F490457

General Info

Members Datasets Scaffolds Average Seq Length
1125 641 2250 128

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10013975|Ga0070709_100139755
Length 146
Sequence MGGIDLQPGSNHMTDMTPASPIPAAKPPRRPRPQVMRLTEAAAQRIQELTKRADSEIVGLRVGVKNGGCAGQSYTVEYAHEIRPTDEVVEDKGVKILVDPKAVLFLLGTEMDYKADRMQAQFIFNNPNQISACGCGESVQLKPAEV

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
86 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
111 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
119 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
207 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
213 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
214 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
218 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
219 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
232 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
237 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
261 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
291 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
396 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
397 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
398 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
399 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
400 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
401 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
402 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
403 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
404 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
405 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
406 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
412 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
413 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
416 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
417 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
418 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
452 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
453 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
454 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
455 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
456 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
457 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
458 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
459 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
460 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
461 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
462 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
463 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
464 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
465 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
466 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
467 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
468 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
469 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
470 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
471 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
472 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
473 2643221651 Afipia sp. Root123D2 Isolate Unclassified
474 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
475 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
476 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
477 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
478 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
479 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
480 2791355199
481 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
482 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
483 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
484 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
485 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
486 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
487 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
488 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
489 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
490 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
491 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
492 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
493 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
494 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
495 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
496 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
497 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
498 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
499 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
500 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
501 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
502 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
503 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
504 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
505 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
506 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
507 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
508 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
509 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
510 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
511 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
512 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
513 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
514 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
515 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
516 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
517 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
518 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
519 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
520 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
521 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
522 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
523 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
524 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
525 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
526 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
527 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
528 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
529 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
530 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
531 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
532 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
533 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
534 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
535 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
536 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
537 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
538 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
539 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
540 2904699407
541 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
542 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
543 2906610324
544 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
545 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
546 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
547 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
548 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
549 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
550 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
551 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
552 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
553 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
554 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
555 2922425934
556 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
557 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
558 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
559 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
560 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
561 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
562 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
563 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
564 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
565 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
566 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
567 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
568 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
569 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
570 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
571 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
572 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
573 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
574 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
575 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
576 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
577 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
578 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
579 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
580 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
581 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
582 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
583 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
584 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
585 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
586 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
587 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
588 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
589 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
590 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
591 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
592 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
593 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
594 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
595 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
596 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
597 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
598 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
599 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
600 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
601 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
602 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
603 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
604 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
605 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
606 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
607 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
608 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
609 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
610 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
611 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
612 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
613 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
614 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
615 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
616 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
617 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
618 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
