F490457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1125 | 641 | 2250 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10013975|Ga0070709_100139755 |
| Length | 146 |
| Sequence | MGGIDLQPGSNHMTDMTPASPIPAAKPPRRPRPQVMRLTEAAAQRIQELTKRADSEIVGLRVGVKNGGCAGQSYTVEYAHEIRPTDEVVEDKGVKILVDPKAVLFLLGTEMDYKADRMQAQFIFNNPNQISACGCGESVQLKPAEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 86 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 111 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 119 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 233 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 234 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 237 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 398 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 403 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 405 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 412 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 414 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 416 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 418 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 452 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 453 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 454 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 455 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 456 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 457 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 458 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 459 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 460 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 461 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 462 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 463 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 464 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 465 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 466 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 467 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 468 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 469 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 470 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 471 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 472 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 473 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 474 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 475 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 476 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 477 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 478 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 479 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 480 | 2791355199 | |||
| 481 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 482 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 483 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 484 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 485 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 486 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 487 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 488 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 489 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 490 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 491 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 492 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 493 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 494 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 495 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 496 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 497 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 498 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 499 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 500 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 501 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 502 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 503 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 504 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 505 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 506 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 507 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 508 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 509 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 510 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 511 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 512 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 513 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 514 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 515 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 516 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 517 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 518 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 519 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 520 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 521 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 522 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 523 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 524 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 525 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 526 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 527 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 528 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 529 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 530 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 531 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 532 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 533 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 534 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 535 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 536 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 537 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 538 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 539 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 540 | 2904699407 | |||
| 541 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 542 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 543 | 2906610324 | |||
| 544 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 545 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 546 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 547 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 548 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 549 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 550 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 551 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 552 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 553 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 554 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 555 | 2922425934 | |||
| 556 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 557 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 558 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 559 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 560 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 561 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 562 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 563 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 564 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 565 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 566 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 567 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 568 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 569 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 570 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 571 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 572 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 573 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 574 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 575 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 576 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 577 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 578 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 579 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 580 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 581 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 582 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 583 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 584 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 585 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 586 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 587 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 588 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 589 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 590 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 591 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 592 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 593 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 594 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 595 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 596 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 597 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 598 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 599 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 600 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 601 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 602 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 603 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 604 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 605 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 606 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 607 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 608 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 609 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 610 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 611 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 612 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 613 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 614 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 615 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 616 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 617 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 618 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 619 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 620 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 621 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 622 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 623 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 624 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 625 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 626 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 627 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 628 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 629 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 630 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 631 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 632 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 633 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 634 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 635 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 636 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 637 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 638 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 639 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 640 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 641 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.5 |
| Metatranscriptomes | 4.91 |
| Isolates | 16.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.84 |
| Nodule | 12.89 |
| Rhizoplane | 3.2 |
| Rhizosphere | 63.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10013975 | 3300005434 | Bacteria | 4529 |
| 2 | JGI24739J22299_10265156 | 3300001989 | Bacteria | 503 |
| 3 | JGI24737J22298_10007177 | 3300001990 | Bacteria | 3771 |
| 4 | JGI24735J21928_10021816 | 3300002067 | Bacteria | 1953 |
| 5 | JGI25159J45721_1000007 | 3300002987 | Bacteria | 176362 |
| 6 | JGI25159J45721_1000029 | 3300002987 | Bacteria | 105868 |
| 7 | JGI25151J46595_10018877 | 3300003187 | Bacteria | 2946 |
| 8 | JGI25406J46586_10001302 | 3300003203 | Bacteria | 11736 |
| 9 | JGI25153J46596_10018387 | 3300003215 | Bacteria | 2717 |
| 10 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 11 | JGI25160J50197_1006480 | 3300003354 | Bacteria | 4730 |
| 12 | JGI25161J50226_1000216 | 3300003374 | Bacteria | 36285 |
| 13 | JGI25404J52841_10036718 | 3300003659 | Bacteria | 1042 |
| 14 | JGI25404J52841_10047623 | 3300003659 | Bacteria | 903 |
| 15 | Ga0055526_1005205 | 3300003771 | Bacteria | 7555 |
| 16 | Ga0055526_1026200 | 3300003771 | Bacteria | 1847 |
| 17 | Ga0055524_1007493 | 3300003775 | Bacteria | 4623 |
| 18 | Ga0055536_1002370 | 3300003781 | Bacteria | 10647 |
| 19 | Ga0055536_1003841 | 3300003781 | Bacteria | 7905 |
| 20 | Ga0055530_10008423 | 3300003791 | Bacteria | 4135 |
| 21 | Ga0055540_1017856 | 3300003792 | Bacteria | 1965 |
| 22 | Ga0055531_10003918 | 3300003794 | Bacteria | 9271 |
| 23 | Ga0055531_10010017 | 3300003794 | Bacteria | 4770 |
| 24 | Ga0055543_1000097 | 3300004625 | Bacteria | 75364 |
| 25 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 26 | Ga0065165_1006114 | 3300005262 | Bacteria | 6445 |
| 27 | Ga0070683_100086618 | 3300005329 | Bacteria | 2937 |
| 28 | Ga0070670_100317512 | 3300005331 | Bacteria | 1364 |
| 29 | Ga0070666_10296382 | 3300005335 | Bacteria | 1151 |
| 30 | Ga0070680_100134714 | 3300005336 | Bacteria | 2068 |
| 31 | Ga0070680_100233158 | 3300005336 | Bacteria | 1555 |
| 32 | Ga0070680_100457672 | 3300005336 | Bacteria | 1090 |
| 33 | Ga0070680_100614802 | 3300005336 | Bacteria | 933 |
| 34 | Ga0070682_100050796 | 3300005337 | Bacteria | 2590 |
| 35 | Ga0068868_100090406 | 3300005338 | Bacteria | 2465 |
| 36 | Ga0068868_100584682 | 3300005338 | Bacteria | 987 |
| 37 | Ga0068868_100789440 | 3300005338 | Bacteria | 856 |
| 38 | Ga0070660_101335422 | 3300005339 | Bacteria | 609 |
