F490452

General Info

Members Datasets Scaffolds Average Seq Length
1124 265 1124 278

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0635151|Ga0501072_0635151_12_821
Length 269
Sequence LACIAQPAAAQSPLAAQLQNQLAMLVTSKSADVGVAAIDLTTGETVSVRGNQRYPMASTMKVAVAATYLSYVETGERTLDETIAGRSAASLMKAMIVRSDNQATDLLLRNLGGPRTVQKWLEWNNVEGIRVDRTIAQLLRAKRDLYEDLDSTTPIAFATFLKRLDKGELLQPWSRNYLLALMAQCKTGSNRMKALLPAGSVAHKTGTLNGYSSDVGFITLPNGHKVAIAIFARGGSNRPQAIAEAARAVYDGFRAVIGWPYNAASALTQ

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
207 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
256 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.45
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1001648 3300000531 Bacteria 1188
2 JGI24736J21556_1007046 3300001904 Bacteria 1894
3 JGI24736J21556_1007403 3300001904 Bacteria 1845
4 JGI24741J21665_1009337 3300001915 Bacteria 1806
5 JGI24740J21852_10000927 3300001979 Bacteria 13026
6 JGI24740J21852_10001189 3300001979 Bacteria 11731
7 JGI24740J21852_10001800 3300001979 Bacteria 9829
8 JGI24740J21852_10008900 3300001979 Bacteria 3969
9 JGI24740J21852_10017908 3300001979 Bacteria 2524
10 JGI24739J22299_10023516 3300001989 Bacteria 2178
11 JGI24737J22298_10000009 3300001990 Bacteria 58784
12 JGI24737J22298_10008786 3300001990 Bacteria 3373
13 JGI24737J22298_10020665 3300001990 Bacteria 2101
14 JGI24737J22298_10036552 3300001990 Bacteria 1516
15 JGI24737J22298_10056164 3300001990 Bacteria 1189
16 JGI24737J22298_10062314 3300001990 Bacteria 1121
17 JGI24735J21928_10003960 3300002067 Bacteria 5007
18 JGI24735J21928_10008880 3300002067 Bacteria 3242
19 JGI24735J21928_10076088 3300002067 Bacteria 961
20 JGI24738J21930_10000008 3300002075 Bacteria 41238
21 JGI24738J21930_10008995 3300002075 Bacteria 2260
22 JGI24738J21930_10015019 3300002075 Bacteria 1652
23 JGI24742J22300_10006655 3300002244 Bacteria 1906
24 rootH2_10078034 3300003320 Bacteria 1234
25 Ga0065712_10100388 3300005290 Bacteria 2051
26 Ga0065712_10211065 3300005290 Bacteria 1072
27 Ga0070658_10016046 3300005327 Bacteria 5991
28 Ga0070658_10024782 3300005327 Bacteria 4811
29 Ga0070658_10028976 3300005327 Bacteria 4446
30 Ga0070658_10030513 3300005327 Bacteria 4331
31 Ga0070658_10032303 3300005327 Bacteria 4208
32 Ga0070658_10075997 3300005327 Bacteria 2755
33 Ga0070658_10079178 3300005327 Bacteria 2698
34 Ga0070658_10106531 3300005327 Bacteria 2319
35 Ga0070658_10221135 3300005327 Bacteria 1601
36 Ga0070658_10323268 3300005327 Bacteria 1318
37 Ga0070658_10545165 3300005327 Bacteria 1004
38 Ga0070676_10001397 3300005328 Bacteria 12187
39 Ga0070676_10004565 3300005328 Bacteria 7298
40 Ga0070676_10009749 3300005328 Bacteria 5194
41 Ga0070676_10032598 3300005328 Bacteria 2986
42 Ga0070676_10085555 3300005328 Bacteria 1922
43 Ga0070676_10090397 3300005328 Bacteria 1874
44 Ga0070683_100020099 3300005329 Bacteria 5939
45 Ga0070683_100057473 3300005329 Bacteria 3614
46 Ga0070690_100019106 3300005330 Bacteria 4153
47 Ga0070690_100051948 3300005330 Bacteria 2619
48 Ga0070690_100085000 3300005330 Bacteria 2075
49 Ga0070670_100002414 3300005331 Bacteria 15403
50 Ga0070670_100005886 3300005331 Bacteria 10363
51 Ga0070670_100007469 3300005331 Bacteria 9281
52 Ga0070670_100010185 3300005331 Bacteria 8022
53 Ga0070670_100011249 3300005331 Bacteria 7649
54 Ga0070670_100029796 3300005331 Bacteria 4701
55 Ga0070670_100097414 3300005331 Bacteria 2530
56 Ga0070670_100100769 3300005331 Bacteria 2487
57 Ga0070670_100107615 3300005331 Bacteria 2402
58 Ga0070670_100113799 3300005331 Bacteria 2333
59 Ga0070670_100146461 3300005331 Bacteria 2043
60 Ga0070670_100246707 3300005331 Bacteria 1555
61 Ga0070677_10013023 3300005333 Bacteria 2899
62 Ga0070677_10074720 3300005333 Bacteria 1434
63 Ga0070677_10088829 3300005333 Bacteria 1340
64 Ga0068869_100000682 3300005334 Bacteria 19175
65 Ga0070666_10000693 3300005335 Bacteria 20437
66 Ga0070666_10016668 3300005335 Bacteria 4702
67 Ga0070666_10020583 3300005335 Bacteria 4266
68 Ga0070666_10021573 3300005335 Bacteria 4175
69 Ga0070666_10028217 3300005335 Bacteria 3681
70 Ga0070666_10032630 3300005335 Bacteria 3441
71 Ga0070680_100023129 3300005336 Bacteria 4954
72 Ga0070680_100054926 3300005336 Bacteria 3253
73 Ga0070682_100064589 3300005337 Bacteria 2324
74 Ga0070682_100080781 3300005337 Bacteria 2103
75 Ga0068868_100001623 3300005338 Bacteria 15367
76 Ga0068868_100001982 3300005338 Bacteria 14064
77 Ga0068868_100002627 3300005338 Bacteria 12464
78 Ga0068868_100022547 3300005338 Bacteria 4754
79 Ga0068868_100039816 3300005338 Bacteria 3654
80 Ga0068868_100174963 3300005338 Bacteria 1779
81 Ga0070660_100004492 3300005339 Bacteria 9639
82 Ga0070660_100006146 3300005339 Bacteria 8306
83 Ga0070660_100012527 3300005339 Bacteria 6058
84 Ga0070660_100017761 3300005339 Bacteria 5188
85 Ga0070660_100019076 3300005339 Bacteria 5020
86 Ga0070660_100024658 3300005339 Bacteria 4463
87 Ga0070660_100029093 3300005339 Bacteria 4138
88 Ga0070660_100070548 3300005339 Bacteria 2727
89 Ga0070660_100095606 3300005339 Bacteria 2348
90 Ga0070660_100175184 3300005339 Bacteria 1734
91 Ga0070660_100388541 3300005339 Bacteria 1152
92 Ga0070691_10014238 3300005341 Bacteria 3647
93 Ga0070661_100003112 3300005344 Bacteria 11415
94 Ga0070661_100003585 3300005344 Bacteria 10686
95 Ga0070661_100007620 3300005344 Bacteria 7467
96 Ga0070661_100014629 3300005344 Bacteria 5532
97 Ga0070661_100017757 3300005344 Bacteria 5050
98 Ga0070661_100057256 3300005344 Bacteria 2856
99 Ga0070661_100069006 3300005344 Bacteria 2598
100 Ga0070661_100076964 3300005344 Bacteria 2459
101 Ga0070661_100113588 3300005344 Bacteria 2024
102 Ga0070661_100128282 3300005344 Bacteria 1904
103 Ga0070661_100175566 3300005344 Bacteria 1628
104 Ga0070661_100430926 3300005344 Bacteria 1046
105 Ga0070692_10079536 3300005345 Bacteria 1763
106 Ga0070668_100000324 3300005347 Bacteria 31403
107 Ga0070668_100058019 3300005347 Bacteria 2994
108 Ga0070668_100159761 3300005347 Bacteria 1828
109 Ga0070669_100000128 3300005353 Bacteria 69625
110 Ga0070669_100021655 3300005353 Bacteria 4594
111 Ga0070669_100117874 3300005353 Bacteria 2022
112 Ga0070669_100256447 3300005353 Bacteria 1394
113 Ga0070669_100399190 3300005353 Bacteria 1125
114 Ga0070669_100513514 3300005353 Unclassified 995
115 Ga0070675_100004665 3300005354 Bacteria 10467
116 Ga0070675_100008335 3300005354 Bacteria 8042
117 Ga0070675_100022362 3300005354 Bacteria 5052
118 Ga0070675_100044938 3300005354 Bacteria 3613
119 Ga0070675_100049898 3300005354 Bacteria 3436
120 Ga0070675_100102642 3300005354 Bacteria 2410
121 Ga0070675_100598446 3300005354 Bacteria 1000
122 Ga0070671_100004394 3300005355 Bacteria 11145
123 Ga0070671_100005300 3300005355 Bacteria 10284
124 Ga0070671_100007225 3300005355 Bacteria 8880
125 Ga0070671_100009611 3300005355 Bacteria 7770
126 Ga0070671_100024620 3300005355 Bacteria 4931
127 Ga0070671_100044818 3300005355 Bacteria 3675
128 Ga0070671_100099574 3300005355 Unclassified 2438
129 Ga0070671_100133549 3300005355 Bacteria 2091