619 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
620 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
621 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
622 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
623 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
624 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
625 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
626 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
627 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
628 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
629 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
630 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
631 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
632 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
633 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
634 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
635 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
636 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
637 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
638 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
639 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
640 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
641 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.5
Metatranscriptomes 4.91
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.84
Nodule 12.89
Rhizoplane 3.2
Rhizosphere 63.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10013975 3300005434 Bacteria 4529
2 JGI24739J22299_10265156 3300001989 Bacteria 503
3 JGI24737J22298_10007177 3300001990 Bacteria 3771
4 JGI24735J21928_10021816 3300002067 Bacteria 1953
5 JGI25159J45721_1000007 3300002987 Bacteria 176362
6 JGI25159J45721_1000029 3300002987 Bacteria 105868
7 JGI25151J46595_10018877 3300003187 Bacteria 2946
8 JGI25406J46586_10001302 3300003203 Bacteria 11736
9 JGI25153J46596_10018387 3300003215 Bacteria 2717
10 JGI25160J50197_1000011 3300003354 Bacteria 275577
11 JGI25160J50197_1006480 3300003354 Bacteria 4730
12 JGI25161J50226_1000216 3300003374 Bacteria 36285
13 JGI25404J52841_10036718 3300003659 Bacteria 1042
14 JGI25404J52841_10047623 3300003659 Bacteria 903
15 Ga0055526_1005205 3300003771 Bacteria 7555
16 Ga0055526_1026200 3300003771 Bacteria 1847
17 Ga0055524_1007493 3300003775 Bacteria 4623
18 Ga0055536_1002370 3300003781 Bacteria 10647
19 Ga0055536_1003841 3300003781 Bacteria 7905
20 Ga0055530_10008423 3300003791 Bacteria 4135
21 Ga0055540_1017856 3300003792 Bacteria 1965
22 Ga0055531_10003918 3300003794 Bacteria 9271
23 Ga0055531_10010017 3300003794 Bacteria 4770
24 Ga0055543_1000097 3300004625 Bacteria 75364
25 Ga0065165_1000018 3300005262 Bacteria 275082
26 Ga0065165_1006114 3300005262 Bacteria 6445
27 Ga0070683_100086618 3300005329 Bacteria 2937
28 Ga0070670_100317512 3300005331 Bacteria 1364
29 Ga0070666_10296382 3300005335 Bacteria 1151
30 Ga0070680_100134714 3300005336 Bacteria 2068
31 Ga0070680_100233158 3300005336 Bacteria 1555
32 Ga0070680_100457672 3300005336 Bacteria 1090
33 Ga0070680_100614802 3300005336 Bacteria 933
34 Ga0070682_100050796 3300005337 Bacteria 2590
35 Ga0068868_100090406 3300005338 Bacteria 2465
36 Ga0068868_100584682 3300005338 Bacteria 987
37 Ga0068868_100789440 3300005338 Bacteria 856
38 Ga0070660_101335422 3300005339 Bacteria 609
39 Ga0070660_101771716 3300005339 Bacteria 526
40 Ga0070689_100224870 3300005340 Bacteria 1541
41 Ga0070661_100682955 3300005344 Bacteria 835
42 Ga0070668_100799538 3300005347 Bacteria 838
43 Ga0070688_100177171 3300005365 Bacteria 1476
44 Ga0070659_100588479 3300005366 Bacteria 955
45 Ga0070667_100014040 3300005367 Bacteria 6620
46 Ga0070667_101147052 3300005367 Bacteria 727
47 Ga0070667_101177856 3300005367 Bacteria 717
48 Ga0070667_101593195 3300005367 Bacteria 614
49 Ga0070709_10036155 3300005434 Bacteria 3007
50 Ga0070709_10930759 3300005434 Bacteria 689
51 Ga0070714_100070886 3300005435 Bacteria 3013
52 Ga0070714_100357446 3300005435 Bacteria 1373
53 Ga0070714_100368719 3300005435 Bacteria 1352
54 Ga0070714_100430673 3300005435 Bacteria 1251
55 Ga0070714_102216250 3300005435 Bacteria 535
56 Ga0070713_100126037 3300005436 Bacteria 2252
57 Ga0070713_100446876 3300005436 Bacteria 1213
58 Ga0070713_100650378 3300005436 Bacteria 1004
59 Ga0070713_101092651 3300005436 Bacteria 771
60 Ga0070713_101756953 3300005436 Bacteria 602
61 Ga0070710_10008697 3300005437 Bacteria 4949
62 Ga0070710_11009654 3300005437 Bacteria 607
63 Ga0070711_100217726 3300005439 Bacteria 1482
64 Ga0070711_100829210 3300005439 Bacteria 786
65 Ga0070711_100936653 3300005439 Bacteria 741
66 Ga0070711_100949118 3300005439 Bacteria 736
67 Ga0070705_101021384 3300005440 Bacteria 672
68 Ga0070708_100713002 3300005445 Bacteria 944
69 Ga0070663_100038698 3300005455 Bacteria 3328
70 Ga0070663_100044651 3300005455 Bacteria 3126
71 Ga0070663_100496174 3300005455 Bacteria 1013
72 Ga0070663_100605851 3300005455 Bacteria 922
73 Ga0070663_100681197 3300005455 Bacteria 872
74 Ga0070662_100037275 3300005457 Bacteria 3447
75 Ga0070681_10054789 3300005458 Bacteria 3973
76 Ga0070681_10123870 3300005458 Bacteria 2517
77 Ga0070681_10277245 3300005458 Bacteria 1588
78 Ga0068867_100931651 3300005459 Bacteria 783
79 Ga0070698_100225801 3300005471 Bacteria 1806
80 Ga0070679_100019797 3300005530 Bacteria 6552
81 Ga0070679_100040249 3300005530 Bacteria 4650
82 Ga0070679_100309866 3300005530 Bacteria 1528
83 Ga0070679_100629649 3300005530 Bacteria 1016
84 Ga0070679_100895711 3300005530 Bacteria 831
85 Ga0070684_100032692 3300005535 Bacteria 4436
86 Ga0070684_100052818 3300005535 Bacteria 3535
87 Ga0068853_100023838 3300005539 Bacteria 5128
88 Ga0068853_100117847 3300005539 Bacteria 2366
89 Ga0068853_100203167 3300005539 Bacteria 1804
90 Ga0068853_100331330 3300005539 Bacteria 1413
91 Ga0068853_100518724 3300005539 Bacteria 1126
92 Ga0068853_100545830 3300005539 Bacteria 1097
93 Ga0070693_100370721 3300005547 Bacteria 985
94 Ga0070693_100562711 3300005547 Bacteria 818
95 Ga0070693_101209744 3300005547 Bacteria 581
96 Ga0070665_100015427 3300005548 Bacteria 7672
97 Ga0070665_100108612 3300005548 Bacteria 2777
98 Ga0070665_101622027 3300005548 Bacteria 655
99 Ga0070704_100273775 3300005549 Bacteria 1396
100 Ga0068855_100015588 3300005563 Bacteria 9146
101 Ga0068855_100200086 3300005563 Bacteria 2249
102 Ga0068855_100207510 3300005563 Bacteria 2203
103 Ga0068855_100384785 3300005563 Bacteria 1540
104 Ga0068855_100473803 3300005563 Bacteria 1363
105 Ga0068855_102021046 3300005563 Bacteria 582
106 Ga0070664_100721245 3300005564 Bacteria 930
107 Ga0068857_100013583 3300005577 Bacteria 7093
108 Ga0068857_100117100 3300005577 Bacteria 2397
109 Ga0068857_100482474 3300005577 Bacteria 1162
110 Ga0068854_100002817 3300005578 Bacteria 10815
111 Ga0068854_100012868 3300005578 Bacteria 5481
112 Ga0068854_100118788 3300005578 Bacteria 2004
113 Ga0068854_100267225 3300005578 Bacteria 1372
114 Ga0068854_100335700 3300005578 Bacteria 1233
115 Ga0068854_100581537 3300005578 Bacteria 954
116 Ga0068856_100000659 3300005614 Bacteria 37359
117 Ga0068856_100007731 3300005614 Bacteria 10497
118 Ga0068856_100047734 3300005614 Bacteria 4219
119 Ga0068856_100255467 3300005614 Bacteria 1767
120 Ga0068856_100874862 3300005614 Bacteria 917
121 Ga0068852_100081387 3300005616 Bacteria 2874
122 Ga0068852_100232220 3300005616 Bacteria 1759
123 Ga0068852_100255930 3300005616 Bacteria 1679
124 Ga0068852_100348366 3300005616 Bacteria 1446
125 Ga0068859_100344401 3300005617 Bacteria 1585
126 Ga0068859_101529885 3300005617 Bacteria 737
127 Ga0068864_100080912 3300005618 Bacteria 2847
128 Ga0068864_100359500 3300005618 Bacteria 1376
129 Ga0068851_10002097 3300005834 Bacteria 8771
130 Ga0068870_10302094 3300005840 Bacteria 1011
131 Ga0068863_100339798 3300005841 Bacteria 1461
132 Ga0068858_100225906 3300005842 Bacteria 1774
133 Ga0068858_100491846 3300005842 Bacteria 1184
134 Ga0068858_100573985 3300005842 Bacteria 1093
135 Ga0068860_100667726 3300005843 Bacteria 1048
136 Ga0081455_10011962 3300005937 Bacteria 8685
137 Ga0081538_10162929 3300005981 Bacteria 987
138 Ga0081540_1014445 3300005983 Bacteria 5057
139 Ga0081540_1115459 3300005983 Bacteria 1125
140 Ga0081539_10000498 3300005985 Bacteria 82216
141 Ga0070717_10007074 3300006028 Bacteria 8312
142 Ga0070717_10553507 3300006028 Bacteria 1042
143 Ga0075365_10050758 3300006038 Bacteria 2737
144 Ga0075365_10250515 3300006038 Bacteria 1244
145 Ga0075365_10327648 3300006038 Bacteria 1079
146 Ga0075365_10439413 3300006038 Bacteria 921
147 Ga0075368_10001670 3300006042 Bacteria 7130
148 Ga0075363_100058730 3300006048 Bacteria 2066
149 Ga0075364_10026333 3300006051 Bacteria 3710
150 Ga0070716_100752771 3300006173 Bacteria 750
151 Ga0070712_100007041 3300006175 Bacteria 7011
152 Ga0075362_10564634 3300006177 Bacteria 586
153 Ga0075367_10089995 3300006178 Bacteria 1866
154 Ga0075369_10010854 3300006186 Bacteria 3570
155 Ga0075369_10156210 3300006186 Bacteria 1044
156 Ga0075369_10423023 3300006186 Bacteria 629
157 Ga0075369_10553296 3300006186 Bacteria 549
158 Ga0075366_10593467 3300006195 Bacteria 686
159 Ga0097621_100418861 3300006237 Bacteria 1202
160 Ga0075370_10224125 3300006353 Bacteria 1111
161 Ga0075370_10654062 3300006353 Bacteria 638
162 Ga0068871_100152457 3300006358 Bacteria 1972
163 Ga0075433_10561517 3300006852 Bacteria 1003
164 Ga0068865_100972715 3300006881 Bacteria 742
165 Ga0075436_100368086 3300006914 Bacteria 1038
166 Ga0097620_100344346 3300006931 Bacteria 1585
167 Ga0097620_101529921 3300006931 Bacteria 737
168 Ga0097620_101739697 3300006931 Bacteria 689
169 Ga0099824_1018671 3300006942 Bacteria 5621
170 Ga0099822_1085678 3300006943 Bacteria 736
171 Ga0075435_101358153 3300007076 Bacteria 623
172 Ga0105250_10116539 3300009092 Bacteria 1096
173 Ga0105240_10010574 3300009093 Bacteria 12963
174 Ga0105240_10074576 3300009093 Bacteria 4187
175 Ga0105240_10125972 3300009093 Bacteria 3078
176 Ga0105245_11378707 3300009098 Bacteria 755
177 Ga0105247_10023505 3300009101 Bacteria 3714
178 Ga0105243_11021716 3300009148 Bacteria 831
179 Ga0105241_10000375 3300009174 Bacteria 34023
180 Ga0105241_12641154 3300009174 Bacteria 505
181 Ga0105248_10212421 3300009177 Bacteria 2180
182 Ga0105248_10699022 3300009177 Bacteria 1144
183 Ga0105237_10199631 3300009545 Bacteria 1999
184 Ga0105237_10203768 3300009545 Bacteria 1979
185 Ga0105237_10836244 3300009545 Bacteria 927
186 Ga0105238_10000885 3300009551 Bacteria 30833
187 Ga0105238_10027088 3300009551 Bacteria 5842
188 Ga0105238_10694286 3300009551 Bacteria 1029
189 Ga0105238_12916316 3300009551 Bacteria 514
190 Ga0105249_10100272 3300009553 Bacteria 2723
191 Ga0105249_10202676 3300009553 Bacteria 1942
192 Ga0099796_10102656 3300010159 Bacteria 1078
193 Ga0099796_10343318 3300010159 Bacteria 642
194 Ga0105239_10001513 3300010375 Bacteria 30845
195 Ga0105239_10018938 3300010375 Bacteria 7607
196 Ga0105239_10097922 3300010375 Bacteria 3242
197 Ga0105246_10259029 3300011119 Bacteria 1385
198 Ga0157323_1014765 3300012495 Bacteria 674
199 Ga0157371_10579161 3300013102 Bacteria 834
200 Ga0157371_11175858 3300013102 Bacteria 590
201 Ga0157370_10169703 3300013104 Bacteria 2028
202 Ga0157369_10084470 3300013105 Bacteria 3393
203 Ga0157369_11181818 3300013105 Bacteria 781
204 Ga0163162_11121526 3300013306 Bacteria 891
205 Ga0157372_10495545 3300013307 Bacteria 1425
206 Ga0157372_10775031 3300013307 Bacteria 1115
207 Ga0157372_11071155 3300013307 Bacteria 933
208 Ga0163163_10370162 3300014325 Bacteria 1490