| 39 | Ga0070660_101771716 | 3300005339 | Bacteria | 526 |
| 40 | Ga0070689_100224870 | 3300005340 | Bacteria | 1541 |
| 41 | Ga0070661_100682955 | 3300005344 | Bacteria | 835 |
| 42 | Ga0070668_100799538 | 3300005347 | Bacteria | 838 |
| 43 | Ga0070688_100177171 | 3300005365 | Bacteria | 1476 |
| 44 | Ga0070659_100588479 | 3300005366 | Bacteria | 955 |
| 45 | Ga0070667_100014040 | 3300005367 | Bacteria | 6620 |
| 46 | Ga0070667_101147052 | 3300005367 | Bacteria | 727 |
| 47 | Ga0070667_101177856 | 3300005367 | Bacteria | 717 |
| 48 | Ga0070667_101593195 | 3300005367 | Bacteria | 614 |
| 49 | Ga0070709_10036155 | 3300005434 | Bacteria | 3007 |
| 50 | Ga0070709_10930759 | 3300005434 | Bacteria | 689 |
| 51 | Ga0070714_100070886 | 3300005435 | Bacteria | 3013 |
| 52 | Ga0070714_100357446 | 3300005435 | Bacteria | 1373 |
| 53 | Ga0070714_100368719 | 3300005435 | Bacteria | 1352 |
| 54 | Ga0070714_100430673 | 3300005435 | Bacteria | 1251 |
| 55 | Ga0070714_102216250 | 3300005435 | Bacteria | 535 |
| 56 | Ga0070713_100126037 | 3300005436 | Bacteria | 2252 |
| 57 | Ga0070713_100446876 | 3300005436 | Bacteria | 1213 |
| 58 | Ga0070713_100650378 | 3300005436 | Bacteria | 1004 |
| 59 | Ga0070713_101092651 | 3300005436 | Bacteria | 771 |
| 60 | Ga0070713_101756953 | 3300005436 | Bacteria | 602 |
| 61 | Ga0070710_10008697 | 3300005437 | Bacteria | 4949 |
| 62 | Ga0070710_11009654 | 3300005437 | Bacteria | 607 |
| 63 | Ga0070711_100217726 | 3300005439 | Bacteria | 1482 |
| 64 | Ga0070711_100829210 | 3300005439 | Bacteria | 786 |
| 65 | Ga0070711_100936653 | 3300005439 | Bacteria | 741 |
| 66 | Ga0070711_100949118 | 3300005439 | Bacteria | 736 |
| 67 | Ga0070705_101021384 | 3300005440 | Bacteria | 672 |
| 68 | Ga0070708_100713002 | 3300005445 | Bacteria | 944 |
| 69 | Ga0070663_100038698 | 3300005455 | Bacteria | 3328 |
| 70 | Ga0070663_100044651 | 3300005455 | Bacteria | 3126 |
| 71 | Ga0070663_100496174 | 3300005455 | Bacteria | 1013 |
| 72 | Ga0070663_100605851 | 3300005455 | Bacteria | 922 |
| 73 | Ga0070663_100681197 | 3300005455 | Bacteria | 872 |
| 74 | Ga0070662_100037275 | 3300005457 | Bacteria | 3447 |
| 75 | Ga0070681_10054789 | 3300005458 | Bacteria | 3973 |
| 76 | Ga0070681_10123870 | 3300005458 | Bacteria | 2517 |
| 77 | Ga0070681_10277245 | 3300005458 | Bacteria | 1588 |
| 78 | Ga0068867_100931651 | 3300005459 | Bacteria | 783 |
| 79 | Ga0070698_100225801 | 3300005471 | Bacteria | 1806 |
| 80 | Ga0070679_100019797 | 3300005530 | Bacteria | 6552 |
| 81 | Ga0070679_100040249 | 3300005530 | Bacteria | 4650 |
| 82 | Ga0070679_100309866 | 3300005530 | Bacteria | 1528 |
| 83 | Ga0070679_100629649 | 3300005530 | Bacteria | 1016 |
| 84 | Ga0070679_100895711 | 3300005530 | Bacteria | 831 |
| 85 | Ga0070684_100032692 | 3300005535 | Bacteria | 4436 |
| 86 | Ga0070684_100052818 | 3300005535 | Bacteria | 3535 |
| 87 | Ga0068853_100023838 | 3300005539 | Bacteria | 5128 |
| 88 | Ga0068853_100117847 | 3300005539 | Bacteria | 2366 |
| 89 | Ga0068853_100203167 | 3300005539 | Bacteria | 1804 |
| 90 | Ga0068853_100331330 | 3300005539 | Bacteria | 1413 |
| 91 | Ga0068853_100518724 | 3300005539 | Bacteria | 1126 |
| 92 | Ga0068853_100545830 | 3300005539 | Bacteria | 1097 |
| 93 | Ga0070693_100370721 | 3300005547 | Bacteria | 985 |
| 94 | Ga0070693_100562711 | 3300005547 | Bacteria | 818 |
| 95 | Ga0070693_101209744 | 3300005547 | Bacteria | 581 |
| 96 | Ga0070665_100015427 | 3300005548 | Bacteria | 7672 |
| 97 | Ga0070665_100108612 | 3300005548 | Bacteria | 2777 |
| 98 | Ga0070665_101622027 | 3300005548 | Bacteria | 655 |
| 99 | Ga0070704_100273775 | 3300005549 | Bacteria | 1396 |
| 100 | Ga0068855_100015588 | 3300005563 | Bacteria | 9146 |
| 101 | Ga0068855_100200086 | 3300005563 | Bacteria | 2249 |
| 102 | Ga0068855_100207510 | 3300005563 | Bacteria | 2203 |
| 103 | Ga0068855_100384785 | 3300005563 | Bacteria | 1540 |
| 104 | Ga0068855_100473803 | 3300005563 | Bacteria | 1363 |
| 105 | Ga0068855_102021046 | 3300005563 | Bacteria | 582 |
| 106 | Ga0070664_100721245 | 3300005564 | Bacteria | 930 |
| 107 | Ga0068857_100013583 | 3300005577 | Bacteria | 7093 |
| 108 | Ga0068857_100117100 | 3300005577 | Bacteria | 2397 |
| 109 | Ga0068857_100482474 | 3300005577 | Bacteria | 1162 |
| 110 | Ga0068854_100002817 | 3300005578 | Bacteria | 10815 |
| 111 | Ga0068854_100012868 | 3300005578 | Bacteria | 5481 |
| 112 | Ga0068854_100118788 | 3300005578 | Bacteria | 2004 |
| 113 | Ga0068854_100267225 | 3300005578 | Bacteria | 1372 |
| 114 | Ga0068854_100335700 | 3300005578 | Bacteria | 1233 |
| 115 | Ga0068854_100581537 | 3300005578 | Bacteria | 954 |
| 116 | Ga0068856_100000659 | 3300005614 | Bacteria | 37359 |
| 117 | Ga0068856_100007731 | 3300005614 | Bacteria | 10497 |
| 118 | Ga0068856_100047734 | 3300005614 | Bacteria | 4219 |
| 119 | Ga0068856_100255467 | 3300005614 | Bacteria | 1767 |
| 120 | Ga0068856_100874862 | 3300005614 | Bacteria | 917 |
| 121 | Ga0068852_100081387 | 3300005616 | Bacteria | 2874 |
| 122 | Ga0068852_100232220 | 3300005616 | Bacteria | 1759 |
| 123 | Ga0068852_100255930 | 3300005616 | Bacteria | 1679 |
| 124 | Ga0068852_100348366 | 3300005616 | Bacteria | 1446 |
| 125 | Ga0068859_100344401 | 3300005617 | Bacteria | 1585 |
| 126 | Ga0068859_101529885 | 3300005617 | Bacteria | 737 |
| 127 | Ga0068864_100080912 | 3300005618 | Bacteria | 2847 |
| 128 | Ga0068864_100359500 | 3300005618 | Bacteria | 1376 |
| 129 | Ga0068851_10002097 | 3300005834 | Bacteria | 8771 |
| 130 | Ga0068870_10302094 | 3300005840 | Bacteria | 1011 |
| 131 | Ga0068863_100339798 | 3300005841 | Bacteria | 1461 |
| 132 | Ga0068858_100225906 | 3300005842 | Bacteria | 1774 |
| 133 | Ga0068858_100491846 | 3300005842 | Bacteria | 1184 |
| 134 | Ga0068858_100573985 | 3300005842 | Bacteria | 1093 |
| 135 | Ga0068860_100667726 | 3300005843 | Bacteria | 1048 |
| 136 | Ga0081455_10011962 | 3300005937 | Bacteria | 8685 |
| 137 | Ga0081538_10162929 | 3300005981 | Bacteria | 987 |
| 138 | Ga0081540_1014445 | 3300005983 | Bacteria | 5057 |
| 139 | Ga0081540_1115459 | 3300005983 | Bacteria | 1125 |
| 140 | Ga0081539_10000498 | 3300005985 | Bacteria | 82216 |
| 141 | Ga0070717_10007074 | 3300006028 | Bacteria | 8312 |
| 142 | Ga0070717_10553507 | 3300006028 | Bacteria | 1042 |
| 143 | Ga0075365_10050758 | 3300006038 | Bacteria | 2737 |
| 144 | Ga0075365_10250515 | 3300006038 | Bacteria | 1244 |
| 145 | Ga0075365_10327648 | 3300006038 | Bacteria | 1079 |
| 146 | Ga0075365_10439413 | 3300006038 | Bacteria | 921 |
| 147 | Ga0075368_10001670 | 3300006042 | Bacteria | 7130 |
| 148 | Ga0075363_100058730 | 3300006048 | Bacteria | 2066 |
| 149 | Ga0075364_10026333 | 3300006051 | Bacteria | 3710 |
| 150 | Ga0070716_100752771 | 3300006173 | Bacteria | 750 |
| 151 | Ga0070712_100007041 | 3300006175 | Bacteria | 7011 |
| 152 | Ga0075362_10564634 | 3300006177 | Bacteria | 586 |
| 153 | Ga0075367_10089995 | 3300006178 | Bacteria | 1866 |
| 154 | Ga0075369_10010854 | 3300006186 | Bacteria | 3570 |
| 155 | Ga0075369_10156210 | 3300006186 | Bacteria | 1044 |
| 156 | Ga0075369_10423023 | 3300006186 | Bacteria | 629 |
| 157 | Ga0075369_10553296 | 3300006186 | Bacteria | 549 |
| 158 | Ga0075366_10593467 | 3300006195 | Bacteria | 686 |
| 159 | Ga0097621_100418861 | 3300006237 | Bacteria | 1202 |
| 160 | Ga0075370_10224125 | 3300006353 | Bacteria | 1111 |
| 161 | Ga0075370_10654062 | 3300006353 | Bacteria | 638 |
| 162 | Ga0068871_100152457 | 3300006358 | Bacteria | 1972 |
| 163 | Ga0075433_10561517 | 3300006852 | Bacteria | 1003 |
| 164 | Ga0068865_100972715 | 3300006881 | Bacteria | 742 |
| 165 | Ga0075436_100368086 | 3300006914 | Bacteria | 1038 |
| 166 | Ga0097620_100344346 | 3300006931 | Bacteria | 1585 |
| 167 | Ga0097620_101529921 | 3300006931 | Bacteria | 737 |
| 168 | Ga0097620_101739697 | 3300006931 | Bacteria | 689 |
| 169 | Ga0099824_1018671 | 3300006942 | Bacteria | 5621 |
| 170 | Ga0099822_1085678 | 3300006943 | Bacteria | 736 |
| 171 | Ga0075435_101358153 | 3300007076 | Bacteria | 623 |
| 172 | Ga0105250_10116539 | 3300009092 | Bacteria | 1096 |
| 173 | Ga0105240_10010574 | 3300009093 | Bacteria | 12963 |
| 174 | Ga0105240_10074576 | 3300009093 | Bacteria | 4187 |
| 175 | Ga0105240_10125972 | 3300009093 | Bacteria | 3078 |
| 176 | Ga0105245_11378707 | 3300009098 | Bacteria | 755 |
| 177 | Ga0105247_10023505 | 3300009101 | Bacteria | 3714 |
| 178 | Ga0105243_11021716 | 3300009148 | Bacteria | 831 |
| 179 | Ga0105241_10000375 | 3300009174 | Bacteria | 34023 |
| 180 | Ga0105241_12641154 | 3300009174 | Bacteria | 505 |
| 181 | Ga0105248_10212421 | 3300009177 | Bacteria | 2180 |
| 182 | Ga0105248_10699022 | 3300009177 | Bacteria | 1144 |
| 183 | Ga0105237_10199631 | 3300009545 | Bacteria | 1999 |
| 184 | Ga0105237_10203768 | 3300009545 | Bacteria | 1979 |
| 185 | Ga0105237_10836244 | 3300009545 | Bacteria | 927 |
| 186 | Ga0105238_10000885 | 3300009551 | Bacteria | 30833 |
| 187 | Ga0105238_10027088 | 3300009551 | Bacteria | 5842 |
| 188 | Ga0105238_10694286 | 3300009551 | Bacteria | 1029 |
| 189 | Ga0105238_12916316 | 3300009551 | Bacteria | 514 |
| 190 | Ga0105249_10100272 | 3300009553 | Bacteria | 2723 |
| 191 | Ga0105249_10202676 | 3300009553 | Bacteria | 1942 |
| 192 | Ga0099796_10102656 | 3300010159 | Bacteria | 1078 |
| 193 | Ga0099796_10343318 | 3300010159 | Bacteria | 642 |
| 194 | Ga0105239_10001513 | 3300010375 | Bacteria | 30845 |
| 195 | Ga0105239_10018938 | 3300010375 | Bacteria | 7607 |
| 196 | Ga0105239_10097922 | 3300010375 | Bacteria | 3242 |
| 197 | Ga0105246_10259029 | 3300011119 | Bacteria | 1385 |
| 198 | Ga0157323_1014765 | 3300012495 | Bacteria | 674 |
| 199 | Ga0157371_10579161 | 3300013102 | Bacteria | 834 |
| 200 | Ga0157371_11175858 | 3300013102 | Bacteria | 590 |
| 201 | Ga0157370_10169703 | 3300013104 | Bacteria | 2028 |
| 202 | Ga0157369_10084470 | 3300013105 | Bacteria | 3393 |
| 203 | Ga0157369_11181818 | 3300013105 | Bacteria | 781 |
| 204 | Ga0163162_11121526 | 3300013306 | Bacteria | 891 |
| 205 | Ga0157372_10495545 | 3300013307 | Bacteria | 1425 |
| 206 | Ga0157372_10775031 | 3300013307 | Bacteria | 1115 |
| 207 | Ga0157372_11071155 | 3300013307 | Bacteria | 933 |
| 208 | Ga0163163_10370162 | 3300014325 | Bacteria | 1490 |
| 209 | Ga0163163_10912428 | 3300014325 | Bacteria | 942 |
| 210 | Ga0163163_11472692 | 3300014325 | Bacteria | 742 |
| 211 | Ga0157380_10381281 | 3300014326 | Bacteria | 1331 |
| 212 | Ga0182005_1001790 | 3300015265 | Bacteria | 8238 |
| 213 | Ga0183363_1171 | 3300015690 | Bacteria | 14444 |
| 214 | Ga0184599_129808 | 3300019188 | Bacteria | 870 |
| 215 | Ga0184599_137827 | 3300019188 | Bacteria | 1509 |
| 216 | Ga0197907_10918224 | 3300020069 | Bacteria | 984 |
| 217 | Ga0197907_11069188 | 3300020069 | Bacteria | 2290 |
| 218 | Ga0206356_10243979 | 3300020070 | Bacteria | 1156 |
| 219 | Ga0206356_11658491 | 3300020070 | Bacteria | 1062 |
| 220 | Ga0206349_1643817 | 3300020075 | Bacteria | 1034 |
| 221 | Ga0206350_10271235 | 3300020080 | Bacteria | 1246 |
| 222 | Ga0206350_10345676 | 3300020080 | Bacteria | 551 |
| 223 | Ga0206350_10615424 | 3300020080 | Bacteria | 553 |
| 224 | Ga0206350_10979557 | 3300020080 | Bacteria | 1669 |
| 225 | Ga0206350_11186857 | 3300020080 | Bacteria | 1351 |
| 226 | Ga0206354_11128885 | 3300020081 | Bacteria | 608 |
| 227 | Ga0154015_1041367 | 3300020610 | Bacteria | 622 |
| 228 | Ga0214542_1000245 | 3300021321 | Bacteria | 90699 |
| 229 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 230 | Ga0213873_10059434 | 3300021358 | Bacteria | 1031 |
| 231 | Ga0213872_10026306 | 3300021361 | Bacteria | 2673 |
| 232 | Ga0213876_10149803 | 3300021384 | Bacteria | 1241 |
| 233 | Ga0213876_10242375 | 3300021384 | Bacteria | 958 |
| 234 | Ga0213875_10074112 | 3300021388 | Bacteria | 1588 |
| 235 | Ga0224712_10001061 | 3300022467 | Bacteria | 6044 |
| 236 | Ga0224712_10041597 | 3300022467 | Bacteria | 1736 |
| 237 | Ga0224712_10043244 | 3300022467 | Bacteria | 1711 |
| 238 | Ga0224712_10246506 | 3300022467 | Bacteria | 824 |
| 239 | Ga0209436_102029 | 3300025208 | Bacteria | 6393 |
| 240 | Ga0209563_129377 | 3300025230 | Bacteria | 535 |
| 241 | Ga0207425_1005747 | 3300025245 | Bacteria | 3492 |
| 242 | Ga0209677_100491 | 3300025253 | Bacteria | 22276 |
| 243 | Ga0209148_1010479 | 3300025254 | Bacteria | 1757 |
| 244 | Ga0209148_1014504 | 3300025254 | Bacteria | 1391 |
| 245 | Ga0209233_1002729 | 3300025261 | Bacteria | 6358 |
| 246 | Ga0209233_1039459 | 3300025261 | Bacteria | 1034 |
| 247 | Ga0209233_1089514 | 3300025261 | Bacteria | 530 |
| 248 | Ga0209565_1017569 | 3300025263 | Bacteria | 1566 |
| 249 | Ga0209455_1011918 | 3300025272 | Bacteria | 2112 |
| 250 | Ga0209455_1012087 | 3300025272 | Bacteria | 2085 |
| 251 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 252 | Ga0209676_1001711 | 3300025292 | Bacteria | 18937 |
| 253 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 254 | Ga0209025_1047665 | 3300025294 | Bacteria | 1746 |
| 255 | Ga0209564_1000275 | 3300025295 | Bacteria | 107884 |
| 256 | Ga0209564_1001009 | 3300025295 | Bacteria | 35025 |
| 257 | Ga0209564_1013153 | 3300025295 | Bacteria | 3539 |
| 258 | Ga0209564_1014089 | 3300025295 | Bacteria | 3349 |
| 259 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 260 | Ga0209758_1002371 | 3300025297 | Bacteria | 19394 |
| 261 | Ga0209758_1004125 | 3300025297 | Bacteria | 12428 |
| 262 | Ga0209758_1026461 | 3300025297 | Bacteria | 2509 |
| 263 | Ga0209050_1001363 | 3300025298 | Bacteria | 26748 |
| 264 | Ga0209256_1000644 | 3300025299 | Bacteria | 47455 |
| 265 | Ga0209256_1000649 | 3300025299 | Bacteria | 47340 |
| 266 | Ga0209256_1005320 | 3300025299 | Bacteria | 7485 |
| 267 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 268 | Ga0209051_1004342 | 3300025303 | Bacteria | 8790 |
| 269 | Ga0209051_1105889 | 3300025303 | Bacteria | 745 |
| 270 | Ga0209257_1002758 | 3300025304 | Bacteria | 16612 |
| 271 | Ga0209257_1003043 | 3300025304 | Bacteria | 15126 |
| 272 | Ga0207656_10025839 | 3300025321 | Bacteria | 2388 |
| 273 | Ga0207696_1096228 | 3300025711 | Bacteria | 809 |
| 274 | Ga0207692_10038277 | 3300025898 | Bacteria | 2352 |
| 275 | Ga0207692_10256932 | 3300025898 | Bacteria | 1049 |
| 276 | Ga0207642_10269973 | 3300025899 | Bacteria | 974 |
| 277 | Ga0207642_10548907 | 3300025899 | Bacteria | 713 |
| 278 | Ga0207710_10023976 | 3300025900 | Bacteria | 2625 |
| 279 | Ga0207710_10149886 | 3300025900 | Bacteria | 1131 |
| 280 | Ga0207688_10024365 | 3300025901 | Bacteria | 3318 |
