926 Bacteria 1125
521 Ga0207659_10662489 3300025926 Bacteria 892
522 Ga0207687_10006406 3300025927 Bacteria 7776
523 Ga0207687_10334769 3300025927 Bacteria 1229
524 Ga0207687_10584201 3300025927 Bacteria 940
525 Ga0207700_10539880 3300025928 Bacteria 1034
526 Ga0207664_10280228 3300025929 Bacteria 1463
527 Ga0207644_10000009 3300025931 Bacteria 251643
528 Ga0207644_10000021 3300025931 Bacteria 165175
529 Ga0207644_10010959 3300025931 Bacteria 5989
530 Ga0207644_10081673 3300025931 Bacteria 2389
531 Ga0207644_10101729 3300025931 Bacteria 2160
532 Ga0207644_10118428 3300025931 Bacteria 2012
533 Ga0207644_10127541 3300025931 Bacteria 1944
534 Ga0207690_10000022 3300025932 Bacteria 215772
535 Ga0207690_10000463 3300025932 Bacteria 26092
536 Ga0207690_10002801 3300025932 Bacteria 10522
537 Ga0207690_10012242 3300025932 Bacteria 5133
538 Ga0207690_10017740 3300025932 Bacteria 4353
539 Ga0207690_10023696 3300025932 Bacteria 3835
540 Ga0207690_10058479 3300025932 Bacteria 2607
541 Ga0207690_10160746 3300025932 Bacteria 1674
542 Ga0207690_10215159 3300025932 Bacteria 1467
543 Ga0207690_10232839 3300025932 Bacteria 1415
544 Ga0207706_10001178 3300025933 Bacteria 26405
545 Ga0207706_10009206 3300025933 Bacteria 9073
546 Ga0207706_10010997 3300025933 Bacteria 8251
547 Ga0207706_10036973 3300025933 Bacteria 4336
548 Ga0207706_10044088 3300025933 Bacteria 3953
549 Ga0207706_10236690 3300025933 Bacteria 1596
550 Ga0207706_10523470 3300025933 Bacteria 1022
551 Ga0207709_10000116 3300025935 Bacteria 123061
552 Ga0207709_10017683 3300025935 Bacteria 3982
553 Ga0207709_10252183 3300025935 Bacteria 1289
554 Ga0207669_10001099 3300025937 Bacteria 11547
555 Ga0207669_10001331 3300025937 Bacteria 10512
556 Ga0207669_10180270 3300025937 Bacteria 1513
557 Ga0207669_10220293 3300025937 Bacteria 1392
558 Ga0207704_10015412 3300025938 Bacteria 3894
559 Ga0207691_10042920 3300025940 Bacteria 4168
560 Ga0207691_10049967 3300025940 Bacteria 3830
561 Ga0207691_10144798 3300025940 Bacteria 2092
562 Ga0207691_10210733 3300025940 Bacteria 1688
563 Ga0207691_10320826 3300025940 Bacteria 1328
564 Ga0207691_10328355 3300025940 Bacteria 1311
565 Ga0207711_10002898 3300025941 Bacteria 15027
566 Ga0207711_10003023 3300025941 Bacteria 14703
567 Ga0207711_10004639 3300025941 Bacteria 11676
568 Ga0207711_10015981 3300025941 Bacteria 6227
569 Ga0207711_10061948 3300025941 Bacteria 3226
570 Ga0207711_10103189 3300025941 Bacteria 2525
571 Ga0207711_10106342 3300025941 Bacteria 2490
572 Ga0207689_10000014 3300025942 Bacteria 122534
573 Ga0207689_10053101 3300025942 Bacteria 3339
574 Ga0207661_10037845 3300025944 Bacteria 3776
575 Ga0207661_10146074 3300025944 Bacteria 2040
576 Ga0207661_10163548 3300025944 Bacteria 1932
577 Ga0207661_10221025 3300025944 Bacteria 1674
578 Ga0207679_10000677 3300025945 Bacteria 22872
579 Ga0207679_10019370 3300025945 Bacteria 4569
580 Ga0207679_10020644 3300025945 Bacteria 4448
581 Ga0207679_10035886 3300025945 Bacteria 3512
582 Ga0207679_10098482 3300025945 Bacteria 2280
583 Ga0207679_10138734 3300025945 Bacteria 1962
584 Ga0207679_10346518 3300025945 Bacteria 1293
585 Ga0207667_10000001 3300025949 Bacteria 1178522
586 Ga0207667_10001580 3300025949 Bacteria 28640
587 Ga0207667_10002922 3300025949 Bacteria 21209
588 Ga0207667_10077441 3300025949 Bacteria 3449
589 Ga0207667_10110426 3300025949 Bacteria 2836
590 Ga0207651_10000310 3300025960 Bacteria 20959
591 Ga0207651_10182429 3300025960 Bacteria 1666
592 Ga0207651_10188407 3300025960 Bacteria 1643
593 Ga0207651_10221217 3300025960 Bacteria 1531
594 Ga0207712_10008477 3300025961 Bacteria 6499
595 Ga0207712_10087965 3300025961 Bacteria 2280
596 Ga0207712_10151782 3300025961 Bacteria 1790
597 Ga0207712_10284324 3300025961 Bacteria 1351
598 Ga0207668_10000083 3300025972 Bacteria 71561
599 Ga0207668_10004935 3300025972 Bacteria 7846
600 Ga0207668_10025939 3300025972 Bacteria 3800
601 Ga0207668_10032953 3300025972 Bacteria 3430
602 Ga0207668_10034311 3300025972 Bacteria 3368
603 Ga0207668_10188344 3300025972 Bacteria 1633
604 Ga0207668_10348194 3300025972 Bacteria 1238
605 Ga0207668_10776347 3300025972 Bacteria 847
606 Ga0207640_10001199 3300025981 Bacteria 14165
607 Ga0207640_10065064 3300025981 Bacteria 2431
608 Ga0207640_10121377 3300025981 Bacteria 1873
609 Ga0207640_10271989 3300025981 Bacteria 1326
610 Ga0207658_10000710 3300025986 Bacteria 28839
611 Ga0207658_10005707 3300025986 Bacteria 8511
612 Ga0207658_10009884 3300025986 Bacteria 6482
613 Ga0207658_10100030 3300025986 Bacteria 2269
614 Ga0207658_10155085 3300025986 Bacteria 1870
615 Ga0207658_10168933 3300025986 Bacteria 1800
616 Ga0207658_10444397 3300025986 Bacteria 1147
617 Ga0207677_10000124 3300026023 Bacteria 63564
618 Ga0207677_10000776 3300026023 Bacteria 18351
619 Ga0207677_10024018 3300026023 Bacteria 3778
620 Ga0207703_10000167 3300026035 Bacteria 76517
621 Ga0207703_10001172 3300026035 Bacteria 24751
622 Ga0207703_10014614 3300026035 Bacteria 6124
623 Ga0207703_10031140 3300026035 Bacteria 4216
624 Ga0207703_10313481 3300026035 Unclassified 1434
625 Ga0207639_10004768 3300026041 Bacteria 9139
626 Ga0207639_10011215 3300026041 Bacteria 6217
627 Ga0207639_10027474 3300026041 Bacteria 4147
628 Ga0207639_10029025 3300026041 Bacteria 4046
629 Ga0207639_10043252 3300026041 Bacteria 3381
630 Ga0207639_10048108 3300026041 Bacteria 3226
631 Ga0207639_10062397 3300026041 Bacteria 2882
632 Ga0207639_10076856 3300026041 Bacteria 2630
633 Ga0207639_10092778 3300026041 Bacteria 2420
634 Ga0207639_10170958 3300026041 Bacteria 1840
635 Ga0207639_10240828 3300026041 Bacteria 1573
636 Ga0207639_10247332 3300026041 Bacteria 1554
637 Ga0207639_10346209 3300026041 Bacteria 1326
638 Ga0207639_10461578 3300026041 Bacteria 1155
639 Ga0207639_10465081 3300026041 Bacteria 1150
640 Ga0207678_10000681 3300026067 Bacteria 31104
641 Ga0207678_10004862 3300026067 Bacteria 12067
642 Ga0207678_10013560 3300026067 Bacteria 7156
643 Ga0207678_10017394 3300026067 Bacteria 6313
644 Ga0207678_10078097 3300026067 Bacteria 2835
645 Ga0207678_10082279 3300026067 Bacteria 2755
646 Ga0207678_10122757 3300026067 Bacteria 2216
647 Ga0207678_10196956 3300026067 Bacteria 1722
648 Ga0207708_10087041 3300026075 Bacteria 2405
649 Ga0207702_10001591 3300026078 Bacteria 22471
650 Ga0207702_10015308 3300026078 Bacteria 6358
651 Ga0207702_10343992 3300026078 Unclassified 1425
652 Ga0207641_10000028 3300026088 Bacteria 232451
653 Ga0207641_10007019 3300026088 Bacteria 9415
654 Ga0207641_10019628 3300026088 Bacteria 5549
655 Ga0207641_10025186 3300026088 Bacteria 4906
656 Ga0207641_10028710 3300026088 Bacteria 4598
657 Ga0207641_10031560 3300026088 Bacteria 4394
658 Ga0207641_10048852 3300026088 Bacteria 3573
659 Ga0207648_10001420 3300026089 Bacteria 26422
660 Ga0207648_10054701 3300026089 Bacteria 3485
661 Ga0207648_10360189 3300026089 Bacteria 1312
662 Ga0207676_10000527 3300026095 Bacteria 32092
663 Ga0207676_10000666 3300026095 Bacteria 27542
664 Ga0207676_10005078 3300026095 Bacteria 9310
665 Ga0207676_10033569 3300026095 Bacteria 3878
666 Ga0207676_10069931 3300026095 Bacteria 2813
667 Ga0207676_10078796 3300026095 Bacteria 2669
668 Ga0207674_10000244 3300026116 Bacteria 67590
669 Ga0207674_10004090 3300026116 Bacteria 17674
670 Ga0207674_10016651 3300026116 Bacteria 8038
671 Ga0207674_10042600 3300026116 Bacteria 4687
672 Ga0207674_10277481 3300026116 Bacteria 1624
673 Ga0207674_10305124 3300026116 Bacteria 1541
674 Ga0207675_100000199 3300026118 Bacteria 55487
675 Ga0207675_100000666 3300026118 Bacteria 33780
676 Ga0207675_100134453 3300026118 Bacteria 2345
677 Ga0207675_100590307 3300026118 Bacteria 1113
678 Ga0207683_10001771 3300026121 Bacteria 19121
679 Ga0207683_10278529 3300026121 Bacteria 1528
680 Ga0207683_10288989 3300026121 Bacteria 1499
681 Ga0207698_10005956 3300026142 Bacteria 7577
682 Ga0207698_10013116 3300026142 Bacteria 5456
683 Ga0207698_10021079 3300026142 Bacteria 4499
684 Ga0207698_10021164 3300026142 Bacteria 4493
685 Ga0207698_10064282 3300026142 Bacteria 2875
686 Ga0207698_10277326 3300026142 Bacteria 1549
687 Ga0207698_10506930 3300026142 Bacteria 1175
688 Ga0207698_10711417 3300026142 Bacteria 1000
689 Ga0209281_1005897 3300027111 Bacteria 3288
690 Ga0209983_1010919 3300027665 Bacteria 1856
691 Ga0207428_10015734 3300027907 Bacteria 6533
692 Ga0268266_10000019 3300028379 Bacteria 556465
693 Ga0268266_10000036 3300028379 Bacteria 348910
694 Ga0268266_10001687 3300028379 Bacteria 25379
695 Ga0268266_10028584 3300028379 Bacteria 4738
696 Ga0268266_10109769 3300028379 Bacteria 2443
697 Ga0268265_10000109 3300028380 Bacteria 104063
698 Ga0268265_10004482 3300028380 Bacteria 9678
699 Ga0268264_10000069 3300028381 Bacteria 270492
700 Ga0268264_10004358 3300028381 Bacteria 12081
701 Ga0268264_10004801 3300028381 Bacteria 11462
702 Ga0268264_10009152 3300028381 Bacteria 8209
703 Ga0268264_10039114 3300028381 Bacteria 3918
704 Ga0268264_10149990 3300028381 Unclassified 2089
705 Ga0268264_10197259 3300028381 Bacteria 1839
706 Ga0265318_10000046 3300028577 Bacteria 126568
707 Ga0307517_10007943 3300028786 Bacteria 15328
708 Ga0265338_10047479 3300028800 Bacteria 3920
709 Ga0316177_1101382 3300030731 Bacteria 1408
710 Ga0265327_10020375 3300031251 Bacteria 4044
711 Ga0307513_10043999 3300031456 Bacteria 4896
712 Ga0307513_10212571 3300031456 Bacteria 1764
713 Ga0307513_10339208 3300031456 Bacteria 1254
714 Ga0307408_100020364 3300031548 Bacteria 4476
715 Ga0307408_100047753 3300031548 Bacteria 3067
716 Ga0307408_100059639 3300031548 Bacteria 2778
717 Ga0307408_100187168 3300031548 Bacteria 1665
718 Ga0307408_100496120 3300031548 Bacteria 1068
719 Ga0307408_100831392 3300031548 Bacteria 840
720 Ga0307508_10001242 3300031616 Bacteria 29119
721 Ga0265314_10089683 3300031711 Bacteria 2005
722 Ga0307405_10001143 3300031731 Bacteria 10886
723 Ga0307405_10001791 3300031731 Bacteria 9189
724 Ga0307405_10029574 3300031731 Bacteria 3203
725 Ga0307405_10056225 3300031731 Bacteria 2467
726 Ga0307405_10185068 3300031731 Bacteria 1499
727 Ga0307405_10494911 3300031731 Bacteria 979
728 Ga0307413_10001436 3300031824 Bacteria 9023
729 Ga0307413_10003418 3300031824 Bacteria 6678
730 Ga0307413_10026883 3300031824 Bacteria 3179
731 Ga0307413_10034901 3300031824 Bacteria 2879
732 Ga0307413_10043222 3300031824 Bacteria 2654
733 Ga0307413_10113559 3300031824 Bacteria 1819
734 Ga0307413_10166587 3300031824 Bacteria 1555
735 Ga0307413_10888331 3300031824 Bacteria 756
736 Ga0307410_10006204 3300031852 Bacteria 6426
737 Ga0307410_10008488 3300031852 Bacteria 5698
738 Ga0307410_10012577 3300031852 Bacteria 4900
739 Ga0307410_10063489 3300031852 Bacteria 2534
740 Ga0307410_10120250 3300031852 Bacteria 1914
741 Ga0307410_10135805 3300031852 Bacteria 1813
742 Ga0307410_10211319 3300031852 Bacteria 1487
743 Ga0307410_10221435 3300031852 Bacteria 1456
744 Ga0307410_10326154 3300031852 Bacteria 1220
745 Ga0307410_10549189 3300031852 Bacteria 957
746 Ga0307406_10004895 3300031901 Bacteria 7294
747 Ga0307406_10014574 3300031901 Bacteria 4526
748 Ga0307406_10034013 3300031901 Bacteria 3124
749 Ga0307406_10063684 3300031901 Bacteria 2390
750 Ga0307407_10002091 3300031903 Bacteria 7655
751 Ga0307407_10002700 3300031903 Bacteria 7039
752 Ga0307407_10005183 3300031903 Bacteria 5626
753 Ga0307407_10270209 3300031903 Bacteria 1173
754 Ga0307412_10004442 3300031911 Bacteria 7812
755 Ga0307412_10018121 3300031911 Bacteria 4229
756 Ga0307412_10031357 3300031911 Bacteria 3356
757 Ga0307412_10073649 3300031911 Bacteria 2337
758 Ga0307412_10077414 3300031911 Bacteria 2288
759 Ga0307412_10138016 3300031911 Bacteria 1782
760 Ga0307412_10234555 3300031911 Bacteria 1415
761 Ga0307412_10502205 3300031911 Bacteria 1010
762 Ga0307409_100002533 3300031995 Bacteria 9581
763 Ga0307409_100007426 3300031995 Bacteria 6554
764 Ga0307409_100022011 3300031995 Bacteria 4385
765 Ga0307409_100042126 3300031995 Bacteria 3417
766 Ga0307409_100063032 3300031995 Bacteria 2905
767 Ga0307409_100137150 3300031995 Bacteria 2101
768 Ga0307409_100153145 3300031995 Bacteria 2005
769 Ga0307409_100234250 3300031995 Bacteria 1667
770 Ga0307409_100325951 3300031995 Bacteria 1439
771 Ga0307416_100008545 3300032002 Bacteria 6616
772 Ga0307416_100047316 3300032002 Bacteria 3403
773 Ga0307416_100219558 3300032002 Bacteria 1821
774 Ga0307416_100408484 3300032002 Bacteria 1398