209 Ga0163163_10912428 3300014325 Bacteria 942
210 Ga0163163_11472692 3300014325 Bacteria 742
211 Ga0157380_10381281 3300014326 Bacteria 1331
212 Ga0182005_1001790 3300015265 Bacteria 8238
213 Ga0183363_1171 3300015690 Bacteria 14444
214 Ga0184599_129808 3300019188 Bacteria 870
215 Ga0184599_137827 3300019188 Bacteria 1509
216 Ga0197907_10918224 3300020069 Bacteria 984
217 Ga0197907_11069188 3300020069 Bacteria 2290
218 Ga0206356_10243979 3300020070 Bacteria 1156
219 Ga0206356_11658491 3300020070 Bacteria 1062
220 Ga0206349_1643817 3300020075 Bacteria 1034
221 Ga0206350_10271235 3300020080 Bacteria 1246
222 Ga0206350_10345676 3300020080 Bacteria 551
223 Ga0206350_10615424 3300020080 Bacteria 553
224 Ga0206350_10979557 3300020080 Bacteria 1669
225 Ga0206350_11186857 3300020080 Bacteria 1351
226 Ga0206354_11128885 3300020081 Bacteria 608
227 Ga0154015_1041367 3300020610 Bacteria 622
228 Ga0214542_1000245 3300021321 Bacteria 90699
229 Ga0214543_1000010 3300021327 Bacteria 364844
230 Ga0213873_10059434 3300021358 Bacteria 1031
231 Ga0213872_10026306 3300021361 Bacteria 2673
232 Ga0213876_10149803 3300021384 Bacteria 1241
233 Ga0213876_10242375 3300021384 Bacteria 958
234 Ga0213875_10074112 3300021388 Bacteria 1588
235 Ga0224712_10001061 3300022467 Bacteria 6044
236 Ga0224712_10041597 3300022467 Bacteria 1736
237 Ga0224712_10043244 3300022467 Bacteria 1711
238 Ga0224712_10246506 3300022467 Bacteria 824
239 Ga0209436_102029 3300025208 Bacteria 6393
240 Ga0209563_129377 3300025230 Bacteria 535
241 Ga0207425_1005747 3300025245 Bacteria 3492
242 Ga0209677_100491 3300025253 Bacteria 22276
243 Ga0209148_1010479 3300025254 Bacteria 1757
244 Ga0209148_1014504 3300025254 Bacteria 1391
245 Ga0209233_1002729 3300025261 Bacteria 6358
246 Ga0209233_1039459 3300025261 Bacteria 1034
247 Ga0209233_1089514 3300025261 Bacteria 530
248 Ga0209565_1017569 3300025263 Bacteria 1566
249 Ga0209455_1011918 3300025272 Bacteria 2112
250 Ga0209455_1012087 3300025272 Bacteria 2085
251 Ga0209130_1000029 3300025284 Bacteria 323399
252 Ga0209676_1001711 3300025292 Bacteria 18937
253 Ga0209025_1000033 3300025294 Bacteria 414511
254 Ga0209025_1047665 3300025294 Bacteria 1746
255 Ga0209564_1000275 3300025295 Bacteria 107884
256 Ga0209564_1001009 3300025295 Bacteria 35025
257 Ga0209564_1013153 3300025295 Bacteria 3539
258 Ga0209564_1014089 3300025295 Bacteria 3349
259 Ga0209758_1000021 3300025297 Bacteria 697691
260 Ga0209758_1002371 3300025297 Bacteria 19394
261 Ga0209758_1004125 3300025297 Bacteria 12428
262 Ga0209758_1026461 3300025297 Bacteria 2509
263 Ga0209050_1001363 3300025298 Bacteria 26748
264 Ga0209256_1000644 3300025299 Bacteria 47455
265 Ga0209256_1000649 3300025299 Bacteria 47340
266 Ga0209256_1005320 3300025299 Bacteria 7485
267 Ga0207426_1000074 3300025302 Bacteria 323399
268 Ga0209051_1004342 3300025303 Bacteria 8790
269 Ga0209051_1105889 3300025303 Bacteria 745
270 Ga0209257_1002758 3300025304 Bacteria 16612
271 Ga0209257_1003043 3300025304 Bacteria 15126
272 Ga0207656_10025839 3300025321 Bacteria 2388
273 Ga0207696_1096228 3300025711 Bacteria 809
274 Ga0207692_10038277 3300025898 Bacteria 2352
275 Ga0207692_10256932 3300025898 Bacteria 1049
276 Ga0207642_10269973 3300025899 Bacteria 974
277 Ga0207642_10548907 3300025899 Bacteria 713
278 Ga0207710_10023976 3300025900 Bacteria 2625
279 Ga0207710_10149886 3300025900 Bacteria 1131
280 Ga0207688_10024365 3300025901 Bacteria 3318
281 Ga0207688_10127773 3300025901 Bacteria 1488
282 Ga0207680_10371677 3300025903 Bacteria 1007
283 Ga0207680_10421829 3300025903 Bacteria 945
284 Ga0207647_10003194 3300025904 Bacteria 12291
285 Ga0207647_10206434 3300025904 Bacteria 1135
286 Ga0207647_10301293 3300025904 Bacteria 913
287 Ga0207685_10162137 3300025905 Bacteria 1022
288 Ga0207685_10225347 3300025905 Bacteria 894
289 Ga0207699_10018049 3300025906 Bacteria 3731
290 Ga0207699_10306057 3300025906 Bacteria 1111
291 Ga0207699_10478814 3300025906 Bacteria 896
292 Ga0207645_10119113 3300025907 Bacteria 1713
293 Ga0207645_10218071 3300025907 Bacteria 1257
294 Ga0207643_10057384 3300025908 Bacteria 2216
295 Ga0207654_10000337 3300025911 Bacteria 28090
296 Ga0207654_10020336 3300025911 Bacteria 3518
297 Ga0207654_10143688 3300025911 Bacteria 1524
298 Ga0207654_10167185 3300025911 Bacteria 1425
299 Ga0207654_10206733 3300025911 Bacteria 1295
300 Ga0207707_10014349 3300025912 Bacteria 6900
301 Ga0207707_10030625 3300025912 Bacteria 4707
302 Ga0207695_10001265 3300025913 Bacteria 42969
303 Ga0207695_10060233 3300025913 Bacteria 3931
304 Ga0207695_10093574 3300025913 Bacteria 3015
305 Ga0207695_10488778 3300025913 Bacteria 1113
306 Ga0207695_10925688 3300025913 Bacteria 751
307 Ga0207671_10047805 3300025914 Bacteria 3166
308 Ga0207671_10092021 3300025914 Bacteria 2286
309 Ga0207671_10340355 3300025914 Bacteria 1189
310 Ga0207671_10530432 3300025914 Bacteria 939
311 Ga0207693_10002749 3300025915 Bacteria 15236
312 Ga0207693_10047117 3300025915 Bacteria 3388
313 Ga0207693_10202439 3300025915 Bacteria 1561
314 Ga0207663_10170719 3300025916 Bacteria 1544
315 Ga0207663_10397525 3300025916 Bacteria 1053
316 Ga0207660_10068701 3300025917 Bacteria 2570
317 Ga0207662_10267787 3300025918 Bacteria 1127
318 Ga0207657_10133010 3300025919 Bacteria 2037
319 Ga0207657_10743917 3300025919 Bacteria 760
320 Ga0207649_11078103 3300025920 Bacteria 633
321 Ga0207652_10066046 3300025921 Bacteria 3134
322 Ga0207652_10099998 3300025921 Bacteria 2560
323 Ga0207652_10161134 3300025921 Bacteria 2011
324 Ga0207652_11012796 3300025921 Bacteria 730
325 Ga0207646_10627600 3300025922 Bacteria 964
326 Ga0207681_10096096 3300025923 Bacteria 2127
327 Ga0207681_10200972 3300025923 Bacteria 1530
328 Ga0207681_10468845 3300025923 Bacteria 1027
329 Ga0207681_11186071 3300025923 Bacteria 641
330 Ga0207694_10000082 3300025924 Bacteria 109787
331 Ga0207694_10025462 3300025924 Bacteria 4498
332 Ga0207694_10047802 3300025924 Bacteria 3309
333 Ga0207694_10215388 3300025924 Bacteria 1565
334 Ga0207694_10474639 3300025924 Bacteria 1046
335 Ga0207659_11665056 3300025926 Bacteria 544
336 Ga0207687_10048842 3300025927 Bacteria 2940
337 Ga0207687_10181596 3300025927 Bacteria 1631
338 Ga0207687_11005285 3300025927 Bacteria 715
339 Ga0207700_10108198 3300025928 Bacteria 2232
340 Ga0207700_10504726 3300025928 Bacteria 1071
341 Ga0207700_10729739 3300025928 Bacteria 885
342 Ga0207700_11250130 3300025928 Bacteria 662
343 Ga0207664_10291185 3300025929 Bacteria 1435
344 Ga0207664_10481382 3300025929 Bacteria 1110
345 Ga0207644_10568832 3300025931 Bacteria 939
346 Ga0207644_11014796 3300025931 Bacteria 696
347 Ga0207644_11614350 3300025931 Bacteria 544
348 Ga0207690_11018315 3300025932 Bacteria 689
349 Ga0207706_10033220 3300025933 Bacteria 4593
350 Ga0207706_10077110 3300025933 Bacteria 2931
351 Ga0207686_10220806 3300025934 Bacteria 1368
352 Ga0207686_10563242 3300025934 Bacteria 892
353 Ga0207709_10027283 3300025935 Bacteria 3288
354 Ga0207709_10056403 3300025935 Bacteria 2431
355 Ga0207709_10848091 3300025935 Bacteria 740
356 Ga0207670_10247598 3300025936 Bacteria 1376
357 Ga0207670_10664949 3300025936 Bacteria 860
358 Ga0207669_10022164 3300025937 Bacteria 3368
359 Ga0207704_10033275 3300025938 Bacteria 2929
360 Ga0207704_10723084 3300025938 Bacteria 826
361 Ga0207704_10987374 3300025938 Bacteria 712
362 Ga0207704_11262354 3300025938 Bacteria 631
363 Ga0207665_10274006 3300025939 Bacteria 1254
364 Ga0207711_10176305 3300025941 Bacteria 1942
365 Ga0207711_10888847 3300025941 Bacteria 828
366 Ga0207689_10023824 3300025942 Bacteria 5135
367 Ga0207689_10084589 3300025942 Bacteria 2607
368 Ga0207689_10439096 3300025942 Bacteria 1090
369 Ga0207661_10203397 3300025944 Bacteria 1742
370 Ga0207661_10421493 3300025944 Bacteria 1212
371 Ga0207661_10956085 3300025944 Bacteria 789
372 Ga0207679_10441242 3300025945 Bacteria 1153
373 Ga0207679_10927250 3300025945 Bacteria 797
374 Ga0207679_11208577 3300025945 Bacteria 694
375 Ga0207667_10005368 3300025949 Bacteria 15623
376 Ga0207667_10011709 3300025949 Bacteria 10175
377 Ga0207667_10135740 3300025949 Bacteria 2533
378 Ga0207667_10414553 3300025949 Bacteria 1371
379 Ga0207712_10097880 3300025961 Bacteria 2175
380 Ga0207668_10451133 3300025972 Bacteria 1097
381 Ga0207668_10728258 3300025972 Bacteria 873
382 Ga0207668_11718211 3300025972 Bacteria 566
383 Ga0207640_10007135 3300025981 Bacteria 6157
384 Ga0207640_10037459 3300025981 Bacteria 3052
385 Ga0207640_10072736 3300025981 Bacteria 2321
386 Ga0207640_10467368 3300025981 Bacteria 1043
387 Ga0207640_10538385 3300025981 Bacteria 979
388 Ga0207640_11612443 3300025981 Bacteria 585
389 Ga0207640_11957738 3300025981 Bacteria 531
390 Ga0207658_10896742 3300025986 Bacteria 807
391 Ga0207658_10934217 3300025986 Bacteria 790
392 Ga0207677_10161885 3300026023 Bacteria 1739
393 Ga0207677_10409634 3300026023 Bacteria 1152
394 Ga0207703_10114094 3300026035 Bacteria 2310
395 Ga0207703_10754280 3300026035 Bacteria 927
396 Ga0207703_11067296 3300026035 Bacteria 775
397 Ga0207703_12264017 3300026035 Bacteria 519
398 Ga0207639_10007126 3300026041 Bacteria 7621
399 Ga0207639_10206574 3300026041 Bacteria 1688
400 Ga0207639_10327429 3300026041 Bacteria 1362
401 Ga0207639_10344424 3300026041 Bacteria 1329
402 Ga0207639_10435820 3300026041 Bacteria 1187
403 Ga0207639_10916873 3300026041 Bacteria 819
404 Ga0207678_10009455 3300026067 Bacteria 8574
405 Ga0207678_10030378 3300026067 Bacteria 4718
406 Ga0207678_10058059 3300026067 Bacteria 3330
407 Ga0207678_10158502 3300026067 Bacteria 1933
408 Ga0207678_10267287 3300026067 Bacteria 1466
409 Ga0207678_10486269 3300026067 Bacteria 1075
410 Ga0207678_10562573 3300026067 Bacteria 998
411 Ga0207708_10371320 3300026075 Bacteria 1178
412 Ga0207702_10000002 3300026078 Bacteria 491507
413 Ga0207702_10000442 3300026078 Bacteria 47074
414 Ga0207702_10005388 3300026078 Bacteria 11206
415 Ga0207702_10158985 3300026078 Bacteria 2062
416 Ga0207702_10229496 3300026078 Bacteria 1734
417 Ga0207702_11321156 3300026078 Bacteria 715
418 Ga0207641_10205256 3300026088 Bacteria 1820
419 Ga0207648_10068374 3300026089 Bacteria 3095
420 Ga0207676_10252097 3300026095 Bacteria 1589
421 Ga0207676_10328080 3300026095 Bacteria 1407
422 Ga0207674_10001614 3300026116 Bacteria 29042
423 Ga0207674_10053911 3300026116 Bacteria 4096
424 Ga0207674_10054460 3300026116 Bacteria 4072
425 Ga0207674_12182887 3300026116 Bacteria 517
426 Ga0207675_100133711 3300026118 Bacteria 2352
427 Ga0207683_10319485 3300026121 Bacteria 1422
428 Ga0207683_10401739 3300026121 Bacteria 1261
429 Ga0207683_10722074 3300026121 Bacteria 924
430 Ga0207698_10029731 3300026142 Bacteria 3917
431 Ga0207698_10075798 3300026142 Bacteria 2690
432 Ga0207698_10168267 3300026142 Bacteria 1927
433 Ga0207698_11272540 3300026142 Bacteria 750
434 Ga0209389_1000445 3300027296 Bacteria 24525
435 Ga0209589_1000003 3300027357 Bacteria 629130
436 Ga0209589_1000514 3300027357 Bacteria 55043
437 Ga0209489_100003 3300027361 Bacteria 663105
438 Ga0209700_100003 3300027363 Bacteria 663105
439 Ga0209813_10083040 3300027866 Bacteria 1063
440 Ga0268266_10060568 3300028379 Bacteria 3263
441 Ga0268266_10134066 3300028379 Bacteria 2217
442 Ga0268266_10450261 3300028379 Bacteria 1224
443 Ga0268266_10634657 3300028379 Bacteria 1027
444 Ga0268265_10155880 3300028380 Bacteria 1932
445 Ga0268265_10188803 3300028380 Bacteria 1777
446 Ga0268265_10191307 3300028380 Bacteria 1767
447 Ga0268264_10212848 3300028381 Bacteria 1775
448 Ga0268264_10239966 3300028381 Bacteria 1678
449 Ga0268264_10407607 3300028381 Bacteria 1308
450 Ga0268264_10834651 3300028381 Bacteria 922