| 281 | Ga0207688_10127773 | 3300025901 | Bacteria | 1488 |
| 282 | Ga0207680_10371677 | 3300025903 | Bacteria | 1007 |
| 283 | Ga0207680_10421829 | 3300025903 | Bacteria | 945 |
| 284 | Ga0207647_10003194 | 3300025904 | Bacteria | 12291 |
| 285 | Ga0207647_10206434 | 3300025904 | Bacteria | 1135 |
| 286 | Ga0207647_10301293 | 3300025904 | Bacteria | 913 |
| 287 | Ga0207685_10162137 | 3300025905 | Bacteria | 1022 |
| 288 | Ga0207685_10225347 | 3300025905 | Bacteria | 894 |
| 289 | Ga0207699_10018049 | 3300025906 | Bacteria | 3731 |
| 290 | Ga0207699_10306057 | 3300025906 | Bacteria | 1111 |
| 291 | Ga0207699_10478814 | 3300025906 | Bacteria | 896 |
| 292 | Ga0207645_10119113 | 3300025907 | Bacteria | 1713 |
| 293 | Ga0207645_10218071 | 3300025907 | Bacteria | 1257 |
| 294 | Ga0207643_10057384 | 3300025908 | Bacteria | 2216 |
| 295 | Ga0207654_10000337 | 3300025911 | Bacteria | 28090 |
| 296 | Ga0207654_10020336 | 3300025911 | Bacteria | 3518 |
| 297 | Ga0207654_10143688 | 3300025911 | Bacteria | 1524 |
| 298 | Ga0207654_10167185 | 3300025911 | Bacteria | 1425 |
| 299 | Ga0207654_10206733 | 3300025911 | Bacteria | 1295 |
| 300 | Ga0207707_10014349 | 3300025912 | Bacteria | 6900 |
| 301 | Ga0207707_10030625 | 3300025912 | Bacteria | 4707 |
| 302 | Ga0207695_10001265 | 3300025913 | Bacteria | 42969 |
| 303 | Ga0207695_10060233 | 3300025913 | Bacteria | 3931 |
| 304 | Ga0207695_10093574 | 3300025913 | Bacteria | 3015 |
| 305 | Ga0207695_10488778 | 3300025913 | Bacteria | 1113 |
| 306 | Ga0207695_10925688 | 3300025913 | Bacteria | 751 |
| 307 | Ga0207671_10047805 | 3300025914 | Bacteria | 3166 |
| 308 | Ga0207671_10092021 | 3300025914 | Bacteria | 2286 |
| 309 | Ga0207671_10340355 | 3300025914 | Bacteria | 1189 |
| 310 | Ga0207671_10530432 | 3300025914 | Bacteria | 939 |
| 311 | Ga0207693_10002749 | 3300025915 | Bacteria | 15236 |
| 312 | Ga0207693_10047117 | 3300025915 | Bacteria | 3388 |
| 313 | Ga0207693_10202439 | 3300025915 | Bacteria | 1561 |
| 314 | Ga0207663_10170719 | 3300025916 | Bacteria | 1544 |
| 315 | Ga0207663_10397525 | 3300025916 | Bacteria | 1053 |
| 316 | Ga0207660_10068701 | 3300025917 | Bacteria | 2570 |
| 317 | Ga0207662_10267787 | 3300025918 | Bacteria | 1127 |
| 318 | Ga0207657_10133010 | 3300025919 | Bacteria | 2037 |
| 319 | Ga0207657_10743917 | 3300025919 | Bacteria | 760 |
| 320 | Ga0207649_11078103 | 3300025920 | Bacteria | 633 |
| 321 | Ga0207652_10066046 | 3300025921 | Bacteria | 3134 |
| 322 | Ga0207652_10099998 | 3300025921 | Bacteria | 2560 |
| 323 | Ga0207652_10161134 | 3300025921 | Bacteria | 2011 |
| 324 | Ga0207652_11012796 | 3300025921 | Bacteria | 730 |
| 325 | Ga0207646_10627600 | 3300025922 | Bacteria | 964 |
| 326 | Ga0207681_10096096 | 3300025923 | Bacteria | 2127 |
| 327 | Ga0207681_10200972 | 3300025923 | Bacteria | 1530 |
| 328 | Ga0207681_10468845 | 3300025923 | Bacteria | 1027 |
| 329 | Ga0207681_11186071 | 3300025923 | Bacteria | 641 |
| 330 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 331 | Ga0207694_10025462 | 3300025924 | Bacteria | 4498 |
| 332 | Ga0207694_10047802 | 3300025924 | Bacteria | 3309 |
| 333 | Ga0207694_10215388 | 3300025924 | Bacteria | 1565 |
| 334 | Ga0207694_10474639 | 3300025924 | Bacteria | 1046 |
| 335 | Ga0207659_11665056 | 3300025926 | Bacteria | 544 |
| 336 | Ga0207687_10048842 | 3300025927 | Bacteria | 2940 |
| 337 | Ga0207687_10181596 | 3300025927 | Bacteria | 1631 |
| 338 | Ga0207687_11005285 | 3300025927 | Bacteria | 715 |
| 339 | Ga0207700_10108198 | 3300025928 | Bacteria | 2232 |
| 340 | Ga0207700_10504726 | 3300025928 | Bacteria | 1071 |
| 341 | Ga0207700_10729739 | 3300025928 | Bacteria | 885 |
| 342 | Ga0207700_11250130 | 3300025928 | Bacteria | 662 |
| 343 | Ga0207664_10291185 | 3300025929 | Bacteria | 1435 |
| 344 | Ga0207664_10481382 | 3300025929 | Bacteria | 1110 |
| 345 | Ga0207644_10568832 | 3300025931 | Bacteria | 939 |
| 346 | Ga0207644_11014796 | 3300025931 | Bacteria | 696 |
| 347 | Ga0207644_11614350 | 3300025931 | Bacteria | 544 |
| 348 | Ga0207690_11018315 | 3300025932 | Bacteria | 689 |
| 349 | Ga0207706_10033220 | 3300025933 | Bacteria | 4593 |
| 350 | Ga0207706_10077110 | 3300025933 | Bacteria | 2931 |
| 351 | Ga0207686_10220806 | 3300025934 | Bacteria | 1368 |
| 352 | Ga0207686_10563242 | 3300025934 | Bacteria | 892 |
| 353 | Ga0207709_10027283 | 3300025935 | Bacteria | 3288 |
| 354 | Ga0207709_10056403 | 3300025935 | Bacteria | 2431 |
| 355 | Ga0207709_10848091 | 3300025935 | Bacteria | 740 |
| 356 | Ga0207670_10247598 | 3300025936 | Bacteria | 1376 |
| 357 | Ga0207670_10664949 | 3300025936 | Bacteria | 860 |
| 358 | Ga0207669_10022164 | 3300025937 | Bacteria | 3368 |
| 359 | Ga0207704_10033275 | 3300025938 | Bacteria | 2929 |
| 360 | Ga0207704_10723084 | 3300025938 | Bacteria | 826 |
| 361 | Ga0207704_10987374 | 3300025938 | Bacteria | 712 |
| 362 | Ga0207704_11262354 | 3300025938 | Bacteria | 631 |
| 363 | Ga0207665_10274006 | 3300025939 | Bacteria | 1254 |
| 364 | Ga0207711_10176305 | 3300025941 | Bacteria | 1942 |
| 365 | Ga0207711_10888847 | 3300025941 | Bacteria | 828 |
| 366 | Ga0207689_10023824 | 3300025942 | Bacteria | 5135 |
| 367 | Ga0207689_10084589 | 3300025942 | Bacteria | 2607 |
| 368 | Ga0207689_10439096 | 3300025942 | Bacteria | 1090 |
| 369 | Ga0207661_10203397 | 3300025944 | Bacteria | 1742 |
| 370 | Ga0207661_10421493 | 3300025944 | Bacteria | 1212 |
| 371 | Ga0207661_10956085 | 3300025944 | Bacteria | 789 |
| 372 | Ga0207679_10441242 | 3300025945 | Bacteria | 1153 |
| 373 | Ga0207679_10927250 | 3300025945 | Bacteria | 797 |
| 374 | Ga0207679_11208577 | 3300025945 | Bacteria | 694 |
| 375 | Ga0207667_10005368 | 3300025949 | Bacteria | 15623 |
| 376 | Ga0207667_10011709 | 3300025949 | Bacteria | 10175 |
| 377 | Ga0207667_10135740 | 3300025949 | Bacteria | 2533 |
| 378 | Ga0207667_10414553 | 3300025949 | Bacteria | 1371 |
| 379 | Ga0207712_10097880 | 3300025961 | Bacteria | 2175 |
| 380 | Ga0207668_10451133 | 3300025972 | Bacteria | 1097 |
| 381 | Ga0207668_10728258 | 3300025972 | Bacteria | 873 |
| 382 | Ga0207668_11718211 | 3300025972 | Bacteria | 566 |
| 383 | Ga0207640_10007135 | 3300025981 | Bacteria | 6157 |
| 384 | Ga0207640_10037459 | 3300025981 | Bacteria | 3052 |
| 385 | Ga0207640_10072736 | 3300025981 | Bacteria | 2321 |
| 386 | Ga0207640_10467368 | 3300025981 | Bacteria | 1043 |
| 387 | Ga0207640_10538385 | 3300025981 | Bacteria | 979 |
| 388 | Ga0207640_11612443 | 3300025981 | Bacteria | 585 |
| 389 | Ga0207640_11957738 | 3300025981 | Bacteria | 531 |
| 390 | Ga0207658_10896742 | 3300025986 | Bacteria | 807 |
| 391 | Ga0207658_10934217 | 3300025986 | Bacteria | 790 |
| 392 | Ga0207677_10161885 | 3300026023 | Bacteria | 1739 |
| 393 | Ga0207677_10409634 | 3300026023 | Bacteria | 1152 |
| 394 | Ga0207703_10114094 | 3300026035 | Bacteria | 2310 |
| 395 | Ga0207703_10754280 | 3300026035 | Bacteria | 927 |
| 396 | Ga0207703_11067296 | 3300026035 | Bacteria | 775 |
| 397 | Ga0207703_12264017 | 3300026035 | Bacteria | 519 |
| 398 | Ga0207639_10007126 | 3300026041 | Bacteria | 7621 |
| 399 | Ga0207639_10206574 | 3300026041 | Bacteria | 1688 |
| 400 | Ga0207639_10327429 | 3300026041 | Bacteria | 1362 |
| 401 | Ga0207639_10344424 | 3300026041 | Bacteria | 1329 |
| 402 | Ga0207639_10435820 | 3300026041 | Bacteria | 1187 |
| 403 | Ga0207639_10916873 | 3300026041 | Bacteria | 819 |
| 404 | Ga0207678_10009455 | 3300026067 | Bacteria | 8574 |
| 405 | Ga0207678_10030378 | 3300026067 | Bacteria | 4718 |
| 406 | Ga0207678_10058059 | 3300026067 | Bacteria | 3330 |
| 407 | Ga0207678_10158502 | 3300026067 | Bacteria | 1933 |
| 408 | Ga0207678_10267287 | 3300026067 | Bacteria | 1466 |
| 409 | Ga0207678_10486269 | 3300026067 | Bacteria | 1075 |
| 410 | Ga0207678_10562573 | 3300026067 | Bacteria | 998 |
| 411 | Ga0207708_10371320 | 3300026075 | Bacteria | 1178 |
| 412 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 413 | Ga0207702_10000442 | 3300026078 | Bacteria | 47074 |
| 414 | Ga0207702_10005388 | 3300026078 | Bacteria | 11206 |
| 415 | Ga0207702_10158985 | 3300026078 | Bacteria | 2062 |
| 416 | Ga0207702_10229496 | 3300026078 | Bacteria | 1734 |
| 417 | Ga0207702_11321156 | 3300026078 | Bacteria | 715 |
| 418 | Ga0207641_10205256 | 3300026088 | Bacteria | 1820 |
| 419 | Ga0207648_10068374 | 3300026089 | Bacteria | 3095 |
| 420 | Ga0207676_10252097 | 3300026095 | Bacteria | 1589 |
| 421 | Ga0207676_10328080 | 3300026095 | Bacteria | 1407 |
| 422 | Ga0207674_10001614 | 3300026116 | Bacteria | 29042 |
| 423 | Ga0207674_10053911 | 3300026116 | Bacteria | 4096 |
| 424 | Ga0207674_10054460 | 3300026116 | Bacteria | 4072 |
| 425 | Ga0207674_12182887 | 3300026116 | Bacteria | 517 |
| 426 | Ga0207675_100133711 | 3300026118 | Bacteria | 2352 |
| 427 | Ga0207683_10319485 | 3300026121 | Bacteria | 1422 |
| 428 | Ga0207683_10401739 | 3300026121 | Bacteria | 1261 |
| 429 | Ga0207683_10722074 | 3300026121 | Bacteria | 924 |
| 430 | Ga0207698_10029731 | 3300026142 | Bacteria | 3917 |
| 431 | Ga0207698_10075798 | 3300026142 | Bacteria | 2690 |
| 432 | Ga0207698_10168267 | 3300026142 | Bacteria | 1927 |
| 433 | Ga0207698_11272540 | 3300026142 | Bacteria | 750 |
| 434 | Ga0209389_1000445 | 3300027296 | Bacteria | 24525 |
| 435 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 436 | Ga0209589_1000514 | 3300027357 | Bacteria | 55043 |
| 437 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 438 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 439 | Ga0209813_10083040 | 3300027866 | Bacteria | 1063 |
| 440 | Ga0268266_10060568 | 3300028379 | Bacteria | 3263 |
| 441 | Ga0268266_10134066 | 3300028379 | Bacteria | 2217 |
| 442 | Ga0268266_10450261 | 3300028379 | Bacteria | 1224 |
| 443 | Ga0268266_10634657 | 3300028379 | Bacteria | 1027 |
| 444 | Ga0268265_10155880 | 3300028380 | Bacteria | 1932 |
| 445 | Ga0268265_10188803 | 3300028380 | Bacteria | 1777 |
| 446 | Ga0268265_10191307 | 3300028380 | Bacteria | 1767 |
| 447 | Ga0268264_10212848 | 3300028381 | Bacteria | 1775 |
| 448 | Ga0268264_10239966 | 3300028381 | Bacteria | 1678 |
| 449 | Ga0268264_10407607 | 3300028381 | Bacteria | 1308 |
| 450 | Ga0268264_10834651 | 3300028381 | Bacteria | 922 |
| 451 | Ga0265337_1005726 | 3300028556 | Bacteria | 4883 |
| 452 | Ga0265326_10001798 | 3300028558 | Bacteria | 7393 |
| 453 | Ga0265319_1005521 | 3300028563 | Bacteria | 6043 |
| 454 | Ga0265334_10002109 | 3300028573 | Bacteria | 9396 |
| 455 | Ga0265334_10030164 | 3300028573 | Bacteria | 2172 |
| 456 | Ga0265318_10018005 | 3300028577 | Bacteria | 2890 |
| 457 | Ga0265323_10003106 | 3300028653 | Bacteria | 7386 |
| 458 | Ga0265322_10013091 | 3300028654 | Bacteria | 2400 |
| 459 | Ga0265336_10000765 | 3300028666 | Bacteria | 17023 |
| 460 | Ga0307515_10000198 | 3300028794 | Bacteria | 147738 |
| 461 | Ga0307515_10188224 | 3300028794 | Bacteria | 1985 |
| 462 | Ga0265338_10001398 | 3300028800 | Bacteria | 39299 |
| 463 | Ga0265324_10004472 | 3300029957 | Bacteria | 6294 |
| 464 | Ga0265340_10150688 | 3300031247 | Bacteria | 1060 |
| 465 | Ga0265339_10018141 | 3300031249 | Bacteria | 4154 |
| 466 | Ga0265331_10048861 | 3300031250 | Bacteria | 2033 |
| 467 | Ga0307513_10006546 | 3300031456 | Bacteria | 15215 |
| 468 | Ga0307408_100965537 | 3300031548 | Bacteria | 784 |
| 469 | Ga0307508_10279508 | 3300031616 | Bacteria | 1263 |
| 470 | Ga0265314_10013455 | 3300031711 | Bacteria | 6608 |
| 471 | Ga0265342_10003387 | 3300031712 | Bacteria | 13137 |
| 472 | Ga0307516_10058125 | 3300031730 | Bacteria | 3766 |
| 473 | Ga0307516_10297926 | 3300031730 | Bacteria | 1289 |
| 474 | Ga0316044_114609 | 3300031810 | Bacteria | 884 |
| 475 | Ga0307406_10822393 | 3300031901 | Bacteria | 785 |
| 476 | Ga0307407_11115557 | 3300031903 | Bacteria | 614 |
| 477 | Ga0307412_10266323 | 3300031911 | Bacteria | 1339 |
| 478 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 479 | Ga0373950_0039160 | 3300034818 | Bacteria | 902 |
| 480 | Ga0373952_0197686 | 3300035092 | Bacteria | 588 |
| 481 | Ga0373953_0022877 | 3300035117 | Bacteria | 2362 |
| 482 | Ga0373954_0025410 | 3300035118 | Bacteria | 2706 |
| 483 | Ga0373957_0021546 | 3300035120 | Bacteria | 2289 |
| 484 | Ga0373943_0070873 | 3300035170 | Bacteria | 1765 |
| 485 | Ga0373946_0518987 | 3300035171 | Bacteria | 612 |
| 486 | Ga0373924_0084043 | 3300035410 | Bacteria | 1357 |
| 487 | Ga0373935_0463742 | 3300035692 | Bacteria | 916 |
| 488 | Ga0373927_0194919 | 3300035695 | Bacteria | 1329 |
| 489 | Ga0373933_0075677 | 3300035724 | Bacteria | 2055 |
| 490 | Ga0373947_0309666 | 3300035725 | Bacteria | 1054 |
| 491 | Ga0373937_0296866 | 3300036401 | Bacteria | 1527 |
| 492 | Ga0316582_0191602 | 3300036647 | Bacteria | 1393 |
| 493 | Ga0395899_0000059 | 3300037312 | Bacteria | 213004 |
| 494 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 495 | Ga0395900_0797231 | 3300037418 | Bacteria | 873 |
| 496 | Ga0395900_1472613 | 3300037418 | Bacteria | 593 |
| 497 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 498 | Ga0395898_0092749 | 3300037466 | Bacteria | 2904 |
| 499 | Ga0395905_0000056 | 3300037471 | Bacteria | 209230 |
| 500 | Ga0395905_0032237 | 3300037471 | Bacteria | 4928 |
| 501 | Ga0395905_0120425 | 3300037471 | Bacteria | 2467 |
| 502 | Ga0436364_0011267 | 3300037853 | Bacteria | 2897 |
| 503 | Ga0436364_0223577 | 3300037853 | Bacteria | 1326 |
| 504 | Ga0436364_0836584 | 3300037853 | Bacteria | 3621 |
| 505 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 506 | Ga0395901_1330146 | 3300038443 | Bacteria | 679 |
| 507 | Ga0436365_0188153 | 3300039437 | Bacteria | 613 |
| 508 | Ga0436365_1034663 | 3300039437 | Bacteria | 598 |
| 509 | Ga0436365_1530142 | 3300039437 | Bacteria | 2200 |
| 510 | Ga0436365_1689582 | 3300039437 | Bacteria | 2390 |
| 511 | Ga0436365_1721433 | 3300039437 | Bacteria | 2506 |
| 512 | Ga0436365_1792102 | 3300039437 | Bacteria | 814 |
| 513 | Ga0436361_0389690 | 3300039447 | Bacteria | 7027 |
| 514 | Ga0436361_0393557 | 3300039447 | Bacteria | 965 |
| 515 | Ga0436363_1282227 | 3300039450 | Bacteria | 1043 |
| 516 | Ga0451791_0347348 | 3300041451 | Bacteria | 622 |
| 517 | Ga0451800_0052594 | 3300041459 | Bacteria | 656 |
| 518 | Ga0439434_0222684 | 3300042435 | Bacteria | 640 |
| 519 | Ga0466969_0016125 | 3300044656 | Bacteria | 3914 |
| 520 | Ga0466969_0272834 | 3300044656 | Bacteria | 766 |
| 521 | Ga0466969_0283938 | 3300044656 | Bacteria | 749 |
| 522 | Ga0466972_0006610 | 3300044658 | Bacteria | 5822 |
| 523 | Ga0466965_0207394 | 3300044683 | Bacteria | 1041 |
| 524 | Ga0466965_0704471 | 3300044683 | Bacteria | 579 |