130 Ga0070671_100164399 3300005355 Bacteria 1876
131 Ga0070671_100314303 3300005355 Bacteria 1334
132 Ga0070674_100019310 3300005356 Bacteria 4328
133 Ga0070674_100027368 3300005356 Bacteria 3736
134 Ga0070674_100126273 3300005356 Bacteria 1901
135 Ga0070674_100473603 3300005356 Bacteria 1038
136 Ga0070673_100000204 3300005364 Bacteria 29365
137 Ga0070673_100012375 3300005364 Bacteria 5855
138 Ga0070673_100014743 3300005364 Bacteria 5461
139 Ga0070673_100034179 3300005364 Bacteria 3844
140 Ga0070673_100041818 3300005364 Bacteria 3528
141 Ga0070673_100043357 3300005364 Bacteria 3476
142 Ga0070673_100060032 3300005364 Bacteria 3012
143 Ga0070673_100064668 3300005364 Bacteria 2915
144 Ga0070673_100334441 3300005364 Bacteria 1341
145 Ga0070688_100243776 3300005365 Bacteria 1277
146 Ga0070659_100003498 3300005366 Bacteria 11185
147 Ga0070659_100018067 3300005366 Bacteria 5318
148 Ga0070659_100018589 3300005366 Bacteria 5245
149 Ga0070659_100029553 3300005366 Bacteria 4236
150 Ga0070659_100029971 3300005366 Bacteria 4208
151 Ga0070659_100035102 3300005366 Bacteria 3903
152 Ga0070659_100043855 3300005366 Bacteria 3500
153 Ga0070659_100048069 3300005366 Bacteria 3350
154 Ga0070659_100085208 3300005366 Bacteria 2527
155 Ga0070659_100363926 3300005366 Bacteria 1215
156 Ga0070667_100001539 3300005367 Bacteria 20661
157 Ga0070667_100001793 3300005367 Bacteria 19116
158 Ga0070667_100002452 3300005367 Bacteria 16200
159 Ga0070667_100004350 3300005367 Bacteria 11952
160 Ga0070667_100007452 3300005367 Bacteria 9084
161 Ga0070667_100011342 3300005367 Bacteria 7370
162 Ga0070667_100048291 3300005367 Bacteria 3582
163 Ga0070667_100089940 3300005367 Bacteria 2637
164 Ga0070667_100095007 3300005367 Bacteria 2569
165 Ga0070667_100187455 3300005367 Bacteria 1831
166 Ga0070709_10160962 3300005434 Bacteria 1561
167 Ga0070714_100058491 3300005435 Bacteria 3302
168 Ga0070714_100099690 3300005435 Bacteria 2557
169 Ga0070714_100171234 3300005435 Bacteria 1970
170 Ga0070713_100003021 3300005436 Bacteria 11043
171 Ga0070713_100159781 3300005436 Bacteria 2011
172 Ga0070705_100216182 3300005440 Bacteria 1324
173 Ga0070694_100357715 3300005444 Bacteria 1133
174 Ga0070663_100003483 3300005455 Bacteria 9075
175 Ga0070663_100010497 3300005455 Bacteria 5772
176 Ga0070663_100017843 3300005455 Bacteria 4640
177 Ga0070663_100019953 3300005455 Bacteria 4427
178 Ga0070663_100056909 3300005455 Bacteria 2803
179 Ga0070663_100077100 3300005455 Bacteria 2439
180 Ga0070663_100124560 3300005455 Bacteria 1951
181 Ga0070663_100154549 3300005455 Bacteria 1762
182 Ga0070663_100205415 3300005455 Bacteria 1539
183 Ga0070678_100057677 3300005456 Bacteria 2846
184 Ga0070678_100296052 3300005456 Bacteria 1373
185 Ga0070678_100355557 3300005456 Bacteria 1261
186 Ga0070678_100632300 3300005456 Bacteria 958
187 Ga0070662_100002026 3300005457 Bacteria 12411
188 Ga0070662_100009542 3300005457 Bacteria 6351
189 Ga0070662_100011887 3300005457 Bacteria 5755
190 Ga0070662_100015942 3300005457 Bacteria 5041
191 Ga0070662_100024689 3300005457 Bacteria 4144
192 Ga0070662_100028722 3300005457 Bacteria 3873
193 Ga0070662_100032041 3300005457 Bacteria 3693
194 Ga0070662_100039513 3300005457 Bacteria 3356
195 Ga0070662_100095202 3300005457 Bacteria 2244
196 Ga0070662_100102609 3300005457 Bacteria 2167
197 Ga0070662_100115852 3300005457 Bacteria 2047
198 Ga0070662_100157406 3300005457 Bacteria 1774
199 Ga0070662_100265782 3300005457 Bacteria 1383
200 Ga0070662_100332977 3300005457 Bacteria 1240
201 Ga0070662_100345172 3300005457 Bacteria 1218
202 Ga0070662_100417214 3300005457 Bacteria 1110
203 Ga0070662_100492526 3300005457 Bacteria 1022
204 Ga0070681_10047943 3300005458 Bacteria 4270
205 Ga0070681_10326943 3300005458 Bacteria 1443
206 Ga0068867_100000045 3300005459 Bacteria 75898
207 Ga0068867_100001601 3300005459 Bacteria 15719
208 Ga0068867_100020790 3300005459 Bacteria 4679
209 Ga0068867_100143773 3300005459 Bacteria 1867
210 Ga0068867_100149890 3300005459 Bacteria 1831
211 Ga0070685_10113018 3300005466 Bacteria 1676
212 Ga0070679_100014156 3300005530 Bacteria 7651
213 Ga0070679_100018589 3300005530 Bacteria 6747
214 Ga0070679_100261802 3300005530 Bacteria 1685
215 Ga0070679_100282324 3300005530 Bacteria 1613
216 Ga0070684_100002928 3300005535 Bacteria 12687
217 Ga0070684_100006344 3300005535 Bacteria 9137
218 Ga0070684_100109922 3300005535 Bacteria 2471
219 Ga0070684_100261382 3300005535 Bacteria 1583
220 Ga0068853_100000162 3300005539 Bacteria 45622
221 Ga0068853_100020292 3300005539 Bacteria 5526
222 Ga0068853_100024862 3300005539 Bacteria 5024
223 Ga0068853_100099446 3300005539 Bacteria 2570
224 Ga0068853_100102407 3300005539 Bacteria 2533
225 Ga0068853_100182471 3300005539 Unclassified 1904
226 Ga0068853_100327313 3300005539 Bacteria 1421
227 Ga0070672_100000041 3300005543 Bacteria 56886
228 Ga0070672_100002633 3300005543 Bacteria 11476
229 Ga0070672_100009120 3300005543 Bacteria 6825
230 Ga0070672_100042844 3300005543 Bacteria 3486
231 Ga0070672_100060757 3300005543 Bacteria 2977
232 Ga0070672_100070955 3300005543 Bacteria 2769
233 Ga0070672_100071824 3300005543 Bacteria 2754
234 Ga0070672_100081210 3300005543 Bacteria 2599
235 Ga0070672_100124558 3300005543 Bacteria 2113
236 Ga0070686_100087219 3300005544 Bacteria 2080
237 Ga0070696_100005700 3300005546 Bacteria 8319
238 Ga0070696_100025535 3300005546 Bacteria 4018
239 Ga0070693_100088119 3300005547 Bacteria 1865
240 Ga0070665_100000670 3300005548 Bacteria 45961
241 Ga0070665_100008070 3300005548 Bacteria 10657
242 Ga0070665_100079327 3300005548 Bacteria 3289
243 Ga0070665_100141760 3300005548 Bacteria 2406
244 Ga0070665_100143633 3300005548 Bacteria 2390
245 Ga0070665_100741008 3300005548 Bacteria 996
246 Ga0068855_100025033 3300005563 Bacteria 7143
247 Ga0068855_100025338 3300005563 Bacteria 7098
248 Ga0068855_100095847 3300005563 Bacteria 3419
249 Ga0068855_100172857 3300005563 Bacteria 2446
250 Ga0068855_100500508 3300005563 Bacteria 1320
251 Ga0068855_100755012 3300005563 Bacteria 1037
252 Ga0070664_100001064 3300005564 Bacteria 21598
253 Ga0070664_100002825 3300005564 Bacteria 14048
254 Ga0070664_100003970 3300005564 Bacteria 11898
255 Ga0070664_100005597 3300005564 Bacteria 10099
256 Ga0070664_100009841 3300005564 Bacteria 7747
257 Ga0070664_100013227 3300005564 Bacteria 6721
258 Ga0070664_100016775 3300005564 Bacteria 6010
259 Ga0070664_100022999 3300005564 Bacteria 5142
260 Ga0070664_100080605 3300005564 Bacteria 2804
261 Ga0070664_100098160 3300005564 Bacteria 2544
262 Ga0070664_100210748 3300005564 Bacteria 1736
263 Ga0070664_100250049 3300005564 Bacteria 1593
264 Ga0070664_100404609 3300005564 Bacteria 1248
265 Ga0070664_100588265 3300005564 Bacteria 1031
266 Ga0068857_100001542 3300005577 Bacteria 18443
267 Ga0068857_100008558 3300005577 Bacteria 8849
268 Ga0068857_100009896 3300005577 Bacteria 8279
269 Ga0068857_100011442 3300005577 Bacteria 7720
270 Ga0068857_100107040 3300005577 Bacteria 2511
271 Ga0068857_100130035 3300005577 Bacteria 2270
272 Ga0068857_100147994 3300005577 Bacteria 2126