451 Ga0265337_1005726 3300028556 Bacteria 4883
452 Ga0265326_10001798 3300028558 Bacteria 7393
453 Ga0265319_1005521 3300028563 Bacteria 6043
454 Ga0265334_10002109 3300028573 Bacteria 9396
455 Ga0265334_10030164 3300028573 Bacteria 2172
456 Ga0265318_10018005 3300028577 Bacteria 2890
457 Ga0265323_10003106 3300028653 Bacteria 7386
458 Ga0265322_10013091 3300028654 Bacteria 2400
459 Ga0265336_10000765 3300028666 Bacteria 17023
460 Ga0307515_10000198 3300028794 Bacteria 147738
461 Ga0307515_10188224 3300028794 Bacteria 1985
462 Ga0265338_10001398 3300028800 Bacteria 39299
463 Ga0265324_10004472 3300029957 Bacteria 6294
464 Ga0265340_10150688 3300031247 Bacteria 1060
465 Ga0265339_10018141 3300031249 Bacteria 4154
466 Ga0265331_10048861 3300031250 Bacteria 2033
467 Ga0307513_10006546 3300031456 Bacteria 15215
468 Ga0307408_100965537 3300031548 Bacteria 784
469 Ga0307508_10279508 3300031616 Bacteria 1263
470 Ga0265314_10013455 3300031711 Bacteria 6608
471 Ga0265342_10003387 3300031712 Bacteria 13137
472 Ga0307516_10058125 3300031730 Bacteria 3766
473 Ga0307516_10297926 3300031730 Bacteria 1289
474 Ga0316044_114609 3300031810 Bacteria 884
475 Ga0307406_10822393 3300031901 Bacteria 785
476 Ga0307407_11115557 3300031903 Bacteria 614
477 Ga0307412_10266323 3300031911 Bacteria 1339
478 Ga0315911_1000001 3300033442 Bacteria 1088602
479 Ga0373950_0039160 3300034818 Bacteria 902
480 Ga0373952_0197686 3300035092 Bacteria 588
481 Ga0373953_0022877 3300035117 Bacteria 2362
482 Ga0373954_0025410 3300035118 Bacteria 2706
483 Ga0373957_0021546 3300035120 Bacteria 2289
484 Ga0373943_0070873 3300035170 Bacteria 1765
485 Ga0373946_0518987 3300035171 Bacteria 612
486 Ga0373924_0084043 3300035410 Bacteria 1357
487 Ga0373935_0463742 3300035692 Bacteria 916
488 Ga0373927_0194919 3300035695 Bacteria 1329
489 Ga0373933_0075677 3300035724 Bacteria 2055
490 Ga0373947_0309666 3300035725 Bacteria 1054
491 Ga0373937_0296866 3300036401 Bacteria 1527
492 Ga0316582_0191602 3300036647 Bacteria 1393
493 Ga0395899_0000059 3300037312 Bacteria 213004
494 Ga0395900_0000017 3300037418 Bacteria 369602
495 Ga0395900_0797231 3300037418 Bacteria 873
496 Ga0395900_1472613 3300037418 Bacteria 593
497 Ga0395898_0000030 3300037466 Bacteria 369577
498 Ga0395898_0092749 3300037466 Bacteria 2904
499 Ga0395905_0000056 3300037471 Bacteria 209230
500 Ga0395905_0032237 3300037471 Bacteria 4928
501 Ga0395905_0120425 3300037471 Bacteria 2467
502 Ga0436364_0011267 3300037853 Bacteria 2897
503 Ga0436364_0223577 3300037853 Bacteria 1326
504 Ga0436364_0836584 3300037853 Bacteria 3621
505 Ga0395901_0000015 3300038443 Bacteria 373388
506 Ga0395901_1330146 3300038443 Bacteria 679
507 Ga0436365_0188153 3300039437 Bacteria 613
508 Ga0436365_1034663 3300039437 Bacteria 598
509 Ga0436365_1530142 3300039437 Bacteria 2200
510 Ga0436365_1689582 3300039437 Bacteria 2390
511 Ga0436365_1721433 3300039437 Bacteria 2506
512 Ga0436365_1792102 3300039437 Bacteria 814
513 Ga0436361_0389690 3300039447 Bacteria 7027
514 Ga0436361_0393557 3300039447 Bacteria 965
515 Ga0436363_1282227 3300039450 Bacteria 1043
516 Ga0451791_0347348 3300041451 Bacteria 622
517 Ga0451800_0052594 3300041459 Bacteria 656
518 Ga0439434_0222684 3300042435 Bacteria 640
519 Ga0466969_0016125 3300044656 Bacteria 3914
520 Ga0466969_0272834 3300044656 Bacteria 766
521 Ga0466969_0283938 3300044656 Bacteria 749
522 Ga0466972_0006610 3300044658 Bacteria 5822
523 Ga0466965_0207394 3300044683 Bacteria 1041
524 Ga0466965_0704471 3300044683 Bacteria 579
525 Ga0466966_0284386 3300044684 Bacteria 994
526 Ga0466961_0477939 3300044693 Bacteria 753
527 Ga0466963_0160928 3300044694 Bacteria 1562
528 Ga0466971_0045342 3300044719 Bacteria 1975
529 Ga0466968_0161364 3300044735 Bacteria 1035
530 Ga0466968_0413420 3300044735 Bacteria 663
531 Ga0466968_0608198 3300044735 Bacteria 552
532 Ga0466968_0654954 3300044735 Bacteria 533
533 Ga0466970_0155949 3300044765 Bacteria 1262
534 Ga0466957_0559766 3300044842 Bacteria 797
535 Ga0466959_0016249 3300045049 Bacteria 5435
536 Ga0466959_0030669 3300045049 Bacteria 3981
537 Ga0466959_0207675 3300045049 Bacteria 1362
538 Ga0466959_0478394 3300045049 Bacteria 843
539 Ga0466959_0745770 3300045049 Bacteria 655
540 Ga0466958_1043632 3300045836 Bacteria 533
541 Ga0466967_0066166 3300045976 Bacteria 3219
542 Ga0466967_0136069 3300045976 Bacteria 2285
543 Ga0466967_0280234 3300045976 Bacteria 1599
544 Ga0495627_208489 3300046453 Bacteria 538
545 Ga0495603_0080240 3300046455 Bacteria 1912
546 Ga0495603_0101515 3300046455 Bacteria 1679
547 Ga0495603_0833492 3300046455 Bacteria 525
548 Ga0495651_0049749 3300046462 Bacteria 3235
549 Ga0495653_0037072 3300046463 Bacteria 3835
550 Ga0495653_0278818 3300046463 Bacteria 1098
551 Ga0495580_0119656 3300046472 Bacteria 1829
552 Ga0495580_0991449 3300046472 Bacteria 536
553 Ga0495582_0510710 3300046473 Bacteria 695
554 Ga0495639_0059158 3300046475 Bacteria 1754
555 Ga0495585_0055312 3300046492 Bacteria 2193
556 Ga0495594_0090670 3300046499 Bacteria 1713
557 Ga0495594_0139606 3300046499 Bacteria 1374
558 Ga0495607_0028013 3300046501 Bacteria 3479
559 Ga0495608_0047322 3300046511 Bacteria 2859
560 Ga0495616_0267572 3300046513 Bacteria 729
561 Ga0495618_0120870 3300046514 Bacteria 1677
562 Ga0495630_0027840 3300046517 Bacteria 4198
563 Ga0495630_0411849 3300046517 Bacteria 1036
564 Ga0495632_0173159 3300046519 Bacteria 991
565 Ga0495637_0119905 3300046520 Bacteria 1013
566 Ga0495643_0148033 3300046522 Bacteria 1165
567 Ga0495663_0365409 3300046525 Bacteria 527
568 Ga0495652_0028933 3300046529 Bacteria 4869
569 Ga0495665_0445599 3300046531 Bacteria 655
570 Ga0495587_0023026 3300046536 Bacteria 3830
571 Ga0495598_0032556 3300046537 Bacteria 1474
572 Ga0495597_0094850 3300046542 Bacteria 1263
573 Ga0495622_0186161 3300046557 Bacteria 929
574 Ga0495667_0029419 3300046559 Bacteria 3698
575 Ga0495656_0154924 3300046615 Bacteria 1109
576 Ga0495668_0057814 3300046616 Bacteria 2140
577 Ga0495668_0099147 3300046616 Bacteria 1594
578 Ga0495661_0412218 3300046665 Bacteria 655
579 Ga0495588_0282226 3300046674 Bacteria 875
580 Ga0495588_0567180 3300046674 Bacteria 595
581 Ga0495657_0209589 3300046675 Bacteria 1185
582 Ga0495599_0085566 3300046678 Bacteria 1969
583 Ga0495623_0020900 3300046679 Bacteria 4230
584 Ga0495658_0256442 3300046683 Bacteria 1101
585 Ga0495669_0236885 3300046684 Bacteria 876
586 Ga0495624_0838855 3300046690 Bacteria 542
587 Ga0495670_0080717 3300046691 Bacteria 1657
588 Ga0495671_0016535 3300046692 Bacteria 3937
589 Ga0495581_0360247 3300047315 Bacteria 849
590 Ga0495604_0023604 3300047317 Bacteria 4907
591 Ga0495604_0757227 3300047317 Bacteria 614
592 Ga0495672_0541618 3300047320 Bacteria 511
593 Ga0495676_0021656 3300047321 Bacteria 5608
594 Ga0495680_0047093 3300047322 Bacteria 3394
595 Ga0495687_007256 3300047443 Bacteria 6577
596 Ga0495675_0059711 3300047444 Bacteria 2417
597 Ga0495677_0070733 3300047445 Bacteria 1300
598 Ga0495673_0239560 3300047469 Bacteria 665
599 Ga0495681_0059701 3300047470 Bacteria 1762
600 Ga0495686_0081318 3300047472 Bacteria 1979
601 Ga0495686_0347204 3300047472 Bacteria 807
602 Ga0495602_0381519 3300048088 Bacteria 1009
603 Ga0495626_0093493 3300048091 Bacteria 1320
604 Ga0495626_0407025 3300048091 Bacteria 525
605 Ga0496100_0053461 3300048903 Bacteria 2630
606 Ga0496100_0140001 3300048903 Bacteria 1714
607 Ga0496101_0054703 3300048904 Bacteria 2882
608 Ga0496101_0453101 3300048904 Bacteria 1012
609 Ga0496101_0588899 3300048904 Bacteria 879
610 Ga0496102_0004466 3300048905 Bacteria 11805
611 Ga0496102_0257729 3300048905 Bacteria 1644
612 Ga0496103_0222176 3300048906 Bacteria 1215
613 Ga0496105_0018366 3300048908 Bacteria 5618
614 Ga0496105_0170799 3300048908 Bacteria 1782
615 Ga0496105_0473379 3300048908 Bacteria 986
616 Ga0496105_1135701 3300048908 Bacteria 578
617 Ga0496106_0245270 3300048909 Bacteria 1431
618 Ga0496108_1356615 3300048911 Bacteria 596
619 Ga0496109_0130302 3300048912 Bacteria 2347
620 Ga0496109_0367193 3300048912 Bacteria 1359
621 Ga0496110_0135466 3300048913 Bacteria 2225
622 Ga0496110_0169841 3300048913 Bacteria 1978
623 Ga0496110_0208480 3300048913 Bacteria 1776
624 Ga0496110_0793344 3300048913 Bacteria 851
625 Ga0496111_0189975 3300048914 Bacteria 1527
626 Ga0496111_0220626 3300048914 Bacteria 1409
627 Ga0496112_0066511 3300048915 Bacteria 3556
628 Ga0496112_0621399 3300048915 Bacteria 1011
629 Ga0496112_0708443 3300048915 Bacteria 934
630 Ga0496113_0005243 3300048916 Bacteria 8069
631 Ga0496113_0259845 3300048916 Bacteria 1387
632 Ga0496113_1108711 3300048916 Bacteria 620
633 Ga0496114_0300994 3300048917 Bacteria 1416
634 Ga0496114_0942637 3300048917 Bacteria 745
635 Ga0496115_0009418 3300048918 Bacteria 7257
636 Ga0496115_0553371 3300048918 Bacteria 919
637 Ga0496116_0105066 3300048919 Bacteria 1676
638 Ga0496117_0034246 3300048920 Bacteria 3829
639 Ga0496117_0077642 3300048920 Bacteria 2196
640 Ga0496117_0172333 3300048920 Bacteria 1254
641 Ga0496118_0026583 3300048921 Bacteria 4925
642 Ga0496118_0041896 3300048921 Bacteria 3619
643 Ga0496118_0090739 3300048921 Bacteria 2104
644 Ga0496118_0294961 3300048921 Bacteria 894
645 Ga0496119_0239808 3300048922 Bacteria 919
646 Ga0496120_0092251 3300048923 Bacteria 1616
647 Ga0496120_0171153 3300048923 Bacteria 1074
648 Ga0496121_0003672 3300048924 Bacteria 21573
649 Ga0496121_0070646 3300048924 Bacteria 2811
650 Ga0496121_0087661 3300048924 Bacteria 2442
651 Ga0496121_0129036 3300048924 Bacteria 1896
652 Ga0496121_0346783 3300048924 Bacteria 990
653 Ga0496121_0651291 3300048924 Bacteria 641
654 Ga0496122_0101863 3300048925 Bacteria 1916
655 Ga0496123_0088944 3300048926 Bacteria 1841
656 Ga0496124_0300048 3300048927 Bacteria 1161
657 Ga0496125_0000090 3300048928 Bacteria 214433
658 Ga0496125_0001219 3300048928 Bacteria 38596
659 Ga0496125_0043512 3300048928 Bacteria 3810
660 Ga0496125_0055311 3300048928 Bacteria 3234
661 Ga0496125_0076314 3300048928 Bacteria 2588
662 Ga0496125_0709333 3300048928 Bacteria 533
663 Ga0496126_0013869 3300048929 Bacteria 8174
664 Ga0496126_0023395 3300048929 Bacteria 5988
665 Ga0496126_0028110 3300048929 Bacteria 5362
666 Ga0496126_0060139 3300048929 Bacteria 3418
667 Ga0496126_0137332 3300048929 Bacteria 2107
668 Ga0496126_0207038 3300048929 Bacteria 1653
669 Ga0496126_0260728 3300048929 Bacteria 1441
670 Ga0496126_0528628 3300048929 Bacteria 939
671 Ga0496126_0946543 3300048929 Bacteria 650
672 Ga0496126_0960951 3300048929 Bacteria 644
673 Ga0495682_0243303 3300049460 Bacteria 636
674 Ga0501031_0000442 3300049568 Bacteria 23895
675 Ga0501031_0014148 3300049568 Bacteria 5191
676 Ga0501031_0021697 3300049568 Bacteria 4186
677 Ga0501031_0102498 3300049568 Bacteria 1867
678 Ga0501031_0218862 3300049568 Bacteria 1240
679 Ga0501031_0275537 3300049568 Bacteria 1092
680 Ga0501031_0358115 3300049568 Bacteria 944
681 Ga0501032_0000031 3300049569 Bacteria 130204
682 Ga0501032_0000773 3300049569 Bacteria 25943
683 Ga0501032_0006279 3300049569 Bacteria 8753
684 Ga0501032_0023195 3300049569 Bacteria 4294
685 Ga0501032_0068001 3300049569 Bacteria 2379
686 Ga0501032_0102250 3300049569 Bacteria 1899
687 Ga0501032_0204503 3300049569 Bacteria 1288
688 Ga0501033_0000126 3300049570 Bacteria 74250
689 Ga0501033_0005198 3300049570 Bacteria 10340
690 Ga0501033_0009424 3300049570 Bacteria 7517
691 Ga0501033_0014639 3300049570 Bacteria 5955
692 Ga0501033_0033905 3300049570 Bacteria 3832
693 Ga0501033_0043543 3300049570 Bacteria 3343
694 Ga0501033_0044422 3300049570 Bacteria 3308
695 Ga0501033_0136117 3300049570 Bacteria 1777