775 Ga0307416_100793181 3300032002 Bacteria 1042
776 Ga0307414_10003894 3300032004 Bacteria 8038
777 Ga0307414_10010707 3300032004 Bacteria 5339
778 Ga0307414_10032504 3300032004 Bacteria 3436
779 Ga0307414_10039799 3300032004 Bacteria 3169
780 Ga0307414_10046248 3300032004 Bacteria 2986
781 Ga0307414_10144556 3300032004 Bacteria 1867
782 Ga0307414_10277319 3300032004 Bacteria 1407
783 Ga0307414_10475657 3300032004 Bacteria 1101
784 Ga0307414_10479712 3300032004 Bacteria 1096
785 Ga0307411_10001555 3300032005 Bacteria 9488
786 Ga0307411_10024979 3300032005 Bacteria 3571
787 Ga0307411_10076290 3300032005 Bacteria 2291
788 Ga0307411_10078928 3300032005 Bacteria 2258
789 Ga0307411_10208932 3300032005 Bacteria 1506
790 Ga0307411_10327119 3300032005 Bacteria 1240
791 Ga0307411_10500354 3300032005 Bacteria 1027
792 Ga0307411_10577536 3300032005 Unclassified 963
793 Ga0307411_10725215 3300032005 Bacteria 868
794 Ga0307415_100000632 3300032126 Bacteria 15442
795 Ga0307415_100002383 3300032126 Bacteria 9366
796 Ga0307415_100041995 3300032126 Bacteria 3040
797 Ga0307415_100086361 3300032126 Bacteria 2257
798 Ga0307415_100142512 3300032126 Bacteria 1833
799 Ga0307510_10103418 3300033180 Bacteria 2626
800 Ga0373923_0062819 3300035111 Bacteria 1581
801 Ga0373923_0065455 3300035111 Bacteria 1551
802 Ga0373953_0023016 3300035117 Bacteria 2356
803 Ga0373943_0006039 3300035170 Bacteria 5437
804 Ga0373955_0000936 3300035172 Bacteria 12491
805 Ga0373931_0002063 3300035691 Bacteria 8836
806 Ga0373935_0308362 3300035692 Bacteria 1120
807 Ga0373937_0004532 3300036401 Bacteria 11800
808 Ga0373925_0011013 3300037068 Bacteria 6567
809 Ga0395899_0006947 3300037312 Bacteria 8767
810 Ga0395899_0074811 3300037312 Bacteria 2474
811 Ga0395899_0140577 3300037312 Bacteria 1718
812 Ga0395899_0155446 3300037312 Bacteria 1618
813 Ga0395899_0166709 3300037312 Unclassified 1553
814 Ga0395900_0000336 3300037418 Bacteria 69212
815 Ga0395900_0005712 3300037418 Bacteria 13000
816 Ga0395900_0050979 3300037418 Bacteria 4263
817 Ga0395900_0078289 3300037418 Bacteria 3397
818 Ga0395900_0083504 3300037418 Bacteria 3281
819 Ga0395900_0104552 3300037418 Bacteria 2909
820 Ga0395900_0145175 3300037418 Bacteria 2426
821 Ga0395900_0167501 3300037418 Bacteria 2238
822 Ga0395898_0016208 3300037466 Bacteria 7631
823 Ga0395898_0022790 3300037466 Bacteria 6337
824 Ga0395898_0294833 3300037466 Bacteria 1547
825 Ga0395898_0423500 3300037466 Bacteria 1268
826 Ga0395898_0858978 3300037466 Bacteria 846
827 Ga0395905_0029283 3300037471 Bacteria 5189
828 Ga0395905_0054283 3300037471 Bacteria 3750
829 Ga0395905_0084437 3300037471 Bacteria 2975
830 Ga0395905_0090504 3300037471 Bacteria 2868
831 Ga0395905_0110002 3300037471 Bacteria 2587
832 Ga0395905_0117033 3300037471 Bacteria 2504
833 Ga0395905_0319064 3300037471 Bacteria 1443
834 Ga0395901_0000398 3300038443 Bacteria 51885
835 Ga0395901_0002173 3300038443 Bacteria 20032
836 Ga0395901_0124817 3300038443 Bacteria 2705
837 Ga0395901_0139053 3300038443 Bacteria 2552
838 Ga0395901_0222418 3300038443 Bacteria 1973
839 Ga0395901_0278471 3300038443 Bacteria 1738
840 Ga0237819_00292 3300038705 Bacteria 18420
841 Ga0436365_1902390 3300039437 Bacteria 4486
842 Ga0436363_0606517 3300039450 Bacteria 819
843 Ga0436363_1122466 3300039450 Bacteria 1052
844 Ga0439465_0081722 3300041413 Bacteria 1096
845 Ga0439431_0001810 3300041997 Bacteria 4729
846 Ga0439432_000391 3300042006 Bacteria 16191
847 Ga0439462_0004540 3300042015 Bacteria 3397
848 Ga0450912_000302 3300042116 Bacteria 2250
849 Ga0450917_003634 3300042120 Bacteria 1118
850 Ga0450923_038696 3300042125 Unclassified 996
851 Ga0450905_004102 3300042142 Bacteria 1922
852 Ga0450889_000006 3300042144 Bacteria 19255
853 Ga0439434_0002010 3300042435 Bacteria 5882
854 Ga0439464_0008848 3300042439 Bacteria 2639
855 Ga0450893_0003067 3300042532 Bacteria 2627
856 Ga0466966_0000301 3300044684 Bacteria 32475
857 Ga0466966_0074595 3300044684 Bacteria 2120
858 Ga0466966_0115417 3300044684 Bacteria 1653
859 Ga0466966_0135612 3300044684 Bacteria 1505
860 Ga0466961_0020790 3300044693 Bacteria 4225
861 Ga0466963_0223929 3300044694 Bacteria 1318
862 Ga0466963_0345078 3300044694 Bacteria 1048
863 Ga0466971_0059943 3300044719 Unclassified 1720
864 Ga0466971_0102069 3300044719 Bacteria 1319
865 Ga0466957_0097773 3300044842 Bacteria 1846
866 Ga0466959_0086297 3300045049 Bacteria 2258
867 Ga0451576_0574629 3300045051 Bacteria 1184
868 Ga0466958_0262411 3300045836 Unclassified 1106
869 Ga0466958_0411452 3300045836 Bacteria 874
870 Ga0466967_0001182 3300045976 Bacteria 14643
871 Ga0466967_0138252 3300045976 Bacteria 2267
872 Ga0466967_0280572 3300045976 Bacteria 1598
873 Ga0466967_0450672 3300045976 Unclassified 1257
874 Ga0495638_0000029 3300046460 Bacteria 330201
875 Ga0495638_0001480 3300046460 Bacteria 21212
876 Ga0495638_0021189 3300046460 Bacteria 4287
877 Ga0495638_0074540 3300046460 Bacteria 2070
878 Ga0495650_0000290 3300046471 Bacteria 93004
879 Ga0495650_0012351 3300046471 Bacteria 4600
880 Ga0495584_0004125 3300046491 Bacteria 7842
881 Ga0495585_0001024 3300046492 Bacteria 23262
882 Ga0495585_0087436 3300046492 Bacteria 1682
883 Ga0495596_0000091 3300046500 Bacteria 63577
884 Ga0495596_0008830 3300046500 Bacteria 4460
885 Ga0495607_0005251 3300046501 Bacteria 9319
886 Ga0495583_0000147 3300046506 Bacteria 119035
887 Ga0495583_0002617 3300046506 Bacteria 15046
888 Ga0495583_0019485 3300046506 Bacteria 3540
889 Ga0495583_0034629 3300046506 Bacteria 2417
890 Ga0495583_0067410 3300046506 Bacteria 1581
891 Ga0495606_0000178 3300046507 Bacteria 112329
892 Ga0495606_0053017 3300046507 Bacteria 2634
893 Ga0495606_0054178 3300046507 Bacteria 2598
894 Ga0495606_0115164 3300046507 Bacteria 1616
895 Ga0495606_0345361 3300046507 Bacteria 791
896 Ga0495610_0000220 3300046512 Bacteria 61190
897 Ga0495610_0000352 3300046512 Bacteria 48332
898 Ga0495610_0001714 3300046512 Bacteria 19218
899 Ga0495616_0000009 3300046513 Bacteria 225502
900 Ga0495620_0003485 3300046515 Bacteria 9003
901 Ga0495620_0075294 3300046515 Bacteria 1374
902 Ga0495632_0000047 3300046519 Bacteria 138951
903 Ga0495632_0000565 3300046519 Bacteria 34434
904 Ga0495632_0001651 3300046519 Bacteria 18277
905 Ga0495632_0071777 3300046519 Bacteria 1662
906 Ga0495632_0076201 3300046519 Bacteria 1604
907 Ga0495632_0140863 3300046519 Bacteria 1119
908 Ga0495643_0000036 3300046522 Bacteria 238374
909 Ga0495643_0000166 3300046522 Bacteria 104972
910 Ga0495643_0001718 3300046522 Bacteria 18979
911 Ga0495643_0007008 3300046522 Bacteria 7324
912 Ga0495643_0013682 3300046522 Bacteria 4848
913 Ga0495643_0081907 3300046522 Bacteria 1677
914 Ga0495648_0000020 3300046524 Bacteria 254330
915 Ga0495648_0002711 3300046524 Bacteria 16000
916 Ga0495648_0009822 3300046524 Bacteria 7358
917 Ga0495648_0011578 3300046524 Bacteria 6634
918 Ga0495663_0000017 3300046525 Bacteria 138955
919 Ga0495663_0000533 3300046525 Bacteria 13597
920 Ga0495642_0003717 3300046528 Bacteria 5985
921 Ga0495654_0028751 3300046530 Bacteria 2840
922 Ga0495598_0018214 3300046537 Bacteria 1822
923 Ga0495609_0004809 3300046538 Bacteria 7286
924 Ga0495597_0004964 3300046542 Bacteria 7144
925 Ga0495622_0128231 3300046557 Bacteria 1156
926 Ga0495633_0000496 3300046558 Bacteria 39673
927 Ga0495633_0000685 3300046558 Bacteria 31174
928 Ga0495633_0000737 3300046558 Bacteria 29667
929 Ga0495633_0009060 3300046558 Bacteria 5535
930 Ga0495633_0019259 3300046558 Bacteria 3452
931 Ga0495668_0000013 3300046616 Bacteria 452938
932 Ga0495668_0007020 3300046616 Bacteria 7270
933 Ga0495668_0076747 3300046616 Bacteria 1834
934 Ga0495668_0104330 3300046616 Bacteria 1551
935 Ga0495668_0198996 3300046616 Bacteria 1097
936 Ga0495668_0222100 3300046616 Bacteria 1034
937 Ga0495611_0003692 3300046648 Bacteria 6699
938 Ga0495611_0037085 3300046648 Bacteria 2166
939 Ga0495625_0000400 3300046660 Bacteria 66228
940 Ga0495625_0000599 3300046660 Bacteria 52442
941 Ga0495625_0012837 3300046660 Bacteria 6771
942 Ga0495625_0020250 3300046660 Bacteria 5140
943 Ga0495625_0023541 3300046660 Bacteria 4703
944 Ga0495669_0093406 3300046684 Bacteria 1391
945 Ga0495669_0109928 3300046684 Bacteria 1286
946 Ga0495669_0203340 3300046684 Bacteria 947
947 Ga0495670_0014132 3300046691 Bacteria 3928
948 Ga0495670_0062004 3300046691 Bacteria 1880
949 Ga0495671_0000022 3300046692 Bacteria 255591
950 Ga0495600_0047932 3300046809 Bacteria 2787
951 Ga0495683_0001221 3300047323 Bacteria 17505
952 Ga0495687_000384 3300047443 Bacteria 54885
953 Ga0495677_0002225 3300047445 Bacteria 7673
954 Ga0495677_0002456 3300047445 Bacteria 7282
955 Ga0495673_0000051 3300047469 Bacteria 255511
956 Ga0495673_0046497 3300047469 Bacteria 1923
957 Ga0495681_0046345 3300047470 Bacteria 2073
958 Ga0495681_0084971 3300047470 Bacteria 1406
959 Ga0495686_0046805 3300047472 Bacteria 2733
960 Ga0495602_0038123 3300048088 Bacteria 4450
961 Ga0495615_0000009 3300048090 Bacteria 76727
962 Ga0495615_0003485 3300048090 Bacteria 2641
963 Ga0495626_0000517 3300048091 Bacteria 38618
964 Ga0496101_0088988 3300048904 Bacteria 2294
965 Ga0496102_0000066 3300048905 Bacteria 159020
966 Ga0496102_0009317 3300048905 Bacteria 8431
967 Ga0496103_0000248 3300048906 Bacteria 52332
968 Ga0496103_0019178 3300048906 Bacteria 4107
969 Ga0496104_0052149 3300048907 Bacteria 3863
970 Ga0496105_0000199 3300048908 Bacteria 40100
971 Ga0496107_0029046 3300048910 Bacteria 3932
972 Ga0496108_0005656 3300048911 Bacteria 10119
973 Ga0496108_0172143 3300048911 Bacteria 1874
974 Ga0496108_0299899 3300048911 Bacteria 1400
975 Ga0496109_0091111 3300048912 Bacteria 2819
976 Ga0496110_0015870 3300048913 Bacteria 6280
977 Ga0496110_0023976 3300048913 Bacteria 5197
978 Ga0496110_0278115 3300048913 Bacteria 1524
979 Ga0496110_0303493 3300048913 Bacteria 1454
980 Ga0496110_0587925 3300048913 Bacteria 1010
981 Ga0496111_0087964 3300048914 Bacteria 2274
982 Ga0496111_0173569 3300048914 Bacteria 1602
983 Ga0496112_0009138 3300048915 Bacteria 8905
984 Ga0496113_0009937 3300048916 Bacteria 6269
985 Ga0496113_0029922 3300048916 Bacteria 3937
986 Ga0496114_0014088 3300048917 Bacteria 6411
987 Ga0496115_0000216 3300048918 Bacteria 53242
988 Ga0496115_0000732 3300048918 Bacteria 24253
989 Ga0496116_0000279 3300048919 Bacteria 88014
990 Ga0496116_0002551 3300048919 Bacteria 19034
991 Ga0496117_0000717 3300048920 Bacteria 52330
992 Ga0496118_0000754 3300048921 Bacteria 52330
993 Ga0496119_0003364 3300048922 Bacteria 16654
994 Ga0496120_0043993 3300048923 Bacteria 2597
995 Ga0496121_0000954 3300048924 Bacteria 52302
996 Ga0496121_0002098 3300048924 Bacteria 31368
997 Ga0496121_0009641 3300048924 Bacteria 11060
998 Ga0496121_0024707 3300048924 Bacteria 5734
999 Ga0496121_0038601 3300048924 Bacteria 4223
1000 Ga0496121_0088189 3300048924 Bacteria 2433
1001 Ga0496121_0119116 3300048924 Bacteria 1997
1002 Ga0496122_0000385 3300048925 Bacteria 94046
1003 Ga0496122_0003528 3300048925 Bacteria 20474
1004 Ga0496122_0008856 3300048925 Bacteria 10738
1005 Ga0496122_0011771 3300048925 Bacteria 8812
1006 Ga0496122_0013679 3300048925 Bacteria 7920
1007 Ga0496122_0015070 3300048925 Bacteria 7418
1008 Ga0496123_0000220 3300048926 Bacteria 115824
1009 Ga0496123_0000300 3300048926 Bacteria 96475
1010 Ga0496123_0000684 3300048926 Bacteria 55863
1011 Ga0496123_0008437 3300048926 Bacteria 9466
1012 Ga0496123_0056302 3300048926 Bacteria 2571
1013 Ga0496123_0262501 3300048926 Bacteria 845
1014 Ga0496124_0000767 3300048927 Bacteria 52350
1015 Ga0496124_0001301 3300048927 Bacteria 37771
1016 Ga0496124_0040271 3300048927 Bacteria 4044
1017 Ga0496124_0092017 3300048927 Bacteria 2470
1018 Ga0496125_0000229 3300048928 Bacteria 114537
1019 Ga0496125_0002679 3300048928 Bacteria 22728
1020 Ga0496125_0017789 3300048928 Bacteria 6764
1021 Ga0496125_0025306 3300048928 Bacteria 5438
1022 Ga0496125_0032271 3300048928 Bacteria 4654
1023 Ga0496126_0000891 3300048929 Bacteria 52294
1024 Ga0496126_0007119 3300048929 Bacteria 12321
1025 Ga0496126_0008301 3300048929 Bacteria 11215
1026 Ga0496126_0245081 3300048929 Bacteria 1495
1027 Ga0496126_0346070 3300048929 Bacteria 1217
1028 Ga0496126_0385991 3300048929 Bacteria 1139
1029 Ga0501032_0078028 3300049569 Bacteria 2205
1030 Ga0501033_0007416 3300049570 Bacteria 8543
1031 Ga0501033_0097399 3300049570 Bacteria 2149
1032 Ga0501033_0190395 3300049570 Bacteria 1468
1033 Ga0501036_0410571 3300049572 Bacteria 1129