273 Ga0068857_100180807 3300005577 Bacteria 1919
274 Ga0068854_100000542 3300005578 Bacteria 22825
275 Ga0068854_100001932 3300005578 Bacteria 12640
276 Ga0068854_100008675 3300005578 Bacteria 6545
277 Ga0068854_100008742 3300005578 Bacteria 6519
278 Ga0068854_100021848 3300005578 Bacteria 4349
279 Ga0068854_100031971 3300005578 Bacteria 3659
280 Ga0068854_100055259 3300005578 Bacteria 2857
281 Ga0068854_100084692 3300005578 Bacteria 2346
282 Ga0068854_100088238 3300005578 Bacteria 2303
283 Ga0068854_100088800 3300005578 Bacteria 2296
284 Ga0068854_100208982 3300005578 Unclassified 1539
285 Ga0068854_100239021 3300005578 Bacteria 1445
286 Ga0068856_100029066 3300005614 Bacteria 5401
287 Ga0068856_100117762 3300005614 Bacteria 2657
288 Ga0068856_100162492 3300005614 Bacteria 2244
289 Ga0068856_100294565 3300005614 Bacteria 1640
290 Ga0068852_100001650 3300005616 Bacteria 15231
291 Ga0068852_100001814 3300005616 Bacteria 14511
292 Ga0068852_100002219 3300005616 Bacteria 13323
293 Ga0068852_100006345 3300005616 Bacteria 8535
294 Ga0068852_100116423 3300005616 Bacteria 2438
295 Ga0068852_100170861 3300005616 Bacteria 2037
296 Ga0068852_100178848 3300005616 Bacteria 1993
297 Ga0068852_100259604 3300005616 Bacteria 1668
298 Ga0068859_100000088 3300005617 Bacteria 84390
299 Ga0068859_100008386 3300005617 Bacteria 10474
300 Ga0068859_100008428 3300005617 Bacteria 10440
301 Ga0068859_100011079 3300005617 Bacteria 9073
302 Ga0068859_100016383 3300005617 Bacteria 7445
303 Ga0068859_100024951 3300005617 Bacteria 6000
304 Ga0068864_100000047 3300005618 Bacteria 150798
305 Ga0068864_100000136 3300005618 Bacteria 70797
306 Ga0068864_100001503 3300005618 Bacteria 19202
307 Ga0068864_100017849 3300005618 Bacteria 5918
308 Ga0068864_100033704 3300005618 Bacteria 4354
309 Ga0068864_100246477 3300005618 Bacteria 1657
310 Ga0068864_100369152 3300005618 Bacteria 1358
311 Ga0068866_10003876 3300005718 Bacteria 6134
312 Ga0068866_10004933 3300005718 Bacteria 5486
313 Ga0068861_100026007 3300005719 Bacteria 4251
314 Ga0068861_100707054 3300005719 Bacteria 937
315 Ga0068851_10002427 3300005834 Bacteria 8184
316 Ga0068851_10008521 3300005834 Bacteria 4745
317 Ga0068851_10009986 3300005834 Bacteria 4420
318 Ga0068851_10014094 3300005834 Bacteria 3791
319 Ga0068851_10040820 3300005834 Bacteria 2333
320 Ga0068851_10048496 3300005834 Bacteria 2152
321 Ga0068851_10069288 3300005834 Bacteria 1822
322 Ga0068851_10188092 3300005834 Bacteria 1147
323 Ga0068863_100001560 3300005841 Bacteria 22637
324 Ga0068863_100005004 3300005841 Bacteria 13068
325 Ga0068863_100009138 3300005841 Bacteria 9678
326 Ga0068863_100025790 3300005841 Bacteria 5607
327 Ga0068863_100026719 3300005841 Bacteria 5504
328 Ga0068863_100029918 3300005841 Bacteria 5202
329 Ga0068863_100078262 3300005841 Bacteria 3131
330 Ga0068858_100000063 3300005842 Bacteria 111811
331 Ga0068858_100000631 3300005842 Bacteria 36634
332 Ga0068858_100000855 3300005842 Bacteria 31513
333 Ga0068858_100043316 3300005842 Bacteria 4174
334 Ga0068858_100084023 3300005842 Bacteria 2961
335 Ga0068858_100112990 3300005842 Bacteria 2537
336 Ga0068858_100130303 3300005842 Bacteria 2358
337 Ga0068860_100005063 3300005843 Bacteria 13404
338 Ga0068860_100029004 3300005843 Bacteria 5324
339 Ga0068860_100050559 3300005843 Bacteria 3956
340 Ga0068860_100055986 3300005843 Bacteria 3749
341 Ga0068860_100249863 3300005843 Bacteria 1727
342 Ga0068860_100296765 3300005843 Bacteria 1582
343 Ga0068862_100002790 3300005844 Bacteria 15308
344 Ga0068862_100008241 3300005844 Bacteria 8622
345 Ga0068862_100018105 3300005844 Bacteria 5866
346 Ga0068862_100024321 3300005844 Bacteria 5082
347 Ga0068862_100059853 3300005844 Bacteria 3271
348 Ga0068862_100064548 3300005844 Bacteria 3152
349 Ga0068862_100087072 3300005844 Bacteria 2717
350 Ga0068862_100170619 3300005844 Bacteria 1948
351 Ga0081539_10012171 3300005985 Bacteria 6676
352 Ga0081539_10042924 3300005985 Bacteria 2627
353 Ga0070717_10054255 3300006028 Bacteria 3305
354 Ga0075364_10132900 3300006051 Bacteria 1671
355 Ga0070716_100040631 3300006173 Bacteria 2589
356 Ga0070716_100075028 3300006173 Bacteria 2000
357 Ga0070712_100058440 3300006175 Bacteria 2713
358 Ga0070712_100078484 3300006175 Bacteria 2384
359 Ga0097621_100033930 3300006237 Bacteria 4068
360 Ga0097621_100049456 3300006237 Bacteria 3415
361 Ga0097621_100075669 3300006237 Bacteria 2791
362 Ga0097621_100429698 3300006237 Bacteria 1187
363 Ga0068871_100017299 3300006358 Bacteria 5451
364 Ga0068871_100039990 3300006358 Bacteria 3755
365 Ga0068871_100100016 3300006358 Bacteria 2428
366 Ga0068871_100284431 3300006358 Bacteria 1447
367 Ga0075428_100205562 3300006844 Bacteria 2128
368 Ga0075428_100281751 3300006844 Bacteria 1788
369 Ga0075434_100399034 3300006871 Bacteria 1396
370 Ga0068865_100000528 3300006881 Bacteria 21368
371 Ga0068865_100014020 3300006881 Bacteria 5086
372 Ga0068865_100054049 3300006881 Bacteria 2789
373 Ga0068865_100330593 3300006881 Bacteria 1229
374 Ga0097620_100000088 3300006931 Bacteria 84390
375 Ga0097620_100008386 3300006931 Bacteria 10474
376 Ga0097620_100008428 3300006931 Bacteria 10440
377 Ga0097620_100011079 3300006931 Bacteria 9073
378 Ga0097620_100016383 3300006931 Bacteria 7445
379 Ga0097620_100024951 3300006931 Bacteria 6000
380 Ga0105250_10008858 3300009092 Bacteria 4259
381 Ga0111539_10037205 3300009094 Bacteria 5879
382 Ga0105245_10000062 3300009098 Bacteria 115179
383 Ga0105245_10020038 3300009098 Bacteria 5862
384 Ga0105245_10031755 3300009098 Bacteria 4675
385 Ga0105247_10120037 3300009101 Bacteria 1702
386 Ga0105243_10013997 3300009148 Bacteria 6070
387 Ga0105243_10027550 3300009148 Bacteria 4354
388 Ga0105243_10044298 3300009148 Bacteria 3491
389 Ga0105243_10049422 3300009148 Bacteria 3318
390 Ga0105242_10241403 3300009176 Bacteria 1624
391 Ga0105242_10266405 3300009176 Bacteria 1550
392 Ga0105248_10000122 3300009177 Bacteria 89560
393 Ga0105248_10000169 3300009177 Bacteria 75948
394 Ga0105248_10001030 3300009177 Bacteria 30868
395 Ga0105248_10003561 3300009177 Bacteria 17260
396 Ga0105248_10020997 3300009177 Bacteria 7236
397 Ga0105248_10023443 3300009177 Bacteria 6856
398 Ga0105248_10039564 3300009177 Bacteria 5283
399 Ga0105248_10114740 3300009177 Bacteria 3038
400 Ga0105248_10248369 3300009177 Bacteria 2003
401 Ga0105248_10300796 3300009177 Unclassified 1806
402 Ga0105248_10430047 3300009177 Bacteria 1487
403 Ga0105248_10804786 3300009177 Bacteria 1061
404 Ga0105237_10057753 3300009545 Bacteria 3883
405 Ga0105237_10302849 3300009545 Bacteria 1601
406 Ga0105237_10756721 3300009545 Bacteria 978
407 Ga0105238_10028244 3300009551 Bacteria 5716
408 Ga0105238_10037891 3300009551 Bacteria 4899
409 Ga0105238_10599926 3300009551 Bacteria 1109
410 Ga0105249_10154617 3300009553 Bacteria 2211
411 Ga0105239_10105089 3300010375 Bacteria 3127
412 Ga0105239_10274328 3300010375 Bacteria 1897
413 Ga0105239_10388017 3300010375 Bacteria 1579
414 Ga0105239_10649291 3300010375 Bacteria 1205