696 Ga0501033_0141567 3300049570 Bacteria 1738
697 Ga0501033_0823751 3300049570 Bacteria 627
698 Ga0501034_0000021 3300049571 Bacteria 266023
699 Ga0501034_0000064 3300049571 Bacteria 189461
700 Ga0501034_0059763 3300049571 Bacteria 3829
701 Ga0501034_0113529 3300049571 Bacteria 2699
702 Ga0501034_0186446 3300049571 Bacteria 2038
703 Ga0501034_0256592 3300049571 Bacteria 1692
704 Ga0501034_0490434 3300049571 Bacteria 1143
705 Ga0501036_0000069 3300049572 Bacteria 64331
706 Ga0501036_0005749 3300049572 Bacteria 10056
707 Ga0501036_0189772 3300049572 Bacteria 1729
708 Ga0501036_0328858 3300049572 Bacteria 1277
709 Ga0501036_0930287 3300049572 Bacteria 713
710 Ga0501037_0000034 3300049573 Bacteria 126321
711 Ga0501037_0000616 3300049573 Bacteria 27595
712 Ga0501037_0005524 3300049573 Bacteria 9221
713 Ga0501037_0025364 3300049573 Bacteria 4381
714 Ga0501037_0095767 3300049573 Bacteria 2145
715 Ga0501037_0800436 3300049573 Bacteria 622
716 Ga0501038_0000205 3300049574 Bacteria 50558
717 Ga0501038_0000537 3300049574 Bacteria 33396
718 Ga0501038_0037431 3300049574 Bacteria 4253
719 Ga0501038_0049398 3300049574 Bacteria 3637
720 Ga0501038_0200018 3300049574 Bacteria 1604
721 Ga0501038_0227550 3300049574 Bacteria 1486
722 Ga0501038_0307720 3300049574 Bacteria 1242
723 Ga0501038_0600137 3300049574 Bacteria 833
724 Ga0501038_0895858 3300049574 Bacteria 655
725 Ga0501039_0000198 3300049575 Bacteria 43456
726 Ga0501039_0002792 3300049575 Bacteria 13046
727 Ga0501039_0830048 3300049575 Bacteria 721
728 Ga0501039_1077254 3300049575 Bacteria 623
729 Ga0501040_0156581 3300049576 Bacteria 1609
730 Ga0501040_0622376 3300049576 Bacteria 780
731 Ga0501041_0478332 3300049577 Bacteria 791
732 Ga0501042_0074198 3300049578 Bacteria 2434
733 Ga0501043_0000015 3300049579 Bacteria 175932
734 Ga0501043_0000107 3300049579 Bacteria 77469
735 Ga0501043_0001044 3300049579 Bacteria 24351
736 Ga0501043_0016446 3300049579 Bacteria 5800
737 Ga0501043_0021518 3300049579 Bacteria 5057
738 Ga0501043_0068674 3300049579 Bacteria 2783
739 Ga0501043_0174701 3300049579 Bacteria 1675
740 Ga0501043_0624827 3300049579 Bacteria 793
741 Ga0501043_0728933 3300049579 Bacteria 722
742 Ga0501046_0003594 3300049580 Bacteria 14203
743 Ga0501046_0011039 3300049580 Bacteria 7740
744 Ga0501046_0095285 3300049580 Bacteria 2287
745 Ga0501046_0097356 3300049580 Bacteria 2260
746 Ga0501046_1082929 3300049580 Bacteria 554
747 Ga0501047_0000587 3300049581 Bacteria 38665
748 Ga0501047_0020996 3300049581 Bacteria 6273
749 Ga0501047_0068073 3300049581 Bacteria 3430
750 Ga0501047_0100525 3300049581 Bacteria 2771
751 Ga0501047_0242842 3300049581 Bacteria 1651
752 Ga0501048_0001731 3300049582 Bacteria 16614
753 Ga0501048_0059277 3300049582 Bacteria 2713
754 Ga0501067_0000331 3300049583 Bacteria 25804
755 Ga0501067_0047655 3300049583 Bacteria 2377
756 Ga0501067_0203767 3300049583 Bacteria 1102
757 Ga0501068_0000039 3300049584 Bacteria 48466
758 Ga0501068_0716273 3300049584 Bacteria 655
759 Ga0501068_1007242 3300049584 Bacteria 550
760 Ga0501069_0000039 3300049585 Bacteria 82361
761 Ga0501069_0013970 3300049585 Bacteria 4289
762 Ga0501069_0019200 3300049585 Bacteria 3694
763 Ga0501069_0039180 3300049585 Bacteria 2617
764 Ga0501070_0000132 3300049586 Bacteria 67092
765 Ga0501070_0000299 3300049586 Bacteria 46014
766 Ga0501070_0002117 3300049586 Bacteria 17410
767 Ga0501070_0007344 3300049586 Bacteria 9356
768 Ga0501070_0036765 3300049586 Bacteria 4090
769 Ga0501070_0070851 3300049586 Bacteria 2886
770 Ga0501070_0078238 3300049586 Bacteria 2737
771 Ga0501070_0233142 3300049586 Bacteria 1508
772 Ga0501070_0690937 3300049586 Bacteria 807
773 Ga0501070_1035658 3300049586 Bacteria 635
774 Ga0501071_0165148 3300049587 Bacteria 1656
775 Ga0501071_0302093 3300049587 Bacteria 1213
776 Ga0501071_0845836 3300049587 Bacteria 706
777 Ga0501071_1326758 3300049587 Bacteria 556
778 Ga0501072_0014578 3300049588 Bacteria 6023
779 Ga0501072_0469800 3300049588 Bacteria 996
780 Ga0501072_1406849 3300049588 Bacteria 539
781 Ga0501073_0000144 3300049589 Bacteria 47087
782 Ga0501073_0048839 3300049589 Bacteria 2969
783 Ga0501073_0367399 3300049589 Bacteria 994
784 Ga0501073_0695776 3300049589 Bacteria 701
785 Ga0501074_0001123 3300049590 Bacteria 17513
786 Ga0501074_0005397 3300049590 Bacteria 9201
787 Ga0501074_0010236 3300049590 Bacteria 6805
788 Ga0501074_0089756 3300049590 Bacteria 2201
789 Ga0501074_0108152 3300049590 Bacteria 1990
790 Ga0501074_1029684 3300049590 Bacteria 579
791 Ga0501076_0173360 3300049592 Bacteria 1758
792 Ga0501077_1026456 3300049593 Bacteria 531
793 Ga0501079_0004404 3300049741 Bacteria 10430
794 Ga0501079_0206606 3300049741 Bacteria 1534
795 Ga0501080_0001145 3300049742 Bacteria 21850
796 Ga0501080_0001676 3300049742 Bacteria 18865
797 Ga0501080_0003023 3300049742 Bacteria 14830
798 Ga0501080_0004511 3300049742 Bacteria 12412
799 Ga0501080_0097918 3300049742 Bacteria 2723
800 Ga0501080_0260497 3300049742 Bacteria 1580
801 Ga0501080_0569745 3300049742 Bacteria 1007
802 Ga0501080_1184114 3300049742 Bacteria 657
803 Ga0501081_1253969 3300049743 Bacteria 562
804 Ga0501081_1545901 3300049743 Bacteria 504
805 Ga0501083_0002416 3300049744 Bacteria 12766
806 Ga0501083_0003750 3300049744 Bacteria 10671
807 Ga0501083_0390073 3300049744 Bacteria 906
808 Ga0501035_0000055 3300049822 Bacteria 139471
809 Ga0501035_0000436 3300049822 Bacteria 46832
810 Ga0501035_0000807 3300049822 Bacteria 33393
811 Ga0501035_0000865 3300049822 Bacteria 32300
812 Ga0501035_0013030 3300049822 Bacteria 7674
813 Ga0501035_0022239 3300049822 Bacteria 5823
814 Ga0501035_0040528 3300049822 Bacteria 4208
815 Ga0501035_0167350 3300049822 Bacteria 1900
816 Ga0501035_0203988 3300049822 Bacteria 1694
817 Ga0501035_0242553 3300049822 Bacteria 1532
818 Ga0501035_1181097 3300049822 Bacteria 594
819 Ga0501044_0000028 3300049823 Bacteria 179203
820 Ga0501044_0000071 3300049823 Bacteria 124531
821 Ga0501044_0030397 3300049823 Bacteria 5693
822 Ga0501044_0030832 3300049823 Bacteria 5647
823 Ga0501044_0052011 3300049823 Bacteria 4223
824 Ga0501044_0053864 3300049823 Bacteria 4137
825 Ga0501044_0070576 3300049823 Bacteria 3553
826 Ga0501044_0070897 3300049823 Bacteria 3544
827 Ga0501044_0086235 3300049823 Bacteria 3172
828 Ga0501044_0122650 3300049823 Bacteria 2598
829 Ga0501044_0125897 3300049823 Bacteria 2560
830 Ga0501044_0534274 3300049823 Bacteria 1071
831 Ga0501044_0704296 3300049823 Bacteria 895
832 Ga0501044_0718589 3300049823 Bacteria 883
833 Ga0501044_0795012 3300049823 Bacteria 826
834 Ga0501045_0015837 3300049824 Bacteria 5348
835 Ga0501045_0497188 3300049824 Bacteria 906
836 Ga0501045_0815964 3300049824 Bacteria 687
837 nmdc:mga03n38_238584_c1 3300050490 Bacteria 956
838 nmdc:mga03n38_522247_c1 3300050490 Bacteria 669
839 nmdc:mga00v17_113033_c1 3300050491 Bacteria 1724
840 nmdc:mga00v17_23145_c1 3300050491 Bacteria 3591
841 nmdc:mga00v17_424712_c1 3300050491 Bacteria 863
842 nmdc:mga00v17_441924_c1 3300050491 Bacteria 845
843 nmdc:mga0yw44_178137_c1 3300050492 Bacteria 1398
844 nmdc:mga0yw44_751055_c1 3300050492 Bacteria 663
845 nmdc:mga0k408_405448_c1 3300050493 Bacteria 811
846 nmdc:mga0k408_712448_c1 3300050493 Bacteria 588
847 nmdc:mga0k408_833593_c1 3300050493 Bacteria 537
848 nmdc:mga06z11_554979_c1 3300050494 Bacteria 698
849 nmdc:mga06z11_998767_c1 3300050494 Bacteria 510
850 nmdc:mga04h51_1603_c1 3300050495 Bacteria 5267
851 nmdc:mga07m45_299048_c1 3300050496 Bacteria 936
852 nmdc:mga07m45_316189_c1 3300050496 Bacteria 908
853 nmdc:mga07m45_36612_c1 3300050496 Bacteria 2186
854 nmdc:mga07m45_728742_c1 3300050496 Bacteria 570
855 nmdc:mga0sz30_26148_c1 3300050516 Bacteria 2391
856 nmdc:mga0sz30_69532_c1 3300050516 Bacteria 1514
857 Ga0495655_0198720 3300053083 Bacteria 655
858 Ga0495655_0275696 3300053083 Bacteria 572
859 Ga0495595_0235348 3300053084 Bacteria 915
860 Ga0495619_0091324 3300053085 Bacteria 2061
861 Ga0500566_0006668 3300053094 Bacteria 6837
862 Ga0500650_0002916 3300053098 Bacteria 5796
863 Ga0500555_001383 3300053103 Bacteria 7489
864 Ga0500572_000088 3300053111 Bacteria 29518
865 Ga0500593_223144 3300053117 Bacteria 660
866 Ga0500608_010423 3300053122 Bacteria 3989
867 Ga0500618_006001 3300053125 Bacteria 3615
868 Ga0500621_227861 3300053126 Bacteria 641
869 Ga0500642_0000074 3300053130 Bacteria 54356
870 Ga0500642_0274603 3300053130 Bacteria 767
871 Ga0500652_000065 3300053131 Bacteria 46129
872 Ga0500658_0362206 3300053134 Bacteria 665
873 Ga0500559_0000321 3300053136 Bacteria 36410
874 Ga0500559_0000381 3300053136 Bacteria 32402
875 Ga0500559_0085448 3300053136 Bacteria 1439
876 Ga0500559_0293394 3300053136 Bacteria 764
877 Ga0500568_0000556 3300053139 Bacteria 27442
878 Ga0500568_0009976 3300053139 Bacteria 4480
879 Ga0500586_085382 3300053145 Bacteria 1108
880 Ga0500604_0002433 3300053151 Bacteria 5079
881 Ga0500616_0000283 3300053153 Bacteria 74456
882 Ga0500633_0049618 3300053160 Bacteria 1444
883 Ga0500634_0076383 3300053161 Bacteria 1739
884 Ga0500639_022496 3300053163 Bacteria 3330
885 Ga0500636_0000479 3300053177 Bacteria 21763
886 Ga0500637_0216074 3300053178 Bacteria 1086
887 Ga0500649_152363 3300053722 Bacteria 828
888 Ga0500570_129912 3300053724 Bacteria 960
889 Ga0500576_030942 3300053725 Bacteria 2432
890 Ga0500645_004743 3300053730 Bacteria 5148
891 Ga0500645_028876 3300053730 Bacteria 1676
892 Ga0500645_165285 3300053730 Bacteria 606
893 Ga0500596_000143 3300053735 Bacteria 10778
894 Ga0501084_0006472 3300054114 Bacteria 9632
895 Ga0501084_0049335 3300054114 Bacteria 3524
896 Ga0587066_120608 3300059490 Bacteria 619
897 Ga0587073_0110384 3300059492 Bacteria 728
898 Ga0587073_0132435 3300059492 Bacteria 686
899 Ga0587073_0203977 3300059492 Bacteria 595
900 Ga0587077_074509 3300059493 Bacteria 766
901 Ga0587080_107286 3300059503 Bacteria 605
902 Ga0587082_181561 3300059504 Bacteria 516
903 Ga0587083_0062596 3300059505 Bacteria 843
904 Ga0587083_0066555 3300059505 Bacteria 826
905 Ga0587083_0209779 3300059505 Bacteria 561
906 Ga0587083_0266102 3300059505 Bacteria 516
907 Ga0587085_027564 3300059506 Bacteria 912
908 Ga0587086_017567 3300059507 Bacteria 945
909 Ga0587089_068118 3300059509 Bacteria 600
910 Ga0587090_131331 3300059510 Bacteria 552
911 Ga0587094_068791 3300059513 Bacteria 634
912 Ga0587106_129405 3300059605 Bacteria 543
913 Ga0587131_015566 3300059609 Bacteria 588
914 Ga0587101_058093 3300059623 Bacteria 684
915 Ga0587109_126536 3300059624 Bacteria 612
916 Ga0587115_047365 3300059626 Bacteria 689
917 Ga0587122_058045 3300059628 Bacteria 515
918 Ga0587128_054851 3300059630 Bacteria 738
919 Ga0587128_056786 3300059630 Bacteria 729
920 Ga0587128_057552 3300059630 Bacteria 726
921 Ga0587062_080859 3300059639 Bacteria 604
922 Ga0587068_088156 3300059641 Bacteria 636
923 Ga0587069_156258 3300059642 Bacteria 510
924 Ga0587072_029201 3300059643 Bacteria 1022
925 Ga0587072_206428 3300059643 Bacteria 502
926 Ga0587102_034710 3300059649 Bacteria 630
927 Ga0587107_047735 3300059652 Bacteria 715
928 Ga0587110_033874 3300059654 Bacteria 633
929 Ga0587114_082539 3300059655 Bacteria 600
930 Ga0587116_20562 3300059656 Bacteria 504
931 Ga0587071_107742 3300060344 Bacteria 652
932 Ga0501082_0011901 3300060353 Bacteria 7479
933 Ga0501082_0540966 3300060353 Bacteria 1019
934 Ga0501082_1052723 3300060353 Bacteria 711
935 Ga0530510_0805988 3300061734 Bacteria 717
936 2507508697 2507262055 Bacteria 8048963
937 2508542791 2508501009 Bacteria 7784016
938 2509150394 2508501128 Bacteria 8613869
939 2513623145 2513237092 Bacteria 8341956
940 2513639090 2513237094 Bacteria 8789602