1034 Ga0501037_0041873 3300049573 Bacteria 3367
1035 Ga0501038_0019972 3300049574 Bacteria 6031
1036 Ga0501038_0167917 3300049574 Bacteria 1779
1037 Ga0501047_0029038 3300049581 Bacteria 5334
1038 Ga0501047_0064618 3300049581 Bacteria 3529
1039 Ga0501047_0073563 3300049581 Bacteria 3290
1040 Ga0501047_0440467 3300049581 Bacteria 1133
1041 Ga0501067_0016612 3300049583 Bacteria 4067
1042 Ga0501067_0242614 3300049583 Bacteria 1003
1043 Ga0501070_0522088 3300049586 Bacteria 953
1044 Ga0501080_0065115 3300049742 Bacteria 3391
1045 Ga0501080_0707770 3300049742 Bacteria 888
1046 Ga0501083_0214106 3300049744 Bacteria 1256
1047 Ga0501241_005531 3300049758 Bacteria 2354
1048 Ga0501241_013910 3300049758 Bacteria 1462
1049 Ga0501270_001791 3300049767 Bacteria 2124
1050 Ga0501035_0069158 3300049822 Bacteria 3130
1051 Ga0501035_0560386 3300049822 Bacteria 935
1052 Ga0501044_0004024 3300049823 Bacteria 16477
1053 Ga0501044_0005674 3300049823 Bacteria 13835
1054 Ga0501044_0146616 3300049823 Bacteria 2345
1055 Ga0501044_0172839 3300049823 Bacteria 2131
1056 Ga0501044_0228335 3300049823 Bacteria 1810
1057 Ga0501044_0410150 3300049823 Bacteria 1266
1058 Ga0501044_0506546 3300049823 Bacteria 1108
1059 nmdc:mga03683_33738_c2 3300050489 Bacteria 1189
1060 nmdc:mga03683_9114_c1 3300050489 Bacteria 3515
1061 nmdc:mga00v17_1450_c1 3300050491 Bacteria 12406
1062 nmdc:mga0k408_12448_c1 3300050493 Bacteria 4650
1063 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
1064 nmdc:mga07m45_2592_c1 3300050496 Bacteria 8519
1065 nmdc:mga07m45_5623_c1 3300050496 Bacteria 6260
1066 nmdc:mga05p37_123477_c1 3300050507 Bacteria 3180
1067 nmdc:mga05p37_342720_c1 3300050507 Bacteria 1762
1068 nmdc:mga05p37_9157_c1 3300050507 Bacteria 11705
1069 nmdc:mga0qj67_27138_c1 3300050509 Bacteria 4436
1070 nmdc:mga08y16_209291_c1 3300050511 Bacteria 2020
1071 nmdc:mga08y16_381262_c1 3300050511 Bacteria 1445
1072 nmdc:mga0n895_444082_c1 3300050512 Bacteria 1310
1073 Ga0500610_0002615 3300053079 Bacteria 6687
1074 Ga0500643_008453 3300053087 Bacteria 4041
1075 Ga0500643_018922 3300053087 Bacteria 2276
1076 Ga0500641_0039472 3300053096 Bacteria 1902
1077 Ga0500556_0000217 3300053104 Bacteria 46762
1078 Ga0500557_079179 3300053105 Bacteria 1084
1079 Ga0500595_002981 3300053119 Bacteria 8054
1080 Ga0500595_005185 3300053119 Bacteria 5716
1081 Ga0500607_000070 3300053121 Bacteria 73162
1082 Ga0500607_000102 3300053121 Bacteria 65607
1083 Ga0500608_127336 3300053122 Bacteria 1146
1084 Ga0500642_0000001 3300053130 Bacteria 1468402
1085 Ga0500642_0000543 3300053130 Bacteria 11428
1086 Ga0500658_0000049 3300053134 Bacteria 65535
1087 Ga0500658_0002034 3300053134 Bacteria 7893
1088 Ga0500559_0002376 3300053136 Bacteria 9811
1089 Ga0500559_0009272 3300053136 Bacteria 4269
1090 Ga0500559_0012440 3300053136 Bacteria 3617
1091 Ga0500559_0012634 3300053136 Bacteria 3585
1092 Ga0500559_0014432 3300053136 Bacteria 3339
1093 Ga0500568_0013440 3300053139 Bacteria 3731
1094 Ga0500568_0021149 3300053139 Bacteria 2803
1095 Ga0500568_0037492 3300053139 Bacteria 1966
1096 Ga0500577_0203930 3300053142 Bacteria 854
1097 Ga0500588_0028133 3300053146 Bacteria 1591
1098 Ga0500590_008590 3300053148 Bacteria 5103
1099 Ga0500604_0000007 3300053151 Bacteria 115773
1100 Ga0500604_0003053 3300053151 Bacteria 4499
1101 Ga0500604_0017140 3300053151 Bacteria 2001
1102 Ga0500616_0000080 3300053153 Bacteria 200381
1103 Ga0500616_0025469 3300053153 Bacteria 3281
1104 Ga0500616_0033403 3300053153 Bacteria 2808
1105 Ga0500622_0003841 3300053156 Bacteria 9776
1106 Ga0500636_0008384 3300053177 Bacteria 5994
1107 Ga0500625_096024 3300053729 Bacteria 1255
1108 Ga0500645_000148 3300053730 Bacteria 54683
1109 Ga0500645_003044 3300053730 Bacteria 7055
1110 Ga0500645_006610 3300053730 Bacteria 4114
1111 Ga0500596_000119 3300053735 Bacteria 11234
1112 Ga0466962_0098253 3300061719 Bacteria 1405
1113 Ga0466962_0102452 3300061719 Bacteria 1375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10648483 Ga0207654_106484831 194
2 3300049758 Ga0501241_005531 Ga0501241_005531_162_926 199
3 3300049758 Ga0501241_013910 Ga0501241_013910_14_853 208
4 3300049581 Ga0501047_0440467 Ga0501047_0440467_38_688 209
5 3300009553 Ga0105249_10730645 Ga0105249_107306451 210
6 3300046660 Ga0495625_0000400 Ga0495625_0000400_65185_65961 210
7 3300013297 Ga0157378_10203789 Ga0157378_102037892 211
8 3300005353 Ga0070669_100185643 Ga0070669_1001856431 213
9 3300014326 Ga0157380_10033099 Ga0157380_100330993 213
10 3300025923 Ga0207681_10048992 Ga0207681_100489921 213
11 3300025926 Ga0207659_10307988 Ga0207659_103079882 213
12 3300025937 Ga0207669_10220293 Ga0207669_102202932 213
13 3300005347 Ga0070668_100050214 Ga0070668_1000502142 214
14 3300005543 Ga0070672_100352458 Ga0070672_1003524582 214
15 3300025940 Ga0207691_10320826 Ga0207691_103208262 214
16 3300025972 Ga0207668_10032953 Ga0207668_100329532 214
17 3300031824 Ga0307413_10888331 Ga0307413_108883311 214
18 3300048917 Ga0496114_0014088 Ga0496114_0014088_3374_4057 214
19 3300005355 Ga0070671_100005122 Ga0070671_10000512212 216
20 3300005364 Ga0070673_100032130 Ga0070673_1000321302 216
21 3300005367 Ga0070667_100020111 Ga0070667_1000201113 216
22 3300005617 Ga0068859_100011213 Ga0068859_1000112133 216
23 3300005618 Ga0068864_100000652 Ga0068864_10000065228 216
24 3300005841 Ga0068863_100015750 Ga0068863_1000157506 216
25 3300005842 Ga0068858_100004683 Ga0068858_1000046836 216
26 3300006931 Ga0097620_100011215 Ga0097620_1000112153 216
27 3300009101 Ga0105247_10137751 Ga0105247_101377513 216
28 3300009177 Ga0105248_10049925 Ga0105248_100499255 216
29 3300009553 Ga0105249_10021020 Ga0105249_100210203 216
30 3300011119 Ga0105246_10486402 Ga0105246_104864022 216
31 3300013308 Ga0157375_10712577 Ga0157375_107125772 216
32 3300014325 Ga0163163_10023225 Ga0163163_100232254 216
33 3300014745 Ga0157377_10340657 Ga0157377_103406571 216
34 3300014968 Ga0157379_10002639 Ga0157379_100026394 216
35 3300025931 Ga0207644_10118428 Ga0207644_101184282 216
36 3300025941 Ga0207711_10061948 Ga0207711_100619483 216
37 3300025960 Ga0207651_10188407 Ga0207651_101884073 216
38 3300025961 Ga0207712_10284324 Ga0207712_102843241 216
39 3300025972 Ga0207668_10188344 Ga0207668_101883442 216
40 3300026035 Ga0207703_10313481 Ga0207703_103134812 216
41 3300026088 Ga0207641_10028710 Ga0207641_100287103 216
42 3300026095 Ga0207676_10033569 Ga0207676_100335693 216
43 3300028577 Ga0265318_10000046 Ga0265318_1000004669 216
44 3300046507 Ga0495606_0345361 Ga0495606_0345361_80_772 216
45 3300048929 Ga0496126_0245081 Ga0496126_0245081_54_743 216
46 3300017792 Ga0163161_10119588 Ga0163161_101195882 217
47 3300026078 Ga0207702_10343992 Ga0207702_103439921 217
48 3300032004 Ga0307414_10475657 Ga0307414_104756571 217
49 3300005937 Ga0081455_10000964 Ga0081455_1000096439 218
50 3300041997 Ga0439431_0001810 Ga0439431_0001810_2126_2890 218
51 3300042006 Ga0439432_000391 Ga0439432_000391_1691_2455 218
52 3300042435 Ga0439434_0002010 Ga0439434_0002010_4225_4989 218
53 3300046506 Ga0495583_0067410 Ga0495583_0067410_203_970 218
54 3300047445 Ga0495677_0002225 Ga0495677_0002225_5717_6484 218
55 3300025931 Ga0207644_10127541 Ga0207644_101275412 219
56 3300032126 Ga0307415_100000632 Ga0307415_10000063210 219
57 3300005355 Ga0070671_100314227 Ga0070671_1003142272 220
58 3300005366 Ga0070659_100098436 Ga0070659_1000984362 220
59 3300005563 Ga0068855_100104230 Ga0068855_1001042302 220
60 3300025932 Ga0207690_10023696 Ga0207690_100236962 220
61 3300025949 Ga0207667_10110426 Ga0207667_101104263 220
62 3300026041 Ga0207639_10062397 Ga0207639_100623972 220
63 3300032005 Ga0307411_10076290 Ga0307411_100762903 220
64 3300009177 Ga0105248_10017191 Ga0105248_100171918 221
65 3300009177 Ga0105248_10019300 Ga0105248_100193006 221
66 3300025941 Ga0207711_10003023 Ga0207711_100030234 221
67 3300031995 Ga0307409_100063032 Ga0307409_1000630324 221
68 3300039437 Ga0436365_1902390 Ga0436365_1902390_211_987 221
69 3300005564 Ga0070664_100421340 Ga0070664_1004213402 223
70 3300025945 Ga0207679_10346518 Ga0207679_103465182 223
71 3300026075 Ga0207708_10087041 Ga0207708_100870414 223
72 3300031731 Ga0307405_10001143 Ga0307405_100011439 223
73 3300031911 Ga0307412_10018121 Ga0307412_100181212 223
74 3300033180 Ga0307510_10103418 Ga0307510_101034181 223
75 3300048927 Ga0496124_0092017 Ga0496124_0092017_1192_1950 223
76 3300053151 Ga0500604_0017140 Ga0500604_0017140_190_951 224
77 3300053730 Ga0500645_006610 Ga0500645_006610_1170_1919 224
78 3300005539 Ga0068853_100510370 Ga0068853_1005103702 225
79 3300006353 Ga0075370_10260992 Ga0075370_102609921 225
80 3300048924 Ga0496121_0088189 Ga0496121_0088189_802_1557 225
81 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_52715_53482 225
82 3300038443 Ga0395901_0222418 Ga0395901_0222418_71_838 226
83 3300044684 Ga0466966_0000301 Ga0466966_0000301_29235_29999 226
84 3300046524 Ga0495648_0011578 Ga0495648_0011578_4496_5254 226
85 3300005344 Ga0070661_100350579 Ga0070661_1003505792 227
86 3300025920 Ga0207649_10318133 Ga0207649_103181332 227
87 3300025921 Ga0207652_10505052 Ga0207652_105050522 227
88 3300031852 Ga0307410_10211319 Ga0307410_102113192 227
89 3300031995 Ga0307409_100042126 Ga0307409_1000421263 227
90 3300053136 Ga0500559_0014432 Ga0500559_0014432_1242_2000 227
91 3300005616 Ga0068852_100774218 Ga0068852_1007742181 228
92 3300005842 Ga0068858_100000986 Ga0068858_1000009866 228
93 3300026035 Ga0207703_10000167 Ga0207703_1000016771 228
94 3300026041 Ga0207639_10247332 Ga0207639_102473322 228
95 3300026142 Ga0207698_10506930 Ga0207698_105069301 228
96 3300035170 Ga0373943_0006039 Ga0373943_0006039_2721_3452 228
97 3300035692 Ga0373935_0308362 Ga0373935_0308362_319_1050 228
98 3300037068 Ga0373925_0011013 Ga0373925_0011013_3472_4203 228
99 3300048911 Ga0496108_0299899 Ga0496108_0299899_243_974 228
100 3300048913 Ga0496110_0023976 Ga0496110_0023976_4450_5181 228
101 3300003214 JGI25165J46597_1000071 JGI25165J46597_1000071149 229
102 3300005335 Ga0070666_10102257 Ga0070666_101022572 229
103 3300025233 Ga0209437_104409 Ga0209437_1044093 229
104 3300025261 Ga0209233_1000140 Ga0209233_100014037 229
105 3300025911 Ga0207654_10276736 Ga0207654_102767361 229
106 3300025937 Ga0207669_10001331 Ga0207669_100013312 229
107 3300026121 Ga0207683_10288989 Ga0207683_102889892 229
108 3300039450 Ga0436363_0606517 Ga0436363_0606517_22_756 229
109 3300046471 Ga0495650_0000290 Ga0495650_0000290_43859_44620 229
110 3300046506 Ga0495583_0002617 Ga0495583_0002617_9763_10524 229
111 3300046525 Ga0495663_0000533 Ga0495663_0000533_6571_7332 229
112 3300046557 Ga0495622_0128231 Ga0495622_0128231_288_1049 229
113 3300046558 Ga0495633_0019259 Ga0495633_0019259_1082_1843 229
114 3300047323 Ga0495683_0001221 Ga0495683_0001221_8090_8851 229
115 3300048924 Ga0496121_0038601 Ga0496121_0038601_1198_1956 229
116 3300049583 Ga0501067_0016612 Ga0501067_0016612_1714_2490 229
117 3300053119 Ga0500595_005185 Ga0500595_005185_4858_5619 229
118 3300049569 Ga0501032_0078028 Ga0501032_0078028_1111_1872 230
119 3300049570 Ga0501033_0007416 Ga0501033_0007416_3532_4293 230
120 3300049570 Ga0501033_0190395 Ga0501033_0190395_538_1299 230
121 3300049573 Ga0501037_0041873 Ga0501037_0041873_262_1023 230
122 3300049574 Ga0501038_0019972 Ga0501038_0019972_770_1531 230
123 3300049581 Ga0501047_0029038 Ga0501047_0029038_4282_5043 230
124 3300049581 Ga0501047_0073563 Ga0501047_0073563_294_1055 230
125 3300049767 Ga0501270_001791 Ga0501270_001791_668_1411 230
126 3300049822 Ga0501035_0069158 Ga0501035_0069158_291_1052 230
127 3300049822 Ga0501035_0560386 Ga0501035_0560386_106_867 230
128 3300049823 Ga0501044_0004024 Ga0501044_0004024_1042_1803 230
129 3300049823 Ga0501044_0146616 Ga0501044_0146616_595_1356 230
130 3300050512 nmdc:mga0n895_444082_c1 nmdc:mga0n895_444082_c1_424_1161 230
131 3300042120 Ga0450917_003634 Ga0450917_003634_317_1060 231
132 3300046460 Ga0495638_0000029 Ga0495638_0000029_215808_216569 231
133 3300046524 Ga0495648_0000020 Ga0495648_0000020_139956_140717 231
134 iso_pu_bacteria 2882806704 2882809389 231
135 iso_pu_bacteria 2885429604 2885432604 231
136 iso_pu_bacteria 2896429255 2896431432 231
137 3300005548 Ga0070665_100053287 Ga0070665_1000532873 232
138 3300025909 Ga0207705_10021171 Ga0207705_100211715 232
139 3300025920 Ga0207649_10405868 Ga0207649_104058681 232
140 3300031901 Ga0307406_10063684 Ga0307406_100636843 232