415 Ga0105246_10044648 3300011119 Bacteria 3013
416 Ga0105246_10048303 3300011119 Bacteria 2909
417 Ga0105246_10093511 3300011119 Bacteria 2172
418 Ga0157316_1001696 3300012510 Bacteria 1408
419 Ga0157373_10014037 3300013100 Bacteria 5873
420 Ga0157373_10027750 3300013100 Bacteria 4085
421 Ga0157373_10028389 3300013100 Bacteria 4036
422 Ga0157373_10033380 3300013100 Bacteria 3702
423 Ga0157373_10328506 3300013100 Bacteria 1089
424 Ga0157371_10000144 3300013102 Bacteria 103512
425 Ga0157371_10023986 3300013102 Bacteria 4457
426 Ga0157371_10027985 3300013102 Bacteria 4084
427 Ga0157371_10102510 3300013102 Bacteria 2030
428 Ga0157370_10015351 3300013104 Bacteria 7786
429 Ga0157370_10183781 3300013104 Bacteria 1942
430 Ga0157370_10329157 3300013104 Bacteria 1409
431 Ga0157369_10003544 3300013105 Bacteria 18538
432 Ga0157369_10073070 3300013105 Bacteria 3680
433 Ga0157369_10140985 3300013105 Bacteria 2551
434 Ga0157369_10165984 3300013105 Bacteria 2328
435 Ga0157369_10243301 3300013105 Bacteria 1879
436 Ga0157369_10273658 3300013105 Bacteria 1759
437 Ga0157374_10004105 3300013296 Bacteria 12227
438 Ga0157374_10039984 3300013296 Bacteria 4318
439 Ga0157374_10073128 3300013296 Bacteria 3236
440 Ga0157374_10124608 3300013296 Bacteria 2490
441 Ga0157374_10237893 3300013296 Bacteria 1790
442 Ga0157378_10000242 3300013297 Bacteria 53256
443 Ga0157378_10059458 3300013297 Bacteria 3410
444 Ga0157378_10470870 3300013297 Bacteria 1250
445 Ga0163162_10168196 3300013306 Bacteria 2316
446 Ga0163162_10365055 3300013306 Bacteria 1577
447 Ga0163162_10518528 3300013306 Bacteria 1321
448 Ga0157372_10011773 3300013307 Bacteria 9317
449 Ga0157372_10067590 3300013307 Bacteria 4016
450 Ga0157372_10120967 3300013307 Bacteria 3007
451 Ga0157372_10136055 3300013307 Bacteria 2830
452 Ga0157372_10270453 3300013307 Bacteria 1974
453 Ga0157372_10354435 3300013307 Bacteria 1710
454 Ga0157372_10380432 3300013307 Bacteria 1645
455 Ga0157372_10585811 3300013307 Bacteria 1300
456 Ga0157375_10026310 3300013308 Bacteria 5419
457 Ga0157375_10039482 3300013308 Bacteria 4544
458 Ga0157375_10054009 3300013308 Bacteria 3955
459 Ga0157375_10057944 3300013308 Bacteria 3831
460 Ga0157375_10087808 3300013308 Bacteria 3163
461 Ga0157375_10733379 3300013308 Bacteria 1140
462 Ga0163163_10001969 3300014325 Bacteria 17361
463 Ga0163163_10044035 3300014325 Bacteria 4377
464 Ga0157380_10030248 3300014326 Bacteria 4146
465 Ga0157380_10043133 3300014326 Bacteria 3530
466 Ga0157377_10014277 3300014745 Bacteria 4039
467 Ga0157379_10003175 3300014968 Bacteria 13917
468 Ga0157379_10024874 3300014968 Bacteria 5316
469 Ga0157379_10118826 3300014968 Bacteria 2378
470 Ga0157379_10169445 3300014968 Bacteria 1971
471 Ga0157376_10029478 3300014969 Bacteria 4371
472 Ga0157376_10189938 3300014969 Bacteria 1883
473 Ga0163161_10015176 3300017792 Bacteria 5367
474 Ga0163161_10184028 3300017792 Bacteria 1603
475 Ga0163161_10223498 3300017792 Bacteria 1459
476 Ga0163161_10244647 3300017792 Bacteria 1396
477 Ga0206356_11487008 3300020070 Bacteria 2848
478 Ga0206354_11203043 3300020081 Bacteria 1153
479 Ga0213876_10057048 3300021384 Bacteria 2061
480 Ga0213875_10002752 3300021388 Bacteria 10382
481 Ga0207697_10000002 3300025315 Bacteria 92560
482 Ga0207697_10021898 3300025315 Bacteria 2619
483 Ga0207697_10063340 3300025315 Bacteria 1541
484 Ga0207697_10076749 3300025315 Bacteria 1404
485 Ga0207656_10006879 3300025321 Bacteria 4118
486 Ga0207656_10012456 3300025321 Bacteria 3233
487 Ga0207656_10018769 3300025321 Bacteria 2727
488 Ga0207656_10094168 3300025321 Bacteria 1364
489 Ga0207682_10004530 3300025893 Bacteria 5792
490 Ga0207682_10007248 3300025893 Bacteria 4429
491 Ga0207682_10040052 3300025893 Bacteria 1907
492 Ga0207642_10012258 3300025899 Bacteria 3090
493 Ga0207642_10131509 3300025899 Bacteria 1307
494 Ga0207710_10095528 3300025900 Bacteria 1396
495 Ga0207688_10000185 3300025901 Bacteria 27678
496 Ga0207688_10009119 3300025901 Bacteria 5401
497 Ga0207688_10011623 3300025901 Bacteria 4787
498 Ga0207680_10001868 3300025903 Bacteria 9878
499 Ga0207680_10006526 3300025903 Bacteria 5649
500 Ga0207680_10024768 3300025903 Bacteria 3299
501 Ga0207680_10064823 3300025903 Bacteria 2241
502 Ga0207680_10168123 3300025903 Bacteria 1475
503 Ga0207647_10000095 3300025904 Bacteria 67884
504 Ga0207647_10001001 3300025904 Bacteria 21921
505 Ga0207647_10001765 3300025904 Bacteria 16596
506 Ga0207647_10007018 3300025904 Bacteria 8169
507 Ga0207647_10021448 3300025904 Bacteria 4312
508 Ga0207647_10032750 3300025904 Bacteria 3335
509 Ga0207647_10092240 3300025904 Bacteria 1806
510 Ga0207647_10182842 3300025904 Bacteria 1217
511 Ga0207699_10045618 3300025906 Bacteria 2559
512 Ga0207645_10002989 3300025907 Bacteria 13069
513 Ga0207645_10003442 3300025907 Bacteria 12023
514 Ga0207645_10007529 3300025907 Bacteria 7683
515 Ga0207645_10032192 3300025907 Bacteria 3371
516 Ga0207645_10035509 3300025907 Bacteria 3201
517 Ga0207645_10088599 3300025907 Bacteria 1990
518 Ga0207645_10089083 3300025907 Bacteria 1984
519 Ga0207705_10002578 3300025909 Bacteria 13924
520 Ga0207705_10003350 3300025909 Bacteria 12181
521 Ga0207705_10005118 3300025909 Bacteria 9831
522 Ga0207705_10007626 3300025909 Bacteria 7958
523 Ga0207705_10011516 3300025909 Bacteria 6397
524 Ga0207705_10050714 3300025909 Bacteria 2987
525 Ga0207705_10064533 3300025909 Bacteria 2646
526 Ga0207705_10080789 3300025909 Bacteria 2369
527 Ga0207705_10110620 3300025909 Bacteria 2029
528 Ga0207705_10148127 3300025909 Bacteria 1757
529 Ga0207705_10298028 3300025909 Bacteria 1236
530 Ga0207707_10063252 3300025912 Bacteria 3221
531 Ga0207707_10321809 3300025912 Bacteria 1335
532 Ga0207695_10151392 3300025913 Bacteria 2259
533 Ga0207671_10181484 3300025914 Bacteria 1638
534 Ga0207693_10022649 3300025915 Bacteria 4990
535 Ga0207693_10062363 3300025915 Bacteria 2920
536 Ga0207660_10033154 3300025917 Bacteria 3570
537 Ga0207660_10212018 3300025917 Bacteria 1517
538 Ga0207662_10102759 3300025918 Bacteria 1773
539 Ga0207662_10191728 3300025918 Bacteria 1319
540 Ga0207657_10000594 3300025919 Bacteria 38336
541 Ga0207657_10002671 3300025919 Bacteria 19229
542 Ga0207657_10003798 3300025919 Bacteria 16059
543 Ga0207657_10003856 3300025919 Bacteria 15923
544 Ga0207657_10011912 3300025919 Bacteria 8606
545 Ga0207657_10013132 3300025919 Bacteria 8134
546 Ga0207657_10014084 3300025919 Bacteria 7826
547 Ga0207657_10014211 3300025919 Bacteria 7784
548 Ga0207657_10017472 3300025919 Bacteria 6875
549 Ga0207657_10031010 3300025919 Bacteria 4847
550 Ga0207657_10040580 3300025919 Bacteria 4122
551 Ga0207657_10044849 3300025919 Bacteria 3884
552 Ga0207657_10045431 3300025919 Bacteria 3855
553 Ga0207657_10148942 3300025919 Bacteria 1907
554 Ga0207657_10175354 3300025919 Bacteria 1735
555 Ga0207657_10243919 3300025919 Bacteria 1434
556 Ga0207657_10245547 3300025919 Bacteria 1428
557 Ga0207657_10263266 3300025919 Unclassified 1372
558 Ga0207657_10492318 3300025919 Bacteria 961
559 Ga0207649_10004210 3300025920 Bacteria 7836