941 2513654627 2513237096 Bacteria 8722461
942 2513680291 2513237098 Bacteria 9902361
943 2513692409 2513237101 Bacteria 7952346
944 2513700171 2513237102 Bacteria 7703324
945 2513860996 2513237137 Bacteria 9558895
946 2513872665 2513237139 Bacteria 8737671
947 2513893547 2513237141 Bacteria 8496279
948 2513915194 2513237145 Bacteria 8979722
949 2514011958 2513237161 Bacteria 8871253
950 2517892489 2517572143 Bacteria 9484767
951 2524440455 2524023205 Bacteria 8918781
952 2524471317 2524023210 Bacteria 9029266
953 2524540060 2524023228 Bacteria 10118060
954 2603859341 2602042107 Bacteria 6226103
955 2617348909 2617270735 Bacteria 9163226
956 2617375873 2617270741 Bacteria 8201522
957 2644288662 2643221651 Bacteria 4798932
958 2671122400 2667528175 Bacteria 7532676
959 2723845202 2721755755 Bacteria 8322773
960 2728751531 2728368998 Bacteria 8720350
961 2745075276 2744054633 Bacteria 8678936
962 2793062514 2791355196 Bacteria 7323613
963 2793068689 2791355197 Bacteria 8420563
964 2793083589
965 2805915437 2802429603 Bacteria 8777136
966 2818241017 2816332527 Bacteria 8933356
967 2824603464 2824600985 Bacteria 8488197
968 2824614743 2824609381 Bacteria 8672835
969 2824667427 2824661429 Bacteria 9877870
970 2824675800 2824671348 Bacteria 8369588
971 2824686293 2824679649 Bacteria 8248951
972 2824695370 2824687955 Bacteria 8360029
973 2824703755 2824696289 Bacteria 8335049
974 2824711988 2824704595 Bacteria 9667483
975 2824738607 2824732956 Bacteria 7810675
976 2824751571 2824746037 Bacteria 7911610
977 2824756878 2824753945 Bacteria 9787441
978 2824767471 2824763712 Bacteria 9792355
979 2824777692 2824773399 Bacteria 8360218
980 2838123861 2838122688 Bacteria 8803140
981 2841944012 2841941048 Bacteria 8688029
982 2841949960 2841949485 Bacteria 8680857
983 2841966379 2841966195 Bacteria 8673214
984 2841975112 2841974524 Bacteria 8931498
985 2841983316 2841983080 Bacteria 8395090
986 2842039180 2842038055 Bacteria 8002051
987 2842047873 2842045827 Bacteria 8006841
988 2844318983 2844315083 Bacteria 8138177
989 2847936106 2847930680 Bacteria 9342022
990 2847946458 2847939898 Bacteria 8606328
991 2849079422 2849076700 Bacteria 7039503
992 2857514429 2857509624 Bacteria 7472071
993 2857529246 2857524615 Bacteria 6615449
994 2874593431 2874590934 Bacteria 8299676
995 2874605084 2874604998 Bacteria 7834745
996 2874615203 2874612657 Bacteria 8252029
997 2874627216 2874620515 Bacteria 8290088
998 2874633295 2874628541 Bacteria 8630250
999 2874648985 2874645413 Bacteria 8214782
1000 2876767082 2876761206 Bacteria 10111113
1001 2876773152 2876771140 Bacteria 8287509
1002 2876822042 2876818435 Bacteria 8274608
1003 2879077197 2879074833 Bacteria 8279565
1004 2879090085 2879083081 Bacteria 8587928
1005 2879103242 2879099564 Bacteria 10442239
1006 2879113581 2879110137 Bacteria 8907982
1007 2879130034 2879127579 Bacteria 8294491
1008 2879147049 2879142872 Bacteria 8267021
1009 2881367045 2881364244 Bacteria 7710352
1010 2881671069 2881665667 Bacteria 8175609
1011 2885370443 2885366525 Bacteria 8326213
1012 2885379906 2885374607 Bacteria 8927485
1013 2885392561 2885383462 Bacteria 9473874
1014 2885412161 2885409591 Bacteria 9235467
1015 2888393914 2888388044 Bacteria 7304136
1016 2888424363 2888419890 Bacteria 7857137
1017 2889039954 2889033259 Bacteria 9099371
1018 2893071359 2893066018 Bacteria 6158120
1019 2903729093 2903727486 Bacteria 8281579
1020 2903750143 2903748898 Bacteria 9972761
1021 2903774076 2903768456 Bacteria 9749579
1022 2904671264 2904666416 Bacteria 8226587
1023 2904695898 2904690495 Bacteria 9412302
1024 2904703320
1025 2904720631 2904711408 Bacteria 9771557
1026 2906610138 2906602504 Bacteria 8295279
1027 2906618530
1028 2906634886 2906626472 Bacteria 8826946
1029 2906638798 2906635258 Bacteria 8601019
1030 2906650495 2906643746 Bacteria 8722424
1031 2906664215 2906660503 Bacteria 8595048
1032 2908742801 2908739725 Bacteria 8628932
1033 2908761019 2908756301 Bacteria 8864324
1034 2908780071 2908775508 Bacteria 8092255
1035 2919076754 2919073203 Bacteria 6531949
1036 2922365247 2922361189 Bacteria 7436256
1037 2922390871 2922386360 Bacteria 7017218
1038 2922396424 2922393267 Bacteria 8285685
1039 2922430173
1040 2929617941 2929615660 Bacteria 9193770
1041 2929627622 2929624759 Bacteria 9339455
1042 2932797599 2932794094 Bacteria 7915132
1043 2932802917 2932801729 Bacteria 7987968
1044 2932810573 2932809354 Bacteria 9135765
1045 2932821283 2932818245 Bacteria 9955613
1046 2933579870 2933577622 Bacteria 9116884
1047 2935608778 2935608549 Bacteria 8203142
1048 2935622931 2935616580 Bacteria 9032984
1049 2935631757 2935630451 Bacteria 8169952
1050 2935642289 2935638405 Bacteria 10015038
1051 2935649932 2935648319 Bacteria 8801166
1052 2935661916 2935656913 Bacteria 8965014
1053 2935668407 2935665750 Bacteria 9571747
1054 2935692788 2935684952 Bacteria 9590419
1055 2935700958 2935694250 Bacteria 9291695
1056 2935721487 2935713505 Bacteria 9608509
1057 2935730405 2935722832 Bacteria 9608746
1058 2935740418 2935732158 Bacteria 9706831
1059 2935749682 2935741537 Bacteria 9707219
1060 2935759005 2935750917 Bacteria 9590372
1061 2935762663 2935760218 Bacteria 9817913
1062 2935790447 2935785616 Bacteria 7962367
1063 2935814582 2935810662 Bacteria 9401221
1064 2935821939 2935819856 Bacteria 8261050
1065 2935831720 2935827899 Bacteria 10038562
1066 2935838588 2935837841 Bacteria 9454360
1067 2935847521 2935847175 Bacteria 8228321
1068 2935861179 2935855204 Bacteria 9035059
1069 2935865717 2935864058 Bacteria 9784707
1070 2935878218 2935873716 Bacteria 9632195
1071 2935885257 2935883170 Bacteria 7964738
1072 2935909212 2935908558 Bacteria 8568796
1073 2935919933 2935916978 Bacteria 9113783
1074 2935926214 2935926038 Bacteria 8601059
1075 2935934664 2935934488 Bacteria 8602579
1076 2935943114 2935942939 Bacteria 8599779
1077 2935951552 2935951376 Bacteria 8602333
1078 2935966373 2935959822 Bacteria 7869783
1079 2935967677 2935967501 Bacteria 8603075
1080 2935977126 2935975950 Bacteria 8347125
1081 2935988284 2935984226 Bacteria 8302647
1082 2935994529 2935992306 Bacteria 9802711
1083 2936012585 2936011229 Bacteria 8801034
1084 2936021149 2936019824 Bacteria 8804134
1085 2936029878 2936028420 Bacteria 8965941
1086 2936040139 2936037263 Bacteria 9446081
1087 2936047343 2936046547 Bacteria 8903709
1088 2936057499 2936055302 Bacteria 8785755
1089 2940564990 2940556831 Bacteria 9590747
1090 2941513128 2941507105 Bacteria 8166816
1091 2941520968 2941515067 Bacteria 8166720
1092 2941526168 2941523033 Bacteria 8169134
1093 2941532633 2941531003 Bacteria 7653939
1094 3005480116 3005474847 Bacteria 9259049
1095 3005487239 3005483717 Bacteria 7877331
1096 3005510222 3005506211 Bacteria 6943378
1097 3005591026 3005587118 Bacteria 7794411
1098 3005599125 3005594810 Bacteria 8716512
1099 3005722214 3005718088 Bacteria 8283608
1100 8006940774 8006933436 Bacteria 10410654
1101 8006965623 8006964411 Bacteria 8966052
1102 8006980464 8006973647 Bacteria 10679141
1103 8006987159 8006984368 Bacteria 9651211
1104 8006998845 8006994254 Bacteria 8309700
1105 8016513332 8016511872 Bacteria 9921665
1106 8016573287 8016566248 Bacteria 8158151
1107 8016591913 8016583857 Bacteria 10421953
1108 8016600151 8016595262 Bacteria 8149947
1109 8016626656 8016622563 Bacteria 7999408
1110 8016640469 8016630954 Bacteria 9217207
1111 8019556857 8019555841 Bacteria 9642137
1112 8019568441 8019565922 Bacteria 9639779
1113 8019582532 8019576017 Bacteria 10049540
1114 8019590317 8019586578 Bacteria 10212056
1115 8019617515 8019608314 Bacteria 10042931
1116 8019628016 8019619141 Bacteria 9218857
1117 8019634581 8019629233 Bacteria 8687553
1118 8019658276 8019648815 Bacteria 10014479
1119 8019684119 8019678201 Bacteria 8863603
1120 8019689957 8019687851 Bacteria 8712826
1121 8055746469 8055742211 Bacteria 9226248
1122 8056673977 8056673599 Bacteria 7871253
1123 8056688292 8056681323 Bacteria 8472857
1124 8056693622 8056689827 Bacteria 6712655
1125 8056967924 8056967851 Bacteria 9038162
1126 Ga0070709_10013975
1127 JGI24739J22299_10265156
1128 JGI24737J22298_10007177
1129 JGI24735J21928_10021816
1130 JGI25159J45721_1000007
1131 JGI25159J45721_1000029
1132 JGI25151J46595_10018877
1133 JGI25406J46586_10001302
1134 JGI25153J46596_10018387
1135 JGI25160J50197_1000011
1136 JGI25160J50197_1006480
1137 JGI25161J50226_1000216
1138 JGI25404J52841_10036718
1139 JGI25404J52841_10047623
1140 Ga0055526_1005205
1141 Ga0055526_1026200
1142 Ga0055524_1007493
1143 Ga0055536_1002370
1144 Ga0055536_1003841
1145 Ga0055530_10008423
1146 Ga0055540_1017856
1147 Ga0055531_10003918
1148 Ga0055531_10010017
1149 Ga0055543_1000097
1150 Ga0065165_1000018
1151 Ga0065165_1006114
1152 Ga0070683_100086618
1153 Ga0070670_100317512
1154 Ga0070666_10296382
1155 Ga0070680_100134714
1156 Ga0070680_100233158
1157 Ga0070680_100457672
1158 Ga0070680_100614802
1159 Ga0070682_100050796
1160 Ga0068868_100090406
1161 Ga0068868_100584682
1162 Ga0068868_100789440
1163 Ga0070660_101335422
1164 Ga0070660_101771716
1165 Ga0070689_100224870
1166 Ga0070661_100682955
1167 Ga0070668_100799538
1168 Ga0070688_100177171
1169 Ga0070659_100588479
1170 Ga0070667_100014040
1171 Ga0070667_101147052
1172 Ga0070667_101177856
1173 Ga0070667_101593195
1174 Ga0070709_10036155
1175 Ga0070709_10930759
1176 Ga0070714_100070886
1177 Ga0070714_100357446
1178 Ga0070714_100368719
1179 Ga0070714_100430673
1180 Ga0070714_102216250
1181 Ga0070713_100126037
1182 Ga0070713_100446876
1183 Ga0070713_100650378
1184 Ga0070713_101092651
1185 Ga0070713_101756953
1186 Ga0070710_10008697
1187 Ga0070710_11009654
1188 Ga0070711_100217726
1189 Ga0070711_100829210
1190 Ga0070711_100936653
1191 Ga0070711_100949118
1192 Ga0070705_101021384
1193 Ga0070708_100713002
1194 Ga0070663_100038698
1195 Ga0070663_100044651
1196 Ga0070663_100496174
1197 Ga0070663_100605851
1198 Ga0070663_100681197
1199 Ga0070662_100037275
1200 Ga0070681_10054789
1201 Ga0070681_10123870
1202 Ga0070681_10277245
1203 Ga0068867_100931651
1204 Ga0070698_100225801
1205 Ga0070679_100019797
1206 Ga0070679_100040249
1207 Ga0070679_100309866
1208 Ga0070679_100629649
1209 Ga0070679_100895711
1210 Ga0070684_100032692
1211 Ga0070684_100052818
1212 Ga0068853_100023838
1213 Ga0068853_100117847
1214 Ga0068853_100203167
1215 Ga0068853_100331330
1216 Ga0068853_100518724
1217 Ga0068853_100545830
1218 Ga0070693_100370721
1219 Ga0070693_100562711
1220 Ga0070693_101209744
1221 Ga0070665_100015427
1222 Ga0070665_100108612
1223 Ga0070665_101622027
1224 Ga0070704_100273775
1225 Ga0068855_100015588
1226 Ga0068855_100200086
1227 Ga0068855_100207510
1228 Ga0068855_100384785
1229 Ga0068855_100473803
1230 Ga0068855_102021046
1231 Ga0070664_100721245
1232 Ga0068857_100013583
1233 Ga0068857_100117100
1234 Ga0068857_100482474
1235 Ga0068854_100002817
1236 Ga0068854_100012868
1237 Ga0068854_100118788
1238 Ga0068854_100267225
1239 Ga0068854_100335700
1240 Ga0068854_100581537
1241 Ga0068856_100000659
1242 Ga0068856_100007731
1243 Ga0068856_100047734
1244 Ga0068856_100255467
1245 Ga0068856_100874862
1246 Ga0068852_100081387
1247 Ga0068852_100232220
1248 Ga0068852_100255930
1249 Ga0068852_100348366
1250 Ga0068859_100344401
1251 Ga0068859_101529885
1252 Ga0068864_100080912
1253 Ga0068864_100359500
1254 Ga0068851_10002097
1255 Ga0068870_10302094
1256 Ga0068863_100339798
1257 Ga0068858_100225906
1258 Ga0068858_100491846
1259 Ga0068858_100573985
1260 Ga0068860_100667726
1261 Ga0081455_10011962
1262 Ga0081538_10162929
1263 Ga0081540_1014445
1264 Ga0081540_1115459
1265 Ga0081539_10000498
1266 Ga0070717_10007074