141 3300031911 Ga0307412_10077414 Ga0307412_100774143 232
142 3300046506 Ga0495583_0000147 Ga0495583_0000147_51222_51986 232
143 3300046519 Ga0495632_0000565 Ga0495632_0000565_14625_15389 232
144 3300046558 Ga0495633_0009060 Ga0495633_0009060_2894_3658 232
145 3300046692 Ga0495671_0000022 Ga0495671_0000022_141186_141950 232
146 3300047469 Ga0495673_0000051 Ga0495673_0000051_113662_114426 232
147 3300053119 Ga0500595_002981 Ga0500595_002981_6415_7176 232
148 iso_pu_bacteria 2919138771 2919143570 232
149 3300005548 Ga0070665_100000049 Ga0070665_100000049210 233
150 3300028379 Ga0268266_10000036 Ga0268266_10000036210 233
151 3300048904 Ga0496101_0088988 Ga0496101_0088988_819_1580 233
152 3300048905 Ga0496102_0000066 Ga0496102_0000066_153835_154596 233
153 3300048906 Ga0496103_0000248 Ga0496103_0000248_4448_5209 233
154 3300048908 Ga0496105_0000199 Ga0496105_0000199_34918_35679 233
155 3300048910 Ga0496107_0029046 Ga0496107_0029046_2849_3610 233
156 3300048913 Ga0496110_0015870 Ga0496110_0015870_4431_5192 233
157 3300048916 Ga0496113_0009937 Ga0496113_0009937_2020_2781 233
158 3300048918 Ga0496115_0000216 Ga0496115_0000216_47125_47886 233
159 3300048919 Ga0496116_0002551 Ga0496116_0002551_10070_10831 233
160 3300048920 Ga0496117_0000717 Ga0496117_0000717_4448_5209 233
161 3300048921 Ga0496118_0000754 Ga0496118_0000754_47122_47883 233
162 3300048922 Ga0496119_0003364 Ga0496119_0003364_8187_8948 233
163 3300048923 Ga0496120_0043993 Ga0496120_0043993_916_1677 233
164 3300048924 Ga0496121_0000954 Ga0496121_0000954_4441_5202 233
165 3300048925 Ga0496122_0011771 Ga0496122_0011771_3918_4679 233
166 3300048926 Ga0496123_0008437 Ga0496123_0008437_8580_9341 233
167 3300048927 Ga0496124_0000767 Ga0496124_0000767_47142_47903 233
168 3300048928 Ga0496125_0000229 Ga0496125_0000229_87756_88517 233
169 3300048929 Ga0496126_0000891 Ga0496126_0000891_4448_5209 233
170 3300003322 rootL2_10167713 rootL2_101677133 234
171 3300003323 rootH1_10310960 rootH1_103109601 234
172 3300006051 Ga0075364_10170292 Ga0075364_101702922 234
173 3300006177 Ga0075362_10141469 Ga0075362_101414692 234
174 3300025932 Ga0207690_10160746 Ga0207690_101607462 234
175 3300031852 Ga0307410_10120250 Ga0307410_101202503 234
176 3300031995 Ga0307409_100153145 Ga0307409_1001531452 234
177 3300032002 Ga0307416_100219558 Ga0307416_1002195583 234
178 3300048928 Ga0496125_0025306 Ga0496125_0025306_484_1245 234
179 3300050489 nmdc:mga03683_33738_c2 nmdc:mga03683_33738_c2_246_1013 234
180 3300050491 nmdc:mga00v17_1450_c1 nmdc:mga00v17_1450_c1_10974_11741 234
181 3300050507 nmdc:mga05p37_9157_c1 nmdc:mga05p37_9157_c1_9942_10709 234
182 3300050509 nmdc:mga0qj67_27138_c1 nmdc:mga0qj67_27138_c1_3063_3827 234
183 iso_pu_bacteria 2510917021 2511127776 234
184 iso_pu_bacteria 2599185354 2600203172 234
185 iso_pu_bacteria 2643221588 2643950995 234
186 iso_pu_bacteria 2751185897 2753766691 234
187 iso_pu_bacteria 2919709256 2919712652 234
188 iso_pu_bacteria 3000865235 3000868158 234
189 3300005338 Ga0068868_100000019 Ga0068868_1000000195 235
190 3300005339 Ga0070660_100014625 Ga0070660_1000146252 235
191 3300005343 Ga0070687_100451623 Ga0070687_1004516231 235
192 3300005344 Ga0070661_100159766 Ga0070661_1001597663 235
193 3300005366 Ga0070659_100000009 Ga0070659_10000000960 235
194 3300005366 Ga0070659_100165523 Ga0070659_1001655232 235
195 3300005434 Ga0070709_10070530 Ga0070709_100705302 235
196 3300005458 Ga0070681_10433898 Ga0070681_104338982 235
197 3300005539 Ga0068853_100102660 Ga0068853_1001026603 235
198 3300005539 Ga0068853_100136179 Ga0068853_1001361792 235
199 3300005543 Ga0070672_100011310 Ga0070672_1000113104 235
200 3300005614 Ga0068856_100085893 Ga0068856_1000858933 235
201 3300005617 Ga0068859_100006035 Ga0068859_1000060352 235
202 3300005719 Ga0068861_100000414 Ga0068861_10000041412 235
203 3300005937 Ga0081455_10212806 Ga0081455_102128062 235
204 3300006028 Ga0070717_10208178 Ga0070717_102081782 235
205 3300006175 Ga0070712_100203270 Ga0070712_1002032702 235
206 3300006846 Ga0075430_100033702 Ga0075430_1000337024 235
207 3300006931 Ga0097620_100006035 Ga0097620_1000060352 235
208 3300009094 Ga0111539_10260122 Ga0111539_102601222 235
209 3300009147 Ga0114129_10116412 Ga0114129_101164123 235
210 3300009147 Ga0114129_10293032 Ga0114129_102930322 235
211 3300009177 Ga0105248_10000400 Ga0105248_1000040033 235
212 3300010375 Ga0105239_10622658 Ga0105239_106226582 235
213 3300014326 Ga0157380_10507749 Ga0157380_105077492 235
214 3300025915 Ga0207693_10026672 Ga0207693_100266724 235
215 3300025919 Ga0207657_10006324 Ga0207657_100063248 235
216 3300025919 Ga0207657_10189914 Ga0207657_101899142 235
217 3300025928 Ga0207700_10539880 Ga0207700_105398801 235
218 3300025929 Ga0207664_10280228 Ga0207664_102802282 235
219 3300025932 Ga0207690_10000022 Ga0207690_10000022185 235
220 3300025941 Ga0207711_10002898 Ga0207711_1000289814 235
221 3300026023 Ga0207677_10000124 Ga0207677_100001245 235
222 3300026078 Ga0207702_10015308 Ga0207702_100153084 235
223 3300026118 Ga0207675_100000666 Ga0207675_10000066621 235
224 3300028800 Ga0265338_10047479 Ga0265338_100474793 235
225 3300044694 Ga0466963_0223929 Ga0466963_0223929_393_1145 235
226 3300045976 Ga0466967_0450672 Ga0466967_0450672_356_1108 235
227 3300049586 Ga0501070_0522088 Ga0501070_0522088_171_932 235
228 3300049823 Ga0501044_0506546 Ga0501044_0506546_79_840 235
229 3300050507 nmdc:mga05p37_123477_c1 nmdc:mga05p37_123477_c1_1005_1772 235
230 3300050507 nmdc:mga05p37_342720_c1 nmdc:mga05p37_342720_c1_488_1255 235
231 3300050511 nmdc:mga08y16_209291_c1 nmdc:mga08y16_209291_c1_851_1618 235
232 3300053177 Ga0500636_0008384 Ga0500636_0008384_3649_4410 235
233 3300053735 Ga0500596_000119 Ga0500596_000119_9065_9826 235
234 3300005328 Ga0070676_10034049 Ga0070676_100340492 236
235 3300005354 Ga0070675_100053030 Ga0070675_1000530302 236
236 3300005367 Ga0070667_100609669 Ga0070667_1006096691 236
237 3300005440 Ga0070705_100257571 Ga0070705_1002575712 236
238 3300005457 Ga0070662_100027482 Ga0070662_1000274825 236
239 3300005539 Ga0068853_100090181 Ga0068853_1000901814 236
240 3300005843 Ga0068860_100034629 Ga0068860_1000346292 236
241 3300006353 Ga0075370_10237265 Ga0075370_102372651 236
242 3300025304 Ga0209257_1010120 Ga0209257_10101206 236
243 3300025919 Ga0207657_10002591 Ga0207657_100025913 236
244 3300025926 Ga0207659_10416938 Ga0207659_104169381 236
245 3300025986 Ga0207658_10168933 Ga0207658_101689332 236
246 3300026121 Ga0207683_10278529 Ga0207683_102785292 236
247 3300028381 Ga0268264_10039114 Ga0268264_100391143 236
248 3300031711 Ga0265314_10089683 Ga0265314_100896832 236
249 3300045051 Ga0451576_0574629 Ga0451576_0574629_274_1038 236
250 3300046691 Ga0495670_0062004 Ga0495670_0062004_1075_1830 236
251 3300048905 Ga0496102_0009317 Ga0496102_0009317_7296_8051 236
252 3300049581 Ga0501047_0064618 Ga0501047_0064618_1650_2411 236
253 3300053139 Ga0500568_0037492 Ga0500568_0037492_582_1349 236
254 iso_pu_bacteria 8057101203 8057101539 236
255 3300001979 JGI24740J21852_10026015 JGI24740J21852_100260153 237
256 3300001989 JGI24739J22299_10002626 JGI24739J22299_100026262 237
257 3300003791 Ga0055530_10043565 Ga0055530_100435652 237
258 3300005329 Ga0070683_100492938 Ga0070683_1004929382 237
259 3300005339 Ga0070660_100064868 Ga0070660_1000648681 237
260 3300005530 Ga0070679_100646299 Ga0070679_1006462991 237
261 3300005535 Ga0070684_100257650 Ga0070684_1002576502 237
262 3300005578 Ga0068854_100072441 Ga0068854_1000724413 237
263 3300006177 Ga0075362_10034249 Ga0075362_100342492 237
264 3300006186 Ga0075369_10013769 Ga0075369_100137693 237
265 3300006195 Ga0075366_10101406 Ga0075366_101014062 237
266 3300009011 Ga0105251_10019640 Ga0105251_100196403 237
267 3300009148 Ga0105243_10082629 Ga0105243_100826293 237
268 3300009176 Ga0105242_10814588 Ga0105242_108145881 237
269 3300009545 Ga0105237_10002575 Ga0105237_1000257510 237
270 3300009553 Ga0105249_10011174 Ga0105249_100111743 237
271 3300013105 Ga0157369_10453915 Ga0157369_104539152 237
272 3300017792 Ga0163161_10282621 Ga0163161_102826212 237
273 3300025261 Ga0209233_1006894 Ga0209233_10068943 237
274 3300025298 Ga0209050_1000140 Ga0209050_100014026 237
275 3300025904 Ga0207647_10004308 Ga0207647_100043084 237
276 3300025909 Ga0207705_10019495 Ga0207705_100194955 237
277 3300025914 Ga0207671_10001065 Ga0207671_1000106510 237
278 3300025935 Ga0207709_10017683 Ga0207709_100176832 237
279 3300025944 Ga0207661_10221025 Ga0207661_102210252 237
280 3300025981 Ga0207640_10121377 Ga0207640_101213772 237
281 3300025986 Ga0207658_10100030 Ga0207658_101000302 237
282 3300031456 Ga0307513_10043999 Ga0307513_100439993 237
283 3300037471 Ga0395905_0084437 Ga0395905_0084437_2204_2962 237
284 3300046460 Ga0495638_0001480 Ga0495638_0001480_15188_15946 237
285 3300046492 Ga0495585_0001024 Ga0495585_0001024_6426_7187 237
286 3300046492 Ga0495585_0087436 Ga0495585_0087436_344_1105 237
287 3300046500 Ga0495596_0008830 Ga0495596_0008830_1262_2023 237
288 3300046506 Ga0495583_0019485 Ga0495583_0019485_1570_2331 237
289 3300046507 Ga0495606_0054178 Ga0495606_0054178_310_1071 237
290 3300046512 Ga0495610_0000220 Ga0495610_0000220_7000_7761 237
291 3300046515 Ga0495620_0075294 Ga0495620_0075294_286_1047 237
292 3300046522 Ga0495643_0000166 Ga0495643_0000166_72223_72984 237
293 3300046522 Ga0495643_0081907 Ga0495643_0081907_845_1606 237
294 3300046524 Ga0495648_0002711 Ga0495648_0002711_2786_3547 237
295 3300046542 Ga0495597_0004964 Ga0495597_0004964_3521_4282 237
296 3300046558 Ga0495633_0000685 Ga0495633_0000685_7239_8000 237
297 3300046616 Ga0495668_0000013 Ga0495668_0000013_180806_181567 237
298 3300046616 Ga0495668_0076747 Ga0495668_0076747_281_1042 237
299 3300046648 Ga0495611_0003692 Ga0495611_0003692_5785_6546 237
300 3300046660 Ga0495625_0023541 Ga0495625_0023541_749_1510 237
301 3300046691 Ga0495670_0014132 Ga0495670_0014132_2970_3731 237
302 3300046809 Ga0495600_0047932 Ga0495600_0047932_329_1090 237
303 3300047469 Ga0495673_0046497 Ga0495673_0046497_1117_1878 237
304 3300047470 Ga0495681_0046345 Ga0495681_0046345_1292_2053 237
305 3300048913 Ga0496110_0303493 Ga0496110_0303493_570_1331 237
306 3300048914 Ga0496111_0173569 Ga0496111_0173569_730_1491 237
307 3300048919 Ga0496116_0000279 Ga0496116_0000279_41525_42307 237
308 3300048924 Ga0496121_0024707 Ga0496121_0024707_687_1445 237
309 3300048924 Ga0496121_0119116 Ga0496121_0119116_1055_1816 237
310 3300048925 Ga0496122_0003528 Ga0496122_0003528_19477_20259 237
311 3300048925 Ga0496122_0013679 Ga0496122_0013679_6402_7184 237
312 3300048925 Ga0496122_0015070 Ga0496122_0015070_6425_7186 237
313 3300048926 Ga0496123_0000684 Ga0496123_0000684_10296_11078 237
314 3300048926 Ga0496123_0056302 Ga0496123_0056302_1614_2375 237
315 3300048927 Ga0496124_0001301 Ga0496124_0001301_34737_35519 237
316 3300048928 Ga0496125_0002679 Ga0496125_0002679_18869_19630 237
317 3300048928 Ga0496125_0017789 Ga0496125_0017789_3280_4062 237
318 3300048929 Ga0496126_0007119 Ga0496126_0007119_262_1044 237
319 3300048929 Ga0496126_0346070 Ga0496126_0346070_252_1013 237
320 3300048929 Ga0496126_0385991 Ga0496126_0385991_358_1116 237
321 3300049744 Ga0501083_0214106 Ga0501083_0214106_58_825 237
322 3300050489 nmdc:mga03683_9114_c1 nmdc:mga03683_9114_c1_952_1716 237
323 3300053079 Ga0500610_0002615 Ga0500610_0002615_5414_6175 237
324 3300053096 Ga0500641_0039472 Ga0500641_0039472_1126_1884 237
325 3300053121 Ga0500607_000102 Ga0500607_000102_63517_64284 237
326 3300053130 Ga0500642_0000543 Ga0500642_0000543_7289_8050 237
327 3300053134 Ga0500658_0002034 Ga0500658_0002034_1771_2529 237
328 3300053139 Ga0500568_0021149 Ga0500568_0021149_1402_2160 237
329 3300053146 Ga0500588_0028133 Ga0500588_0028133_494_1255 237
330 3300053153 Ga0500616_0033403 Ga0500616_0033403_749_1507 237
331 3300001990 JGI24737J22298_10002252 JGI24737J22298_100022524 238
332 3300002067 JGI24735J21928_10060453 JGI24735J21928_100604532 238
333 3300005327 Ga0070658_10142169 Ga0070658_101421692 238
334 3300005327 Ga0070658_10345275 Ga0070658_103452751 238
335 3300005336 Ga0070680_100260340 Ga0070680_1002603402 238
336 3300005337 Ga0070682_100079366 Ga0070682_1000793662 238
337 3300005339 Ga0070660_100133185 Ga0070660_1001331852 238
338 3300005339 Ga0070660_100154406 Ga0070660_1001544062 238
339 3300005344 Ga0070661_100183768 Ga0070661_1001837682 238
340 3300005366 Ga0070659_100010016 Ga0070659_1000100164 238