560 Ga0207649_10035552 3300025920 Bacteria 2994
561 Ga0207649_10035583 3300025920 Bacteria 2993
562 Ga0207649_10046878 3300025920 Bacteria 2657
563 Ga0207649_10089696 3300025920 Bacteria 2010
564 Ga0207649_10091741 3300025920 Bacteria 1990
565 Ga0207649_10161231 3300025920 Bacteria 1554
566 Ga0207652_10014820 3300025921 Bacteria 6321
567 Ga0207652_10234653 3300025921 Bacteria 1653
568 Ga0207652_10245211 3300025921 Bacteria 1615
569 Ga0207681_10044337 3300025923 Bacteria 2980
570 Ga0207681_10080381 3300025923 Bacteria 2299
571 Ga0207694_10007832 3300025924 Bacteria 8090
572 Ga0207694_10061872 3300025924 Bacteria 2914
573 Ga0207694_10121717 3300025924 Bacteria 2084
574 Ga0207650_10001178 3300025925 Bacteria 19210
575 Ga0207650_10010874 3300025925 Bacteria 6253
576 Ga0207650_10018736 3300025925 Bacteria 4861
577 Ga0207650_10029150 3300025925 Bacteria 3964
578 Ga0207650_10040177 3300025925 Bacteria 3421
579 Ga0207650_10041703 3300025925 Bacteria 3365
580 Ga0207650_10126069 3300025925 Bacteria 1999
581 Ga0207650_10138287 3300025925 Bacteria 1913
582 Ga0207650_10147707 3300025925 Bacteria 1853
583 Ga0207659_10005396 3300025926 Bacteria 7743
584 Ga0207659_10019830 3300025926 Bacteria 4433
585 Ga0207659_10022827 3300025926 Bacteria 4170
586 Ga0207659_10026000 3300025926 Bacteria 3943
587 Ga0207659_10036608 3300025926 Bacteria 3401
588 Ga0207659_10081491 3300025926 Bacteria 2393
589 Ga0207659_10386862 3300025926 Bacteria 1167
590 Ga0207687_10000899 3300025927 Bacteria 20227
591 Ga0207687_10030308 3300025927 Bacteria 3647
592 Ga0207687_10115375 3300025927 Bacteria 2001
593 Ga0207687_10178354 3300025927 Bacteria 1644
594 Ga0207700_10027074 3300025928 Bacteria 4009
595 Ga0207700_10146015 3300025928 Bacteria 1949
596 Ga0207664_10003705 3300025929 Bacteria 10245
597 Ga0207664_10094392 3300025929 Bacteria 2458
598 Ga0207644_10000135 3300025931 Bacteria 53131
599 Ga0207644_10003132 3300025931 Bacteria 10653
600 Ga0207644_10011767 3300025931 Bacteria 5792
601 Ga0207644_10011879 3300025931 Bacteria 5772
602 Ga0207644_10029120 3300025931 Bacteria 3828
603 Ga0207644_10034692 3300025931 Bacteria 3532
604 Ga0207644_10110317 3300025931 Bacteria 2079
605 Ga0207644_10316841 3300025931 Bacteria 1260
606 Ga0207690_10004247 3300025932 Bacteria 8465
607 Ga0207690_10005603 3300025932 Bacteria 7421
608 Ga0207690_10020183 3300025932 Bacteria 4113
609 Ga0207690_10031963 3300025932 Bacteria 3373
610 Ga0207690_10113502 3300025932 Bacteria 1955
611 Ga0207690_10118996 3300025932 Bacteria 1915
612 Ga0207706_10000020 3300025933 Bacteria 162063
613 Ga0207706_10002559 3300025933 Bacteria 17732
614 Ga0207706_10006178 3300025933 Bacteria 11123
615 Ga0207706_10007937 3300025933 Bacteria 9797
616 Ga0207706_10010553 3300025933 Bacteria 8439
617 Ga0207706_10013013 3300025933 Bacteria 7572
618 Ga0207706_10017823 3300025933 Bacteria 6396
619 Ga0207706_10024600 3300025933 Bacteria 5399
620 Ga0207706_10025629 3300025933 Bacteria 5282
621 Ga0207706_10037891 3300025933 Bacteria 4278
622 Ga0207706_10037929 3300025933 Bacteria 4276
623 Ga0207706_10038918 3300025933 Bacteria 4218
624 Ga0207706_10041370 3300025933 Bacteria 4085
625 Ga0207706_10090981 3300025933 Bacteria 2683
626 Ga0207706_10097907 3300025933 Bacteria 2580
627 Ga0207706_10112829 3300025933 Bacteria 2391
628 Ga0207706_10148206 3300025933 Bacteria 2064
629 Ga0207706_10219199 3300025933 Bacteria 1666
630 Ga0207706_10233283 3300025933 Bacteria 1609
631 Ga0207706_10248378 3300025933 Bacteria 1555
632 Ga0207706_10313479 3300025933 Bacteria 1366
633 Ga0207706_10384527 3300025933 Bacteria 1218
634 Ga0207706_10577852 3300025933 Bacteria 966
635 Ga0207686_10134817 3300025934 Bacteria 1699
636 Ga0207686_10166013 3300025934 Bacteria 1552
637 Ga0207709_10033052 3300025935 Bacteria 3034
638 Ga0207669_10006996 3300025937 Bacteria 5189
639 Ga0207669_10040242 3300025937 Bacteria 2710
640 Ga0207669_10041599 3300025937 Bacteria 2676
641 Ga0207669_10070130 3300025937 Bacteria 2196
642 Ga0207669_10074198 3300025937 Bacteria 2150
643 Ga0207669_10278378 3300025937 Bacteria 1260
644 Ga0207704_10011660 3300025938 Bacteria 4337
645 Ga0207704_10020346 3300025938 Bacteria 3509
646 Ga0207704_10048673 3300025938 Bacteria 2543
647 Ga0207704_10143548 3300025938 Bacteria 1674
648 Ga0207704_10508549 3300025938 Bacteria 972
649 Ga0207665_10115100 3300025939 Bacteria 1894
650 Ga0207665_10121470 3300025939 Bacteria 1846
651 Ga0207691_10000133 3300025940 Bacteria 68368
652 Ga0207691_10002368 3300025940 Bacteria 18465
653 Ga0207691_10007876 3300025940 Bacteria 10263
654 Ga0207691_10013203 3300025940 Bacteria 7910
655 Ga0207691_10030931 3300025940 Bacteria 4999
656 Ga0207691_10037001 3300025940 Bacteria 4521
657 Ga0207691_10051976 3300025940 Bacteria 3744
658 Ga0207691_10076950 3300025940 Bacteria 3007
659 Ga0207691_10111110 3300025940 Bacteria 2437
660 Ga0207691_10466874 3300025940 Bacteria 1073
661 Ga0207691_10539532 3300025940 Bacteria 989
662 Ga0207711_10000107 3300025941 Bacteria 87146
663 Ga0207711_10000543 3300025941 Bacteria 38517
664 Ga0207711_10001496 3300025941 Bacteria 21764
665 Ga0207711_10001711 3300025941 Bacteria 20192
666 Ga0207711_10002235 3300025941 Bacteria 17366
667 Ga0207711_10003051 3300025941 Bacteria 14636
668 Ga0207711_10003726 3300025941 Bacteria 13140
669 Ga0207711_10004444 3300025941 Bacteria 11952
670 Ga0207711_10083191 3300025941 Bacteria 2799
671 Ga0207711_10209316 3300025941 Unclassified 1781
672 Ga0207711_10454557 3300025941 Bacteria 1192
673 Ga0207689_10000002 3300025942 Bacteria 198437
674 Ga0207689_10003262 3300025942 Bacteria 14871
675 Ga0207689_10019276 3300025942 Bacteria 5751
676 Ga0207661_10002460 3300025944 Bacteria 12728
677 Ga0207661_10039512 3300025944 Bacteria 3703
678 Ga0207679_10003893 3300025945 Bacteria 9259
679 Ga0207679_10005368 3300025945 Bacteria 8035
680 Ga0207679_10044121 3300025945 Bacteria 3215
681 Ga0207679_10046901 3300025945 Bacteria 3135
682 Ga0207679_10047868 3300025945 Bacteria 3109
683 Ga0207679_10052921 3300025945 Bacteria 2980
684 Ga0207679_10110973 3300025945 Bacteria 2164
685 Ga0207679_10144404 3300025945 Bacteria 1928
686 Ga0207679_10176475 3300025945 Bacteria 1764
687 Ga0207679_10260201 3300025945 Bacteria 1480
688 Ga0207679_10508568 3300025945 Bacteria 1076
689 Ga0207667_10023065 3300025949 Bacteria 6858
690 Ga0207667_10037156 3300025949 Bacteria 5208
691 Ga0207667_10076813 3300025949 Bacteria 3465
692 Ga0207667_10087122 3300025949 Bacteria 3230
693 Ga0207667_10185603 3300025949 Bacteria 2135
694 Ga0207667_10214887 3300025949 Bacteria 1971
695 Ga0207667_10601584 3300025949 Bacteria 1109
696 Ga0207651_10001472 3300025960 Bacteria 10708
697 Ga0207651_10002855 3300025960 Bacteria 8324
698 Ga0207651_10019925 3300025960 Bacteria 4034
699 Ga0207651_10021057 3300025960 Bacteria 3952
700 Ga0207651_10081593 3300025960 Bacteria 2331
701 Ga0207651_10308062 3300025960 Bacteria 1319
702 Ga0207712_10000195 3300025961 Bacteria 62560
703 Ga0207712_10135091 3300025961 Bacteria 1885
704 Ga0207712_10218705 3300025961 Bacteria 1522