1267 Ga0070717_10553507
1268 Ga0075365_10050758
1269 Ga0075365_10250515
1270 Ga0075365_10327648
1271 Ga0075365_10439413
1272 Ga0075368_10001670
1273 Ga0075363_100058730
1274 Ga0075364_10026333
1275 Ga0070716_100752771
1276 Ga0070712_100007041
1277 Ga0075362_10564634
1278 Ga0075367_10089995
1279 Ga0075369_10010854
1280 Ga0075369_10156210
1281 Ga0075369_10423023
1282 Ga0075369_10553296
1283 Ga0075366_10593467
1284 Ga0097621_100418861
1285 Ga0075370_10224125
1286 Ga0075370_10654062
1287 Ga0068871_100152457
1288 Ga0075433_10561517
1289 Ga0068865_100972715
1290 Ga0075436_100368086
1291 Ga0097620_100344346
1292 Ga0097620_101529921
1293 Ga0097620_101739697
1294 Ga0099824_1018671
1295 Ga0099822_1085678
1296 Ga0075435_101358153
1297 Ga0105250_10116539
1298 Ga0105240_10010574
1299 Ga0105240_10074576
1300 Ga0105240_10125972
1301 Ga0105245_11378707
1302 Ga0105247_10023505
1303 Ga0105243_11021716
1304 Ga0105241_10000375
1305 Ga0105241_12641154
1306 Ga0105248_10212421
1307 Ga0105248_10699022
1308 Ga0105237_10199631
1309 Ga0105237_10203768
1310 Ga0105237_10836244
1311 Ga0105238_10000885
1312 Ga0105238_10027088
1313 Ga0105238_10694286
1314 Ga0105238_12916316
1315 Ga0105249_10100272
1316 Ga0105249_10202676
1317 Ga0099796_10102656
1318 Ga0099796_10343318
1319 Ga0105239_10001513
1320 Ga0105239_10018938
1321 Ga0105239_10097922
1322 Ga0105246_10259029
1323 Ga0157323_1014765
1324 Ga0157371_10579161
1325 Ga0157371_11175858
1326 Ga0157370_10169703
1327 Ga0157369_10084470
1328 Ga0157369_11181818
1329 Ga0163162_11121526
1330 Ga0157372_10495545
1331 Ga0157372_10775031
1332 Ga0157372_11071155
1333 Ga0163163_10370162
1334 Ga0163163_10912428
1335 Ga0163163_11472692
1336 Ga0157380_10381281
1337 Ga0182005_1001790
1338 Ga0183363_1171
1339 Ga0184599_129808
1340 Ga0184599_137827
1341 Ga0197907_10918224
1342 Ga0197907_11069188
1343 Ga0206356_10243979
1344 Ga0206356_11658491
1345 Ga0206349_1643817
1346 Ga0206350_10271235
1347 Ga0206350_10345676
1348 Ga0206350_10615424
1349 Ga0206350_10979557
1350 Ga0206350_11186857
1351 Ga0206354_11128885
1352 Ga0154015_1041367
1353 Ga0214542_1000245
1354 Ga0214543_1000010
1355 Ga0213873_10059434
1356 Ga0213872_10026306
1357 Ga0213876_10149803
1358 Ga0213876_10242375
1359 Ga0213875_10074112
1360 Ga0224712_10001061
1361 Ga0224712_10041597
1362 Ga0224712_10043244
1363 Ga0224712_10246506
1364 Ga0209436_102029
1365 Ga0209563_129377
1366 Ga0207425_1005747
1367 Ga0209677_100491
1368 Ga0209148_1010479
1369 Ga0209148_1014504
1370 Ga0209233_1002729
1371 Ga0209233_1039459
1372 Ga0209233_1089514
1373 Ga0209565_1017569
1374 Ga0209455_1011918
1375 Ga0209455_1012087
1376 Ga0209130_1000029
1377 Ga0209676_1001711
1378 Ga0209025_1000033
1379 Ga0209025_1047665
1380 Ga0209564_1000275
1381 Ga0209564_1001009
1382 Ga0209564_1013153
1383 Ga0209564_1014089
1384 Ga0209758_1000021
1385 Ga0209758_1002371
1386 Ga0209758_1004125
1387 Ga0209758_1026461
1388 Ga0209050_1001363
1389 Ga0209256_1000644
1390 Ga0209256_1000649
1391 Ga0209256_1005320
1392 Ga0207426_1000074
1393 Ga0209051_1004342
1394 Ga0209051_1105889
1395 Ga0209257_1002758
1396 Ga0209257_1003043
1397 Ga0207656_10025839
1398 Ga0207696_1096228
1399 Ga0207692_10038277
1400 Ga0207692_10256932
1401 Ga0207642_10269973
1402 Ga0207642_10548907
1403 Ga0207710_10023976
1404 Ga0207710_10149886
1405 Ga0207688_10024365
1406 Ga0207688_10127773
1407 Ga0207680_10371677
1408 Ga0207680_10421829
1409 Ga0207647_10003194
1410 Ga0207647_10206434
1411 Ga0207647_10301293
1412 Ga0207685_10162137
1413 Ga0207685_10225347
1414 Ga0207699_10018049
1415 Ga0207699_10306057
1416 Ga0207699_10478814
1417 Ga0207645_10119113
1418 Ga0207645_10218071
1419 Ga0207643_10057384
1420 Ga0207654_10000337
1421 Ga0207654_10020336
1422 Ga0207654_10143688
1423 Ga0207654_10167185
1424 Ga0207654_10206733
1425 Ga0207707_10014349
1426 Ga0207707_10030625
1427 Ga0207695_10001265
1428 Ga0207695_10060233
1429 Ga0207695_10093574
1430 Ga0207695_10488778
1431 Ga0207695_10925688
1432 Ga0207671_10047805
1433 Ga0207671_10092021
1434 Ga0207671_10340355
1435 Ga0207671_10530432
1436 Ga0207693_10002749
1437 Ga0207693_10047117
1438 Ga0207693_10202439
1439 Ga0207663_10170719
1440 Ga0207663_10397525
1441 Ga0207660_10068701
1442 Ga0207662_10267787
1443 Ga0207657_10133010
1444 Ga0207657_10743917
1445 Ga0207649_11078103
1446 Ga0207652_10066046
1447 Ga0207652_10099998
1448 Ga0207652_10161134
1449 Ga0207652_11012796
1450 Ga0207646_10627600
1451 Ga0207681_10096096
1452 Ga0207681_10200972
1453 Ga0207681_10468845
1454 Ga0207681_11186071
1455 Ga0207694_10000082
1456 Ga0207694_10025462
1457 Ga0207694_10047802
1458 Ga0207694_10215388
1459 Ga0207694_10474639
1460 Ga0207659_11665056
1461 Ga0207687_10048842
1462 Ga0207687_10181596
1463 Ga0207687_11005285
1464 Ga0207700_10108198
1465 Ga0207700_10504726
1466 Ga0207700_10729739
1467 Ga0207700_11250130
1468 Ga0207664_10291185
1469 Ga0207664_10481382
1470 Ga0207644_10568832
1471 Ga0207644_11014796
1472 Ga0207644_11614350
1473 Ga0207690_11018315
1474 Ga0207706_10033220
1475 Ga0207706_10077110
1476 Ga0207686_10220806
1477 Ga0207686_10563242
1478 Ga0207709_10027283
1479 Ga0207709_10056403
1480 Ga0207709_10848091
1481 Ga0207670_10247598
1482 Ga0207670_10664949
1483 Ga0207669_10022164
1484 Ga0207704_10033275
1485 Ga0207704_10723084
1486 Ga0207704_10987374
1487 Ga0207704_11262354
1488 Ga0207665_10274006
1489 Ga0207711_10176305
1490 Ga0207711_10888847
1491 Ga0207689_10023824
1492 Ga0207689_10084589
1493 Ga0207689_10439096
1494 Ga0207661_10203397
1495 Ga0207661_10421493
1496 Ga0207661_10956085
1497 Ga0207679_10441242
1498 Ga0207679_10927250
1499 Ga0207679_11208577
1500 Ga0207667_10005368
1501 Ga0207667_10011709
1502 Ga0207667_10135740
1503 Ga0207667_10414553
1504 Ga0207712_10097880
1505 Ga0207668_10451133
1506 Ga0207668_10728258
1507 Ga0207668_11718211
1508 Ga0207640_10007135
1509 Ga0207640_10037459
1510 Ga0207640_10072736
1511 Ga0207640_10467368
1512 Ga0207640_10538385
1513 Ga0207640_11612443
1514 Ga0207640_11957738
1515 Ga0207658_10896742
1516 Ga0207658_10934217
1517 Ga0207677_10161885
1518 Ga0207677_10409634
1519 Ga0207703_10114094
1520 Ga0207703_10754280
1521 Ga0207703_11067296
1522 Ga0207703_12264017
1523 Ga0207639_10007126
1524 Ga0207639_10206574
1525 Ga0207639_10327429
1526 Ga0207639_10344424
1527 Ga0207639_10435820
1528 Ga0207639_10916873
1529 Ga0207678_10009455
1530 Ga0207678_10030378
1531 Ga0207678_10058059
1532 Ga0207678_10158502
1533 Ga0207678_10267287
1534 Ga0207678_10486269
1535 Ga0207678_10562573
1536 Ga0207708_10371320
1537 Ga0207702_10000002
1538 Ga0207702_10000442
1539 Ga0207702_10005388
1540 Ga0207702_10158985
1541 Ga0207702_10229496
1542 Ga0207702_11321156
1543 Ga0207641_10205256
1544 Ga0207648_10068374
1545 Ga0207676_10252097
1546 Ga0207676_10328080
1547 Ga0207674_10001614
1548 Ga0207674_10053911
1549 Ga0207674_10054460
1550 Ga0207674_12182887
1551 Ga0207675_100133711
1552 Ga0207683_10319485
1553 Ga0207683_10401739
1554 Ga0207683_10722074
1555 Ga0207698_10029731
1556 Ga0207698_10075798
1557 Ga0207698_10168267
1558 Ga0207698_11272540
1559 Ga0209389_1000445
1560 Ga0209589_1000003
1561 Ga0209589_1000514
1562 Ga0209489_100003
1563 Ga0209700_100003
1564 Ga0209813_10083040
1565 Ga0268266_10060568
1566 Ga0268266_10134066
1567 Ga0268266_10450261
1568 Ga0268266_10634657
1569 Ga0268265_10155880
1570 Ga0268265_10188803
1571 Ga0268265_10191307
1572 Ga0268264_10212848
1573 Ga0268264_10239966
1574 Ga0268264_10407607
1575 Ga0268264_10834651
1576 Ga0265337_1005726
1577 Ga0265326_10001798
1578 Ga0265319_1005521
1579 Ga0265334_10002109
1580 Ga0265334_10030164
1581 Ga0265318_10018005
1582 Ga0265323_10003106
1583 Ga0265322_10013091
1584 Ga0265336_10000765
1585 Ga0307515_10000198
1586 Ga0307515_10188224
1587 Ga0265338_10001398
1588 Ga0265324_10004472
1589 Ga0265340_10150688
1590 Ga0265339_10018141
1591 Ga0265331_10048861
1592 Ga0307513_10006546
1593 Ga0307408_100965537
1594 Ga0307508_10279508
1595 Ga0265314_10013455
1596 Ga0265342_10003387
1597 Ga0307516_10058125
1598 Ga0307516_10297926
1599 Ga0316044_114609
1600 Ga0307406_10822393
1601 Ga0307407_11115557
1602 Ga0307412_10266323
1603 Ga0315911_1000001
1604 Ga0373950_0039160
1605 Ga0373952_0197686
1606 Ga0373953_0022877
1607 Ga0373954_0025410
1608 Ga0373957_0021546
1609 Ga0373943_0070873
1610 Ga0373946_0518987
1611 Ga0373924_0084043
1612 Ga0373935_0463742
1613 Ga0373927_0194919
1614 Ga0373933_0075677
1615 Ga0373947_0309666
1616 Ga0373937_0296866
1617 Ga0316582_0191602
1618 Ga0395899_0000059
1619 Ga0395900_0000017
1620 Ga0395900_0797231
1621 Ga0395900_1472613
1622 Ga0395898_0000030
1623 Ga0395898_0092749
1624 Ga0395905_0000056
1625 Ga0395905_0032237
1626 Ga0395905_0120425
1627 Ga0436364_0011267
1628 Ga0436364_0223577
1629 Ga0436364_0836584
1630 Ga0395901_0000015
1631 Ga0395901_1330146
1632 Ga0436365_0188153
1633 Ga0436365_1034663
1634 Ga0436365_1530142
1635 Ga0436365_1689582
1636 Ga0436365_1721433
1637 Ga0436365_1792102
1638 Ga0436361_0389690
1639 Ga0436361_0393557
1640 Ga0436363_1282227
1641 Ga0451791_0347348
1642 Ga0451800_0052594
1643 Ga0439434_0222684
1644 Ga0466969_0016125
1645 Ga0466969_0272834
1646 Ga0466969_0283938
1647 Ga0466972_0006610
1648 Ga0466965_0207394
1649 Ga0466965_0704471
1650 Ga0466966_0284386
1651 Ga0466961_0477939
1652 Ga0466963_0160928
1653 Ga0466971_0045342
1654 Ga0466968_0161364
1655 Ga0466968_0413420
1656 Ga0466968_0608198
1657 Ga0466968_0654954
1658 Ga0466970_0155949
1659 Ga0466957_0559766
1660 Ga0466959_0016249
1661 Ga0466959_0030669
1662 Ga0466959_0207675
1663 Ga0466959_0478394
1664 Ga0466959_0745770
1665 Ga0466958_1043632
1666 Ga0466967_0066166
1667 Ga0466967_0136069
1668 Ga0466967_0280234
1669 Ga0495627_208489
1670 Ga0495603_0080240
1671 Ga0495603_0101515
1672 Ga0495603_0833492
1673 Ga0495651_0049749
1674 Ga0495653_0037072
1675 Ga0495653_0278818
1676 Ga0495580_0119656
1677 Ga0495580_0991449
1678 Ga0495582_0510710
1679 Ga0495639_0059158
1680 Ga0495585_0055312
1681 Ga0495594_0090670
1682 Ga0495594_0139606
1683 Ga0495607_0028013
1684 Ga0495608_0047322
1685 Ga0495616_0267572
1686 Ga0495618_0120870
1687 Ga0495630_0027840
1688 Ga0495630_0411849
1689 Ga0495632_0173159
1690 Ga0495637_0119905
1691 Ga0495643_0148033
1692 Ga0495663_0365409
1693 Ga0495652_0028933
1694 Ga0495665_0445599
1695 Ga0495587_0023026
1696 Ga0495598_0032556
1697 Ga0495597_0094850
1698 Ga0495622_0186161
1699 Ga0495667_0029419
1700 Ga0495656_0154924
1701 Ga0495668_0057814
1702 Ga0495668_0099147
1703 Ga0495661_0412218
1704 Ga0495588_0282226
1705 Ga0495588_0567180
1706 Ga0495657_0209589
1707 Ga0495599_0085566
1708 Ga0495623_0020900
1709 Ga0495658_0256442
1710 Ga0495669_0236885
1711 Ga0495624_0838855
1712 Ga0495670_0080717
1713 Ga0495671_0016535
1714 Ga0495581_0360247
1715 Ga0495604_0023604
1716 Ga0495604_0757227
1717 Ga0495672_0541618
1718 Ga0495676_0021656
1719 Ga0495680_0047093
1720 Ga0495687_007256
1721 Ga0495675_0059711
1722 Ga0495677_0070733
1723 Ga0495673_0239560
1724 Ga0495681_0059701
1725 Ga0495686_0081318
1726 Ga0495686_0347204
1727 Ga0495602_0381519
1728 Ga0495626_0093493
1729 Ga0495626_0407025
1730 Ga0496100_0053461
1731 Ga0496100_0140001
1732 Ga0496101_0054703
1733 Ga0496101_0453101
1734 Ga0496101_0588899
1735 Ga0496102_0004466
1736 Ga0496102_0257729
1737 Ga0496103_0222176
1738 Ga0496105_0018366
1739 Ga0496105_0170799
1740 Ga0496105_0473379
1741 Ga0496105_1135701
1742 Ga0496106_0245270
1743 Ga0496108_1356615
1744 Ga0496109_0130302
1745 Ga0496109_0367193
1746 Ga0496110_0135466
1747 Ga0496110_0169841
1748 Ga0496110_0208480
1749 Ga0496110_0793344
1750 Ga0496111_0189975
1751 Ga0496111_0220626
1752 Ga0496112_0066511
1753 Ga0496112_0621399
1754 Ga0496112_0708443