341 3300005366 Ga0070659_100038415 Ga0070659_1000384154 238
342 3300005366 Ga0070659_100117957 Ga0070659_1001179572 238
343 3300005457 Ga0070662_100004883 Ga0070662_1000048833 238
344 3300005457 Ga0070662_100249997 Ga0070662_1002499972 238
345 3300005458 Ga0070681_10063149 Ga0070681_100631492 238
346 3300005458 Ga0070681_10521002 Ga0070681_105210022 238
347 3300005471 Ga0070698_100313275 Ga0070698_1003132752 238
348 3300005530 Ga0070679_100014028 Ga0070679_1000140281 238
349 3300005530 Ga0070679_100038477 Ga0070679_1000384773 238
350 3300005530 Ga0070679_100040229 Ga0070679_1000402291 238
351 3300005530 Ga0070679_100304841 Ga0070679_1003048411 238
352 3300005535 Ga0070684_100390431 Ga0070684_1003904312 238
353 3300005539 Ga0068853_100007960 Ga0068853_1000079603 238
354 3300005539 Ga0068853_100056439 Ga0068853_1000564392 238
355 3300005546 Ga0070696_100011558 Ga0070696_1000115583 238
356 3300005547 Ga0070693_100178794 Ga0070693_1001787942 238
357 3300005563 Ga0068855_100002861 Ga0068855_10000286115 238
358 3300005563 Ga0068855_100032263 Ga0068855_1000322633 238
359 3300005563 Ga0068855_100064616 Ga0068855_1000646162 238
360 3300005578 Ga0068854_100025243 Ga0068854_1000252432 238
361 3300005578 Ga0068854_100325360 Ga0068854_1003253602 238
362 3300005614 Ga0068856_100034050 Ga0068856_1000340505 238
363 3300005616 Ga0068852_100628212 Ga0068852_1006282122 238
364 3300005983 Ga0081540_1065923 Ga0081540_10659232 238
365 3300006353 Ga0075370_10002507 Ga0075370_100025072 238
366 3300009093 Ga0105240_10035590 Ga0105240_100355901 238
367 3300009093 Ga0105240_10074553 Ga0105240_100745532 238
368 3300009094 Ga0111539_10133704 Ga0111539_101337042 238
369 3300009147 Ga0114129_10751408 Ga0114129_107514082 238
370 3300009174 Ga0105241_10120633 Ga0105241_101206332 238
371 3300009553 Ga0105249_10190214 Ga0105249_101902142 238
372 3300011119 Ga0105246_10000160 Ga0105246_1000016010 238
373 3300013100 Ga0157373_10327634 Ga0157373_103276342 238
374 3300013102 Ga0157371_10036127 Ga0157371_100361272 238
375 3300013104 Ga0157370_10114356 Ga0157370_101143563 238
376 3300013105 Ga0157369_10039817 Ga0157369_100398172 238
377 3300013105 Ga0157369_10138316 Ga0157369_101383163 238
378 3300013307 Ga0157372_10028966 Ga0157372_100289662 238
379 3300013308 Ga0157375_10160157 Ga0157375_101601573 238
380 3300025893 Ga0207682_10171435 Ga0207682_101714351 238
381 3300025904 Ga0207647_10058442 Ga0207647_100584423 238
382 3300025909 Ga0207705_10002734 Ga0207705_100027342 238
383 3300025909 Ga0207705_10158196 Ga0207705_101581962 238
384 3300025909 Ga0207705_10410980 Ga0207705_104109801 238
385 3300025913 Ga0207695_10031036 Ga0207695_100310366 238
386 3300025917 Ga0207660_10073175 Ga0207660_100731753 238
387 3300025919 Ga0207657_10004362 Ga0207657_100043629 238
388 3300025919 Ga0207657_10022552 Ga0207657_100225528 238
389 3300025919 Ga0207657_10173661 Ga0207657_101736612 238
390 3300025921 Ga0207652_10003272 Ga0207652_100032727 238
391 3300025921 Ga0207652_10085290 Ga0207652_100852902 238
392 3300025921 Ga0207652_10087574 Ga0207652_100875742 238
393 3300025932 Ga0207690_10012242 Ga0207690_100122424 238
394 3300025933 Ga0207706_10010997 Ga0207706_100109973 238
395 3300025933 Ga0207706_10523470 Ga0207706_105234701 238
396 3300025945 Ga0207679_10098482 Ga0207679_100984822 238
397 3300025949 Ga0207667_10001580 Ga0207667_100015803 238
398 3300025949 Ga0207667_10002922 Ga0207667_1000292215 238
399 3300025961 Ga0207712_10151782 Ga0207712_101517821 238
400 3300025981 Ga0207640_10271989 Ga0207640_102719892 238
401 3300026041 Ga0207639_10029025 Ga0207639_100290252 238
402 3300026041 Ga0207639_10043252 Ga0207639_100432523 238
403 3300026041 Ga0207639_10170958 Ga0207639_101709582 238
404 3300026067 Ga0207678_10078097 Ga0207678_100780972 238
405 3300026067 Ga0207678_10196956 Ga0207678_101969562 238
406 3300026116 Ga0207674_10042600 Ga0207674_100426002 238
407 3300031616 Ga0307508_10001242 Ga0307508_100012426 238
408 3300031731 Ga0307405_10185068 Ga0307405_101850682 238
409 3300031731 Ga0307405_10494911 Ga0307405_104949111 238
410 3300031824 Ga0307413_10001436 Ga0307413_100014365 238
411 3300031824 Ga0307413_10026883 Ga0307413_100268832 238
412 3300031824 Ga0307413_10166587 Ga0307413_101665872 238
413 3300031852 Ga0307410_10008488 Ga0307410_100084884 238
414 3300031852 Ga0307410_10135805 Ga0307410_101358052 238
415 3300031852 Ga0307410_10221435 Ga0307410_102214351 238
416 3300031903 Ga0307407_10005183 Ga0307407_100051835 238
417 3300031911 Ga0307412_10004442 Ga0307412_100044426 238
418 3300031995 Ga0307409_100022011 Ga0307409_1000220112 238
419 3300031995 Ga0307409_100234250 Ga0307409_1002342501 238
420 3300032004 Ga0307414_10039799 Ga0307414_100397992 238
421 3300032004 Ga0307414_10144556 Ga0307414_101445562 238
422 3300032004 Ga0307414_10479712 Ga0307414_104797121 238
423 3300032005 Ga0307411_10078928 Ga0307411_100789282 238
424 3300032005 Ga0307411_10500354 Ga0307411_105003541 238
425 3300039450 Ga0436363_1122466 Ga0436363_1122466_38_802 238
426 3300042116 Ga0450912_000302 Ga0450912_000302_515_1276 238
427 3300042142 Ga0450905_004102 Ga0450905_004102_1079_1840 238
428 3300042144 Ga0450889_000006 Ga0450889_000006_612_1373 238
429 3300044842 Ga0466957_0097773 Ga0466957_0097773_855_1616 238
430 3300045836 Ga0466958_0262411 Ga0466958_0262411_193_954 238
431 3300046460 Ga0495638_0074540 Ga0495638_0074540_297_1058 238
432 3300046491 Ga0495584_0004125 Ga0495584_0004125_1491_2258 238
433 3300046500 Ga0495596_0000091 Ga0495596_0000091_55490_56254 238
434 3300046506 Ga0495583_0034629 Ga0495583_0034629_990_1754 238
435 3300046513 Ga0495616_0000009 Ga0495616_0000009_114715_115476 238
436 3300046519 Ga0495632_0000047 Ga0495632_0000047_21705_22472 238
437 3300046519 Ga0495632_0071777 Ga0495632_0071777_440_1204 238
438 3300046522 Ga0495643_0007008 Ga0495643_0007008_5453_6217 238
439 3300046524 Ga0495648_0009822 Ga0495648_0009822_2672_3439 238
440 3300046525 Ga0495663_0000017 Ga0495663_0000017_21711_22478 238
441 3300046538 Ga0495609_0004809 Ga0495609_0004809_4988_5752 238
442 3300046558 Ga0495633_0000496 Ga0495633_0000496_4255_5022 238
443 3300046558 Ga0495633_0000737 Ga0495633_0000737_6897_7664 238
444 3300046648 Ga0495611_0037085 Ga0495611_0037085_1271_2032 238
445 3300046660 Ga0495625_0012837 Ga0495625_0012837_218_979 238
446 3300046660 Ga0495625_0020250 Ga0495625_0020250_1922_2686 238
447 3300047470 Ga0495681_0084971 Ga0495681_0084971_544_1308 238
448 3300047472 Ga0495686_0046805 Ga0495686_0046805_467_1234 238
449 3300048924 Ga0496121_0009641 Ga0496121_0009641_8330_9091 238
450 3300048925 Ga0496122_0000385 Ga0496122_0000385_72645_73406 238
451 3300048926 Ga0496123_0000220 Ga0496123_0000220_79592_80353 238
452 3300048928 Ga0496125_0032271 Ga0496125_0032271_434_1198 238
453 3300049570 Ga0501033_0097399 Ga0501033_0097399_785_1546 238
454 3300049742 Ga0501080_0707770 Ga0501080_0707770_95_856 238
455 3300049823 Ga0501044_0005674 Ga0501044_0005674_1288_2055 238
456 3300049823 Ga0501044_0172839 Ga0501044_0172839_1196_1957 238
457 3300050493 nmdc:mga0k408_12448_c1 nmdc:mga0k408_12448_c1_3869_4636 238
458 3300050496 nmdc:mga07m45_2592_c1 nmdc:mga07m45_2592_c1_7423_8190 238
459 3300050496 nmdc:mga07m45_5623_c1 nmdc:mga07m45_5623_c1_4193_4960 238
460 3300053087 Ga0500643_008453 Ga0500643_008453_558_1319 238
461 3300053104 Ga0500556_0000217 Ga0500556_0000217_24640_25401 238
462 3300053105 Ga0500557_079179 Ga0500557_079179_161_922 238
463 3300053121 Ga0500607_000070 Ga0500607_000070_53618_54397 238
464 3300053122 Ga0500608_127336 Ga0500608_127336_26_787 238
465 3300053130 Ga0500642_0000001 Ga0500642_0000001_425412_426173 238
466 3300053136 Ga0500559_0002376 Ga0500559_0002376_4348_5109 238
467 3300053136 Ga0500559_0009272 Ga0500559_0009272_3344_4123 238
468 3300053142 Ga0500577_0203930 Ga0500577_0203930_69_833 238
469 3300053151 Ga0500604_0003053 Ga0500604_0003053_1431_2192 238
470 3300053730 Ga0500645_000148 Ga0500645_000148_22254_23015 238
471 3300053730 Ga0500645_003044 Ga0500645_003044_5152_5931 238
472 3300001904 JGI24736J21556_1003886 JGI24736J21556_10038863 239
473 3300001915 JGI24741J21665_1000617 JGI24741J21665_10006176 239
474 3300001979 JGI24740J21852_10003183 JGI24740J21852_100031837 239
475 3300001979 JGI24740J21852_10004741 JGI24740J21852_100047412 239
476 3300001979 JGI24740J21852_10010219 JGI24740J21852_100102191 239
477 3300001989 JGI24739J22299_10000035 JGI24739J22299_1000003521 239
478 3300001989 JGI24739J22299_10001730 JGI24739J22299_100017303 239
479 3300001990 JGI24737J22298_10000020 JGI24737J22298_1000002014 239
480 3300001990 JGI24737J22298_10000167 JGI24737J22298_100001673 239
481 3300001991 JGI24743J22301_10021275 JGI24743J22301_100212752 239
482 3300002067 JGI24735J21928_10017959 JGI24735J21928_100179593 239
483 3300002075 JGI24738J21930_10000050 JGI24738J21930_1000005012 239
484 3300002244 JGI24742J22300_10007668 JGI24742J22300_100076682 239
485 3300002774 JGI25150J39212_1000658 JGI25150J39212_100065816 239
486 3300003215 JGI25153J46596_10000008 JGI25153J46596_1000000827 239
487 3300003215 JGI25153J46596_10000183 JGI25153J46596_1000018316 239
488 3300003762 Ga0055542_1000038 Ga0055542_1000038116 239
489 3300003763 Ga0055529_1000002 Ga0055529_1000002392 239
490 3300003763 Ga0055529_1000021 Ga0055529_100002188 239
491 3300003771 Ga0055526_1007617 Ga0055526_10076174 239
492 3300003791 Ga0055530_10034994 Ga0055530_100349941 239
493 3300003791 Ga0055530_10037292 Ga0055530_100372921 239
494 3300003792 Ga0055540_1006104 Ga0055540_10061044 239
495 3300003794 Ga0055531_10043203 Ga0055531_100432031 239
496 3300003794 Ga0055531_10045520 Ga0055531_100455201 239
497 3300005262 Ga0065165_1004893 Ga0065165_10048936 239
498 3300005290 Ga0065712_10131800 Ga0065712_101318002 239
499 3300005327 Ga0070658_10000246 Ga0070658_1000024639 239
500 3300005327 Ga0070658_10003252 Ga0070658_1000325211 239
501 3300005327 Ga0070658_10009024 Ga0070658_100090248 239
502 3300005328 Ga0070676_10003530 Ga0070676_100035307 239
503 3300005330 Ga0070690_100156555 Ga0070690_1001565552 239
504 3300005331 Ga0070670_100007537 Ga0070670_1000075377 239
505 3300005331 Ga0070670_100014177 Ga0070670_1000141778 239
506 3300005331 Ga0070670_100105231 Ga0070670_1001052312 239
507 3300005331 Ga0070670_100160248 Ga0070670_1001602482 239
508 3300005331 Ga0070670_100526559 Ga0070670_1005265592 239
509 3300005333 Ga0070677_10012331 Ga0070677_100123313 239
510 3300005333 Ga0070677_10021855 Ga0070677_100218552 239
511 3300005334 Ga0068869_100000043 Ga0068869_10000004336 239
512 3300005335 Ga0070666_10000090 Ga0070666_100000908 239
513 3300005338 Ga0068868_100001402 Ga0068868_1000014024 239
514 3300005339 Ga0070660_100000415 Ga0070660_1000004158 239
515 3300005347 Ga0070668_100000062 Ga0070668_10000006210 239
516 3300005347 Ga0070668_100075301 Ga0070668_1000753012 239
517 3300005347 Ga0070668_100183067 Ga0070668_1001830672 239
518 3300005353 Ga0070669_100000024 Ga0070669_10000002483 239
519 3300005353 Ga0070669_100000209 Ga0070669_10000020923 239
520 3300005353 Ga0070669_100015859 Ga0070669_1000158592 239
521 3300005354 Ga0070675_100016633 Ga0070675_1000166334 239
522 3300005354 Ga0070675_100184593 Ga0070675_1001845932 239
523 3300005355 Ga0070671_100000006 Ga0070671_100000006170 239
524 3300005355 Ga0070671_100000174 Ga0070671_10000017410 239
525 3300005355 Ga0070671_100016942 Ga0070671_1000169424 239
526 3300005355 Ga0070671_100077682 Ga0070671_1000776823 239
527 3300005355 Ga0070671_100167379 Ga0070671_1001673791 239
528 3300005355 Ga0070671_100178291 Ga0070671_1001782912 239
529 3300005355 Ga0070671_100305719 Ga0070671_1003057192 239
530 3300005356 Ga0070674_100000168 Ga0070674_1000001681 239
531 3300005356 Ga0070674_100214774 Ga0070674_1002147742 239
532 3300005364 Ga0070673_100000440 Ga0070673_10000044013 239
533 3300005364 Ga0070673_100161375 Ga0070673_1001613752 239
534 3300005364 Ga0070673_100634640 Ga0070673_1006346401 239
535 3300005366 Ga0070659_100000903 Ga0070659_1000009037 239
536 3300005366 Ga0070659_100070355 Ga0070659_1000703552 239
537 3300005367 Ga0070667_100000160 Ga0070667_10000016086 239
538 3300005367 Ga0070667_100002316 Ga0070667_1000023164 239
539 3300005367 Ga0070667_100235951 Ga0070667_1002359512 239
540 3300005367 Ga0070667_100239281 Ga0070667_1002392811 239
541 3300005367 Ga0070667_100256563 Ga0070667_1002565631 239