| 525 | Ga0466966_0284386 | 3300044684 | Bacteria | 994 |
| 526 | Ga0466961_0477939 | 3300044693 | Bacteria | 753 |
| 527 | Ga0466963_0160928 | 3300044694 | Bacteria | 1562 |
| 528 | Ga0466971_0045342 | 3300044719 | Bacteria | 1975 |
| 529 | Ga0466968_0161364 | 3300044735 | Bacteria | 1035 |
| 530 | Ga0466968_0413420 | 3300044735 | Bacteria | 663 |
| 531 | Ga0466968_0608198 | 3300044735 | Bacteria | 552 |
| 532 | Ga0466968_0654954 | 3300044735 | Bacteria | 533 |
| 533 | Ga0466970_0155949 | 3300044765 | Bacteria | 1262 |
| 534 | Ga0466957_0559766 | 3300044842 | Bacteria | 797 |
| 535 | Ga0466959_0016249 | 3300045049 | Bacteria | 5435 |
| 536 | Ga0466959_0030669 | 3300045049 | Bacteria | 3981 |
| 537 | Ga0466959_0207675 | 3300045049 | Bacteria | 1362 |
| 538 | Ga0466959_0478394 | 3300045049 | Bacteria | 843 |
| 539 | Ga0466959_0745770 | 3300045049 | Bacteria | 655 |
| 540 | Ga0466958_1043632 | 3300045836 | Bacteria | 533 |
| 541 | Ga0466967_0066166 | 3300045976 | Bacteria | 3219 |
| 542 | Ga0466967_0136069 | 3300045976 | Bacteria | 2285 |
| 543 | Ga0466967_0280234 | 3300045976 | Bacteria | 1599 |
| 544 | Ga0495627_208489 | 3300046453 | Bacteria | 538 |
| 545 | Ga0495603_0080240 | 3300046455 | Bacteria | 1912 |
| 546 | Ga0495603_0101515 | 3300046455 | Bacteria | 1679 |
| 547 | Ga0495603_0833492 | 3300046455 | Bacteria | 525 |
| 548 | Ga0495651_0049749 | 3300046462 | Bacteria | 3235 |
| 549 | Ga0495653_0037072 | 3300046463 | Bacteria | 3835 |
| 550 | Ga0495653_0278818 | 3300046463 | Bacteria | 1098 |
| 551 | Ga0495580_0119656 | 3300046472 | Bacteria | 1829 |
| 552 | Ga0495580_0991449 | 3300046472 | Bacteria | 536 |
| 553 | Ga0495582_0510710 | 3300046473 | Bacteria | 695 |
| 554 | Ga0495639_0059158 | 3300046475 | Bacteria | 1754 |
| 555 | Ga0495585_0055312 | 3300046492 | Bacteria | 2193 |
| 556 | Ga0495594_0090670 | 3300046499 | Bacteria | 1713 |
| 557 | Ga0495594_0139606 | 3300046499 | Bacteria | 1374 |
| 558 | Ga0495607_0028013 | 3300046501 | Bacteria | 3479 |
| 559 | Ga0495608_0047322 | 3300046511 | Bacteria | 2859 |
| 560 | Ga0495616_0267572 | 3300046513 | Bacteria | 729 |
| 561 | Ga0495618_0120870 | 3300046514 | Bacteria | 1677 |
| 562 | Ga0495630_0027840 | 3300046517 | Bacteria | 4198 |
| 563 | Ga0495630_0411849 | 3300046517 | Bacteria | 1036 |
| 564 | Ga0495632_0173159 | 3300046519 | Bacteria | 991 |
| 565 | Ga0495637_0119905 | 3300046520 | Bacteria | 1013 |
| 566 | Ga0495643_0148033 | 3300046522 | Bacteria | 1165 |
| 567 | Ga0495663_0365409 | 3300046525 | Bacteria | 527 |
| 568 | Ga0495652_0028933 | 3300046529 | Bacteria | 4869 |
| 569 | Ga0495665_0445599 | 3300046531 | Bacteria | 655 |
| 570 | Ga0495587_0023026 | 3300046536 | Bacteria | 3830 |
| 571 | Ga0495598_0032556 | 3300046537 | Bacteria | 1474 |
| 572 | Ga0495597_0094850 | 3300046542 | Bacteria | 1263 |
| 573 | Ga0495622_0186161 | 3300046557 | Bacteria | 929 |
| 574 | Ga0495667_0029419 | 3300046559 | Bacteria | 3698 |
| 575 | Ga0495656_0154924 | 3300046615 | Bacteria | 1109 |
| 576 | Ga0495668_0057814 | 3300046616 | Bacteria | 2140 |
| 577 | Ga0495668_0099147 | 3300046616 | Bacteria | 1594 |
| 578 | Ga0495661_0412218 | 3300046665 | Bacteria | 655 |
| 579 | Ga0495588_0282226 | 3300046674 | Bacteria | 875 |
| 580 | Ga0495588_0567180 | 3300046674 | Bacteria | 595 |
| 581 | Ga0495657_0209589 | 3300046675 | Bacteria | 1185 |
| 582 | Ga0495599_0085566 | 3300046678 | Bacteria | 1969 |
| 583 | Ga0495623_0020900 | 3300046679 | Bacteria | 4230 |
| 584 | Ga0495658_0256442 | 3300046683 | Bacteria | 1101 |
| 585 | Ga0495669_0236885 | 3300046684 | Bacteria | 876 |
| 586 | Ga0495624_0838855 | 3300046690 | Bacteria | 542 |
| 587 | Ga0495670_0080717 | 3300046691 | Bacteria | 1657 |
| 588 | Ga0495671_0016535 | 3300046692 | Bacteria | 3937 |
| 589 | Ga0495581_0360247 | 3300047315 | Bacteria | 849 |
| 590 | Ga0495604_0023604 | 3300047317 | Bacteria | 4907 |
| 591 | Ga0495604_0757227 | 3300047317 | Bacteria | 614 |
| 592 | Ga0495672_0541618 | 3300047320 | Bacteria | 511 |
| 593 | Ga0495676_0021656 | 3300047321 | Bacteria | 5608 |
| 594 | Ga0495680_0047093 | 3300047322 | Bacteria | 3394 |
| 595 | Ga0495687_007256 | 3300047443 | Bacteria | 6577 |
| 596 | Ga0495675_0059711 | 3300047444 | Bacteria | 2417 |
| 597 | Ga0495677_0070733 | 3300047445 | Bacteria | 1300 |
| 598 | Ga0495673_0239560 | 3300047469 | Bacteria | 665 |
| 599 | Ga0495681_0059701 | 3300047470 | Bacteria | 1762 |
| 600 | Ga0495686_0081318 | 3300047472 | Bacteria | 1979 |
| 601 | Ga0495686_0347204 | 3300047472 | Bacteria | 807 |
| 602 | Ga0495602_0381519 | 3300048088 | Bacteria | 1009 |
| 603 | Ga0495626_0093493 | 3300048091 | Bacteria | 1320 |
| 604 | Ga0495626_0407025 | 3300048091 | Bacteria | 525 |
| 605 | Ga0496100_0053461 | 3300048903 | Bacteria | 2630 |
| 606 | Ga0496100_0140001 | 3300048903 | Bacteria | 1714 |
| 607 | Ga0496101_0054703 | 3300048904 | Bacteria | 2882 |
| 608 | Ga0496101_0453101 | 3300048904 | Bacteria | 1012 |
| 609 | Ga0496101_0588899 | 3300048904 | Bacteria | 879 |
| 610 | Ga0496102_0004466 | 3300048905 | Bacteria | 11805 |
| 611 | Ga0496102_0257729 | 3300048905 | Bacteria | 1644 |
| 612 | Ga0496103_0222176 | 3300048906 | Bacteria | 1215 |
| 613 | Ga0496105_0018366 | 3300048908 | Bacteria | 5618 |
| 614 | Ga0496105_0170799 | 3300048908 | Bacteria | 1782 |
| 615 | Ga0496105_0473379 | 3300048908 | Bacteria | 986 |
| 616 | Ga0496105_1135701 | 3300048908 | Bacteria | 578 |
| 617 | Ga0496106_0245270 | 3300048909 | Bacteria | 1431 |
| 618 | Ga0496108_1356615 | 3300048911 | Bacteria | 596 |
| 619 | Ga0496109_0130302 | 3300048912 | Bacteria | 2347 |
| 620 | Ga0496109_0367193 | 3300048912 | Bacteria | 1359 |
| 621 | Ga0496110_0135466 | 3300048913 | Bacteria | 2225 |
| 622 | Ga0496110_0169841 | 3300048913 | Bacteria | 1978 |
| 623 | Ga0496110_0208480 | 3300048913 | Bacteria | 1776 |
| 624 | Ga0496110_0793344 | 3300048913 | Bacteria | 851 |
| 625 | Ga0496111_0189975 | 3300048914 | Bacteria | 1527 |
| 626 | Ga0496111_0220626 | 3300048914 | Bacteria | 1409 |
| 627 | Ga0496112_0066511 | 3300048915 | Bacteria | 3556 |
| 628 | Ga0496112_0621399 | 3300048915 | Bacteria | 1011 |
| 629 | Ga0496112_0708443 | 3300048915 | Bacteria | 934 |
| 630 | Ga0496113_0005243 | 3300048916 | Bacteria | 8069 |
| 631 | Ga0496113_0259845 | 3300048916 | Bacteria | 1387 |
| 632 | Ga0496113_1108711 | 3300048916 | Bacteria | 620 |
| 633 | Ga0496114_0300994 | 3300048917 | Bacteria | 1416 |
| 634 | Ga0496114_0942637 | 3300048917 | Bacteria | 745 |
| 635 | Ga0496115_0009418 | 3300048918 | Bacteria | 7257 |
| 636 | Ga0496115_0553371 | 3300048918 | Bacteria | 919 |
| 637 | Ga0496116_0105066 | 3300048919 | Bacteria | 1676 |
| 638 | Ga0496117_0034246 | 3300048920 | Bacteria | 3829 |
| 639 | Ga0496117_0077642 | 3300048920 | Bacteria | 2196 |
| 640 | Ga0496117_0172333 | 3300048920 | Bacteria | 1254 |
| 641 | Ga0496118_0026583 | 3300048921 | Bacteria | 4925 |
| 642 | Ga0496118_0041896 | 3300048921 | Bacteria | 3619 |
| 643 | Ga0496118_0090739 | 3300048921 | Bacteria | 2104 |
| 644 | Ga0496118_0294961 | 3300048921 | Bacteria | 894 |
| 645 | Ga0496119_0239808 | 3300048922 | Bacteria | 919 |
| 646 | Ga0496120_0092251 | 3300048923 | Bacteria | 1616 |
| 647 | Ga0496120_0171153 | 3300048923 | Bacteria | 1074 |
| 648 | Ga0496121_0003672 | 3300048924 | Bacteria | 21573 |
| 649 | Ga0496121_0070646 | 3300048924 | Bacteria | 2811 |
| 650 | Ga0496121_0087661 | 3300048924 | Bacteria | 2442 |
| 651 | Ga0496121_0129036 | 3300048924 | Bacteria | 1896 |
| 652 | Ga0496121_0346783 | 3300048924 | Bacteria | 990 |
| 653 | Ga0496121_0651291 | 3300048924 | Bacteria | 641 |
| 654 | Ga0496122_0101863 | 3300048925 | Bacteria | 1916 |
| 655 | Ga0496123_0088944 | 3300048926 | Bacteria | 1841 |
| 656 | Ga0496124_0300048 | 3300048927 | Bacteria | 1161 |
| 657 | Ga0496125_0000090 | 3300048928 | Bacteria | 214433 |
| 658 | Ga0496125_0001219 | 3300048928 | Bacteria | 38596 |
| 659 | Ga0496125_0043512 | 3300048928 | Bacteria | 3810 |
| 660 | Ga0496125_0055311 | 3300048928 | Bacteria | 3234 |
| 661 | Ga0496125_0076314 | 3300048928 | Bacteria | 2588 |
| 662 | Ga0496125_0709333 | 3300048928 | Bacteria | 533 |
| 663 | Ga0496126_0013869 | 3300048929 | Bacteria | 8174 |
| 664 | Ga0496126_0023395 | 3300048929 | Bacteria | 5988 |
| 665 | Ga0496126_0028110 | 3300048929 | Bacteria | 5362 |
| 666 | Ga0496126_0060139 | 3300048929 | Bacteria | 3418 |
| 667 | Ga0496126_0137332 | 3300048929 | Bacteria | 2107 |
| 668 | Ga0496126_0207038 | 3300048929 | Bacteria | 1653 |
| 669 | Ga0496126_0260728 | 3300048929 | Bacteria | 1441 |
| 670 | Ga0496126_0528628 | 3300048929 | Bacteria | 939 |
| 671 | Ga0496126_0946543 | 3300048929 | Bacteria | 650 |
| 672 | Ga0496126_0960951 | 3300048929 | Bacteria | 644 |
| 673 | Ga0495682_0243303 | 3300049460 | Bacteria | 636 |
| 674 | Ga0501031_0000442 | 3300049568 | Bacteria | 23895 |
| 675 | Ga0501031_0014148 | 3300049568 | Bacteria | 5191 |
| 676 | Ga0501031_0021697 | 3300049568 | Bacteria | 4186 |
| 677 | Ga0501031_0102498 | 3300049568 | Bacteria | 1867 |
| 678 | Ga0501031_0218862 | 3300049568 | Bacteria | 1240 |
| 679 | Ga0501031_0275537 | 3300049568 | Bacteria | 1092 |
| 680 | Ga0501031_0358115 | 3300049568 | Bacteria | 944 |
| 681 | Ga0501032_0000031 | 3300049569 | Bacteria | 130204 |
| 682 | Ga0501032_0000773 | 3300049569 | Bacteria | 25943 |
| 683 | Ga0501032_0006279 | 3300049569 | Bacteria | 8753 |
| 684 | Ga0501032_0023195 | 3300049569 | Bacteria | 4294 |
| 685 | Ga0501032_0068001 | 3300049569 | Bacteria | 2379 |
| 686 | Ga0501032_0102250 | 3300049569 | Bacteria | 1899 |
| 687 | Ga0501032_0204503 | 3300049569 | Bacteria | 1288 |
| 688 | Ga0501033_0000126 | 3300049570 | Bacteria | 74250 |
| 689 | Ga0501033_0005198 | 3300049570 | Bacteria | 10340 |
| 690 | Ga0501033_0009424 | 3300049570 | Bacteria | 7517 |
| 691 | Ga0501033_0014639 | 3300049570 | Bacteria | 5955 |
| 692 | Ga0501033_0033905 | 3300049570 | Bacteria | 3832 |
| 693 | Ga0501033_0043543 | 3300049570 | Bacteria | 3343 |
| 694 | Ga0501033_0044422 | 3300049570 | Bacteria | 3308 |
| 695 | Ga0501033_0136117 | 3300049570 | Bacteria | 1777 |
| 696 | Ga0501033_0141567 | 3300049570 | Bacteria | 1738 |
| 697 | Ga0501033_0823751 | 3300049570 | Bacteria | 627 |
| 698 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 699 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 700 | Ga0501034_0059763 | 3300049571 | Bacteria | 3829 |
| 701 | Ga0501034_0113529 | 3300049571 | Bacteria | 2699 |
| 702 | Ga0501034_0186446 | 3300049571 | Bacteria | 2038 |
| 703 | Ga0501034_0256592 | 3300049571 | Bacteria | 1692 |
| 704 | Ga0501034_0490434 | 3300049571 | Bacteria | 1143 |
| 705 | Ga0501036_0000069 | 3300049572 | Bacteria | 64331 |
| 706 | Ga0501036_0005749 | 3300049572 | Bacteria | 10056 |
| 707 | Ga0501036_0189772 | 3300049572 | Bacteria | 1729 |
| 708 | Ga0501036_0328858 | 3300049572 | Bacteria | 1277 |
| 709 | Ga0501036_0930287 | 3300049572 | Bacteria | 713 |
| 710 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 711 | Ga0501037_0000616 | 3300049573 | Bacteria | 27595 |
| 712 | Ga0501037_0005524 | 3300049573 | Bacteria | 9221 |
| 713 | Ga0501037_0025364 | 3300049573 | Bacteria | 4381 |
| 714 | Ga0501037_0095767 | 3300049573 | Bacteria | 2145 |
| 715 | Ga0501037_0800436 | 3300049573 | Bacteria | 622 |
| 716 | Ga0501038_0000205 | 3300049574 | Bacteria | 50558 |
| 717 | Ga0501038_0000537 | 3300049574 | Bacteria | 33396 |
| 718 | Ga0501038_0037431 | 3300049574 | Bacteria | 4253 |
| 719 | Ga0501038_0049398 | 3300049574 | Bacteria | 3637 |
| 720 | Ga0501038_0200018 | 3300049574 | Bacteria | 1604 |
| 721 | Ga0501038_0227550 | 3300049574 | Bacteria | 1486 |
| 722 | Ga0501038_0307720 | 3300049574 | Bacteria | 1242 |
| 723 | Ga0501038_0600137 | 3300049574 | Bacteria | 833 |
| 724 | Ga0501038_0895858 | 3300049574 | Bacteria | 655 |
| 725 | Ga0501039_0000198 | 3300049575 | Bacteria | 43456 |
| 726 | Ga0501039_0002792 | 3300049575 | Bacteria | 13046 |
| 727 | Ga0501039_0830048 | 3300049575 | Bacteria | 721 |
| 728 | Ga0501039_1077254 | 3300049575 | Bacteria | 623 |
| 729 | Ga0501040_0156581 | 3300049576 | Bacteria | 1609 |
| 730 | Ga0501040_0622376 | 3300049576 | Bacteria | 780 |
| 731 | Ga0501041_0478332 | 3300049577 | Bacteria | 791 |
| 732 | Ga0501042_0074198 | 3300049578 | Bacteria | 2434 |
| 733 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 734 | Ga0501043_0000107 | 3300049579 | Bacteria | 77469 |
| 735 | Ga0501043_0001044 | 3300049579 | Bacteria | 24351 |
| 736 | Ga0501043_0016446 | 3300049579 | Bacteria | 5800 |
| 737 | Ga0501043_0021518 | 3300049579 | Bacteria | 5057 |
| 738 | Ga0501043_0068674 | 3300049579 | Bacteria | 2783 |
| 739 | Ga0501043_0174701 | 3300049579 | Bacteria | 1675 |
| 740 | Ga0501043_0624827 | 3300049579 | Bacteria | 793 |
| 741 | Ga0501043_0728933 | 3300049579 | Bacteria | 722 |
| 742 | Ga0501046_0003594 | 3300049580 | Bacteria | 14203 |
| 743 | Ga0501046_0011039 | 3300049580 | Bacteria | 7740 |
| 744 | Ga0501046_0095285 | 3300049580 | Bacteria | 2287 |
| 745 | Ga0501046_0097356 | 3300049580 | Bacteria | 2260 |
| 746 | Ga0501046_1082929 | 3300049580 | Bacteria | 554 |
| 747 | Ga0501047_0000587 | 3300049581 | Bacteria | 38665 |
| 748 | Ga0501047_0020996 | 3300049581 | Bacteria | 6273 |
| 749 | Ga0501047_0068073 | 3300049581 | Bacteria | 3430 |
| 750 | Ga0501047_0100525 | 3300049581 | Bacteria | 2771 |
| 751 | Ga0501047_0242842 | 3300049581 | Bacteria | 1651 |
| 752 | Ga0501048_0001731 | 3300049582 | Bacteria | 16614 |
| 753 | Ga0501048_0059277 | 3300049582 | Bacteria | 2713 |
| 754 | Ga0501067_0000331 | 3300049583 | Bacteria | 25804 |
| 755 | Ga0501067_0047655 | 3300049583 | Bacteria | 2377 |
| 756 | Ga0501067_0203767 | 3300049583 | Bacteria | 1102 |
| 757 | Ga0501068_0000039 | 3300049584 | Bacteria | 48466 |
| 758 | Ga0501068_0716273 | 3300049584 | Bacteria | 655 |
| 759 | Ga0501068_1007242 | 3300049584 | Bacteria | 550 |
| 760 | Ga0501069_0000039 | 3300049585 | Bacteria | 82361 |
| 761 | Ga0501069_0013970 | 3300049585 | Bacteria | 4289 |
| 762 | Ga0501069_0019200 | 3300049585 | Bacteria | 3694 |
| 763 | Ga0501069_0039180 | 3300049585 | Bacteria | 2617 |
| 764 | Ga0501070_0000132 | 3300049586 | Bacteria | 67092 |
| 765 | Ga0501070_0000299 | 3300049586 | Bacteria | 46014 |
| 766 | Ga0501070_0002117 | 3300049586 | Bacteria | 17410 |
| 767 | Ga0501070_0007344 | 3300049586 | Bacteria | 9356 |
| 768 | Ga0501070_0036765 | 3300049586 | Bacteria | 4090 |
| 769 | Ga0501070_0070851 | 3300049586 | Bacteria | 2886 |
| 770 | Ga0501070_0078238 | 3300049586 | Bacteria | 2737 |