705 Ga0207668_10000176 3300025972 Bacteria 43587
706 Ga0207668_10022305 3300025972 Bacteria 4051
707 Ga0207668_10079916 3300025972 Bacteria 2367
708 Ga0207668_10082301 3300025972 Bacteria 2338
709 Ga0207668_10397456 3300025972 Bacteria 1164
710 Ga0207640_10002835 3300025981 Bacteria 9301
711 Ga0207640_10011803 3300025981 Bacteria 4958
712 Ga0207640_10013090 3300025981 Bacteria 4745
713 Ga0207640_10028910 3300025981 Bacteria 3396
714 Ga0207640_10054601 3300025981 Bacteria 2613
715 Ga0207640_10071155 3300025981 Bacteria 2341
716 Ga0207640_10073015 3300025981 Unclassified 2317
717 Ga0207640_10130215 3300025981 Bacteria 1818
718 Ga0207640_10135423 3300025981 Bacteria 1787
719 Ga0207658_10002281 3300025986 Bacteria 14178
720 Ga0207658_10004177 3300025986 Bacteria 10062
721 Ga0207658_10005694 3300025986 Bacteria 8521
722 Ga0207658_10009770 3300025986 Bacteria 6515
723 Ga0207658_10012484 3300025986 Bacteria 5804
724 Ga0207658_10053329 3300025986 Bacteria 2987
725 Ga0207658_10068747 3300025986 Bacteria 2674
726 Ga0207658_10080767 3300025986 Bacteria 2491
727 Ga0207658_10091107 3300025986 Bacteria 2364
728 Ga0207658_10123470 3300025986 Bacteria 2068
729 Ga0207658_10193044 3300025986 Bacteria 1694
730 Ga0207658_10237628 3300025986 Bacteria 1541
731 Ga0207677_10002392 3300026023 Bacteria 9830
732 Ga0207677_10015775 3300026023 Bacteria 4455
733 Ga0207677_10034695 3300026023 Bacteria 3269
734 Ga0207677_10098925 3300026023 Bacteria 2141
735 Ga0207677_10271920 3300026023 Bacteria 1386
736 Ga0207677_10347166 3300026023 Bacteria 1242
737 Ga0207677_10383509 3300026023 Bacteria 1187
738 Ga0207677_10437238 3300026023 Bacteria 1118
739 Ga0207703_10000327 3300026035 Bacteria 51797
740 Ga0207703_10001701 3300026035 Bacteria 19778
741 Ga0207703_10003896 3300026035 Bacteria 12393
742 Ga0207703_10015295 3300026035 Bacteria 5985
743 Ga0207703_10015361 3300026035 Bacteria 5972
744 Ga0207703_10091979 3300026035 Bacteria 2552
745 Ga0207703_10095097 3300026035 Bacteria 2513
746 Ga0207639_10015038 3300026041 Bacteria 5450
747 Ga0207639_10026235 3300026041 Bacteria 4233
748 Ga0207639_10026556 3300026041 Bacteria 4208
749 Ga0207639_10029438 3300026041 Bacteria 4020
750 Ga0207639_10056995 3300026041 Bacteria 2998
751 Ga0207639_10108556 3300026041 Bacteria 2256
752 Ga0207639_10266809 3300026041 Bacteria 1500
753 Ga0207639_10543258 3300026041 Bacteria 1066
754 Ga0207678_10004189 3300026067 Bacteria 12946
755 Ga0207678_10004258 3300026067 Bacteria 12830
756 Ga0207678_10005341 3300026067 Bacteria 11504
757 Ga0207678_10006809 3300026067 Bacteria 10136
758 Ga0207678_10010475 3300026067 Bacteria 8143
759 Ga0207678_10014855 3300026067 Bacteria 6850
760 Ga0207678_10031647 3300026067 Bacteria 4614
761 Ga0207678_10033586 3300026067 Bacteria 4469
762 Ga0207678_10043667 3300026067 Bacteria 3878
763 Ga0207678_10050123 3300026067 Bacteria 3607
764 Ga0207678_10089836 3300026067 Bacteria 2625
765 Ga0207678_10114073 3300026067 Bacteria 2306
766 Ga0207708_10490678 3300026075 Bacteria 1028
767 Ga0207702_10017313 3300026078 Bacteria 5962
768 Ga0207702_10019757 3300026078 Bacteria 5578
769 Ga0207702_10171809 3300026078 Bacteria 1988
770 Ga0207702_10334006 3300026078 Bacteria 1446
771 Ga0207641_10000138 3300026088 Bacteria 106531
772 Ga0207641_10007958 3300026088 Bacteria 8783
773 Ga0207641_10035838 3300026088 Bacteria 4137
774 Ga0207641_10043214 3300026088 Bacteria 3783
775 Ga0207641_10106860 3300026088 Bacteria 2474
776 Ga0207641_10454254 3300026088 Bacteria 1239
777 Ga0207648_10000088 3300026089 Bacteria 86596
778 Ga0207648_10002364 3300026089 Bacteria 20360
779 Ga0207648_10006357 3300026089 Bacteria 11746
780 Ga0207648_10007110 3300026089 Bacteria 11043
781 Ga0207648_10139243 3300026089 Bacteria 2138
782 Ga0207648_10171055 3300026089 Bacteria 1920
783 Ga0207648_10252238 3300026089 Bacteria 1573
784 Ga0207676_10000245 3300026095 Bacteria 47297
785 Ga0207676_10003364 3300026095 Bacteria 11313
786 Ga0207676_10091060 3300026095 Bacteria 2504
787 Ga0207676_10112014 3300026095 Bacteria 2285
788 Ga0207676_10179519 3300026095 Bacteria 1852
789 Ga0207676_10291756 3300026095 Bacteria 1485
790 Ga0207674_10000065 3300026116 Bacteria 109485
791 Ga0207674_10001363 3300026116 Bacteria 31621
792 Ga0207674_10002644 3300026116 Bacteria 22388
793 Ga0207674_10004380 3300026116 Bacteria 17015
794 Ga0207674_10009197 3300026116 Bacteria 11325
795 Ga0207674_10009547 3300026116 Bacteria 11069
796 Ga0207674_10015599 3300026116 Bacteria 8342
797 Ga0207674_10057996 3300026116 Bacteria 3924
798 Ga0207674_10065368 3300026116 Bacteria 3666
799 Ga0207674_10099350 3300026116 Bacteria 2893
800 Ga0207675_100034448 3300026118 Bacteria 4722
801 Ga0207675_100235673 3300026118 Bacteria 1767
802 Ga0207675_100824641 3300026118 Bacteria 942
803 Ga0207683_10005286 3300026121 Bacteria 11078
804 Ga0207683_10025793 3300026121 Bacteria 5071
805 Ga0207683_10029343 3300026121 Bacteria 4762
806 Ga0207683_10032732 3300026121 Bacteria 4516
807 Ga0207683_10197151 3300026121 Bacteria 1830
808 Ga0207683_10355416 3300026121 Bacteria 1345
809 Ga0207698_10000701 3300026142 Bacteria 19473
810 Ga0207698_10005578 3300026142 Bacteria 7784
811 Ga0207698_10040576 3300026142 Bacteria 3461
812 Ga0207698_10067498 3300026142 Bacteria 2820
813 Ga0207698_10098106 3300026142 Bacteria 2420
814 Ga0207698_10261432 3300026142 Bacteria 1590
815 Ga0207698_10287824 3300026142 Bacteria 1523
816 Ga0207698_10649001 3300026142 Bacteria 1045
817 Ga0207698_10656844 3300026142 Bacteria 1039
818 Ga0210002_1011703 3300027617 Bacteria 1358
819 Ga0209974_10037740 3300027876 Bacteria 1604
820 Ga0268266_10000332 3300028379 Bacteria 74181
821 Ga0268266_10201734 3300028379 Bacteria 1820
822 Ga0268266_10283172 3300028379 Bacteria 1542
823 Ga0268266_10541734 3300028379 Bacteria 1114
824 Ga0268266_10638062 3300028379 Bacteria 1024
825 Ga0268266_10668994 3300028379 Bacteria 1000
826 Ga0268265_10002345 3300028380 Bacteria 14358
827 Ga0268265_10003839 3300028380 Bacteria 10635
828 Ga0268265_10012425 3300028380 Bacteria 5771
829 Ga0268265_10020542 3300028380 Bacteria 4609
830 Ga0268265_10063659 3300028380 Bacteria 2838
831 Ga0268265_10120128 3300028380 Bacteria 2163
832 Ga0268265_10250175 3300028380 Bacteria 1569
833 Ga0268264_10000644 3300028381 Bacteria 41159
834 Ga0268264_10001156 3300028381 Bacteria 25715
835 Ga0268264_10016134 3300028381 Bacteria 6119
836 Ga0268264_10018719 3300028381 Bacteria 5663
837 Ga0268264_10047635 3300028381 Bacteria 3563
838 Ga0268264_10055347 3300028381 Bacteria 3315
839 Ga0307513_10227254 3300031456 Bacteria 1681
840 Ga0307408_100119242 3300031548 Bacteria 2041
841 Ga0307408_100188036 3300031548 Bacteria 1661
842 Ga0307408_100373120 3300031548 Bacteria 1217
843 Ga0307405_10004772 3300031731 Bacteria 6461
844 Ga0307405_10015098 3300031731 Bacteria 4172
845 Ga0307405_10044520 3300031731 Bacteria 2715
846 Ga0307405_10058144 3300031731 Bacteria 2432
847 Ga0307405_10115165 3300031731 Bacteria 1828
848 Ga0307405_10383404 3300031731 Bacteria 1095
849 Ga0307413_10003721 3300031824 Bacteria 6488