1755 Ga0496113_0005243
1756 Ga0496113_0259845
1757 Ga0496113_1108711
1758 Ga0496114_0300994
1759 Ga0496114_0942637
1760 Ga0496115_0009418
1761 Ga0496115_0553371
1762 Ga0496116_0105066
1763 Ga0496117_0034246
1764 Ga0496117_0077642
1765 Ga0496117_0172333
1766 Ga0496118_0026583
1767 Ga0496118_0041896
1768 Ga0496118_0090739
1769 Ga0496118_0294961
1770 Ga0496119_0239808
1771 Ga0496120_0092251
1772 Ga0496120_0171153
1773 Ga0496121_0003672
1774 Ga0496121_0070646
1775 Ga0496121_0087661
1776 Ga0496121_0129036
1777 Ga0496121_0346783
1778 Ga0496121_0651291
1779 Ga0496122_0101863
1780 Ga0496123_0088944
1781 Ga0496124_0300048
1782 Ga0496125_0000090
1783 Ga0496125_0001219
1784 Ga0496125_0043512
1785 Ga0496125_0055311
1786 Ga0496125_0076314
1787 Ga0496125_0709333
1788 Ga0496126_0013869
1789 Ga0496126_0023395
1790 Ga0496126_0028110
1791 Ga0496126_0060139
1792 Ga0496126_0137332
1793 Ga0496126_0207038
1794 Ga0496126_0260728
1795 Ga0496126_0528628
1796 Ga0496126_0946543
1797 Ga0496126_0960951
1798 Ga0495682_0243303
1799 Ga0501031_0000442
1800 Ga0501031_0014148
1801 Ga0501031_0021697
1802 Ga0501031_0102498
1803 Ga0501031_0218862
1804 Ga0501031_0275537
1805 Ga0501031_0358115
1806 Ga0501032_0000031
1807 Ga0501032_0000773
1808 Ga0501032_0006279
1809 Ga0501032_0023195
1810 Ga0501032_0068001
1811 Ga0501032_0102250
1812 Ga0501032_0204503
1813 Ga0501033_0000126
1814 Ga0501033_0005198
1815 Ga0501033_0009424
1816 Ga0501033_0014639
1817 Ga0501033_0033905
1818 Ga0501033_0043543
1819 Ga0501033_0044422
1820 Ga0501033_0136117
1821 Ga0501033_0141567
1822 Ga0501033_0823751
1823 Ga0501034_0000021
1824 Ga0501034_0000064
1825 Ga0501034_0059763
1826 Ga0501034_0113529
1827 Ga0501034_0186446
1828 Ga0501034_0256592
1829 Ga0501034_0490434
1830 Ga0501036_0000069
1831 Ga0501036_0005749
1832 Ga0501036_0189772
1833 Ga0501036_0328858
1834 Ga0501036_0930287
1835 Ga0501037_0000034
1836 Ga0501037_0000616
1837 Ga0501037_0005524
1838 Ga0501037_0025364
1839 Ga0501037_0095767
1840 Ga0501037_0800436
1841 Ga0501038_0000205
1842 Ga0501038_0000537
1843 Ga0501038_0037431
1844 Ga0501038_0049398
1845 Ga0501038_0200018
1846 Ga0501038_0227550
1847 Ga0501038_0307720
1848 Ga0501038_0600137
1849 Ga0501038_0895858
1850 Ga0501039_0000198
1851 Ga0501039_0002792
1852 Ga0501039_0830048
1853 Ga0501039_1077254
1854 Ga0501040_0156581
1855 Ga0501040_0622376
1856 Ga0501041_0478332
1857 Ga0501042_0074198
1858 Ga0501043_0000015
1859 Ga0501043_0000107
1860 Ga0501043_0001044
1861 Ga0501043_0016446
1862 Ga0501043_0021518
1863 Ga0501043_0068674
1864 Ga0501043_0174701
1865 Ga0501043_0624827
1866 Ga0501043_0728933
1867 Ga0501046_0003594
1868 Ga0501046_0011039
1869 Ga0501046_0095285
1870 Ga0501046_0097356
1871 Ga0501046_1082929
1872 Ga0501047_0000587
1873 Ga0501047_0020996
1874 Ga0501047_0068073
1875 Ga0501047_0100525
1876 Ga0501047_0242842
1877 Ga0501048_0001731
1878 Ga0501048_0059277
1879 Ga0501067_0000331
1880 Ga0501067_0047655
1881 Ga0501067_0203767
1882 Ga0501068_0000039
1883 Ga0501068_0716273
1884 Ga0501068_1007242
1885 Ga0501069_0000039
1886 Ga0501069_0013970
1887 Ga0501069_0019200
1888 Ga0501069_0039180
1889 Ga0501070_0000132
1890 Ga0501070_0000299
1891 Ga0501070_0002117
1892 Ga0501070_0007344
1893 Ga0501070_0036765
1894 Ga0501070_0070851
1895 Ga0501070_0078238
1896 Ga0501070_0233142
1897 Ga0501070_0690937
1898 Ga0501070_1035658
1899 Ga0501071_0165148
1900 Ga0501071_0302093
1901 Ga0501071_0845836
1902 Ga0501071_1326758
1903 Ga0501072_0014578
1904 Ga0501072_0469800
1905 Ga0501072_1406849
1906 Ga0501073_0000144
1907 Ga0501073_0048839
1908 Ga0501073_0367399
1909 Ga0501073_0695776
1910 Ga0501074_0001123
1911 Ga0501074_0005397
1912 Ga0501074_0010236
1913 Ga0501074_0089756
1914 Ga0501074_0108152
1915 Ga0501074_1029684
1916 Ga0501076_0173360
1917 Ga0501077_1026456
1918 Ga0501079_0004404
1919 Ga0501079_0206606
1920 Ga0501080_0001145
1921 Ga0501080_0001676
1922 Ga0501080_0003023
1923 Ga0501080_0004511
1924 Ga0501080_0097918
1925 Ga0501080_0260497
1926 Ga0501080_0569745
1927 Ga0501080_1184114
1928 Ga0501081_1253969
1929 Ga0501081_1545901
1930 Ga0501083_0002416
1931 Ga0501083_0003750
1932 Ga0501083_0390073
1933 Ga0501035_0000055
1934 Ga0501035_0000436
1935 Ga0501035_0000807
1936 Ga0501035_0000865
1937 Ga0501035_0013030
1938 Ga0501035_0022239
1939 Ga0501035_0040528
1940 Ga0501035_0167350
1941 Ga0501035_0203988
1942 Ga0501035_0242553
1943 Ga0501035_1181097
1944 Ga0501044_0000028
1945 Ga0501044_0000071
1946 Ga0501044_0030397
1947 Ga0501044_0030832
1948 Ga0501044_0052011
1949 Ga0501044_0053864
1950 Ga0501044_0070576
1951 Ga0501044_0070897
1952 Ga0501044_0086235
1953 Ga0501044_0122650
1954 Ga0501044_0125897
1955 Ga0501044_0534274
1956 Ga0501044_0704296
1957 Ga0501044_0718589
1958 Ga0501044_0795012
1959 Ga0501045_0015837
1960 Ga0501045_0497188
1961 Ga0501045_0815964
1962 nmdc:mga03n38_238584_c1
1963 nmdc:mga03n38_522247_c1
1964 nmdc:mga00v17_113033_c1
1965 nmdc:mga00v17_23145_c1
1966 nmdc:mga00v17_424712_c1
1967 nmdc:mga00v17_441924_c1
1968 nmdc:mga0yw44_178137_c1
1969 nmdc:mga0yw44_751055_c1
1970 nmdc:mga0k408_405448_c1
1971 nmdc:mga0k408_712448_c1
1972 nmdc:mga0k408_833593_c1
1973 nmdc:mga06z11_554979_c1
1974 nmdc:mga06z11_998767_c1
1975 nmdc:mga04h51_1603_c1
1976 nmdc:mga07m45_299048_c1
1977 nmdc:mga07m45_316189_c1
1978 nmdc:mga07m45_36612_c1
1979 nmdc:mga07m45_728742_c1
1980 nmdc:mga0sz30_26148_c1
1981 nmdc:mga0sz30_69532_c1
1982 Ga0495655_0198720
1983 Ga0495655_0275696
1984 Ga0495595_0235348
1985 Ga0495619_0091324
1986 Ga0500566_0006668
1987 Ga0500650_0002916
1988 Ga0500555_001383
1989 Ga0500572_000088
1990 Ga0500593_223144
1991 Ga0500608_010423
1992 Ga0500618_006001
1993 Ga0500621_227861
1994 Ga0500642_0000074
1995 Ga0500642_0274603
1996 Ga0500652_000065
1997 Ga0500658_0362206
1998 Ga0500559_0000321
1999 Ga0500559_0000381
2000 Ga0500559_0085448
2001 Ga0500559_0293394
2002 Ga0500568_0000556
2003 Ga0500568_0009976
2004 Ga0500586_085382
2005 Ga0500604_0002433
2006 Ga0500616_0000283
2007 Ga0500633_0049618
2008 Ga0500634_0076383
2009 Ga0500639_022496
2010 Ga0500636_0000479
2011 Ga0500637_0216074
2012 Ga0500649_152363
2013 Ga0500570_129912
2014 Ga0500576_030942
2015 Ga0500645_004743
2016 Ga0500645_028876
2017 Ga0500645_165285
2018 Ga0500596_000143
2019 Ga0501084_0006472
2020 Ga0501084_0049335
2021 Ga0587066_120608
2022 Ga0587073_0110384
2023 Ga0587073_0132435
2024 Ga0587073_0203977
2025 Ga0587077_074509
2026 Ga0587080_107286
2027 Ga0587082_181561
2028 Ga0587083_0062596
2029 Ga0587083_0066555
2030 Ga0587083_0209779
2031 Ga0587083_0266102
2032 Ga0587085_027564
2033 Ga0587086_017567
2034 Ga0587089_068118
2035 Ga0587090_131331
2036 Ga0587094_068791
2037 Ga0587106_129405
2038 Ga0587131_015566
2039 Ga0587101_058093
2040 Ga0587109_126536
2041 Ga0587115_047365
2042 Ga0587122_058045
2043 Ga0587128_054851
2044 Ga0587128_056786
2045 Ga0587128_057552
2046 Ga0587062_080859
2047 Ga0587068_088156
2048 Ga0587069_156258
2049 Ga0587072_029201
2050 Ga0587072_206428
2051 Ga0587102_034710
2052 Ga0587107_047735
2053 Ga0587110_033874
2054 Ga0587114_082539
2055 Ga0587116_20562
2056 Ga0587071_107742
2057 Ga0501082_0011901
2058 Ga0501082_0540966
2059 Ga0501082_1052723
2060 Ga0530510_0805988
2061 2507508697
2062 2508542791
2063 2509150394
2064 2513623145
2065 2513639090
2066 2513654627
2067 2513680291
2068 2513692409
2069 2513700171
2070 2513860996
2071 2513872665
2072 2513893547
2073 2513915194
2074 2514011958
2075 2517892489
2076 2524440455
2077 2524471317
2078 2524540060
2079 2603859341
2080 2617348909
2081 2617375873
2082 2644288662
2083 2671122400
2084 2723845202
2085 2728751531
2086 2745075276
2087 2793062514
2088 2793068689
2089 2793083589
2090 2805915437
2091 2818241017
2092 2824603464
2093 2824614743
2094 2824667427
2095 2824675800
2096 2824686293
2097 2824695370
2098 2824703755
2099 2824711988
2100 2824738607
2101 2824751571
2102 2824756878
2103 2824767471
2104 2824777692
2105 2838123861
2106 2841944012
2107 2841949960
2108 2841966379
2109 2841975112
2110 2841983316
2111 2842039180
2112 2842047873
2113 2844318983
2114 2847936106
2115 2847946458
2116 2849079422
2117 2857514429
2118 2857529246
2119 2874593431
2120 2874605084
2121 2874615203
2122 2874627216
2123 2874633295
2124 2874648985
2125 2876767082
2126 2876773152
2127 2876822042
2128 2879077197
2129 2879090085
2130 2879103242
2131 2879113581
2132 2879130034
2133 2879147049
2134 2881367045
2135 2881671069
2136 2885370443
2137 2885379906
2138 2885392561
2139 2885412161
2140 2888393914
2141 2888424363
2142 2889039954
2143 2893071359
2144 2903729093
2145 2903750143
2146 2903774076
2147 2904671264
2148 2904695898
2149 2904703320
2150 2904720631
2151 2906610138
2152 2906618530
2153 2906634886
2154 2906638798
2155 2906650495
2156 2906664215
2157 2908742801
2158 2908761019
2159 2908780071
2160 2919076754
2161 2922365247
2162 2922390871
2163 2922396424
2164 2922430173
2165 2929617941
2166 2929627622
2167 2932797599
2168 2932802917
2169 2932810573
2170 2932821283
2171 2933579870
2172 2935608778
2173 2935622931
2174 2935631757
2175 2935642289
2176 2935649932
2177 2935661916
2178 2935668407
2179 2935692788
2180 2935700958
2181 2935721487
2182 2935730405
2183 2935740418
2184 2935749682
2185 2935759005
2186 2935762663
2187 2935790447
2188 2935814582
2189 2935821939
2190 2935831720
2191 2935838588
2192 2935847521
2193 2935861179
2194 2935865717
2195 2935878218
2196 2935885257
2197 2935909212
2198 2935919933
2199 2935926214
2200 2935934664
2201 2935943114
2202 2935951552
2203 2935966373
2204 2935967677
2205 2935977126
2206 2935988284
2207 2935994529
2208 2936012585
2209 2936021149
2210 2936029878
2211 2936040139
2212 2936047343
2213 2936057499
2214 2940564990
2215 2941513128
2216 2941520968
2217 2941526168
2218 2941532633
2219 3005480116
2220 3005487239
2221 3005510222
2222 3005591026
2223 3005599125
2224 3005722214
2225 8006940774
2226 8006965623
2227 8006980464
2228 8006987159
2229 8006998845
2230 8016513332
2231 8016573287
2232 8016591913
2233 8016600151
2234 8016626656
2235 8016640469
2236 8019556857
2237 8019568441
2238 8019582532
2239 8019590317
2240 8019617515
2241 8019628016
2242 8019634581
2243 8019658276
2244 8019684119
2245 8019689957
2246 8055746469
2247 8056673977
2248 8056688292
2249 8056693622
2250 8056967924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

34

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9312 19 110
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8863 19 111
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8783 18 111
2d2a-assembly2.cif.gz_A crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.856 19 123
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8369 18 111
ID Description Score Start End Superfamily
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9502 19 123 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9312 19 110 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9245 19 123 2.60.300.12
af_P78859_82_189_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9083 19 125 2.60.300.12
af_P41901_86_366_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9062 69 81 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q6ZEE9-F1-model_v4 Fe-S cluster assembly scaffold SufA 0.9699 19 131 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A0C2ADA0-F1-model_v4 deleted 0.9666 19 131
AF-G4RAJ6-F1-model_v4 Iron binding protein SufA for iron-sulfur cluster assembly 0.9645 19 129 GO:0005829
GO:0016226
GO:0051537
GO:0097428
AF-A0A4Q3GKX8-F1-model_v4 deleted 0.9629 19 129
AF-A0A0Q6ZEE9-F1-model_v4 Fe-S cluster assembly scaffold SufA 0.9615 19 131 GO:0005829
GO:0016226
GO:0051537
GO:0097428

Map