542 3300005445 Ga0070708_100414317 Ga0070708_1004143172 239
543 3300005456 Ga0070678_100000122 Ga0070678_10000012217 239
544 3300005456 Ga0070678_100120811 Ga0070678_1001208112 239
545 3300005457 Ga0070662_100000324 Ga0070662_10000032421 239
546 3300005457 Ga0070662_100032561 Ga0070662_1000325613 239
547 3300005457 Ga0070662_100088478 Ga0070662_1000884783 239
548 3300005458 Ga0070681_10599998 Ga0070681_105999982 239
549 3300005459 Ga0068867_100001209 Ga0068867_1000012097 239
550 3300005459 Ga0068867_100012453 Ga0068867_1000124535 239
551 3300005539 Ga0068853_100004143 Ga0068853_1000041434 239
552 3300005539 Ga0068853_100078085 Ga0068853_1000780852 239
553 3300005539 Ga0068853_100116760 Ga0068853_1001167602 239
554 3300005539 Ga0068853_100290209 Ga0068853_1002902091 239
555 3300005543 Ga0070672_100275293 Ga0070672_1002752932 239
556 3300005543 Ga0070672_100359658 Ga0070672_1003596581 239
557 3300005543 Ga0070672_100617201 Ga0070672_1006172011 239
558 3300005544 Ga0070686_100000059 Ga0070686_10000005931 239
559 3300005547 Ga0070693_100093519 Ga0070693_1000935192 239
560 3300005548 Ga0070665_100000024 Ga0070665_10000002469 239
561 3300005548 Ga0070665_100000541 Ga0070665_10000054112 239
562 3300005548 Ga0070665_100057319 Ga0070665_1000573191 239
563 3300005548 Ga0070665_100557937 Ga0070665_1005579371 239
564 3300005563 Ga0068855_100000780 Ga0068855_10000078018 239
565 3300005563 Ga0068855_100076235 Ga0068855_1000762355 239
566 3300005564 Ga0070664_100010085 Ga0070664_1000100857 239
567 3300005564 Ga0070664_100169999 Ga0070664_1001699992 239
568 3300005564 Ga0070664_100242350 Ga0070664_1002423502 239
569 3300005564 Ga0070664_100447181 Ga0070664_1004471812 239
570 3300005577 Ga0068857_100001963 Ga0068857_10000196311 239
571 3300005577 Ga0068857_100016345 Ga0068857_1000163456 239
572 3300005578 Ga0068854_100004099 Ga0068854_1000040998 239
573 3300005616 Ga0068852_100000562 Ga0068852_10000056225 239
574 3300005616 Ga0068852_100022610 Ga0068852_1000226102 239
575 3300005616 Ga0068852_100186517 Ga0068852_1001865172 239
576 3300005616 Ga0068852_100589012 Ga0068852_1005890122 239
577 3300005617 Ga0068859_100000934 Ga0068859_1000009348 239
578 3300005617 Ga0068859_100003670 Ga0068859_10000367013 239
579 3300005617 Ga0068859_100005706 Ga0068859_1000057064 239
580 3300005618 Ga0068864_100000181 Ga0068864_10000018121 239
581 3300005618 Ga0068864_100000560 Ga0068864_1000005606 239
582 3300005618 Ga0068864_100010323 Ga0068864_1000103237 239
583 3300005618 Ga0068864_100020751 Ga0068864_1000207515 239
584 3300005618 Ga0068864_100048137 Ga0068864_1000481373 239
585 3300005719 Ga0068861_100052916 Ga0068861_1000529164 239
586 3300005719 Ga0068861_100536875 Ga0068861_1005368752 239
587 3300005834 Ga0068851_10144683 Ga0068851_101446832 239
588 3300005841 Ga0068863_100000011 Ga0068863_100000011114 239
589 3300005841 Ga0068863_100003320 Ga0068863_10000332016 239
590 3300005841 Ga0068863_100020361 Ga0068863_1000203615 239
591 3300005841 Ga0068863_100028370 Ga0068863_1000283703 239
592 3300005841 Ga0068863_100062424 Ga0068863_1000624243 239
593 3300005841 Ga0068863_100078666 Ga0068863_1000786662 239
594 3300005842 Ga0068858_100000338 Ga0068858_10000033826 239
595 3300005842 Ga0068858_100002349 Ga0068858_10000234914 239
596 3300005842 Ga0068858_100188402 Ga0068858_1001884022 239
597 3300005843 Ga0068860_100010006 Ga0068860_1000100064 239
598 3300005843 Ga0068860_100014755 Ga0068860_1000147552 239
599 3300005843 Ga0068860_100017212 Ga0068860_1000172125 239
600 3300005843 Ga0068860_100028785 Ga0068860_1000287854 239
601 3300005843 Ga0068860_100036466 Ga0068860_1000364664 239
602 3300005843 Ga0068860_100258680 Ga0068860_1002586803 239
603 3300005843 Ga0068860_100483411 Ga0068860_1004834112 239
604 3300005844 Ga0068862_100000307 Ga0068862_10000030729 239
605 3300005844 Ga0068862_100003180 Ga0068862_10000318014 239
606 3300005844 Ga0068862_100130515 Ga0068862_1001305152 239
607 3300005844 Ga0068862_100178377 Ga0068862_1001783772 239
608 3300006237 Ga0097621_100027264 Ga0097621_1000272645 239
609 3300006237 Ga0097621_100074960 Ga0097621_1000749602 239
610 3300006237 Ga0097621_100304594 Ga0097621_1003045942 239
611 3300006881 Ga0068865_100000775 Ga0068865_10000077511 239
612 3300006931 Ga0097620_100000934 Ga0097620_10000093426 239
613 3300006931 Ga0097620_100003670 Ga0097620_10000367013 239
614 3300006931 Ga0097620_100005706 Ga0097620_1000057064 239
615 3300009093 Ga0105240_10348809 Ga0105240_103488093 239
616 3300009094 Ga0111539_10043818 Ga0111539_100438186 239
617 3300009098 Ga0105245_10000120 Ga0105245_1000012010 239
618 3300009098 Ga0105245_10001533 Ga0105245_100015336 239
619 3300009098 Ga0105245_10078423 Ga0105245_100784232 239
620 3300009098 Ga0105245_10934896 Ga0105245_109348961 239
621 3300009101 Ga0105247_10004401 Ga0105247_100044019 239
622 3300009148 Ga0105243_10000113 Ga0105243_1000011350 239
623 3300009148 Ga0105243_10019774 Ga0105243_100197745 239
624 3300009174 Ga0105241_10025707 Ga0105241_100257075 239
625 3300009177 Ga0105248_10000256 Ga0105248_1000025631 239
626 3300009177 Ga0105248_10146066 Ga0105248_101460662 239
627 3300009177 Ga0105248_10164291 Ga0105248_101642912 239
628 3300009177 Ga0105248_10168191 Ga0105248_101681913 239
629 3300009553 Ga0105249_10009644 Ga0105249_100096444 239
630 3300009553 Ga0105249_10441162 Ga0105249_104411622 239
631 3300010375 Ga0105239_10075291 Ga0105239_100752912 239
632 3300011119 Ga0105246_10001420 Ga0105246_100014205 239
633 3300013100 Ga0157373_10002630 Ga0157373_100026303 239
634 3300013100 Ga0157373_10038833 Ga0157373_100388335 239
635 3300013100 Ga0157373_10049331 Ga0157373_100493313 239
636 3300013102 Ga0157371_10000114 Ga0157371_1000011497 239
637 3300013102 Ga0157371_10002108 Ga0157371_1000210815 239
638 3300013102 Ga0157371_10373290 Ga0157371_103732902 239
639 3300013296 Ga0157374_10225674 Ga0157374_102256743 239
640 3300013297 Ga0157378_10044452 Ga0157378_100444523 239
641 3300013306 Ga0163162_10020908 Ga0163162_100209082 239
642 3300013306 Ga0163162_10102278 Ga0163162_101022783 239
643 3300013306 Ga0163162_10220426 Ga0163162_102204262 239
644 3300013308 Ga0157375_10198094 Ga0157375_101980942 239
645 3300013308 Ga0157375_10447835 Ga0157375_104478351 239
646 3300013308 Ga0157375_10598194 Ga0157375_105981942 239
647 3300014325 Ga0163163_10111881 Ga0163163_101118813 239
648 3300014745 Ga0157377_10181641 Ga0157377_101816412 239
649 3300014968 Ga0157379_10375636 Ga0157379_103756361 239
650 3300014968 Ga0157379_10520736 Ga0157379_105207362 239
651 3300017792 Ga0163161_10012240 Ga0163161_100122405 239
652 3300017792 Ga0163161_10088745 Ga0163161_100887453 239
653 3300020070 Ga0206356_11779621 Ga0206356_117796212 239
654 3300025230 Ga0209563_100081 Ga0209563_100081177 239
655 3300025245 Ga0207425_1000005 Ga0207425_1000005468 239
656 3300025254 Ga0209148_1000008 Ga0209148_10000081109 239
657 3300025258 Ga0209129_1000526 Ga0209129_10005266 239
658 3300025263 Ga0209565_1000044 Ga0209565_100004449 239
659 3300025272 Ga0209455_1000002 Ga0209455_1000002316 239
660 3300025273 Ga0209673_1022156 Ga0209673_10221562 239
661 3300025292 Ga0209676_1006640 Ga0209676_10066403 239
662 3300025292 Ga0209676_1015467 Ga0209676_10154671 239
663 3300025294 Ga0209025_1000128 Ga0209025_1000128114 239
664 3300025297 Ga0209758_1000002 Ga0209758_1000002876 239
665 3300025297 Ga0209758_1000017 Ga0209758_1000017384 239
666 3300025298 Ga0209050_1000001 Ga0209050_1000001870 239
667 3300025298 Ga0209050_1011915 Ga0209050_10119153 239
668 3300025303 Ga0209051_1000797 Ga0209051_100079712 239
669 3300025304 Ga0209257_1002519 Ga0209257_10025194 239
670 3300025304 Ga0209257_1002670 Ga0209257_10026704 239
671 3300025315 Ga0207697_10000244 Ga0207697_1000024417 239
672 3300025315 Ga0207697_10000260 Ga0207697_100002606 239
673 3300025315 Ga0207697_10009084 Ga0207697_100090843 239
674 3300025893 Ga0207682_10000110 Ga0207682_100001109 239
675 3300025893 Ga0207682_10037745 Ga0207682_100377453 239
676 3300025893 Ga0207682_10062222 Ga0207682_100622222 239
677 3300025900 Ga0207710_10011691 Ga0207710_100116912 239
678 3300025901 Ga0207688_10000225 Ga0207688_1000022511 239
679 3300025901 Ga0207688_10068543 Ga0207688_100685434 239
680 3300025901 Ga0207688_10087540 Ga0207688_100875403 239
681 3300025901 Ga0207688_10135512 Ga0207688_101355122 239
682 3300025903 Ga0207680_10000439 Ga0207680_1000043914 239
683 3300025904 Ga0207647_10000052 Ga0207647_1000005235 239
684 3300025907 Ga0207645_10011101 Ga0207645_100111015 239
685 3300025907 Ga0207645_10081385 Ga0207645_100813853 239
686 3300025909 Ga0207705_10000658 Ga0207705_1000065813 239
687 3300025909 Ga0207705_10004744 Ga0207705_100047444 239
688 3300025909 Ga0207705_10260726 Ga0207705_102607262 239
689 3300025909 Ga0207705_10366033 Ga0207705_103660332 239
690 3300025911 Ga0207654_10014233 Ga0207654_100142335 239
691 3300025912 Ga0207707_10011692 Ga0207707_100116926 239
692 3300025912 Ga0207707_10186703 Ga0207707_101867032 239
693 3300025913 Ga0207695_10355166 Ga0207695_103551661 239
694 3300025914 Ga0207671_10017233 Ga0207671_100172333 239
695 3300025917 Ga0207660_10570949 Ga0207660_105709491 239
696 3300025919 Ga0207657_10002788 Ga0207657_1000278812 239
697 3300025919 Ga0207657_10014781 Ga0207657_100147816 239
698 3300025920 Ga0207649_10000104 Ga0207649_100001045 239
699 3300025920 Ga0207649_10055556 Ga0207649_100555562 239
700 3300025923 Ga0207681_10000004 Ga0207681_10000004259 239
701 3300025923 Ga0207681_10002587 Ga0207681_1000258711 239
702 3300025923 Ga0207681_10016147 Ga0207681_100161474 239
703 3300025923 Ga0207681_10110407 Ga0207681_101104072 239
704 3300025924 Ga0207694_10007740 Ga0207694_100077405 239
705 3300025924 Ga0207694_10422429 Ga0207694_104224292 239
706 3300025925 Ga0207650_10004421 Ga0207650_100044219 239
707 3300025925 Ga0207650_10006658 Ga0207650_100066585 239
708 3300025925 Ga0207650_10187840 Ga0207650_101878402 239
709 3300025925 Ga0207650_10212543 Ga0207650_102125433 239
710 3300025926 Ga0207659_10662489 Ga0207659_106624891 239
711 3300025927 Ga0207687_10006406 Ga0207687_100064068 239
712 3300025927 Ga0207687_10334769 Ga0207687_103347692 239
713 3300025927 Ga0207687_10584201 Ga0207687_105842011 239
714 3300025931 Ga0207644_10000009 Ga0207644_1000000981 239
715 3300025931 Ga0207644_10000021 Ga0207644_10000021115 239
716 3300025931 Ga0207644_10010959 Ga0207644_100109595 239
717 3300025931 Ga0207644_10101729 Ga0207644_101017292 239
718 3300025932 Ga0207690_10000463 Ga0207690_1000046321 239
719 3300025932 Ga0207690_10002801 Ga0207690_100028015 239
720 3300025932 Ga0207690_10017740 Ga0207690_100177405 239
721 3300025932 Ga0207690_10232839 Ga0207690_102328393 239
722 3300025933 Ga0207706_10001178 Ga0207706_100011784 239
723 3300025933 Ga0207706_10044088 Ga0207706_100440883 239
724 3300025935 Ga0207709_10000116 Ga0207709_10000116120 239
725 3300025935 Ga0207709_10252183 Ga0207709_102521832 239
726 3300025937 Ga0207669_10001099 Ga0207669_100010991 239
727 3300025937 Ga0207669_10180270 Ga0207669_101802702 239
728 3300025938 Ga0207704_10015412 Ga0207704_100154124 239
729 3300025940 Ga0207691_10042920 Ga0207691_100429202 239
730 3300025940 Ga0207691_10144798 Ga0207691_101447983 239
731 3300025940 Ga0207691_10210733 Ga0207691_102107332 239
732 3300025940 Ga0207691_10328355 Ga0207691_103283552 239
733 3300025941 Ga0207711_10004639 Ga0207711_100046394 239
734 3300025941 Ga0207711_10015981 Ga0207711_100159816 239
735 3300025941 Ga0207711_10103189 Ga0207711_101031894 239
736 3300025941 Ga0207711_10106342 Ga0207711_101063423 239
737 3300025942 Ga0207689_10000014 Ga0207689_1000001483 239
738 3300025945 Ga0207679_10019370 Ga0207679_100193702 239
739 3300025945 Ga0207679_10035886 Ga0207679_100358862 239
740 3300025945 Ga0207679_10138734 Ga0207679_101387342 239
741 3300025949 Ga0207667_10000001 Ga0207667_10000001472 239
742 3300025949 Ga0207667_10077441 Ga0207667_100774415 239
743 3300025960 Ga0207651_10000310 Ga0207651_1000031012 239
744 3300025960 Ga0207651_10221217 Ga0207651_102212172 239
745 3300025961 Ga0207712_10008477 Ga0207712_100084772 239
746 3300025961 Ga0207712_10087965 Ga0207712_100879653 239
747 3300025972 Ga0207668_10000083 Ga0207668_1000008351 239
748 3300025972 Ga0207668_10004935 Ga0207668_100049352 239
749 3300025972 Ga0207668_10034311 Ga0207668_100343112 239
750 3300025972 Ga0207668_10348194 Ga0207668_103481942 239
751 3300025972 Ga0207668_10776347 Ga0207668_107763471 239