| 771 | Ga0501070_0233142 | 3300049586 | Bacteria | 1508 |
| 772 | Ga0501070_0690937 | 3300049586 | Bacteria | 807 |
| 773 | Ga0501070_1035658 | 3300049586 | Bacteria | 635 |
| 774 | Ga0501071_0165148 | 3300049587 | Bacteria | 1656 |
| 775 | Ga0501071_0302093 | 3300049587 | Bacteria | 1213 |
| 776 | Ga0501071_0845836 | 3300049587 | Bacteria | 706 |
| 777 | Ga0501071_1326758 | 3300049587 | Bacteria | 556 |
| 778 | Ga0501072_0014578 | 3300049588 | Bacteria | 6023 |
| 779 | Ga0501072_0469800 | 3300049588 | Bacteria | 996 |
| 780 | Ga0501072_1406849 | 3300049588 | Bacteria | 539 |
| 781 | Ga0501073_0000144 | 3300049589 | Bacteria | 47087 |
| 782 | Ga0501073_0048839 | 3300049589 | Bacteria | 2969 |
| 783 | Ga0501073_0367399 | 3300049589 | Bacteria | 994 |
| 784 | Ga0501073_0695776 | 3300049589 | Bacteria | 701 |
| 785 | Ga0501074_0001123 | 3300049590 | Bacteria | 17513 |
| 786 | Ga0501074_0005397 | 3300049590 | Bacteria | 9201 |
| 787 | Ga0501074_0010236 | 3300049590 | Bacteria | 6805 |
| 788 | Ga0501074_0089756 | 3300049590 | Bacteria | 2201 |
| 789 | Ga0501074_0108152 | 3300049590 | Bacteria | 1990 |
| 790 | Ga0501074_1029684 | 3300049590 | Bacteria | 579 |
| 791 | Ga0501076_0173360 | 3300049592 | Bacteria | 1758 |
| 792 | Ga0501077_1026456 | 3300049593 | Bacteria | 531 |
| 793 | Ga0501079_0004404 | 3300049741 | Bacteria | 10430 |
| 794 | Ga0501079_0206606 | 3300049741 | Bacteria | 1534 |
| 795 | Ga0501080_0001145 | 3300049742 | Bacteria | 21850 |
| 796 | Ga0501080_0001676 | 3300049742 | Bacteria | 18865 |
| 797 | Ga0501080_0003023 | 3300049742 | Bacteria | 14830 |
| 798 | Ga0501080_0004511 | 3300049742 | Bacteria | 12412 |
| 799 | Ga0501080_0097918 | 3300049742 | Bacteria | 2723 |
| 800 | Ga0501080_0260497 | 3300049742 | Bacteria | 1580 |
| 801 | Ga0501080_0569745 | 3300049742 | Bacteria | 1007 |
| 802 | Ga0501080_1184114 | 3300049742 | Bacteria | 657 |
| 803 | Ga0501081_1253969 | 3300049743 | Bacteria | 562 |
| 804 | Ga0501081_1545901 | 3300049743 | Bacteria | 504 |
| 805 | Ga0501083_0002416 | 3300049744 | Bacteria | 12766 |
| 806 | Ga0501083_0003750 | 3300049744 | Bacteria | 10671 |
| 807 | Ga0501083_0390073 | 3300049744 | Bacteria | 906 |
| 808 | Ga0501035_0000055 | 3300049822 | Bacteria | 139471 |
| 809 | Ga0501035_0000436 | 3300049822 | Bacteria | 46832 |
| 810 | Ga0501035_0000807 | 3300049822 | Bacteria | 33393 |
| 811 | Ga0501035_0000865 | 3300049822 | Bacteria | 32300 |
| 812 | Ga0501035_0013030 | 3300049822 | Bacteria | 7674 |
| 813 | Ga0501035_0022239 | 3300049822 | Bacteria | 5823 |
| 814 | Ga0501035_0040528 | 3300049822 | Bacteria | 4208 |
| 815 | Ga0501035_0167350 | 3300049822 | Bacteria | 1900 |
| 816 | Ga0501035_0203988 | 3300049822 | Bacteria | 1694 |
| 817 | Ga0501035_0242553 | 3300049822 | Bacteria | 1532 |
| 818 | Ga0501035_1181097 | 3300049822 | Bacteria | 594 |
| 819 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 820 | Ga0501044_0000071 | 3300049823 | Bacteria | 124531 |
| 821 | Ga0501044_0030397 | 3300049823 | Bacteria | 5693 |
| 822 | Ga0501044_0030832 | 3300049823 | Bacteria | 5647 |
| 823 | Ga0501044_0052011 | 3300049823 | Bacteria | 4223 |
| 824 | Ga0501044_0053864 | 3300049823 | Bacteria | 4137 |
| 825 | Ga0501044_0070576 | 3300049823 | Bacteria | 3553 |
| 826 | Ga0501044_0070897 | 3300049823 | Bacteria | 3544 |
| 827 | Ga0501044_0086235 | 3300049823 | Bacteria | 3172 |
| 828 | Ga0501044_0122650 | 3300049823 | Bacteria | 2598 |
| 829 | Ga0501044_0125897 | 3300049823 | Bacteria | 2560 |
| 830 | Ga0501044_0534274 | 3300049823 | Bacteria | 1071 |
| 831 | Ga0501044_0704296 | 3300049823 | Bacteria | 895 |
| 832 | Ga0501044_0718589 | 3300049823 | Bacteria | 883 |
| 833 | Ga0501044_0795012 | 3300049823 | Bacteria | 826 |
| 834 | Ga0501045_0015837 | 3300049824 | Bacteria | 5348 |
| 835 | Ga0501045_0497188 | 3300049824 | Bacteria | 906 |
| 836 | Ga0501045_0815964 | 3300049824 | Bacteria | 687 |
| 837 | nmdc:mga03n38_238584_c1 | 3300050490 | Bacteria | 956 |
| 838 | nmdc:mga03n38_522247_c1 | 3300050490 | Bacteria | 669 |
| 839 | nmdc:mga00v17_113033_c1 | 3300050491 | Bacteria | 1724 |
| 840 | nmdc:mga00v17_23145_c1 | 3300050491 | Bacteria | 3591 |
| 841 | nmdc:mga00v17_424712_c1 | 3300050491 | Bacteria | 863 |
| 842 | nmdc:mga00v17_441924_c1 | 3300050491 | Bacteria | 845 |
| 843 | nmdc:mga0yw44_178137_c1 | 3300050492 | Bacteria | 1398 |
| 844 | nmdc:mga0yw44_751055_c1 | 3300050492 | Bacteria | 663 |
| 845 | nmdc:mga0k408_405448_c1 | 3300050493 | Bacteria | 811 |
| 846 | nmdc:mga0k408_712448_c1 | 3300050493 | Bacteria | 588 |
| 847 | nmdc:mga0k408_833593_c1 | 3300050493 | Bacteria | 537 |
| 848 | nmdc:mga06z11_554979_c1 | 3300050494 | Bacteria | 698 |
| 849 | nmdc:mga06z11_998767_c1 | 3300050494 | Bacteria | 510 |
| 850 | nmdc:mga04h51_1603_c1 | 3300050495 | Bacteria | 5267 |
| 851 | nmdc:mga07m45_299048_c1 | 3300050496 | Bacteria | 936 |
| 852 | nmdc:mga07m45_316189_c1 | 3300050496 | Bacteria | 908 |
| 853 | nmdc:mga07m45_36612_c1 | 3300050496 | Bacteria | 2186 |
| 854 | nmdc:mga07m45_728742_c1 | 3300050496 | Bacteria | 570 |
| 855 | nmdc:mga0sz30_26148_c1 | 3300050516 | Bacteria | 2391 |
| 856 | nmdc:mga0sz30_69532_c1 | 3300050516 | Bacteria | 1514 |
| 857 | Ga0495655_0198720 | 3300053083 | Bacteria | 655 |
| 858 | Ga0495655_0275696 | 3300053083 | Bacteria | 572 |
| 859 | Ga0495595_0235348 | 3300053084 | Bacteria | 915 |
| 860 | Ga0495619_0091324 | 3300053085 | Bacteria | 2061 |
| 861 | Ga0500566_0006668 | 3300053094 | Bacteria | 6837 |
| 862 | Ga0500650_0002916 | 3300053098 | Bacteria | 5796 |
| 863 | Ga0500555_001383 | 3300053103 | Bacteria | 7489 |
| 864 | Ga0500572_000088 | 3300053111 | Bacteria | 29518 |
| 865 | Ga0500593_223144 | 3300053117 | Bacteria | 660 |
| 866 | Ga0500608_010423 | 3300053122 | Bacteria | 3989 |
| 867 | Ga0500618_006001 | 3300053125 | Bacteria | 3615 |
| 868 | Ga0500621_227861 | 3300053126 | Bacteria | 641 |
| 869 | Ga0500642_0000074 | 3300053130 | Bacteria | 54356 |
| 870 | Ga0500642_0274603 | 3300053130 | Bacteria | 767 |
| 871 | Ga0500652_000065 | 3300053131 | Bacteria | 46129 |
| 872 | Ga0500658_0362206 | 3300053134 | Bacteria | 665 |
| 873 | Ga0500559_0000321 | 3300053136 | Bacteria | 36410 |
| 874 | Ga0500559_0000381 | 3300053136 | Bacteria | 32402 |
| 875 | Ga0500559_0085448 | 3300053136 | Bacteria | 1439 |
| 876 | Ga0500559_0293394 | 3300053136 | Bacteria | 764 |
| 877 | Ga0500568_0000556 | 3300053139 | Bacteria | 27442 |
| 878 | Ga0500568_0009976 | 3300053139 | Bacteria | 4480 |
| 879 | Ga0500586_085382 | 3300053145 | Bacteria | 1108 |
| 880 | Ga0500604_0002433 | 3300053151 | Bacteria | 5079 |
| 881 | Ga0500616_0000283 | 3300053153 | Bacteria | 74456 |
| 882 | Ga0500633_0049618 | 3300053160 | Bacteria | 1444 |
| 883 | Ga0500634_0076383 | 3300053161 | Bacteria | 1739 |
| 884 | Ga0500639_022496 | 3300053163 | Bacteria | 3330 |
| 885 | Ga0500636_0000479 | 3300053177 | Bacteria | 21763 |
| 886 | Ga0500637_0216074 | 3300053178 | Bacteria | 1086 |
| 887 | Ga0500649_152363 | 3300053722 | Bacteria | 828 |
| 888 | Ga0500570_129912 | 3300053724 | Bacteria | 960 |
| 889 | Ga0500576_030942 | 3300053725 | Bacteria | 2432 |
| 890 | Ga0500645_004743 | 3300053730 | Bacteria | 5148 |
| 891 | Ga0500645_028876 | 3300053730 | Bacteria | 1676 |
| 892 | Ga0500645_165285 | 3300053730 | Bacteria | 606 |
| 893 | Ga0500596_000143 | 3300053735 | Bacteria | 10778 |
| 894 | Ga0501084_0006472 | 3300054114 | Bacteria | 9632 |
| 895 | Ga0501084_0049335 | 3300054114 | Bacteria | 3524 |
| 896 | Ga0587066_120608 | 3300059490 | Bacteria | 619 |
| 897 | Ga0587073_0110384 | 3300059492 | Bacteria | 728 |
| 898 | Ga0587073_0132435 | 3300059492 | Bacteria | 686 |
| 899 | Ga0587073_0203977 | 3300059492 | Bacteria | 595 |
| 900 | Ga0587077_074509 | 3300059493 | Bacteria | 766 |
| 901 | Ga0587080_107286 | 3300059503 | Bacteria | 605 |
| 902 | Ga0587082_181561 | 3300059504 | Bacteria | 516 |
| 903 | Ga0587083_0062596 | 3300059505 | Bacteria | 843 |
| 904 | Ga0587083_0066555 | 3300059505 | Bacteria | 826 |
| 905 | Ga0587083_0209779 | 3300059505 | Bacteria | 561 |
| 906 | Ga0587083_0266102 | 3300059505 | Bacteria | 516 |
| 907 | Ga0587085_027564 | 3300059506 | Bacteria | 912 |
| 908 | Ga0587086_017567 | 3300059507 | Bacteria | 945 |
| 909 | Ga0587089_068118 | 3300059509 | Bacteria | 600 |
| 910 | Ga0587090_131331 | 3300059510 | Bacteria | 552 |
| 911 | Ga0587094_068791 | 3300059513 | Bacteria | 634 |
| 912 | Ga0587106_129405 | 3300059605 | Bacteria | 543 |
| 913 | Ga0587131_015566 | 3300059609 | Bacteria | 588 |
| 914 | Ga0587101_058093 | 3300059623 | Bacteria | 684 |
| 915 | Ga0587109_126536 | 3300059624 | Bacteria | 612 |
| 916 | Ga0587115_047365 | 3300059626 | Bacteria | 689 |
| 917 | Ga0587122_058045 | 3300059628 | Bacteria | 515 |
| 918 | Ga0587128_054851 | 3300059630 | Bacteria | 738 |
| 919 | Ga0587128_056786 | 3300059630 | Bacteria | 729 |
| 920 | Ga0587128_057552 | 3300059630 | Bacteria | 726 |
| 921 | Ga0587062_080859 | 3300059639 | Bacteria | 604 |
| 922 | Ga0587068_088156 | 3300059641 | Bacteria | 636 |
| 923 | Ga0587069_156258 | 3300059642 | Bacteria | 510 |
| 924 | Ga0587072_029201 | 3300059643 | Bacteria | 1022 |
| 925 | Ga0587072_206428 | 3300059643 | Bacteria | 502 |
| 926 | Ga0587102_034710 | 3300059649 | Bacteria | 630 |
| 927 | Ga0587107_047735 | 3300059652 | Bacteria | 715 |
| 928 | Ga0587110_033874 | 3300059654 | Bacteria | 633 |
| 929 | Ga0587114_082539 | 3300059655 | Bacteria | 600 |
| 930 | Ga0587116_20562 | 3300059656 | Bacteria | 504 |
| 931 | Ga0587071_107742 | 3300060344 | Bacteria | 652 |
| 932 | Ga0501082_0011901 | 3300060353 | Bacteria | 7479 |
| 933 | Ga0501082_0540966 | 3300060353 | Bacteria | 1019 |
| 934 | Ga0501082_1052723 | 3300060353 | Bacteria | 711 |
| 935 | Ga0530510_0805988 | 3300061734 | Bacteria | 717 |
| 936 | 2507508697 | 2507262055 | Bacteria | 8048963 |
| 937 | 2508542791 | 2508501009 | Bacteria | 7784016 |
| 938 | 2509150394 | 2508501128 | Bacteria | 8613869 |
| 939 | 2513623145 | 2513237092 | Bacteria | 8341956 |
| 940 | 2513639090 | 2513237094 | Bacteria | 8789602 |
| 941 | 2513654627 | 2513237096 | Bacteria | 8722461 |
| 942 | 2513680291 | 2513237098 | Bacteria | 9902361 |
| 943 | 2513692409 | 2513237101 | Bacteria | 7952346 |
| 944 | 2513700171 | 2513237102 | Bacteria | 7703324 |
| 945 | 2513860996 | 2513237137 | Bacteria | 9558895 |
| 946 | 2513872665 | 2513237139 | Bacteria | 8737671 |
| 947 | 2513893547 | 2513237141 | Bacteria | 8496279 |
| 948 | 2513915194 | 2513237145 | Bacteria | 8979722 |
| 949 | 2514011958 | 2513237161 | Bacteria | 8871253 |
| 950 | 2517892489 | 2517572143 | Bacteria | 9484767 |
| 951 | 2524440455 | 2524023205 | Bacteria | 8918781 |
| 952 | 2524471317 | 2524023210 | Bacteria | 9029266 |
| 953 | 2524540060 | 2524023228 | Bacteria | 10118060 |
| 954 | 2603859341 | 2602042107 | Bacteria | 6226103 |
| 955 | 2617348909 | 2617270735 | Bacteria | 9163226 |
| 956 | 2617375873 | 2617270741 | Bacteria | 8201522 |
| 957 | 2644288662 | 2643221651 | Bacteria | 4798932 |
| 958 | 2671122400 | 2667528175 | Bacteria | 7532676 |
| 959 | 2723845202 | 2721755755 | Bacteria | 8322773 |
| 960 | 2728751531 | 2728368998 | Bacteria | 8720350 |
| 961 | 2745075276 | 2744054633 | Bacteria | 8678936 |
| 962 | 2793062514 | 2791355196 | Bacteria | 7323613 |
| 963 | 2793068689 | 2791355197 | Bacteria | 8420563 |
| 964 | 2793083589 | |||
| 965 | 2805915437 | 2802429603 | Bacteria | 8777136 |
| 966 | 2818241017 | 2816332527 | Bacteria | 8933356 |
| 967 | 2824603464 | 2824600985 | Bacteria | 8488197 |
| 968 | 2824614743 | 2824609381 | Bacteria | 8672835 |
| 969 | 2824667427 | 2824661429 | Bacteria | 9877870 |
| 970 | 2824675800 | 2824671348 | Bacteria | 8369588 |
| 971 | 2824686293 | 2824679649 | Bacteria | 8248951 |
| 972 | 2824695370 | 2824687955 | Bacteria | 8360029 |
| 973 | 2824703755 | 2824696289 | Bacteria | 8335049 |
| 974 | 2824711988 | 2824704595 | Bacteria | 9667483 |
| 975 | 2824738607 | 2824732956 | Bacteria | 7810675 |
| 976 | 2824751571 | 2824746037 | Bacteria | 7911610 |
| 977 | 2824756878 | 2824753945 | Bacteria | 9787441 |
| 978 | 2824767471 | 2824763712 | Bacteria | 9792355 |
| 979 | 2824777692 | 2824773399 | Bacteria | 8360218 |
| 980 | 2838123861 | 2838122688 | Bacteria | 8803140 |
| 981 | 2841944012 | 2841941048 | Bacteria | 8688029 |
| 982 | 2841949960 | 2841949485 | Bacteria | 8680857 |
| 983 | 2841966379 | 2841966195 | Bacteria | 8673214 |
| 984 | 2841975112 | 2841974524 | Bacteria | 8931498 |
| 985 | 2841983316 | 2841983080 | Bacteria | 8395090 |
| 986 | 2842039180 | 2842038055 | Bacteria | 8002051 |
| 987 | 2842047873 | 2842045827 | Bacteria | 8006841 |
| 988 | 2844318983 | 2844315083 | Bacteria | 8138177 |
| 989 | 2847936106 | 2847930680 | Bacteria | 9342022 |
| 990 | 2847946458 | 2847939898 | Bacteria | 8606328 |
| 991 | 2849079422 | 2849076700 | Bacteria | 7039503 |
| 992 | 2857514429 | 2857509624 | Bacteria | 7472071 |
| 993 | 2857529246 | 2857524615 | Bacteria | 6615449 |
| 994 | 2874593431 | 2874590934 | Bacteria | 8299676 |
| 995 | 2874605084 | 2874604998 | Bacteria | 7834745 |
| 996 | 2874615203 | 2874612657 | Bacteria | 8252029 |
| 997 | 2874627216 | 2874620515 | Bacteria | 8290088 |
| 998 | 2874633295 | 2874628541 | Bacteria | 8630250 |
| 999 | 2874648985 | 2874645413 | Bacteria | 8214782 |
| 1000 | 2876767082 | 2876761206 | Bacteria | 10111113 |
| 1001 | 2876773152 | 2876771140 | Bacteria | 8287509 |
| 1002 | 2876822042 | 2876818435 | Bacteria | 8274608 |
| 1003 | 2879077197 | 2879074833 | Bacteria | 8279565 |
| 1004 | 2879090085 | 2879083081 | Bacteria | 8587928 |
| 1005 | 2879103242 | 2879099564 | Bacteria | 10442239 |
| 1006 | 2879113581 | 2879110137 | Bacteria | 8907982 |
| 1007 | 2879130034 | 2879127579 | Bacteria | 8294491 |
| 1008 | 2879147049 | 2879142872 | Bacteria | 8267021 |
| 1009 | 2881367045 | 2881364244 | Bacteria | 7710352 |
| 1010 | 2881671069 | 2881665667 | Bacteria | 8175609 |
| 1011 | 2885370443 | 2885366525 | Bacteria | 8326213 |
| 1012 | 2885379906 | 2885374607 | Bacteria | 8927485 |
| 1013 | 2885392561 | 2885383462 | Bacteria | 9473874 |
| 1014 | 2885412161 | 2885409591 | Bacteria | 9235467 |
| 1015 | 2888393914 | 2888388044 | Bacteria | 7304136 |
| 1016 | 2888424363 | 2888419890 | Bacteria | 7857137 |
| 1017 | 2889039954 | 2889033259 | Bacteria | 9099371 |
| 1018 | 2893071359 | 2893066018 | Bacteria | 6158120 |
| 1019 | 2903729093 | 2903727486 | Bacteria | 8281579 |
| 1020 | 2903750143 | 2903748898 | Bacteria | 9972761 |
| 1021 | 2903774076 | 2903768456 | Bacteria | 9749579 |
| 1022 | 2904671264 | 2904666416 | Bacteria | 8226587 |