850 Ga0307413_10063312 3300031824 Bacteria 2292
851 Ga0307413_10109806 3300031824 Bacteria 1844
852 Ga0307413_10116342 3300031824 Bacteria 1801
853 Ga0307413_10301333 3300031824 Bacteria 1215
854 Ga0307413_10366595 3300031824 Bacteria 1117
855 Ga0307410_10000196 3300031852 Bacteria 22538
856 Ga0307410_10000537 3300031852 Bacteria 15549
857 Ga0307410_10015712 3300031852 Bacteria 4498
858 Ga0307410_10024837 3300031852 Bacteria 3749
859 Ga0307410_10027374 3300031852 Bacteria 3603
860 Ga0307410_10038646 3300031852 Bacteria 3128
861 Ga0307410_10165041 3300031852 Bacteria 1663
862 Ga0307410_10307986 3300031852 Bacteria 1252
863 Ga0307410_10459307 3300031852 Bacteria 1040
864 Ga0307406_10047666 3300031901 Bacteria 2702
865 Ga0307406_10278144 3300031901 Bacteria 1275
866 Ga0307406_10281584 3300031901 Bacteria 1268
867 Ga0307406_10309463 3300031901 Bacteria 1217
868 Ga0307407_10010569 3300031903 Bacteria 4360
869 Ga0307407_10038715 3300031903 Bacteria 2645
870 Ga0307407_10096333 3300031903 Bacteria 1826
871 Ga0307407_10139115 3300031903 Bacteria 1564
872 Ga0307407_10373387 3300031903 Bacteria 1016
873 Ga0307412_10016705 3300031911 Bacteria 4377
874 Ga0307412_10023269 3300031911 Bacteria 3810
875 Ga0307412_10228519 3300031911 Bacteria 1431
876 Ga0307412_10314523 3300031911 Bacteria 1243
877 Ga0307409_100004899 3300031995 Bacteria 7614
878 Ga0307409_100039334 3300031995 Bacteria 3508
879 Ga0307409_100100155 3300031995 Bacteria 2401
880 Ga0307409_100127426 3300031995 Bacteria 2168
881 Ga0307409_100127836 3300031995 Bacteria 2165
882 Ga0307409_100378879 3300031995 Bacteria 1344
883 Ga0307409_100681024 3300031995 Bacteria 1025
884 Ga0307416_100083287 3300032002 Bacteria 2713
885 Ga0307416_100183199 3300032002 Bacteria 1965
886 Ga0307416_100313143 3300032002 Bacteria 1567
887 Ga0307416_100375558 3300032002 Bacteria 1449
888 Ga0307416_100409533 3300032002 Bacteria 1396
889 Ga0307416_100411816 3300032002 Bacteria 1393
890 Ga0307416_100477490 3300032002 Bacteria 1306
891 Ga0307414_10130022 3300032004 Bacteria 1953
892 Ga0307414_10287069 3300032004 Bacteria 1385
893 Ga0307414_10526957 3300032004 Bacteria 1049
894 Ga0307411_10000314 3300032005 Bacteria 16195
895 Ga0307411_10000577 3300032005 Bacteria 13099
896 Ga0307411_10001878 3300032005 Bacteria 8950
897 Ga0307411_10023318 3300032005 Bacteria 3663
898 Ga0307411_10042622 3300032005 Bacteria 2897
899 Ga0307411_10215982 3300032005 Bacteria 1484
900 Ga0307411_10240765 3300032005 Bacteria 1416
901 Ga0307411_10452093 3300032005 Bacteria 1075
902 Ga0307411_10538208 3300032005 Bacteria 994
903 Ga0307415_100002988 3300032126 Bacteria 8502
904 Ga0307415_100005774 3300032126 Bacteria 6604
905 Ga0307415_100009570 3300032126 Bacteria 5442
906 Ga0307415_100093324 3300032126 Bacteria 2185
907 Ga0307415_100247987 3300032126 Bacteria 1445
908 Ga0307415_100289470 3300032126 Bacteria 1351
909 Ga0307415_100377435 3300032126 Bacteria 1202
910 Ga0307415_100460017 3300032126 Bacteria 1102
911 Ga0307415_100647943 3300032126 Bacteria 946
912 Ga0373940_0046785 3300035088 Bacteria 1205
913 Ga0373931_0116522 3300035691 Bacteria 1522
914 Ga0373935_0007844 3300035692 Bacteria 6402
915 Ga0373947_0243845 3300035725 Bacteria 1186
916 Ga0373925_0004938 3300037068 Bacteria 10027
917 Ga0395899_0003120 3300037312 Bacteria 13202
918 Ga0395899_0005947 3300037312 Bacteria 9476
919 Ga0395899_0007898 3300037312 Bacteria 8195
920 Ga0395899_0037734 3300037312 Bacteria 3621
921 Ga0395899_0084612 3300037312 Bacteria 2305
922 Ga0395899_0113403 3300037312 Bacteria 1947
923 Ga0395899_0222125 3300037312 Bacteria 1308
924 Ga0395899_0271607 3300037312 Bacteria 1156
925 Ga0395900_0004188 3300037418 Bacteria 15315
926 Ga0395900_0022469 3300037418 Bacteria 6451
927 Ga0395900_0035574 3300037418 Bacteria 5130
928 Ga0395900_0082383 3300037418 Bacteria 3306
929 Ga0395900_0090444 3300037418 Bacteria 3146
930 Ga0395900_0102814 3300037418 Bacteria 2935
931 Ga0395900_0110341 3300037418 Bacteria 2826
932 Ga0395900_0117132 3300037418 Bacteria 2733
933 Ga0395900_0187652 3300037418 Bacteria 2098
934 Ga0395900_0200573 3300037418 Bacteria 2019
935 Ga0395900_0226160 3300037418 Bacteria 1884
936 Ga0395900_0300045 3300037418 Unclassified 1593
937 Ga0395900_0340483 3300037418 Bacteria 1475
938 Ga0395900_0366909 3300037418 Bacteria 1410
939 Ga0395900_0556165 3300037418 Bacteria 1091
940 Ga0395900_0627211 3300037418 Bacteria 1013
941 Ga0395898_0002464 3300037466 Bacteria 21836
942 Ga0395898_0009147 3300037466 Bacteria 10437
943 Ga0395898_0009764 3300037466 Bacteria 10057
944 Ga0395898_0044225 3300037466 Bacteria 4386
945 Ga0395898_0064526 3300037466 Bacteria 3552
946 Ga0395898_0069858 3300037466 Bacteria 3397
947 Ga0395898_0085484 3300037466 Bacteria 3040
948 Ga0395898_0097169 3300037466 Bacteria 2829
949 Ga0395898_0100792 3300037466 Bacteria 2773
950 Ga0395898_0151047 3300037466 Bacteria 2222
951 Ga0395898_0449319 3300037466 Bacteria 1227
952 Ga0395898_0511199 3300037466 Unclassified 1142
953 Ga0395905_0000793 3300037471 Bacteria 41518
954 Ga0395905_0000886 3300037471 Bacteria 39025
955 Ga0395905_0000958 3300037471 Bacteria 37063
956 Ga0395905_0004516 3300037471 Bacteria 14418
957 Ga0395905_0006083 3300037471 Bacteria 12197
958 Ga0395905_0008116 3300037471 Bacteria 10374
959 Ga0395905_0009274 3300037471 Bacteria 9626
960 Ga0395905_0010495 3300037471 Bacteria 9008
961 Ga0395905_0024182 3300037471 Bacteria 5733
962 Ga0395905_0029756 3300037471 Bacteria 5147
963 Ga0395905_0031344 3300037471 Bacteria 5005
964 Ga0395905_0032596 3300037471 Bacteria 4899
965 Ga0395905_0044096 3300037471 Bacteria 4185
966 Ga0395905_0052427 3300037471 Bacteria 3819
967 Ga0395905_0072295 3300037471 Bacteria 3233
968 Ga0395905_0076035 3300037471 Bacteria 3146
969 Ga0395905_0139333 3300037471 Bacteria 2282
970 Ga0395905_0154657 3300037471 Bacteria 2157
971 Ga0395905_0172184 3300037471 Bacteria 2033
972 Ga0395905_0179693 3300037471 Bacteria 1986
973 Ga0395905_0212880 3300037471 Bacteria 1810
974 Ga0395905_0268326 3300037471 Bacteria 1592
975 Ga0395905_0277683 3300037471 Bacteria 1561
976 Ga0395905_0304085 3300037471 Bacteria 1482
977 Ga0395905_0331705 3300037471 Bacteria 1412
978 Ga0395905_0358125 3300037471 Bacteria 1351
979 Ga0395905_0398194 3300037471 Bacteria 1272
980 Ga0395905_0497954 3300037471 Bacteria 1118
981 Ga0395905_0498010 3300037471 Bacteria 1118
982 Ga0395905_0522555 3300037471 Bacteria 1087
983 Ga0436364_0512909 3300037853 Bacteria 13452
984 Ga0395901_0001342 3300038443 Bacteria 25807
985 Ga0395901_0005101 3300038443 Bacteria 13266
986 Ga0395901_0006716 3300038443 Bacteria 11626
987 Ga0395901_0042906 3300038443 Bacteria 4691
988 Ga0395901_0044056 3300038443 Bacteria 4628
989 Ga0395901_0049993 3300038443 Bacteria 4344
990 Ga0395901_0073852 3300038443 Bacteria 3557
991 Ga0395901_0175067 3300038443 Bacteria 2251
992 Ga0395901_0292420 3300038443 Bacteria 1690
993 Ga0395901_0318573 3300038443 Bacteria 1609
994 Ga0395901_0348111 3300038443 Bacteria 1529
995 Ga0395901_0619224 3300038443 Bacteria 1089