752 3300025981 Ga0207640_10001199 Ga0207640_100011997 239
753 3300025986 Ga0207658_10000710 Ga0207658_100007105 239
754 3300025986 Ga0207658_10005707 Ga0207658_100057078 239
755 3300025986 Ga0207658_10009884 Ga0207658_100098842 239
756 3300025986 Ga0207658_10444397 Ga0207658_104443971 239
757 3300026023 Ga0207677_10000776 Ga0207677_1000077615 239
758 3300026035 Ga0207703_10001172 Ga0207703_1000117217 239
759 3300026035 Ga0207703_10014614 Ga0207703_100146142 239
760 3300026035 Ga0207703_10031140 Ga0207703_100311402 239
761 3300026041 Ga0207639_10004768 Ga0207639_1000476811 239
762 3300026041 Ga0207639_10011215 Ga0207639_100112153 239
763 3300026041 Ga0207639_10027474 Ga0207639_100274744 239
764 3300026041 Ga0207639_10076856 Ga0207639_100768561 239
765 3300026041 Ga0207639_10346209 Ga0207639_103462092 239
766 3300026041 Ga0207639_10465081 Ga0207639_104650812 239
767 3300026067 Ga0207678_10004862 Ga0207678_100048626 239
768 3300026067 Ga0207678_10013560 Ga0207678_100135604 239
769 3300026067 Ga0207678_10082279 Ga0207678_100822794 239
770 3300026067 Ga0207678_10122757 Ga0207678_101227573 239
771 3300026078 Ga0207702_10001591 Ga0207702_100015917 239
772 3300026088 Ga0207641_10000028 Ga0207641_10000028114 239
773 3300026088 Ga0207641_10007019 Ga0207641_100070197 239
774 3300026088 Ga0207641_10019628 Ga0207641_100196283 239
775 3300026088 Ga0207641_10025186 Ga0207641_100251865 239
776 3300026088 Ga0207641_10031560 Ga0207641_100315603 239
777 3300026088 Ga0207641_10048852 Ga0207641_100488523 239
778 3300026089 Ga0207648_10001420 Ga0207648_100014204 239
779 3300026089 Ga0207648_10054701 Ga0207648_100547012 239
780 3300026095 Ga0207676_10000527 Ga0207676_100005276 239
781 3300026095 Ga0207676_10000666 Ga0207676_1000066621 239
782 3300026095 Ga0207676_10005078 Ga0207676_100050787 239
783 3300026095 Ga0207676_10069931 Ga0207676_100699312 239
784 3300026095 Ga0207676_10078796 Ga0207676_100787964 239
785 3300026116 Ga0207674_10000244 Ga0207674_1000024431 239
786 3300026116 Ga0207674_10016651 Ga0207674_100166517 239
787 3300026118 Ga0207675_100000199 Ga0207675_10000019920 239
788 3300026118 Ga0207675_100134453 Ga0207675_1001344532 239
789 3300026118 Ga0207675_100590307 Ga0207675_1005903072 239
790 3300026121 Ga0207683_10001771 Ga0207683_1000177110 239
791 3300026142 Ga0207698_10005956 Ga0207698_100059567 239
792 3300026142 Ga0207698_10013116 Ga0207698_100131166 239
793 3300026142 Ga0207698_10021079 Ga0207698_100210795 239
794 3300026142 Ga0207698_10021164 Ga0207698_100211642 239
795 3300026142 Ga0207698_10064282 Ga0207698_100642822 239
796 3300026142 Ga0207698_10277326 Ga0207698_102773262 239
797 3300028379 Ga0268266_10000019 Ga0268266_10000019293 239
798 3300028379 Ga0268266_10001687 Ga0268266_100016873 239
799 3300028379 Ga0268266_10109769 Ga0268266_101097694 239
800 3300028380 Ga0268265_10000109 Ga0268265_1000010978 239
801 3300028380 Ga0268265_10004482 Ga0268265_100044824 239
802 3300028381 Ga0268264_10000069 Ga0268264_10000069165 239
803 3300028381 Ga0268264_10004358 Ga0268264_1000435811 239
804 3300028381 Ga0268264_10004801 Ga0268264_100048018 239
805 3300028381 Ga0268264_10009152 Ga0268264_100091523 239
806 3300028381 Ga0268264_10149990 Ga0268264_101499903 239
807 3300028381 Ga0268264_10197259 Ga0268264_101972591 239
808 3300028786 Ga0307517_10007943 Ga0307517_100079435 239
809 3300031456 Ga0307513_10212571 Ga0307513_102125711 239
810 3300031456 Ga0307513_10339208 Ga0307513_103392082 239
811 3300031548 Ga0307408_100496120 Ga0307408_1004961202 239
812 3300031548 Ga0307408_100831392 Ga0307408_1008313921 239
813 3300031731 Ga0307405_10029574 Ga0307405_100295743 239
814 3300031731 Ga0307405_10056225 Ga0307405_100562252 239
815 3300031824 Ga0307413_10034901 Ga0307413_100349013 239
816 3300031852 Ga0307410_10012577 Ga0307410_100125773 239
817 3300031852 Ga0307410_10326154 Ga0307410_103261542 239
818 3300031852 Ga0307410_10549189 Ga0307410_105491891 239
819 3300031901 Ga0307406_10014574 Ga0307406_100145744 239
820 3300031903 Ga0307407_10002091 Ga0307407_100020914 239
821 3300031903 Ga0307407_10270209 Ga0307407_102702092 239
822 3300031911 Ga0307412_10031357 Ga0307412_100313572 239
823 3300031911 Ga0307412_10138016 Ga0307412_101380163 239
824 3300031911 Ga0307412_10234555 Ga0307412_102345552 239
825 3300031911 Ga0307412_10502205 Ga0307412_105022051 239
826 3300031995 Ga0307409_100007426 Ga0307409_1000074266 239
827 3300031995 Ga0307409_100137150 Ga0307409_1001371502 239
828 3300031995 Ga0307409_100325951 Ga0307409_1003259513 239
829 3300032002 Ga0307416_100008545 Ga0307416_1000085453 239
830 3300032004 Ga0307414_10010707 Ga0307414_100107072 239
831 3300032004 Ga0307414_10032504 Ga0307414_100325044 239
832 3300032004 Ga0307414_10046248 Ga0307414_100462482 239
833 3300032004 Ga0307414_10277319 Ga0307414_102773192 239
834 3300032005 Ga0307411_10024979 Ga0307411_100249793 239
835 3300032005 Ga0307411_10327119 Ga0307411_103271192 239
836 3300032005 Ga0307411_10577536 Ga0307411_105775362 239
837 3300032005 Ga0307411_10725215 Ga0307411_107252151 239
838 3300032126 Ga0307415_100086361 Ga0307415_1000863613 239
839 3300032126 Ga0307415_100142512 Ga0307415_1001425122 239
840 3300035111 Ga0373923_0062819 Ga0373923_0062819_584_1348 239
841 3300037418 Ga0395900_0145175 Ga0395900_0145175_1524_2288 239
842 3300037466 Ga0395898_0294833 Ga0395898_0294833_574_1338 239
843 3300037471 Ga0395905_0054283 Ga0395905_0054283_2210_2977 239
844 3300037471 Ga0395905_0319064 Ga0395905_0319064_635_1399 239
845 3300041413 Ga0439465_0081722 Ga0439465_0081722_58_900 239
846 3300042439 Ga0439464_0008848 Ga0439464_0008848_1362_2126 239
847 3300044684 Ga0466966_0074595 Ga0466966_0074595_468_1232 239
848 3300044684 Ga0466966_0115417 Ga0466966_0115417_311_1075 239
849 3300044693 Ga0466961_0020790 Ga0466961_0020790_702_1466 239
850 3300044719 Ga0466971_0059943 Ga0466971_0059943_801_1574 239
851 3300045049 Ga0466959_0086297 Ga0466959_0086297_1170_1934 239
852 3300045976 Ga0466967_0280572 Ga0466967_0280572_59_823 239
853 3300046471 Ga0495650_0012351 Ga0495650_0012351_2725_3489 239
854 3300046507 Ga0495606_0000178 Ga0495606_0000178_3559_4332 239
855 3300046507 Ga0495606_0053017 Ga0495606_0053017_1723_2502 239
856 3300046507 Ga0495606_0115164 Ga0495606_0115164_176_949 239
857 3300046515 Ga0495620_0003485 Ga0495620_0003485_6835_7611 239
858 3300046519 Ga0495632_0001651 Ga0495632_0001651_7021_7797 239
859 3300046519 Ga0495632_0076201 Ga0495632_0076201_37_801 239
860 3300046522 Ga0495643_0000036 Ga0495643_0000036_147470_148258 239
861 3300046522 Ga0495643_0001718 Ga0495643_0001718_14248_15021 239
862 3300046522 Ga0495643_0013682 Ga0495643_0013682_1720_2499 239
863 3300046528 Ga0495642_0003717 Ga0495642_0003717_2160_2933 239
864 3300046530 Ga0495654_0028751 Ga0495654_0028751_1267_2043 239
865 3300046616 Ga0495668_0007020 Ga0495668_0007020_5125_5889 239
866 3300046616 Ga0495668_0104330 Ga0495668_0104330_400_1173 239
867 3300046660 Ga0495625_0000599 Ga0495625_0000599_28439_29212 239
868 3300046684 Ga0495669_0093406 Ga0495669_0093406_198_962 239
869 3300046684 Ga0495669_0109928 Ga0495669_0109928_495_1265 239
870 3300047443 Ga0495687_000384 Ga0495687_000384_36544_37317 239
871 3300047445 Ga0495677_0002456 Ga0495677_0002456_5776_6549 239
872 3300048906 Ga0496103_0019178 Ga0496103_0019178_1527_2291 239
873 3300048907 Ga0496104_0052149 Ga0496104_0052149_368_1135 239
874 3300048912 Ga0496109_0091111 Ga0496109_0091111_1743_2510 239
875 3300048913 Ga0496110_0587925 Ga0496110_0587925_161_928 239
876 3300048914 Ga0496111_0087964 Ga0496111_0087964_1234_2001 239
877 3300048916 Ga0496113_0029922 Ga0496113_0029922_2628_3395 239
878 3300048926 Ga0496123_0262501 Ga0496123_0262501_60_827 239
879 3300049574 Ga0501038_0167917 Ga0501038_0167917_761_1525 239
880 3300049583 Ga0501067_0242614 Ga0501067_0242614_31_795 239
881 3300050511 nmdc:mga08y16_381262_c1 nmdc:mga08y16_381262_c1_415_1179 239
882 3300053134 Ga0500658_0000049 Ga0500658_0000049_45925_46689 239
883 3300053136 Ga0500559_0012634 Ga0500559_0012634_1504_2307 239
884 3300053139 Ga0500568_0013440 Ga0500568_0013440_2533_3297 239
885 3300053153 Ga0500616_0000080 Ga0500616_0000080_162045_162809 239
886 iso_pu_bacteria 2818991438 2819554899 239
887 3300001915 JGI24741J21665_1002803 JGI24741J21665_10028032 240
888 3300001979 JGI24740J21852_10000474 JGI24740J21852_100004746 240
889 3300001989 JGI24739J22299_10040361 JGI24739J22299_100403612 240
890 3300003773 Ga0055537_1003499 Ga0055537_10034992 240
891 3300005289 Ga0065704_10070200 Ga0065704_1007020045 240
892 3300005327 Ga0070658_10001377 Ga0070658_100013777 240
893 3300005327 Ga0070658_10038444 Ga0070658_100384444 240
894 3300005329 Ga0070683_100020418 Ga0070683_1000204186 240
895 3300005331 Ga0070670_100272071 Ga0070670_1002720712 240
896 3300005337 Ga0070682_100183702 Ga0070682_1001837022 240
897 3300005338 Ga0068868_100096446 Ga0068868_1000964462 240
898 3300005339 Ga0070660_100057475 Ga0070660_1000574754 240
899 3300005339 Ga0070660_100061033 Ga0070660_1000610332 240
900 3300005339 Ga0070660_100092138 Ga0070660_1000921382 240
901 3300005344 Ga0070661_100020380 Ga0070661_1000203805 240
902 3300005345 Ga0070692_10036243 Ga0070692_100362432 240
903 3300005345 Ga0070692_10115747 Ga0070692_101157472 240
904 3300005354 Ga0070675_100201011 Ga0070675_1002010112 240
905 3300005355 Ga0070671_100023916 Ga0070671_1000239163 240
906 3300005366 Ga0070659_100197877 Ga0070659_1001978772 240
907 3300005367 Ga0070667_100484995 Ga0070667_1004849951 240
908 3300005455 Ga0070663_100239551 Ga0070663_1002395512 240
909 3300005457 Ga0070662_100115832 Ga0070662_1001158322 240
910 3300005458 Ga0070681_10124657 Ga0070681_101246573 240
911 3300005535 Ga0070684_100033668 Ga0070684_1000336685 240
912 3300005539 Ga0068853_100008144 Ga0068853_1000081446 240
913 3300005539 Ga0068853_100108310 Ga0068853_1001083103 240
914 3300005563 Ga0068855_100238315 Ga0068855_1002383152 240
915 3300005564 Ga0070664_100000738 Ga0070664_10000073828 240
916 3300005564 Ga0070664_100550870 Ga0070664_1005508702 240
917 3300005616 Ga0068852_100081967 Ga0068852_1000819673 240
918 3300005841 Ga0068863_100471478 Ga0068863_1004714782 240
919 3300006871 Ga0075434_100301885 Ga0075434_1003018853 240
920 3300009098 Ga0105245_10235701 Ga0105245_102357012 240
921 3300009551 Ga0105238_10058377 Ga0105238_100583772 240
922 3300013100 Ga0157373_10128340 Ga0157373_101283402 240
923 3300013102 Ga0157371_10013797 Ga0157371_100137974 240
924 3300013102 Ga0157371_10061311 Ga0157371_100613112 240
925 3300013105 Ga0157369_10032870 Ga0157369_100328704 240
926 3300013105 Ga0157369_10060405 Ga0157369_100604053 240
927 3300013296 Ga0157374_10090243 Ga0157374_100902433 240
928 3300014497 Ga0182008_10173442 Ga0182008_101734422 240
929 3300025295 Ga0209564_1001630 Ga0209564_100163018 240
930 3300025295 Ga0209564_1004768 Ga0209564_10047686 240
931 3300025297 Ga0209758_1037345 Ga0209758_10373452 240
932 3300025298 Ga0209050_1034182 Ga0209050_10341821 240
933 3300025302 Ga0207426_1013899 Ga0207426_10138992 240
934 3300025321 Ga0207656_10161624 Ga0207656_101616242 240
935 3300025909 Ga0207705_10002088 Ga0207705_1000208815 240
936 3300025909 Ga0207705_10003400 Ga0207705_100034006 240
937 3300025909 Ga0207705_10221527 Ga0207705_102215272 240
938 3300025917 Ga0207660_10003179 Ga0207660_100031796 240
939 3300025919 Ga0207657_10023328 Ga0207657_100233286 240
940 3300025919 Ga0207657_10056280 Ga0207657_100562804 240
941 3300025920 Ga0207649_10037876 Ga0207649_100378762 240
942 3300025920 Ga0207649_10080584 Ga0207649_100805842 240
943 3300025921 Ga0207652_10011805 Ga0207652_100118056 240
944 3300025921 Ga0207652_10343906 Ga0207652_103439062 240
945 3300025924 Ga0207694_10093691 Ga0207694_100936913 240
946 3300025925 Ga0207650_10143679 Ga0207650_101436792 240
947 3300025931 Ga0207644_10081673 Ga0207644_100816734 240
948 3300025933 Ga0207706_10236690 Ga0207706_102366902 240
949 3300025940 Ga0207691_10049967 Ga0207691_100499674 240
950 3300025944 Ga0207661_10037845 Ga0207661_100378452 240
951 3300025945 Ga0207679_10000677 Ga0207679_100006775 240
952 3300026023 Ga0207677_10024018 Ga0207677_100240182 240
953 3300026041 Ga0207639_10048108 Ga0207639_100481083 240
954 3300026041 Ga0207639_10092778 Ga0207639_100927782 240
955 3300026067 Ga0207678_10000681 Ga0207678_1000068128 240
956 3300026067 Ga0207678_10017394 Ga0207678_100173942 240