| 1023 | 2904695898 | 2904690495 | Bacteria | 9412302 |
| 1024 | 2904703320 | |||
| 1025 | 2904720631 | 2904711408 | Bacteria | 9771557 |
| 1026 | 2906610138 | 2906602504 | Bacteria | 8295279 |
| 1027 | 2906618530 | |||
| 1028 | 2906634886 | 2906626472 | Bacteria | 8826946 |
| 1029 | 2906638798 | 2906635258 | Bacteria | 8601019 |
| 1030 | 2906650495 | 2906643746 | Bacteria | 8722424 |
| 1031 | 2906664215 | 2906660503 | Bacteria | 8595048 |
| 1032 | 2908742801 | 2908739725 | Bacteria | 8628932 |
| 1033 | 2908761019 | 2908756301 | Bacteria | 8864324 |
| 1034 | 2908780071 | 2908775508 | Bacteria | 8092255 |
| 1035 | 2919076754 | 2919073203 | Bacteria | 6531949 |
| 1036 | 2922365247 | 2922361189 | Bacteria | 7436256 |
| 1037 | 2922390871 | 2922386360 | Bacteria | 7017218 |
| 1038 | 2922396424 | 2922393267 | Bacteria | 8285685 |
| 1039 | 2922430173 | |||
| 1040 | 2929617941 | 2929615660 | Bacteria | 9193770 |
| 1041 | 2929627622 | 2929624759 | Bacteria | 9339455 |
| 1042 | 2932797599 | 2932794094 | Bacteria | 7915132 |
| 1043 | 2932802917 | 2932801729 | Bacteria | 7987968 |
| 1044 | 2932810573 | 2932809354 | Bacteria | 9135765 |
| 1045 | 2932821283 | 2932818245 | Bacteria | 9955613 |
| 1046 | 2933579870 | 2933577622 | Bacteria | 9116884 |
| 1047 | 2935608778 | 2935608549 | Bacteria | 8203142 |
| 1048 | 2935622931 | 2935616580 | Bacteria | 9032984 |
| 1049 | 2935631757 | 2935630451 | Bacteria | 8169952 |
| 1050 | 2935642289 | 2935638405 | Bacteria | 10015038 |
| 1051 | 2935649932 | 2935648319 | Bacteria | 8801166 |
| 1052 | 2935661916 | 2935656913 | Bacteria | 8965014 |
| 1053 | 2935668407 | 2935665750 | Bacteria | 9571747 |
| 1054 | 2935692788 | 2935684952 | Bacteria | 9590419 |
| 1055 | 2935700958 | 2935694250 | Bacteria | 9291695 |
| 1056 | 2935721487 | 2935713505 | Bacteria | 9608509 |
| 1057 | 2935730405 | 2935722832 | Bacteria | 9608746 |
| 1058 | 2935740418 | 2935732158 | Bacteria | 9706831 |
| 1059 | 2935749682 | 2935741537 | Bacteria | 9707219 |
| 1060 | 2935759005 | 2935750917 | Bacteria | 9590372 |
| 1061 | 2935762663 | 2935760218 | Bacteria | 9817913 |
| 1062 | 2935790447 | 2935785616 | Bacteria | 7962367 |
| 1063 | 2935814582 | 2935810662 | Bacteria | 9401221 |
| 1064 | 2935821939 | 2935819856 | Bacteria | 8261050 |
| 1065 | 2935831720 | 2935827899 | Bacteria | 10038562 |
| 1066 | 2935838588 | 2935837841 | Bacteria | 9454360 |
| 1067 | 2935847521 | 2935847175 | Bacteria | 8228321 |
| 1068 | 2935861179 | 2935855204 | Bacteria | 9035059 |
| 1069 | 2935865717 | 2935864058 | Bacteria | 9784707 |
| 1070 | 2935878218 | 2935873716 | Bacteria | 9632195 |
| 1071 | 2935885257 | 2935883170 | Bacteria | 7964738 |
| 1072 | 2935909212 | 2935908558 | Bacteria | 8568796 |
| 1073 | 2935919933 | 2935916978 | Bacteria | 9113783 |
| 1074 | 2935926214 | 2935926038 | Bacteria | 8601059 |
| 1075 | 2935934664 | 2935934488 | Bacteria | 8602579 |
| 1076 | 2935943114 | 2935942939 | Bacteria | 8599779 |
| 1077 | 2935951552 | 2935951376 | Bacteria | 8602333 |
| 1078 | 2935966373 | 2935959822 | Bacteria | 7869783 |
| 1079 | 2935967677 | 2935967501 | Bacteria | 8603075 |
| 1080 | 2935977126 | 2935975950 | Bacteria | 8347125 |
| 1081 | 2935988284 | 2935984226 | Bacteria | 8302647 |
| 1082 | 2935994529 | 2935992306 | Bacteria | 9802711 |
| 1083 | 2936012585 | 2936011229 | Bacteria | 8801034 |
| 1084 | 2936021149 | 2936019824 | Bacteria | 8804134 |
| 1085 | 2936029878 | 2936028420 | Bacteria | 8965941 |
| 1086 | 2936040139 | 2936037263 | Bacteria | 9446081 |
| 1087 | 2936047343 | 2936046547 | Bacteria | 8903709 |
| 1088 | 2936057499 | 2936055302 | Bacteria | 8785755 |
| 1089 | 2940564990 | 2940556831 | Bacteria | 9590747 |
| 1090 | 2941513128 | 2941507105 | Bacteria | 8166816 |
| 1091 | 2941520968 | 2941515067 | Bacteria | 8166720 |
| 1092 | 2941526168 | 2941523033 | Bacteria | 8169134 |
| 1093 | 2941532633 | 2941531003 | Bacteria | 7653939 |
| 1094 | 3005480116 | 3005474847 | Bacteria | 9259049 |
| 1095 | 3005487239 | 3005483717 | Bacteria | 7877331 |
| 1096 | 3005510222 | 3005506211 | Bacteria | 6943378 |
| 1097 | 3005591026 | 3005587118 | Bacteria | 7794411 |
| 1098 | 3005599125 | 3005594810 | Bacteria | 8716512 |
| 1099 | 3005722214 | 3005718088 | Bacteria | 8283608 |
| 1100 | 8006940774 | 8006933436 | Bacteria | 10410654 |
| 1101 | 8006965623 | 8006964411 | Bacteria | 8966052 |
| 1102 | 8006980464 | 8006973647 | Bacteria | 10679141 |
| 1103 | 8006987159 | 8006984368 | Bacteria | 9651211 |
| 1104 | 8006998845 | 8006994254 | Bacteria | 8309700 |
| 1105 | 8016513332 | 8016511872 | Bacteria | 9921665 |
| 1106 | 8016573287 | 8016566248 | Bacteria | 8158151 |
| 1107 | 8016591913 | 8016583857 | Bacteria | 10421953 |
| 1108 | 8016600151 | 8016595262 | Bacteria | 8149947 |
| 1109 | 8016626656 | 8016622563 | Bacteria | 7999408 |
| 1110 | 8016640469 | 8016630954 | Bacteria | 9217207 |
| 1111 | 8019556857 | 8019555841 | Bacteria | 9642137 |
| 1112 | 8019568441 | 8019565922 | Bacteria | 9639779 |
| 1113 | 8019582532 | 8019576017 | Bacteria | 10049540 |
| 1114 | 8019590317 | 8019586578 | Bacteria | 10212056 |
| 1115 | 8019617515 | 8019608314 | Bacteria | 10042931 |
| 1116 | 8019628016 | 8019619141 | Bacteria | 9218857 |
| 1117 | 8019634581 | 8019629233 | Bacteria | 8687553 |
| 1118 | 8019658276 | 8019648815 | Bacteria | 10014479 |
| 1119 | 8019684119 | 8019678201 | Bacteria | 8863603 |
| 1120 | 8019689957 | 8019687851 | Bacteria | 8712826 |
| 1121 | 8055746469 | 8055742211 | Bacteria | 9226248 |
| 1122 | 8056673977 | 8056673599 | Bacteria | 7871253 |
| 1123 | 8056688292 | 8056681323 | Bacteria | 8472857 |
| 1124 | 8056693622 | 8056689827 | Bacteria | 6712655 |
| 1125 | 8056967924 | 8056967851 | Bacteria | 9038162 |
| 1126 | Ga0070709_10013975 | |||
| 1127 | JGI24739J22299_10265156 | |||
| 1128 | JGI24737J22298_10007177 | |||
| 1129 | JGI24735J21928_10021816 | |||
| 1130 | JGI25159J45721_1000007 | |||
| 1131 | JGI25159J45721_1000029 | |||
| 1132 | JGI25151J46595_10018877 | |||
| 1133 | JGI25406J46586_10001302 | |||
| 1134 | JGI25153J46596_10018387 | |||
| 1135 | JGI25160J50197_1000011 | |||
| 1136 | JGI25160J50197_1006480 | |||
| 1137 | JGI25161J50226_1000216 | |||
| 1138 | JGI25404J52841_10036718 | |||
| 1139 | JGI25404J52841_10047623 | |||
| 1140 | Ga0055526_1005205 | |||
| 1141 | Ga0055526_1026200 | |||
| 1142 | Ga0055524_1007493 | |||
| 1143 | Ga0055536_1002370 | |||
| 1144 | Ga0055536_1003841 | |||
| 1145 | Ga0055530_10008423 | |||
| 1146 | Ga0055540_1017856 | |||
| 1147 | Ga0055531_10003918 | |||
| 1148 | Ga0055531_10010017 | |||
| 1149 | Ga0055543_1000097 | |||
| 1150 | Ga0065165_1000018 | |||
| 1151 | Ga0065165_1006114 | |||
| 1152 | Ga0070683_100086618 | |||
| 1153 | Ga0070670_100317512 | |||
| 1154 | Ga0070666_10296382 | |||
| 1155 | Ga0070680_100134714 | |||
| 1156 | Ga0070680_100233158 | |||
| 1157 | Ga0070680_100457672 | |||
| 1158 | Ga0070680_100614802 | |||
| 1159 | Ga0070682_100050796 | |||
| 1160 | Ga0068868_100090406 | |||
| 1161 | Ga0068868_100584682 | |||
| 1162 | Ga0068868_100789440 | |||
| 1163 | Ga0070660_101335422 | |||
| 1164 | Ga0070660_101771716 | |||
| 1165 | Ga0070689_100224870 | |||
| 1166 | Ga0070661_100682955 | |||
| 1167 | Ga0070668_100799538 | |||
| 1168 | Ga0070688_100177171 | |||
| 1169 | Ga0070659_100588479 | |||
| 1170 | Ga0070667_100014040 | |||
| 1171 | Ga0070667_101147052 | |||
| 1172 | Ga0070667_101177856 | |||
| 1173 | Ga0070667_101593195 | |||
| 1174 | Ga0070709_10036155 | |||
| 1175 | Ga0070709_10930759 | |||
| 1176 | Ga0070714_100070886 | |||
| 1177 | Ga0070714_100357446 | |||
| 1178 | Ga0070714_100368719 | |||
| 1179 | Ga0070714_100430673 | |||
| 1180 | Ga0070714_102216250 | |||
| 1181 | Ga0070713_100126037 | |||
| 1182 | Ga0070713_100446876 | |||
| 1183 | Ga0070713_100650378 | |||
| 1184 | Ga0070713_101092651 | |||
| 1185 | Ga0070713_101756953 | |||
| 1186 | Ga0070710_10008697 | |||
| 1187 | Ga0070710_11009654 | |||
| 1188 | Ga0070711_100217726 | |||
| 1189 | Ga0070711_100829210 | |||
| 1190 | Ga0070711_100936653 | |||
| 1191 | Ga0070711_100949118 | |||
| 1192 | Ga0070705_101021384 | |||
| 1193 | Ga0070708_100713002 | |||
| 1194 | Ga0070663_100038698 | |||
| 1195 | Ga0070663_100044651 | |||
| 1196 | Ga0070663_100496174 | |||
| 1197 | Ga0070663_100605851 | |||
| 1198 | Ga0070663_100681197 | |||
| 1199 | Ga0070662_100037275 | |||
| 1200 | Ga0070681_10054789 | |||
| 1201 | Ga0070681_10123870 | |||
| 1202 | Ga0070681_10277245 | |||
| 1203 | Ga0068867_100931651 | |||
| 1204 | Ga0070698_100225801 | |||
| 1205 | Ga0070679_100019797 | |||
| 1206 | Ga0070679_100040249 | |||
| 1207 | Ga0070679_100309866 | |||
| 1208 | Ga0070679_100629649 | |||
| 1209 | Ga0070679_100895711 | |||
| 1210 | Ga0070684_100032692 | |||
| 1211 | Ga0070684_100052818 | |||
| 1212 | Ga0068853_100023838 | |||
| 1213 | Ga0068853_100117847 | |||
| 1214 | Ga0068853_100203167 | |||
| 1215 | Ga0068853_100331330 | |||
| 1216 | Ga0068853_100518724 | |||
| 1217 | Ga0068853_100545830 | |||
| 1218 | Ga0070693_100370721 | |||
| 1219 | Ga0070693_100562711 | |||
| 1220 | Ga0070693_101209744 | |||
| 1221 | Ga0070665_100015427 | |||
| 1222 | Ga0070665_100108612 | |||
| 1223 | Ga0070665_101622027 | |||
| 1224 | Ga0070704_100273775 | |||
| 1225 | Ga0068855_100015588 | |||
| 1226 | Ga0068855_100200086 | |||
| 1227 | Ga0068855_100207510 | |||
| 1228 | Ga0068855_100384785 | |||
| 1229 | Ga0068855_100473803 | |||
| 1230 | Ga0068855_102021046 | |||
| 1231 | Ga0070664_100721245 | |||
| 1232 | Ga0068857_100013583 | |||
| 1233 | Ga0068857_100117100 | |||
| 1234 | Ga0068857_100482474 | |||
| 1235 | Ga0068854_100002817 | |||
| 1236 | Ga0068854_100012868 | |||
| 1237 | Ga0068854_100118788 | |||
| 1238 | Ga0068854_100267225 | |||
| 1239 | Ga0068854_100335700 | |||
| 1240 | Ga0068854_100581537 | |||
| 1241 | Ga0068856_100000659 | |||
| 1242 | Ga0068856_100007731 | |||
| 1243 | Ga0068856_100047734 | |||
| 1244 | Ga0068856_100255467 | |||
| 1245 | Ga0068856_100874862 | |||
| 1246 | Ga0068852_100081387 | |||
| 1247 | Ga0068852_100232220 | |||
| 1248 | Ga0068852_100255930 | |||
| 1249 | Ga0068852_100348366 | |||
| 1250 | Ga0068859_100344401 | |||
| 1251 | Ga0068859_101529885 | |||
| 1252 | Ga0068864_100080912 | |||
| 1253 | Ga0068864_100359500 | |||
| 1254 | Ga0068851_10002097 | |||
| 1255 | Ga0068870_10302094 | |||
| 1256 | Ga0068863_100339798 | |||
| 1257 | Ga0068858_100225906 | |||
| 1258 | Ga0068858_100491846 | |||
| 1259 | Ga0068858_100573985 | |||
| 1260 | Ga0068860_100667726 | |||
| 1261 | Ga0081455_10011962 | |||
| 1262 | Ga0081538_10162929 | |||
| 1263 | Ga0081540_1014445 | |||
| 1264 | Ga0081540_1115459 | |||
| 1265 | Ga0081539_10000498 | |||
| 1266 | Ga0070717_10007074 | |||
| 1267 | Ga0070717_10553507 | |||
| 1268 | Ga0075365_10050758 | |||
| 1269 | Ga0075365_10250515 | |||
| 1270 | Ga0075365_10327648 | |||
| 1271 | Ga0075365_10439413 | |||
| 1272 | Ga0075368_10001670 | |||
| 1273 | Ga0075363_100058730 | |||
| 1274 | Ga0075364_10026333 | |||
| 1275 | Ga0070716_100752771 | |||
| 1276 | Ga0070712_100007041 | |||
| 1277 | Ga0075362_10564634 | |||
| 1278 | Ga0075367_10089995 | |||
| 1279 | Ga0075369_10010854 | |||
| 1280 | Ga0075369_10156210 | |||
| 1281 | Ga0075369_10423023 | |||
| 1282 | Ga0075369_10553296 | |||
| 1283 | Ga0075366_10593467 | |||
| 1284 | Ga0097621_100418861 | |||
| 1285 | Ga0075370_10224125 | |||
| 1286 | Ga0075370_10654062 | |||
| 1287 | Ga0068871_100152457 | |||
| 1288 | Ga0075433_10561517 | |||
| 1289 | Ga0068865_100972715 | |||
| 1290 | Ga0075436_100368086 | |||
| 1291 | Ga0097620_100344346 | |||
| 1292 | Ga0097620_101529921 | |||
| 1293 | Ga0097620_101739697 | |||
| 1294 | Ga0099824_1018671 | |||
| 1295 | Ga0099822_1085678 | |||
| 1296 | Ga0075435_101358153 | |||
| 1297 | Ga0105250_10116539 | |||
| 1298 | Ga0105240_10010574 | |||
| 1299 | Ga0105240_10074576 | |||
| 1300 | Ga0105240_10125972 | |||
| 1301 | Ga0105245_11378707 | |||
| 1302 | Ga0105247_10023505 | |||
| 1303 | Ga0105243_11021716 | |||
| 1304 | Ga0105241_10000375 | |||
| 1305 | Ga0105241_12641154 | |||
| 1306 | Ga0105248_10212421 | |||
| 1307 | Ga0105248_10699022 | |||
| 1308 | Ga0105237_10199631 | |||
| 1309 | Ga0105237_10203768 | |||
| 1310 | Ga0105237_10836244 | |||
| 1311 | Ga0105238_10000885 | |||
| 1312 | Ga0105238_10027088 | |||
| 1313 | Ga0105238_10694286 | |||
| 1314 | Ga0105238_12916316 | |||
| 1315 | Ga0105249_10100272 | |||
| 1316 | Ga0105249_10202676 | |||
| 1317 | Ga0099796_10102656 | |||
| 1318 | Ga0099796_10343318 | |||
| 1319 | Ga0105239_10001513 | |||
| 1320 | Ga0105239_10018938 | |||
| 1321 | Ga0105239_10097922 | |||
| 1322 | Ga0105246_10259029 | |||
| 1323 | Ga0157323_1014765 | |||
| 1324 | Ga0157371_10579161 | |||
| 1325 | Ga0157371_11175858 | |||
| 1326 | Ga0157370_10169703 | |||
| 1327 | Ga0157369_10084470 | |||
| 1328 | Ga0157369_11181818 | |||
| 1329 | Ga0163162_11121526 | |||
| 1330 | Ga0157372_10495545 | |||
| 1331 | Ga0157372_10775031 | |||
| 1332 | Ga0157372_11071155 | |||
| 1333 | Ga0163163_10370162 | |||
| 1334 | Ga0163163_10912428 | |||
| 1335 | Ga0163163_11472692 | |||
| 1336 | Ga0157380_10381281 | |||
| 1337 | Ga0182005_1001790 | |||
| 1338 | Ga0183363_1171 | |||
| 1339 | Ga0184599_129808 | |||
| 1340 | Ga0184599_137827 | |||
| 1341 | Ga0197907_10918224 | |||
| 1342 | Ga0197907_11069188 | |||
| 1343 | Ga0206356_10243979 | |||
| 1344 | Ga0206356_11658491 | |||
| 1345 | Ga0206349_1643817 | |||
| 1346 | Ga0206350_10271235 | |||
| 1347 | Ga0206350_10345676 | |||
| 1348 | Ga0206350_10615424 | |||
| 1349 | Ga0206350_10979557 | |||
| 1350 | Ga0206350_11186857 | |||
| 1351 | Ga0206354_11128885 | |||
| 1352 | Ga0154015_1041367 | |||
| 1353 | Ga0214542_1000245 | |||
| 1354 | Ga0214543_1000010 | |||
| 1355 | Ga0213873_10059434 | |||
| 1356 | Ga0213872_10026306 | |||
| 1357 | Ga0213876_10149803 | |||
| 1358 | Ga0213876_10242375 | |||
| 1359 | Ga0213875_10074112 | |||
| 1360 | Ga0224712_10001061 | |||
| 1361 | Ga0224712_10041597 | |||
| 1362 | Ga0224712_10043244 | |||
| 1363 | Ga0224712_10246506 | |||
| 1364 | Ga0209436_102029 | |||
| 1365 | Ga0209563_129377 | |||
| 1366 | Ga0207425_1005747 | |||
| 1367 | Ga0209677_100491 | |||
| 1368 | Ga0209148_1010479 | |||
| 1369 | Ga0209148_1014504 | |||
| 1370 | Ga0209233_1002729 | |||
| 1371 | Ga0209233_1039459 | |||
| 1372 | Ga0209233_1089514 | |||
| 1373 | Ga0209565_1017569 | |||
| 1374 | Ga0209455_1011918 | |||
| 1375 | Ga0209455_1012087 | |||
| 1376 | Ga0209130_1000029 | |||
| 1377 | Ga0209676_1001711 | |||
| 1378 | Ga0209025_1000033 | |||
| 1379 | Ga0209025_1047665 | |||
| 1380 | Ga0209564_1000275 | |||
| 1381 | Ga0209564_1001009 | |||