957 3300026142 Ga0207698_10711417 Ga0207698_107114171 240
958 3300031251 Ga0265327_10020375 Ga0265327_100203753 240
959 3300031824 Ga0307413_10113559 Ga0307413_101135593 240
960 3300032005 Ga0307411_10208932 Ga0307411_102089322 240
961 3300035691 Ga0373931_0002063 Ga0373931_0002063_486_1253 240
962 3300037312 Ga0395899_0006947 Ga0395899_0006947_3280_4053 240
963 3300037312 Ga0395899_0074811 Ga0395899_0074811_98_865 240
964 3300037312 Ga0395899_0155446 Ga0395899_0155446_661_1428 240
965 3300037312 Ga0395899_0166709 Ga0395899_0166709_698_1474 240
966 3300037418 Ga0395900_0000336 Ga0395900_0000336_14497_15270 240
967 3300037418 Ga0395900_0005712 Ga0395900_0005712_7730_8497 240
968 3300037418 Ga0395900_0050979 Ga0395900_0050979_597_1364 240
969 3300037418 Ga0395900_0078289 Ga0395900_0078289_398_1165 240
970 3300037418 Ga0395900_0083504 Ga0395900_0083504_2357_3133 240
971 3300037418 Ga0395900_0167501 Ga0395900_0167501_755_1522 240
972 3300037466 Ga0395898_0016208 Ga0395898_0016208_4185_4958 240
973 3300037466 Ga0395898_0022790 Ga0395898_0022790_38_814 240
974 3300037466 Ga0395898_0423500 Ga0395898_0423500_191_958 240
975 3300037466 Ga0395898_0858978 Ga0395898_0858978_38_814 240
976 3300037471 Ga0395905_0029283 Ga0395905_0029283_2509_3285 240
977 3300037471 Ga0395905_0090504 Ga0395905_0090504_1275_2051 240
978 3300037471 Ga0395905_0110002 Ga0395905_0110002_1478_2245 240
979 3300037471 Ga0395905_0117033 Ga0395905_0117033_957_1724 240
980 3300038443 Ga0395901_0000398 Ga0395901_0000398_23129_23896 240
981 3300038443 Ga0395901_0002173 Ga0395901_0002173_4587_5360 240
982 3300038443 Ga0395901_0139053 Ga0395901_0139053_605_1381 240
983 3300038443 Ga0395901_0278471 Ga0395901_0278471_191_958 240
984 3300044694 Ga0466963_0345078 Ga0466963_0345078_61_828 240
985 3300044719 Ga0466971_0102069 Ga0466971_0102069_514_1281 240
986 3300045836 Ga0466958_0411452 Ga0466958_0411452_85_852 240
987 3300045976 Ga0466967_0001182 Ga0466967_0001182_11023_11790 240
988 3300045976 Ga0466967_0138252 Ga0466967_0138252_409_1185 240
989 3300046460 Ga0495638_0021189 Ga0495638_0021189_966_1733 240
990 3300046501 Ga0495607_0005251 Ga0495607_0005251_7017_7793 240
991 3300046512 Ga0495610_0000352 Ga0495610_0000352_30740_31519 240
992 3300046684 Ga0495669_0203340 Ga0495669_0203340_77_853 240
993 3300048090 Ga0495615_0000009 Ga0495615_0000009_53538_54308 240
994 3300048911 Ga0496108_0172143 Ga0496108_0172143_423_1199 240
995 3300048915 Ga0496112_0009138 Ga0496112_0009138_6141_6917 240
996 3300048925 Ga0496122_0008856 Ga0496122_0008856_4078_4848 240
997 3300048926 Ga0496123_0000300 Ga0496123_0000300_5984_6754 240
998 3300048927 Ga0496124_0040271 Ga0496124_0040271_1467_2237 240
999 3300049742 Ga0501080_0065115 Ga0501080_0065115_2167_2934 240
1000 3300049823 Ga0501044_0228335 Ga0501044_0228335_730_1497 240
1001 3300053087 Ga0500643_018922 Ga0500643_018922_1070_1837 240
1002 3300053136 Ga0500559_0012440 Ga0500559_0012440_1958_2725 240
1003 3300053151 Ga0500604_0000007 Ga0500604_0000007_81796_82563 240
1004 3300061719 Ga0466962_0098253 Ga0466962_0098253_381_1148 240
1005 3300061719 Ga0466962_0102452 Ga0466962_0102452_150_917 240
1006 2162886007 SwRhRL2b_contig_3318283 SwRhRL2b_0442.00001130 241
1007 3300002067 JGI24735J21928_10054526 JGI24735J21928_100545262 241
1008 3300003322 rootL2_10211840 rootL2_102118404 241
1009 3300005327 Ga0070658_10186874 Ga0070658_101868741 241
1010 3300005336 Ga0070680_100001376 Ga0070680_10000137613 241
1011 3300005458 Ga0070681_10090131 Ga0070681_100901314 241
1012 3300005530 Ga0070679_100000008 Ga0070679_10000000814 241
1013 3300005844 Ga0068862_100049721 Ga0068862_1000497213 241
1014 3300006058 Ga0075432_10000082 Ga0075432_1000008220 241
1015 3300006946 Ga0079104_1013431 Ga0079104_10134311 241
1016 3300025912 Ga0207707_10007643 Ga0207707_100076432 241
1017 3300025917 Ga0207660_10008606 Ga0207660_100086064 241
1018 3300025921 Ga0207652_10000008 Ga0207652_10000008280 241
1019 3300027111 Ga0209281_1005897 Ga0209281_10058972 241
1020 3300027907 Ga0207428_10015734 Ga0207428_100157344 241
1021 3300030731 Ga0316177_1101382 Ga0316177_11013822 241
1022 3300031548 Ga0307408_100059639 Ga0307408_1000596392 241
1023 3300038705 Ga0237819_00292 Ga0237819_00292_10913_11683 241
1024 3300042125 Ga0450923_038696 Ga0450923_038696_126_899 241
1025 3300042532 Ga0450893_0003067 Ga0450893_0003067_1340_2110 241
1026 3300046512 Ga0495610_0001714 Ga0495610_0001714_15338_16132 241
1027 3300046519 Ga0495632_0140863 Ga0495632_0140863_64_846 241
1028 3300046616 Ga0495668_0198996 Ga0495668_0198996_226_1020 241
1029 3300048091 Ga0495626_0000517 Ga0495626_0000517_31391_32185 241
1030 3300048918 Ga0496115_0000732 Ga0496115_0000732_6681_7460 241
1031 3300053156 Ga0500622_0003841 Ga0500622_0003841_5983_6762 241
1032 iso_pu_bacteria 8054302542 8054306421 241
1033 3300025926 Ga0207659_10233763 Ga0207659_102337632 242
1034 3300027665 Ga0209983_1010919 Ga0209983_10109192 242
1035 3300031548 Ga0307408_100020364 Ga0307408_1000203643 242
1036 3300031548 Ga0307408_100187168 Ga0307408_1001871681 242
1037 3300031731 Ga0307405_10001791 Ga0307405_100017916 242
1038 3300031824 Ga0307413_10003418 Ga0307413_100034186 242
1039 3300031824 Ga0307413_10043222 Ga0307413_100432222 242
1040 3300031852 Ga0307410_10006204 Ga0307410_100062042 242
1041 3300031901 Ga0307406_10004895 Ga0307406_100048956 242
1042 3300031903 Ga0307407_10002700 Ga0307407_100027005 242
1043 3300031911 Ga0307412_10073649 Ga0307412_100736493 242
1044 3300031995 Ga0307409_100002533 Ga0307409_1000025336 242
1045 3300032002 Ga0307416_100047316 Ga0307416_1000473162 242
1046 3300032002 Ga0307416_100408484 Ga0307416_1004084842 242
1047 3300032004 Ga0307414_10003894 Ga0307414_100038945 242
1048 3300032005 Ga0307411_10001555 Ga0307411_100015556 242
1049 3300032126 Ga0307415_100002383 Ga0307415_1000023836 242
1050 3300037312 Ga0395899_0140577 Ga0395899_0140577_427_1200 242
1051 3300046537 Ga0495598_0018214 Ga0495598_0018214_459_1232 242
1052 3300049572 Ga0501036_0410571 Ga0501036_0410571_63_836 242
1053 3300049823 Ga0501044_0410150 Ga0501044_0410150_414_1187 242
1054 3300053148 Ga0500590_008590 Ga0500590_008590_1704_2510 242
1055 3300053729 Ga0500625_096024 Ga0500625_096024_358_1164 242
1056 3300001979 JGI24740J21852_10024992 JGI24740J21852_100249922 243
1057 3300001989 JGI24739J22299_10002884 JGI24739J22299_100028843 243
1058 3300001990 JGI24737J22298_10030293 JGI24737J22298_100302932 243
1059 3300002075 JGI24738J21930_10004991 JGI24738J21930_100049915 243
1060 3300005328 Ga0070676_10025705 Ga0070676_100257053 243
1061 3300005329 Ga0070683_100079286 Ga0070683_1000792862 243
1062 3300005331 Ga0070670_100016985 Ga0070670_1000169855 243
1063 3300005366 Ga0070659_100054821 Ga0070659_1000548213 243
1064 3300005367 Ga0070667_100235550 Ga0070667_1002355501 243
1065 3300005435 Ga0070714_100022690 Ga0070714_1000226906 243
1066 3300005455 Ga0070663_100084211 Ga0070663_1000842112 243
1067 3300005455 Ga0070663_100382572 Ga0070663_1003825721 243
1068 3300005457 Ga0070662_100086703 Ga0070662_1000867032 243
1069 3300005535 Ga0070684_100173397 Ga0070684_1001733972 243
1070 3300005539 Ga0068853_100105004 Ga0068853_1001050043 243
1071 3300005546 Ga0070696_100006276 Ga0070696_1000062762 243
1072 3300005548 Ga0070665_100049678 Ga0070665_1000496782 243
1073 3300005564 Ga0070664_100139198 Ga0070664_1001391982 243
1074 3300005577 Ga0068857_100019067 Ga0068857_1000190675 243
1075 3300005577 Ga0068857_100482959 Ga0068857_1004829592 243
1076 3300005578 Ga0068854_100075843 Ga0068854_1000758433 243
1077 3300013100 Ga0157373_10023182 Ga0157373_100231825 243
1078 3300013102 Ga0157371_10126617 Ga0157371_101266172 243
1079 3300013308 Ga0157375_10501238 Ga0157375_105012382 243
1080 3300025904 Ga0207647_10048616 Ga0207647_100486163 243
1081 3300025907 Ga0207645_10014890 Ga0207645_100148905 243
1082 3300025925 Ga0207650_10058187 Ga0207650_100581872 243
1083 3300025932 Ga0207690_10058479 Ga0207690_100584793 243
1084 3300025932 Ga0207690_10215159 Ga0207690_102151592 243
1085 3300025933 Ga0207706_10009206 Ga0207706_100092065 243
1086 3300025933 Ga0207706_10036973 Ga0207706_100369735 243
1087 3300025942 Ga0207689_10053101 Ga0207689_100531012 243
1088 3300025944 Ga0207661_10146074 Ga0207661_101460742 243
1089 3300025944 Ga0207661_10163548 Ga0207661_101635482 243
1090 3300025945 Ga0207679_10020644 Ga0207679_100206442 243
1091 3300025960 Ga0207651_10182429 Ga0207651_101824292 243
1092 3300025981 Ga0207640_10065064 Ga0207640_100650642 243
1093 3300025986 Ga0207658_10155085 Ga0207658_101550852 243
1094 3300026041 Ga0207639_10240828 Ga0207639_102408282 243
1095 3300026041 Ga0207639_10461578 Ga0207639_104615782 243
1096 3300026089 Ga0207648_10360189 Ga0207648_103601891 243
1097 3300026116 Ga0207674_10004090 Ga0207674_100040908 243
1098 3300026116 Ga0207674_10277481 Ga0207674_102774812 243
1099 3300026116 Ga0207674_10305124 Ga0207674_103051242 243
1100 3300031548 Ga0307408_100047753 Ga0307408_1000477533 243
1101 3300031852 Ga0307410_10063489 Ga0307410_100634892 243
1102 3300031901 Ga0307406_10034013 Ga0307406_100340131 243
1103 3300032002 Ga0307416_100793181 Ga0307416_1007931811 243
1104 3300032126 Ga0307415_100041995 Ga0307415_1000419952 243
1105 3300035111 Ga0373923_0065455 Ga0373923_0065455_195_974 243
1106 3300035117 Ga0373953_0023016 Ga0373953_0023016_750_1529 243
1107 3300035172 Ga0373955_0000936 Ga0373955_0000936_8099_8878 243
1108 3300036401 Ga0373937_0004532 Ga0373937_0004532_2506_3285 243
1109 3300037418 Ga0395900_0104552 Ga0395900_0104552_1075_1851 243
1110 3300038443 Ga0395901_0124817 Ga0395901_0124817_382_1158 243
1111 3300042015 Ga0439462_0004540 Ga0439462_0004540_737_1513 243
1112 3300044684 Ga0466966_0135612 Ga0466966_0135612_383_1159 243
1113 3300048088 Ga0495602_0038123 Ga0495602_0038123_1991_2770 243
1114 3300048090 Ga0495615_0003485 Ga0495615_0003485_230_1006 243
1115 3300053153 Ga0500616_0025469 Ga0500616_0025469_1608_2390 244
1116 3300046616 Ga0495668_0222100 Ga0495668_0222100_13_816 249
1117 2162886007 SwRhRL2b_contig_1105262 SwRhRL2b_0006.00005120 259
1118 3300005289 Ga0065704_10006528 Ga0065704_100065282 259
1119 3300005353 Ga0070669_100017883 Ga0070669_1000178837 259
1120 3300025923 Ga0207681_10025190 Ga0207681_100251902 259
1121 3300025972 Ga0207668_10025939 Ga0207668_100259392 259
1122 3300028379 Ga0268266_10028584 Ga0268266_100285843 259
1123 3300048911 Ga0496108_0005656 Ga0496108_0005656_2071_2895 259
1124 3300048913 Ga0496110_0278115 Ga0496110_0278115_302_1126 259
1125 3300048924 Ga0496121_0002098 Ga0496121_0002098_23452_24276 259
1126 3300048929 Ga0496126_0008301 Ga0496126_0008301_3046_3870 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

19

239

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfj-assembly1.cif.gz_A crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 0.9554 23 257
1rw0-assembly1.cif.gz_B crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 0.93 47 257
1xaf-assembly1.cif.gz_B crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t 0.9279 47 257
1rv9-assembly1.cif.gz_A crystal structure of neisseria meningitidis protein nmb0706, pfam duf152 0.8785 23 259
6dzd-assembly2.cif.gz_B crystal structure of bacillus licheniformis hypothetical protein yfih 0.8764 36 256
ID Description Score Start End Superfamily
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9447 23 257 3.60.140.10
1rv9A00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8785 23 259 3.60.140.10
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8723 23 257 3.60.140.10
1rv9A00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8578 23 259 3.60.140.10
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8558 28 259 3.60.140.10
ID Description Score Start End GO Terms
AF-A0A0R2TTJ3-F1-model_v4 Purine nucleoside phosphorylase 0.9862 71 256 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A3C0BS80-F1-model_v4 Purine nucleoside phosphorylase 0.9822 79 237 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A1Y2K4K2-F1-model_v4 Purine nucleoside phosphorylase 0.9778 110 249 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A530BMG2-F1-model_v4 Polyphenol oxidase 0.9715 135 251 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A502FUC6-F1-model_v4 Purine nucleoside phosphorylase 0.9712 23 256 GO:0004000
GO:0005507
GO:0017061
GO:0046936

Feature Viewer

pLDDT pTM Quality
90.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map