| 1382 | Ga0209564_1013153 | |||
| 1383 | Ga0209564_1014089 | |||
| 1384 | Ga0209758_1000021 | |||
| 1385 | Ga0209758_1002371 | |||
| 1386 | Ga0209758_1004125 | |||
| 1387 | Ga0209758_1026461 | |||
| 1388 | Ga0209050_1001363 | |||
| 1389 | Ga0209256_1000644 | |||
| 1390 | Ga0209256_1000649 | |||
| 1391 | Ga0209256_1005320 | |||
| 1392 | Ga0207426_1000074 | |||
| 1393 | Ga0209051_1004342 | |||
| 1394 | Ga0209051_1105889 | |||
| 1395 | Ga0209257_1002758 | |||
| 1396 | Ga0209257_1003043 | |||
| 1397 | Ga0207656_10025839 | |||
| 1398 | Ga0207696_1096228 | |||
| 1399 | Ga0207692_10038277 | |||
| 1400 | Ga0207692_10256932 | |||
| 1401 | Ga0207642_10269973 | |||
| 1402 | Ga0207642_10548907 | |||
| 1403 | Ga0207710_10023976 | |||
| 1404 | Ga0207710_10149886 | |||
| 1405 | Ga0207688_10024365 | |||
| 1406 | Ga0207688_10127773 | |||
| 1407 | Ga0207680_10371677 | |||
| 1408 | Ga0207680_10421829 | |||
| 1409 | Ga0207647_10003194 | |||
| 1410 | Ga0207647_10206434 | |||
| 1411 | Ga0207647_10301293 | |||
| 1412 | Ga0207685_10162137 | |||
| 1413 | Ga0207685_10225347 | |||
| 1414 | Ga0207699_10018049 | |||
| 1415 | Ga0207699_10306057 | |||
| 1416 | Ga0207699_10478814 | |||
| 1417 | Ga0207645_10119113 | |||
| 1418 | Ga0207645_10218071 | |||
| 1419 | Ga0207643_10057384 | |||
| 1420 | Ga0207654_10000337 | |||
| 1421 | Ga0207654_10020336 | |||
| 1422 | Ga0207654_10143688 | |||
| 1423 | Ga0207654_10167185 | |||
| 1424 | Ga0207654_10206733 | |||
| 1425 | Ga0207707_10014349 | |||
| 1426 | Ga0207707_10030625 | |||
| 1427 | Ga0207695_10001265 | |||
| 1428 | Ga0207695_10060233 | |||
| 1429 | Ga0207695_10093574 | |||
| 1430 | Ga0207695_10488778 | |||
| 1431 | Ga0207695_10925688 | |||
| 1432 | Ga0207671_10047805 | |||
| 1433 | Ga0207671_10092021 | |||
| 1434 | Ga0207671_10340355 | |||
| 1435 | Ga0207671_10530432 | |||
| 1436 | Ga0207693_10002749 | |||
| 1437 | Ga0207693_10047117 | |||
| 1438 | Ga0207693_10202439 | |||
| 1439 | Ga0207663_10170719 | |||
| 1440 | Ga0207663_10397525 | |||
| 1441 | Ga0207660_10068701 | |||
| 1442 | Ga0207662_10267787 | |||
| 1443 | Ga0207657_10133010 | |||
| 1444 | Ga0207657_10743917 | |||
| 1445 | Ga0207649_11078103 | |||
| 1446 | Ga0207652_10066046 | |||
| 1447 | Ga0207652_10099998 | |||
| 1448 | Ga0207652_10161134 | |||
| 1449 | Ga0207652_11012796 | |||
| 1450 | Ga0207646_10627600 | |||
| 1451 | Ga0207681_10096096 | |||
| 1452 | Ga0207681_10200972 | |||
| 1453 | Ga0207681_10468845 | |||
| 1454 | Ga0207681_11186071 | |||
| 1455 | Ga0207694_10000082 | |||
| 1456 | Ga0207694_10025462 | |||
| 1457 | Ga0207694_10047802 | |||
| 1458 | Ga0207694_10215388 | |||
| 1459 | Ga0207694_10474639 | |||
| 1460 | Ga0207659_11665056 | |||
| 1461 | Ga0207687_10048842 | |||
| 1462 | Ga0207687_10181596 | |||
| 1463 | Ga0207687_11005285 | |||
| 1464 | Ga0207700_10108198 | |||
| 1465 | Ga0207700_10504726 | |||
| 1466 | Ga0207700_10729739 | |||
| 1467 | Ga0207700_11250130 | |||
| 1468 | Ga0207664_10291185 | |||
| 1469 | Ga0207664_10481382 | |||
| 1470 | Ga0207644_10568832 | |||
| 1471 | Ga0207644_11014796 | |||
| 1472 | Ga0207644_11614350 | |||
| 1473 | Ga0207690_11018315 | |||
| 1474 | Ga0207706_10033220 | |||
| 1475 | Ga0207706_10077110 | |||
| 1476 | Ga0207686_10220806 | |||
| 1477 | Ga0207686_10563242 | |||
| 1478 | Ga0207709_10027283 | |||
| 1479 | Ga0207709_10056403 | |||
| 1480 | Ga0207709_10848091 | |||
| 1481 | Ga0207670_10247598 | |||
| 1482 | Ga0207670_10664949 | |||
| 1483 | Ga0207669_10022164 | |||
| 1484 | Ga0207704_10033275 | |||
| 1485 | Ga0207704_10723084 | |||
| 1486 | Ga0207704_10987374 | |||
| 1487 | Ga0207704_11262354 | |||
| 1488 | Ga0207665_10274006 | |||
| 1489 | Ga0207711_10176305 | |||
| 1490 | Ga0207711_10888847 | |||
| 1491 | Ga0207689_10023824 | |||
| 1492 | Ga0207689_10084589 | |||
| 1493 | Ga0207689_10439096 | |||
| 1494 | Ga0207661_10203397 | |||
| 1495 | Ga0207661_10421493 | |||
| 1496 | Ga0207661_10956085 | |||
| 1497 | Ga0207679_10441242 | |||
| 1498 | Ga0207679_10927250 | |||
| 1499 | Ga0207679_11208577 | |||
| 1500 | Ga0207667_10005368 | |||
| 1501 | Ga0207667_10011709 | |||
| 1502 | Ga0207667_10135740 | |||
| 1503 | Ga0207667_10414553 | |||
| 1504 | Ga0207712_10097880 | |||
| 1505 | Ga0207668_10451133 | |||
| 1506 | Ga0207668_10728258 | |||
| 1507 | Ga0207668_11718211 | |||
| 1508 | Ga0207640_10007135 | |||
| 1509 | Ga0207640_10037459 | |||
| 1510 | Ga0207640_10072736 | |||
| 1511 | Ga0207640_10467368 | |||
| 1512 | Ga0207640_10538385 | |||
| 1513 | Ga0207640_11612443 | |||
| 1514 | Ga0207640_11957738 | |||
| 1515 | Ga0207658_10896742 | |||
| 1516 | Ga0207658_10934217 | |||
| 1517 | Ga0207677_10161885 | |||
| 1518 | Ga0207677_10409634 | |||
| 1519 | Ga0207703_10114094 | |||
| 1520 | Ga0207703_10754280 | |||
| 1521 | Ga0207703_11067296 | |||
| 1522 | Ga0207703_12264017 | |||
| 1523 | Ga0207639_10007126 | |||
| 1524 | Ga0207639_10206574 | |||
| 1525 | Ga0207639_10327429 | |||
| 1526 | Ga0207639_10344424 | |||
| 1527 | Ga0207639_10435820 | |||
| 1528 | Ga0207639_10916873 | |||
| 1529 | Ga0207678_10009455 | |||
| 1530 | Ga0207678_10030378 | |||
| 1531 | Ga0207678_10058059 | |||
| 1532 | Ga0207678_10158502 | |||
| 1533 | Ga0207678_10267287 | |||
| 1534 | Ga0207678_10486269 | |||
| 1535 | Ga0207678_10562573 | |||
| 1536 | Ga0207708_10371320 | |||
| 1537 | Ga0207702_10000002 | |||
| 1538 | Ga0207702_10000442 | |||
| 1539 | Ga0207702_10005388 | |||
| 1540 | Ga0207702_10158985 | |||
| 1541 | Ga0207702_10229496 | |||
| 1542 | Ga0207702_11321156 | |||
| 1543 | Ga0207641_10205256 | |||
| 1544 | Ga0207648_10068374 | |||
| 1545 | Ga0207676_10252097 | |||
| 1546 | Ga0207676_10328080 | |||
| 1547 | Ga0207674_10001614 | |||
| 1548 | Ga0207674_10053911 | |||
| 1549 | Ga0207674_10054460 | |||
| 1550 | Ga0207674_12182887 | |||
| 1551 | Ga0207675_100133711 | |||
| 1552 | Ga0207683_10319485 | |||
| 1553 | Ga0207683_10401739 | |||
| 1554 | Ga0207683_10722074 | |||
| 1555 | Ga0207698_10029731 | |||
| 1556 | Ga0207698_10075798 | |||
| 1557 | Ga0207698_10168267 | |||
| 1558 | Ga0207698_11272540 | |||
| 1559 | Ga0209389_1000445 | |||
| 1560 | Ga0209589_1000003 | |||
| 1561 | Ga0209589_1000514 | |||
| 1562 | Ga0209489_100003 | |||
| 1563 | Ga0209700_100003 | |||
| 1564 | Ga0209813_10083040 | |||
| 1565 | Ga0268266_10060568 | |||
| 1566 | Ga0268266_10134066 | |||
| 1567 | Ga0268266_10450261 | |||
| 1568 | Ga0268266_10634657 | |||
| 1569 | Ga0268265_10155880 | |||
| 1570 | Ga0268265_10188803 | |||
| 1571 | Ga0268265_10191307 | |||
| 1572 | Ga0268264_10212848 | |||
| 1573 | Ga0268264_10239966 | |||
| 1574 | Ga0268264_10407607 | |||
| 1575 | Ga0268264_10834651 | |||
| 1576 | Ga0265337_1005726 | |||
| 1577 | Ga0265326_10001798 | |||
| 1578 | Ga0265319_1005521 | |||
| 1579 | Ga0265334_10002109 | |||
| 1580 | Ga0265334_10030164 | |||
| 1581 | Ga0265318_10018005 | |||
| 1582 | Ga0265323_10003106 | |||
| 1583 | Ga0265322_10013091 | |||
| 1584 | Ga0265336_10000765 | |||
| 1585 | Ga0307515_10000198 | |||
| 1586 | Ga0307515_10188224 | |||
| 1587 | Ga0265338_10001398 | |||
| 1588 | Ga0265324_10004472 | |||
| 1589 | Ga0265340_10150688 | |||
| 1590 | Ga0265339_10018141 | |||
| 1591 | Ga0265331_10048861 | |||
| 1592 | Ga0307513_10006546 | |||
| 1593 | Ga0307408_100965537 | |||
| 1594 | Ga0307508_10279508 | |||
| 1595 | Ga0265314_10013455 | |||
| 1596 | Ga0265342_10003387 | |||
| 1597 | Ga0307516_10058125 | |||
| 1598 | Ga0307516_10297926 | |||
| 1599 | Ga0316044_114609 | |||
| 1600 | Ga0307406_10822393 | |||
| 1601 | Ga0307407_11115557 | |||
| 1602 | Ga0307412_10266323 | |||
| 1603 | Ga0315911_1000001 | |||
| 1604 | Ga0373950_0039160 | |||
| 1605 | Ga0373952_0197686 | |||
| 1606 | Ga0373953_0022877 | |||
| 1607 | Ga0373954_0025410 | |||
| 1608 | Ga0373957_0021546 | |||
| 1609 | Ga0373943_0070873 | |||
| 1610 | Ga0373946_0518987 | |||
| 1611 | Ga0373924_0084043 | |||
| 1612 | Ga0373935_0463742 | |||
| 1613 | Ga0373927_0194919 | |||
| 1614 | Ga0373933_0075677 | |||
| 1615 | Ga0373947_0309666 | |||
| 1616 | Ga0373937_0296866 | |||
| 1617 | Ga0316582_0191602 | |||
| 1618 | Ga0395899_0000059 | |||
| 1619 | Ga0395900_0000017 | |||
| 1620 | Ga0395900_0797231 | |||
| 1621 | Ga0395900_1472613 | |||
| 1622 | Ga0395898_0000030 | |||
| 1623 | Ga0395898_0092749 | |||
| 1624 | Ga0395905_0000056 | |||
| 1625 | Ga0395905_0032237 | |||
| 1626 | Ga0395905_0120425 | |||
| 1627 | Ga0436364_0011267 | |||
| 1628 | Ga0436364_0223577 | |||
| 1629 | Ga0436364_0836584 | |||
| 1630 | Ga0395901_0000015 | |||
| 1631 | Ga0395901_1330146 | |||
| 1632 | Ga0436365_0188153 | |||
| 1633 | Ga0436365_1034663 | |||
| 1634 | Ga0436365_1530142 | |||
| 1635 | Ga0436365_1689582 | |||
| 1636 | Ga0436365_1721433 | |||
| 1637 | Ga0436365_1792102 | |||
| 1638 | Ga0436361_0389690 | |||
| 1639 | Ga0436361_0393557 | |||
| 1640 | Ga0436363_1282227 | |||
| 1641 | Ga0451791_0347348 | |||
| 1642 | Ga0451800_0052594 | |||
| 1643 | Ga0439434_0222684 | |||
| 1644 | Ga0466969_0016125 | |||
| 1645 | Ga0466969_0272834 | |||
| 1646 | Ga0466969_0283938 | |||
| 1647 | Ga0466972_0006610 | |||
| 1648 | Ga0466965_0207394 | |||
| 1649 | Ga0466965_0704471 | |||
| 1650 | Ga0466966_0284386 | |||
| 1651 | Ga0466961_0477939 | |||
| 1652 | Ga0466963_0160928 | |||
| 1653 | Ga0466971_0045342 | |||
| 1654 | Ga0466968_0161364 | |||
| 1655 | Ga0466968_0413420 | |||
| 1656 | Ga0466968_0608198 | |||
| 1657 | Ga0466968_0654954 | |||
| 1658 | Ga0466970_0155949 | |||
| 1659 | Ga0466957_0559766 | |||
| 1660 | Ga0466959_0016249 | |||
| 1661 | Ga0466959_0030669 | |||
| 1662 | Ga0466959_0207675 | |||
| 1663 | Ga0466959_0478394 | |||
| 1664 | Ga0466959_0745770 | |||
| 1665 | Ga0466958_1043632 | |||
| 1666 | Ga0466967_0066166 | |||
| 1667 | Ga0466967_0136069 | |||
| 1668 | Ga0466967_0280234 | |||
| 1669 | Ga0495627_208489 | |||
| 1670 | Ga0495603_0080240 | |||
| 1671 | Ga0495603_0101515 | |||
| 1672 | Ga0495603_0833492 | |||
| 1673 | Ga0495651_0049749 | |||
| 1674 | Ga0495653_0037072 | |||
| 1675 | Ga0495653_0278818 | |||
| 1676 | Ga0495580_0119656 | |||
| 1677 | Ga0495580_0991449 | |||
| 1678 | Ga0495582_0510710 | |||
| 1679 | Ga0495639_0059158 | |||
| 1680 | Ga0495585_0055312 | |||
| 1681 | Ga0495594_0090670 | |||
| 1682 | Ga0495594_0139606 | |||
| 1683 | Ga0495607_0028013 | |||
| 1684 | Ga0495608_0047322 | |||
| 1685 | Ga0495616_0267572 | |||
| 1686 | Ga0495618_0120870 | |||
| 1687 | Ga0495630_0027840 | |||
| 1688 | Ga0495630_0411849 | |||
| 1689 | Ga0495632_0173159 | |||
| 1690 | Ga0495637_0119905 | |||
| 1691 | Ga0495643_0148033 | |||
| 1692 | Ga0495663_0365409 | |||
| 1693 | Ga0495652_0028933 | |||
| 1694 | Ga0495665_0445599 | |||
| 1695 | Ga0495587_0023026 | |||
| 1696 | Ga0495598_0032556 | |||
| 1697 | Ga0495597_0094850 | |||
| 1698 | Ga0495622_0186161 | |||
| 1699 | Ga0495667_0029419 | |||
| 1700 | Ga0495656_0154924 | |||
| 1701 | Ga0495668_0057814 | |||
| 1702 | Ga0495668_0099147 | |||
| 1703 | Ga0495661_0412218 | |||
| 1704 | Ga0495588_0282226 | |||
| 1705 | Ga0495588_0567180 | |||
| 1706 | Ga0495657_0209589 | |||
| 1707 | Ga0495599_0085566 | |||
| 1708 | Ga0495623_0020900 | |||
| 1709 | Ga0495658_0256442 | |||
| 1710 | Ga0495669_0236885 | |||
| 1711 | Ga0495624_0838855 | |||
| 1712 | Ga0495670_0080717 | |||
| 1713 | Ga0495671_0016535 | |||
| 1714 | Ga0495581_0360247 | |||
| 1715 | Ga0495604_0023604 | |||
| 1716 | Ga0495604_0757227 | |||
| 1717 | Ga0495672_0541618 | |||
| 1718 | Ga0495676_0021656 | |||
| 1719 | Ga0495680_0047093 | |||
| 1720 | Ga0495687_007256 | |||
| 1721 | Ga0495675_0059711 | |||
| 1722 | Ga0495677_0070733 | |||
| 1723 | Ga0495673_0239560 | |||
| 1724 | Ga0495681_0059701 | |||
| 1725 | Ga0495686_0081318 | |||
| 1726 | Ga0495686_0347204 | |||
| 1727 | Ga0495602_0381519 | |||
| 1728 | Ga0495626_0093493 | |||
| 1729 | Ga0495626_0407025 | |||
| 1730 | Ga0496100_0053461 | |||
| 1731 | Ga0496100_0140001 | |||
| 1732 | Ga0496101_0054703 | |||
| 1733 | Ga0496101_0453101 | |||
| 1734 | Ga0496101_0588899 | |||
| 1735 | Ga0496102_0004466 | |||
| 1736 | Ga0496102_0257729 | |||
| 1737 | Ga0496103_0222176 | |||
| 1738 | Ga0496105_0018366 | |||
| 1739 | Ga0496105_0170799 | |||
| 1740 | Ga0496105_0473379 | |||
| 1741 | Ga0496105_1135701 | |||
| 1742 | Ga0496106_0245270 | |||
| 1743 | Ga0496108_1356615 | |||
| 1744 | Ga0496109_0130302 | |||
| 1745 | Ga0496109_0367193 | |||
| 1746 | Ga0496110_0135466 | |||
| 1747 | Ga0496110_0169841 | |||
| 1748 | Ga0496110_0208480 | |||
| 1749 | Ga0496110_0793344 | |||
| 1750 | Ga0496111_0189975 | |||
| 1751 | Ga0496111_0220626 | |||
| 1752 | Ga0496112_0066511 | |||
| 1753 | Ga0496112_0621399 | |||
| 1754 | Ga0496112_0708443 | |||
| 1755 | Ga0496113_0005243 | |||
| 1756 | Ga0496113_0259845 | |||
| 1757 | Ga0496113_1108711 | |||
| 1758 | Ga0496114_0300994 | |||
| 1759 | Ga0496114_0942637 | |||
| 1760 | Ga0496115_0009418 | |||
| 1761 | Ga0496115_0553371 | |||
| 1762 | Ga0496116_0105066 | |||
| 1763 | Ga0496117_0034246 | |||
| 1764 | Ga0496117_0077642 | |||
| 1765 | Ga0496117_0172333 | |||
| 1766 | Ga0496118_0026583 | |||
| 1767 | Ga0496118_0041896 | |||
| 1768 | Ga0496118_0090739 | |||
| 1769 | Ga0496118_0294961 | |||
| 1770 | Ga0496119_0239808 | |||
| 1771 | Ga0496120_0092251 | |||
| 1772 | Ga0496120_0171153 | |||
| 1773 | Ga0496121_0003672 | |||
| 1774 | Ga0496121_0070646 | |||
| 1775 | Ga0496121_0087661 | |||
| 1776 | Ga0496121_0129036 | |||
| 1777 | Ga0496121_0346783 | |||
| 1778 | Ga0496121_0651291 | |||
| 1779 | Ga0496122_0101863 | |||
| 1780 | Ga0496123_0088944 | |||
| 1781 | Ga0496124_0300048 | |||
| 1782 | Ga0496125_0000090 | |||
| 1783 | Ga0496125_0001219 | |||
| 1784 | Ga0496125_0043512 | |||
| 1785 | Ga0496125_0055311 | |||
| 1786 | Ga0496125_0076314 | |||
| 1787 | Ga0496125_0709333 | |||
| 1788 | Ga0496126_0013869 | |||
| 1789 | Ga0496126_0023395 | |||
| 1790 | Ga0496126_0028110 | |||
| 1791 | Ga0496126_0060139 | |||
| 1792 | Ga0496126_0137332 | |||
| 1793 | Ga0496126_0207038 | |||
| 1794 | Ga0496126_0260728 | |||
| 1795 | Ga0496126_0528628 | |||
| 1796 | Ga0496126_0946543 | |||
| 1797 | Ga0496126_0960951 | |||
| 1798 | Ga0495682_0243303 | |||
| 1799 | Ga0501031_0000442 | |||
| 1800 | Ga0501031_0014148 | |||
| 1801 | Ga0501031_0021697 | |||
| 1802 | Ga0501031_0102498 | |||
| 1803 | Ga0501031_0218862 | |||
| 1804 | Ga0501031_0275537 | |||
| 1805 | Ga0501031_0358115 | |||
| 1806 | Ga0501032_0000031 | |||
| 1807 | Ga0501032_0000773 | |||
| 1808 | Ga0501032_0006279 | |||
| 1809 | Ga0501032_0023195 | |||
| 1810 | Ga0501032_0068001 | |||
| 1811 | Ga0501032_0102250 | |||
| 1812 | Ga0501032_0204503 | |||
| 1813 | Ga0501033_0000126 | |||
| 1814 | Ga0501033_0005198 | |||
| 1815 | Ga0501033_0009424 | |||
| 1816 | Ga0501033_0014639 | |||
| 1817 | Ga0501033_0033905 | |||
| 1818 | Ga0501033_0043543 | |||
| 1819 | Ga0501033_0044422 | |||
| 1820 | Ga0501033_0136117 | |||
| 1821 | Ga0501033_0141567 | |||
| 1822 | Ga0501033_0823751 | |||
| 1823 | Ga0501034_0000021 | |||
| 1824 | Ga0501034_0000064 | |||
| 1825 | Ga0501034_0059763 | |||
| 1826 | Ga0501034_0113529 | |||
| 1827 | Ga0501034_0186446 | |||
| 1828 | Ga0501034_0256592 | |||
| 1829 | Ga0501034_0490434 | |||
| 1830 | Ga0501036_0000069 | |||
| 1831 | Ga0501036_0005749 | |||
| 1832 | Ga0501036_0189772 | |||
| 1833 | Ga0501036_0328858 | |||
| 1834 | Ga0501036_0930287 | |||
| 1835 | Ga0501037_0000034 | |||
| 1836 | Ga0501037_0000616 | |||
| 1837 | Ga0501037_0005524 | |||
| 1838 | Ga0501037_0025364 | |||
| 1839 | Ga0501037_0095767 | |||
| 1840 | Ga0501037_0800436 | |||
| 1841 | Ga0501038_0000205 | |||
| 1842 | Ga0501038_0000537 | |||
| 1843 | Ga0501038_0037431 | |||
| 1844 | Ga0501038_0049398 | |||
| 1845 | Ga0501038_0200018 | |||
| 1846 | Ga0501038_0227550 | |||
| 1847 | Ga0501038_0307720 | |||
| 1848 | Ga0501038_0600137 | |||
| 1849 | Ga0501038_0895858 | |||
| 1850 | Ga0501039_0000198 | |||
| 1851 | Ga0501039_0002792 | |||
| 1852 | Ga0501039_0830048 | |||
| 1853 | Ga0501039_1077254 | |||
| 1854 | Ga0501040_0156581 | |||
| 1855 | Ga0501040_0622376 | |||
| 1856 | Ga0501041_0478332 | |||
| 1857 | Ga0501042_0074198 | |||
| 1858 | Ga0501043_0000015 | |||
| 1859 | Ga0501043_0000107 | |||
| 1860 | Ga0501043_0001044 | |||
| 1861 | Ga0501043_0016446 | |||
| 1862 | Ga0501043_0021518 | |||
| 1863 | Ga0501043_0068674 | |||
| 1864 | Ga0501043_0174701 | |||
| 1865 | Ga0501043_0624827 | |||
| 1866 | Ga0501043_0728933 | |||
| 1867 | Ga0501046_0003594 | |||
| 1868 | Ga0501046_0011039 | |||
| 1869 | Ga0501046_0095285 | |||
| 1870 | Ga0501046_0097356 | |||
| 1871 | Ga0501046_1082929 | |||
| 1872 | Ga0501047_0000587 | |||
| 1873 | Ga0501047_0020996 | |||
| 1874 | Ga0501047_0068073 | |||
| 1875 | Ga0501047_0100525 | |||
| 1876 | Ga0501047_0242842 | |||
| 1877 | Ga0501048_0001731 | |||
| 1878 | Ga0501048_0059277 | |||
| 1879 | Ga0501067_0000331 | |||
| 1880 | Ga0501067_0047655 | |||
| 1881 | Ga0501067_0203767 | |||
| 1882 | Ga0501068_0000039 | |||
| 1883 | Ga0501068_0716273 | |||
| 1884 | Ga0501068_1007242 | |||
| 1885 | Ga0501069_0000039 | |||
| 1886 | Ga0501069_0013970 | |||
| 1887 | Ga0501069_0019200 | |||
| 1888 | Ga0501069_0039180 | |||
| 1889 | Ga0501070_0000132 | |||
| 1890 | Ga0501070_0000299 | |||
| 1891 | Ga0501070_0002117 | |||
| 1892 | Ga0501070_0007344 | |||
| 1893 | Ga0501070_0036765 | |||
| 1894 | Ga0501070_0070851 | |||
| 1895 | Ga0501070_0078238 | |||
| 1896 | Ga0501070_0233142 | |||
| 1897 | Ga0501070_0690937 | |||
| 1898 | Ga0501070_1035658 | |||
| 1899 | Ga0501071_0165148 | |||
| 1900 | Ga0501071_0302093 | |||
| 1901 | Ga0501071_0845836 | |||
| 1902 | Ga0501071_1326758 | |||
| 1903 | Ga0501072_0014578 | |||
| 1904 | Ga0501072_0469800 | |||
| 1905 | Ga0501072_1406849 | |||
| 1906 | Ga0501073_0000144 | |||
| 1907 | Ga0501073_0048839 | |||
| 1908 | Ga0501073_0367399 | |||
| 1909 | Ga0501073_0695776 | |||
| 1910 | Ga0501074_0001123 | |||
| 1911 | Ga0501074_0005397 | |||
| 1912 | Ga0501074_0010236 | |||
| 1913 | Ga0501074_0089756 | |||
| 1914 | Ga0501074_0108152 | |||
| 1915 | Ga0501074_1029684 | |||
| 1916 | Ga0501076_0173360 | |||
| 1917 | Ga0501077_1026456 | |||
| 1918 | Ga0501079_0004404 | |||
| 1919 | Ga0501079_0206606 | |||
| 1920 | Ga0501080_0001145 | |||
| 1921 | Ga0501080_0001676 | |||
| 1922 | Ga0501080_0003023 | |||
| 1923 | Ga0501080_0004511 | |||
| 1924 | Ga0501080_0097918 | |||
| 1925 | Ga0501080_0260497 | |||
| 1926 | Ga0501080_0569745 | |||
| 1927 | Ga0501080_1184114 | |||
| 1928 | Ga0501081_1253969 | |||
| 1929 | Ga0501081_1545901 | |||
| 1930 | Ga0501083_0002416 | |||
| 1931 | Ga0501083_0003750 | |||
| 1932 | Ga0501083_0390073 | |||
| 1933 | Ga0501035_0000055 | |||
| 1934 | Ga0501035_0000436 | |||
| 1935 | Ga0501035_0000807 | |||
| 1936 | Ga0501035_0000865 | |||
| 1937 | Ga0501035_0013030 | |||
| 1938 | Ga0501035_0022239 | |||
| 1939 | Ga0501035_0040528 | |||
| 1940 | Ga0501035_0167350 | |||
| 1941 | Ga0501035_0203988 | |||
| 1942 | Ga0501035_0242553 | |||
| 1943 | Ga0501035_1181097 | |||
| 1944 | Ga0501044_0000028 | |||
| 1945 | Ga0501044_0000071 | |||
| 1946 | Ga0501044_0030397 | |||
| 1947 | Ga0501044_0030832 | |||
| 1948 | Ga0501044_0052011 | |||
| 1949 | Ga0501044_0053864 | |||
| 1950 | Ga0501044_0070576 | |||
| 1951 | Ga0501044_0070897 | |||
| 1952 | Ga0501044_0086235 | |||
| 1953 | Ga0501044_0122650 | |||
| 1954 | Ga0501044_0125897 | |||
| 1955 | Ga0501044_0534274 | |||
| 1956 | Ga0501044_0704296 | |||
| 1957 | Ga0501044_0718589 | |||
| 1958 | Ga0501044_0795012 | |||
| 1959 | Ga0501045_0015837 | |||
| 1960 | Ga0501045_0497188 | |||
| 1961 | Ga0501045_0815964 | |||
| 1962 | nmdc:mga03n38_238584_c1 | |||
| 1963 | nmdc:mga03n38_522247_c1 | |||
| 1964 | nmdc:mga00v17_113033_c1 | |||
| 1965 | nmdc:mga00v17_23145_c1 | |||
| 1966 | nmdc:mga00v17_424712_c1 | |||
| 1967 | nmdc:mga00v17_441924_c1 | |||
| 1968 | nmdc:mga0yw44_178137_c1 | |||
| 1969 | nmdc:mga0yw44_751055_c1 | |||
| 1970 | nmdc:mga0k408_405448_c1 | |||
| 1971 | nmdc:mga0k408_712448_c1 | |||
| 1972 | nmdc:mga0k408_833593_c1 | |||
| 1973 | nmdc:mga06z11_554979_c1 | |||
| 1974 | nmdc:mga06z11_998767_c1 | |||
| 1975 | nmdc:mga04h51_1603_c1 | |||
| 1976 | nmdc:mga07m45_299048_c1 | |||
| 1977 | nmdc:mga07m45_316189_c1 | |||
| 1978 | nmdc:mga07m45_36612_c1 | |||
| 1979 | nmdc:mga07m45_728742_c1 | |||
| 1980 | nmdc:mga0sz30_26148_c1 | |||
| 1981 | nmdc:mga0sz30_69532_c1 | |||
| 1982 | Ga0495655_0198720 | |||
| 1983 | Ga0495655_0275696 | |||
| 1984 | Ga0495595_0235348 | |||
| 1985 | Ga0495619_0091324 | |||
| 1986 | Ga0500566_0006668 | |||
| 1987 | Ga0500650_0002916 | |||
| 1988 | Ga0500555_001383 | |||
| 1989 | Ga0500572_000088 | |||
| 1990 | Ga0500593_223144 | |||
| 1991 | Ga0500608_010423 | |||
| 1992 | Ga0500618_006001 | |||
| 1993 | Ga0500621_227861 | |||
| 1994 | Ga0500642_0000074 | |||
| 1995 | Ga0500642_0274603 | |||
| 1996 | Ga0500652_000065 | |||
| 1997 | Ga0500658_0362206 | |||
| 1998 | Ga0500559_0000321 | |||
| 1999 | Ga0500559_0000381 | |||
| 2000 | Ga0500559_0085448 | |||
| 2001 | Ga0500559_0293394 | |||
| 2002 | Ga0500568_0000556 | |||
| 2003 | Ga0500568_0009976 | |||
| 2004 | Ga0500586_085382 | |||
| 2005 | Ga0500604_0002433 | |||
| 2006 | Ga0500616_0000283 | |||
| 2007 | Ga0500633_0049618 | |||
| 2008 | Ga0500634_0076383 | |||
| 2009 | Ga0500639_022496 | |||
| 2010 | Ga0500636_0000479 | |||
| 2011 | Ga0500637_0216074 | |||
| 2012 | Ga0500649_152363 | |||
| 2013 | Ga0500570_129912 | |||
| 2014 | Ga0500576_030942 | |||
| 2015 | Ga0500645_004743 | |||
| 2016 | Ga0500645_028876 | |||
| 2017 | Ga0500645_165285 | |||
| 2018 | Ga0500596_000143 | |||
| 2019 | Ga0501084_0006472 | |||
| 2020 | Ga0501084_0049335 | |||
| 2021 | Ga0587066_120608 | |||
| 2022 | Ga0587073_0110384 | |||
| 2023 | Ga0587073_0132435 | |||
| 2024 | Ga0587073_0203977 | |||
| 2025 | Ga0587077_074509 | |||
| 2026 | Ga0587080_107286 | |||
| 2027 | Ga0587082_181561 | |||
| 2028 | Ga0587083_0062596 | |||
| 2029 | Ga0587083_0066555 | |||
| 2030 | Ga0587083_0209779 | |||
| 2031 | Ga0587083_0266102 | |||
| 2032 | Ga0587085_027564 | |||
| 2033 | Ga0587086_017567 | |||
| 2034 | Ga0587089_068118 | |||
| 2035 | Ga0587090_131331 | |||
| 2036 | Ga0587094_068791 | |||
| 2037 | Ga0587106_129405 | |||
| 2038 | Ga0587131_015566 | |||
| 2039 | Ga0587101_058093 | |||
| 2040 | Ga0587109_126536 | |||
| 2041 | Ga0587115_047365 | |||
| 2042 | Ga0587122_058045 | |||
| 2043 | Ga0587128_054851 | |||
| 2044 | Ga0587128_056786 | |||
| 2045 | Ga0587128_057552 | |||
| 2046 | Ga0587062_080859 | |||
| 2047 | Ga0587068_088156 | |||
| 2048 | Ga0587069_156258 | |||
| 2049 | Ga0587072_029201 | |||
| 2050 | Ga0587072_206428 | |||
| 2051 | Ga0587102_034710 | |||
| 2052 | Ga0587107_047735 | |||
| 2053 | Ga0587110_033874 | |||
| 2054 | Ga0587114_082539 | |||
| 2055 | Ga0587116_20562 | |||
| 2056 | Ga0587071_107742 | |||
| 2057 | Ga0501082_0011901 | |||
| 2058 | Ga0501082_0540966 | |||
| 2059 | Ga0501082_1052723 | |||
| 2060 | Ga0530510_0805988 | |||
| 2061 | 2507508697 | |||
| 2062 | 2508542791 | |||
| 2063 | 2509150394 | |||
| 2064 | 2513623145 | |||
| 2065 | 2513639090 | |||
| 2066 | 2513654627 | |||
| 2067 | 2513680291 | |||
| 2068 | 2513692409 | |||
| 2069 | 2513700171 | |||
| 2070 | 2513860996 | |||
| 2071 | 2513872665 | |||
| 2072 | 2513893547 | |||
| 2073 | 2513915194 | |||
| 2074 | 2514011958 | |||
| 2075 | 2517892489 | |||
| 2076 | 2524440455 | |||
| 2077 | 2524471317 | |||
| 2078 | 2524540060 | |||
| 2079 | 2603859341 | |||
| 2080 | 2617348909 | |||
| 2081 | 2617375873 | |||
| 2082 | 2644288662 | |||
| 2083 | 2671122400 | |||
| 2084 | 2723845202 | |||
| 2085 | 2728751531 | |||
| 2086 | 2745075276 | |||
| 2087 | 2793062514 | |||
| 2088 | 2793068689 | |||
| 2089 | 2793083589 | |||
| 2090 | 2805915437 | |||
| 2091 | 2818241017 | |||
| 2092 | 2824603464 | |||
| 2093 | 2824614743 | |||
| 2094 | 2824667427 | |||
| 2095 | 2824675800 | |||
| 2096 | 2824686293 | |||
| 2097 | 2824695370 | |||
| 2098 | 2824703755 | |||
| 2099 | 2824711988 | |||
| 2100 | 2824738607 | |||
| 2101 | 2824751571 | |||
| 2102 | 2824756878 | |||
| 2103 | 2824767471 | |||
| 2104 | 2824777692 | |||
| 2105 | 2838123861 | |||
| 2106 | 2841944012 | |||
| 2107 | 2841949960 | |||
| 2108 | 2841966379 | |||
| 2109 | 2841975112 | |||
| 2110 | 2841983316 | |||
| 2111 | 2842039180 | |||
| 2112 | 2842047873 | |||
| 2113 | 2844318983 | |||
| 2114 | 2847936106 | |||
| 2115 | 2847946458 | |||
| 2116 | 2849079422 | |||
| 2117 | 2857514429 | |||
| 2118 | 2857529246 | |||
| 2119 | 2874593431 | |||
| 2120 | 2874605084 | |||
| 2121 | 2874615203 | |||
| 2122 | 2874627216 | |||
| 2123 | 2874633295 | |||
| 2124 | 2874648985 | |||
| 2125 | 2876767082 | |||
| 2126 | 2876773152 | |||
| 2127 | 2876822042 | |||
| 2128 | 2879077197 | |||
| 2129 | 2879090085 | |||
| 2130 | 2879103242 | |||
| 2131 | 2879113581 | |||
| 2132 | 2879130034 | |||
| 2133 | 2879147049 | |||
| 2134 | 2881367045 | |||
| 2135 | 2881671069 | |||
| 2136 | 2885370443 | |||
| 2137 | 2885379906 | |||
| 2138 | 2885392561 | |||
| 2139 | 2885412161 | |||
| 2140 | 2888393914 | |||
| 2141 | 2888424363 | |||
| 2142 | 2889039954 | |||
| 2143 | 2893071359 | |||
| 2144 | 2903729093 | |||
| 2145 | 2903750143 | |||
| 2146 | 2903774076 | |||
| 2147 | 2904671264 | |||
| 2148 | 2904695898 | |||
| 2149 | 2904703320 | |||
| 2150 | 2904720631 | |||
| 2151 | 2906610138 | |||
| 2152 | 2906618530 | |||
| 2153 | 2906634886 | |||
| 2154 | 2906638798 | |||
| 2155 | 2906650495 | |||
| 2156 | 2906664215 | |||
| 2157 | 2908742801 | |||
| 2158 | 2908761019 | |||
| 2159 | 2908780071 | |||
| 2160 | 2919076754 | |||
| 2161 | 2922365247 | |||
| 2162 | 2922390871 | |||
| 2163 | 2922396424 | |||
| 2164 | 2922430173 | |||
| 2165 | 2929617941 | |||
| 2166 | 2929627622 | |||
| 2167 | 2932797599 | |||
| 2168 | 2932802917 | |||
| 2169 | 2932810573 | |||
| 2170 | 2932821283 | |||
| 2171 | 2933579870 | |||
| 2172 | 2935608778 | |||
| 2173 | 2935622931 | |||
| 2174 | 2935631757 | |||
| 2175 | 2935642289 | |||
| 2176 | 2935649932 | |||
| 2177 | 2935661916 | |||
| 2178 | 2935668407 | |||
| 2179 | 2935692788 | |||
| 2180 | 2935700958 | |||
| 2181 | 2935721487 | |||
| 2182 | 2935730405 | |||
| 2183 | 2935740418 | |||
| 2184 | 2935749682 | |||
| 2185 | 2935759005 | |||
| 2186 | 2935762663 | |||
| 2187 | 2935790447 | |||
| 2188 | 2935814582 | |||
| 2189 | 2935821939 | |||
| 2190 | 2935831720 | |||
| 2191 | 2935838588 | |||
| 2192 | 2935847521 | |||
| 2193 | 2935861179 | |||
| 2194 | 2935865717 | |||
| 2195 | 2935878218 | |||
| 2196 | 2935885257 | |||
| 2197 | 2935909212 | |||
| 2198 | 2935919933 | |||
| 2199 | 2935926214 | |||
| 2200 | 2935934664 | |||
| 2201 | 2935943114 | |||
| 2202 | 2935951552 | |||
| 2203 | 2935966373 | |||
| 2204 | 2935967677 | |||
| 2205 | 2935977126 | |||
| 2206 | 2935988284 | |||
| 2207 | 2935994529 | |||
| 2208 | 2936012585 | |||
| 2209 | 2936021149 | |||
| 2210 | 2936029878 | |||
| 2211 | 2936040139 | |||
| 2212 | 2936047343 | |||
| 2213 | 2936057499 | |||
| 2214 | 2940564990 | |||
| 2215 | 2941513128 | |||
| 2216 | 2941520968 | |||
| 2217 | 2941526168 | |||
| 2218 | 2941532633 | |||
| 2219 | 3005480116 | |||
| 2220 | 3005487239 | |||
| 2221 | 3005510222 | |||
| 2222 | 3005591026 | |||
| 2223 | 3005599125 | |||
| 2224 | 3005722214 | |||
| 2225 | 8006940774 | |||
| 2226 | 8006965623 | |||
| 2227 | 8006980464 | |||
| 2228 | 8006987159 | |||
| 2229 | 8006998845 | |||
| 2230 | 8016513332 | |||
| 2231 | 8016573287 | |||
| 2232 | 8016591913 | |||
| 2233 | 8016600151 | |||
| 2234 | 8016626656 | |||
| 2235 | 8016640469 | |||
| 2236 | 8019556857 | |||
| 2237 | 8019568441 | |||
| 2238 | 8019582532 | |||
| 2239 | 8019590317 | |||
| 2240 | 8019617515 | |||
| 2241 | 8019628016 | |||
| 2242 | 8019634581 | |||
| 2243 | 8019658276 | |||
| 2244 | 8019684119 | |||
| 2245 | 8019689957 | |||
| 2246 | 8055746469 | |||
| 2247 | 8056673977 | |||
| 2248 | 8056688292 | |||
| 2249 | 8056693622 | |||
| 2250 | 8056967924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.9312 | 19 | 110 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8863 | 19 | 111 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8783 | 18 | 111 |
| 2d2a-assembly2.cif.gz_A | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.856 | 19 | 123 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8369 | 18 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9502 | 19 | 123 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9312 | 19 | 110 | 2.60.300.12 |
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9245 | 19 | 123 | 2.60.300.12 |
| af_P78859_82_189_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9083 | 19 | 125 | 2.60.300.12 |
| af_P41901_86_366_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9062 | 69 | 81 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q6ZEE9-F1-model_v4 | Fe-S cluster assembly scaffold SufA | 0.9699 | 19 | 131 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A0C2ADA0-F1-model_v4 | deleted | 0.9666 | 19 | 131 |
|
| AF-G4RAJ6-F1-model_v4 | Iron binding protein SufA for iron-sulfur cluster assembly | 0.9645 | 19 | 129 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A4Q3GKX8-F1-model_v4 | deleted | 0.9629 | 19 | 129 |
|
| AF-A0A0Q6ZEE9-F1-model_v4 | Fe-S cluster assembly scaffold SufA | 0.9615 | 19 | 131 |
GO:0005829
GO:0016226 GO:0051537 GO:0097428 |