996 Ga0395901_0766916 3300038443 Unclassified 956
997 Ga0395901_0880702 3300038443 Bacteria 878
998 Ga0436365_1036392 3300039437 Bacteria 7696
999 Ga0439448_0007024 3300042005 Bacteria 3251
1000 Ga0439432_020678 3300042006 Bacteria 2185
1001 Ga0439449_0023653 3300042007 Bacteria 2297
1002 Ga0439455_0047310 3300042012 Bacteria 1116
1003 Ga0450890_003850 3300042127 Bacteria 1977
1004 Ga0450889_000018 3300042144 Bacteria 14192
1005 Ga0439458_0001542 3300042157 Bacteria 5758
1006 Ga0439458_0023257 3300042157 Bacteria 1444
1007 Ga0439464_0018202 3300042439 Bacteria 1910
1008 Ga0466969_0182579 3300044656 Unclassified 960
1009 Ga0466972_0051722 3300044658 Bacteria 1981
1010 Ga0466972_0108614 3300044658 Bacteria 1311
1011 Ga0466965_0028394 3300044683 Bacteria 2719
1012 Ga0466966_0160776 3300044684 Bacteria 1367
1013 Ga0466961_0130005 3300044693 Bacteria 1578
1014 Ga0466963_0045368 3300044694 Bacteria 2895
1015 Ga0466963_0185564 3300044694 Bacteria 1453
1016 Ga0466964_0051973 3300044706 Bacteria 1683
1017 Ga0466964_0115206 3300044706 Bacteria 1204
1018 Ga0466970_0105543 3300044765 Unclassified 1536
1019 Ga0466957_0020054 3300044842 Bacteria 3934
1020 Ga0466957_0060528 3300044842 Bacteria 2322
1021 Ga0466957_0145952 3300044842 Bacteria 1527
1022 Ga0466960_0041111 3300044901 Bacteria 2189
1023 Ga0466960_0277887 3300044901 Unclassified 938
1024 Ga0466959_0105669 3300045049 Bacteria 2013
1025 Ga0466958_0023072 3300045836 Bacteria 3649
1026 Ga0466958_0206169 3300045836 Bacteria 1252
1027 Ga0466967_0067557 3300045976 Bacteria 3189
1028 Ga0466967_0144782 3300045976 Bacteria 2216
1029 Ga0466967_0213440 3300045976 Unclassified 1831
1030 Ga0466967_0264746 3300045976 Bacteria 1645
1031 Ga0466967_0422564 3300045976 Bacteria 1299
1032 Ga0495620_0108762 3300046515 Bacteria 1100
1033 Ga0495663_0002264 3300046525 Bacteria 5848
1034 Ga0495621_0000081 3300046539 Bacteria 19404
1035 Ga0495621_0002061 3300046539 Bacteria 5319
1036 Ga0495621_0011164 3300046539 Bacteria 2770
1037 Ga0495633_0003855 3300046558 Bacteria 9803
1038 Ga0495633_0065176 3300046558 Bacteria 1703
1039 Ga0495668_0008525 3300046616 Bacteria 6383
1040 Ga0495668_0010487 3300046616 Bacteria 5605
1041 Ga0495661_0017672 3300046665 Bacteria 4706
1042 Ga0495669_0002139 3300046684 Bacteria 8108
1043 Ga0495669_0003400 3300046684 Bacteria 6545
1044 Ga0495669_0003874 3300046684 Bacteria 6155
1045 Ga0495669_0004827 3300046684 Bacteria 5594
1046 Ga0495669_0005572 3300046684 Bacteria 5254
1047 Ga0495669_0020550 3300046684 Bacteria 2859
1048 Ga0495669_0054404 3300046684 Bacteria 1801
1049 Ga0495669_0122239 3300046684 Bacteria 1221
1050 Ga0495669_0133487 3300046684 Bacteria 1169
1051 Ga0495670_0001717 3300046691 Bacteria 10783
1052 Ga0495677_0004198 3300047445 Bacteria 5556
1053 Ga0495677_0040317 3300047445 Unclassified 1708
1054 Ga0495677_0064434 3300047445 Bacteria 1362
1055 Ga0495677_0068693 3300047445 Bacteria 1319
1056 Ga0496100_0004354 3300048903 Bacteria 7497
1057 Ga0496101_0003296 3300048904 Bacteria 10044
1058 Ga0496101_0166347 3300048904 Bacteria 1693
1059 Ga0496101_0208039 3300048904 Bacteria 1515
1060 Ga0496101_0312892 3300048904 Bacteria 1231
1061 Ga0496102_0096131 3300048905 Bacteria 2746
1062 Ga0496102_0136919 3300048905 Bacteria 2295
1063 Ga0496103_0014132 3300048906 Bacteria 4739
1064 Ga0496103_0080737 3300048906 Bacteria 2045
1065 Ga0496103_0135747 3300048906 Bacteria 1572
1066 Ga0496105_0007221 3300048908 Bacteria 8579
1067 Ga0496106_0058387 3300048909 Bacteria 2921
1068 Ga0496107_0010084 3300048910 Bacteria 6553
1069 Ga0496107_0020379 3300048910 Bacteria 4683
1070 Ga0496107_0039646 3300048910 Bacteria 3379
1071 Ga0496108_0000946 3300048911 Bacteria 22575
1072 Ga0496108_0003253 3300048911 Bacteria 13057
1073 Ga0496108_0008368 3300048911 Bacteria 8392
1074 Ga0496108_0044873 3300048911 Bacteria 3691
1075 Ga0496108_0047185 3300048911 Bacteria 3600
1076 Ga0496108_0128989 3300048911 Bacteria 2173
1077 Ga0496109_0017156 3300048912 Bacteria 6339
1078 Ga0496109_0019073 3300048912 Bacteria 6039
1079 Ga0496109_0030312 3300048912 Bacteria 4849
1080 Ga0496109_0047689 3300048912 Bacteria 3895
1081 Ga0496109_0090286 3300048912 Bacteria 2833
1082 Ga0496109_0103793 3300048912 Bacteria 2639
1083 Ga0496109_0152044 3300048912 Bacteria 2167
1084 Ga0496109_0393572 3300048912 Bacteria 1309
1085 Ga0496110_0001109 3300048913 Bacteria 19003
1086 Ga0496110_0003761 3300048913 Bacteria 11691
1087 Ga0496111_0002605 3300048914 Bacteria 10918
1088 Ga0496111_0006647 3300048914 Bacteria 7523
1089 Ga0496111_0012157 3300048914 Bacteria 5822
1090 Ga0496111_0087072 3300048914 Bacteria 2286
1091 Ga0496111_0177994 3300048914 Bacteria 1581
1092 Ga0496112_0015539 3300048915 Bacteria 7108
1093 Ga0496112_0026334 3300048915 Bacteria 5593
1094 Ga0496112_0030363 3300048915 Bacteria 5229
1095 Ga0496112_0274273 3300048915 Bacteria 1634
1096 Ga0496112_0338893 3300048915 Bacteria 1447
1097 Ga0496113_0001095 3300048916 Bacteria 14658
1098 Ga0496113_0004673 3300048916 Bacteria 8451
1099 Ga0496113_0037030 3300048916 Bacteria 3577
1100 Ga0496113_0191880 3300048916 Bacteria 1621
1101 Ga0496114_0000006 3300048917 Bacteria 472921
1102 Ga0496114_0016874 3300048917 Bacteria 5888
1103 Ga0496114_0022415 3300048917 Bacteria 5148
1104 Ga0496114_0250837 3300048917 Bacteria 1557
1105 Ga0496115_0001032 3300048918 Bacteria 20227
1106 Ga0501067_0018792 3300049583 Bacteria 3826
1107 Ga0501069_0180985 3300049585 Bacteria 1218
1108 Ga0501072_0635151 3300049588 Bacteria 841
1109 Ga0501223_025995 3300049663 Bacteria 1139
1110 Ga0501233_043510 3300049668 Bacteria 1064
1111 Ga0501243_019847 3300049675 Bacteria 1103
1112 Ga0501257_036995 3300049686 Bacteria 1190
1113 Ga0501225_0042681 3300049705 Bacteria 1253
1114 Ga0501234_015312 3300049707 Bacteria 1207
1115 Ga0501262_006024 3300049759 Bacteria 1443
1116 Ga0501268_003298 3300049765 Bacteria 2199
1117 nmdc:mga00v17_88258_c1 3300050491 Bacteria 1944
1118 nmdc:mga09592_467587_c1 3300050508 Bacteria 1087
1119 nmdc:mga08y16_253769_c1 3300050511 Bacteria 1817
1120 nmdc:mga0a205_696_c1 3300050515 Bacteria 26947
1121 Ga0495655_0007056 3300053083 Bacteria 2071
1122 Ga0500658_0000022 3300053134 Bacteria 129341
1123 Ga0587071_035743 3300060344 Unclassified 977
1124 Ga0466962_0019296 3300061719 Bacteria 3275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049705 Ga0501225_0042681 Ga0501225_0042681_440_1180 240
2 3300005616 Ga0068852_100001650 Ga0068852_1000016505 243
3 3300005366 Ga0070659_100363926 Ga0070659_1003639262 244
4 3300037471 Ga0395905_0304085 Ga0395905_0304085_737_1471 244
5 3300037471 Ga0395905_0358125 Ga0395905_0358125_12_746 244
6 3300037312 Ga0395899_0005947 Ga0395899_0005947_1677_2525 245
7 3300037418 Ga0395900_0004188 Ga0395900_0004188_7582_8430 245
8 3300037466 Ga0395898_0002464 Ga0395898_0002464_12648_13496 245
9 3300038443 Ga0395901_0001342 Ga0395901_0001342_11637_12485 245
10 3300044765 Ga0466970_0105543 Ga0466970_0105543_755_1498 245
11 3300045976 Ga0466967_0213440 Ga0466967_0213440_1051_1794 245
12 3300037312 Ga0395899_0003120 Ga0395899_0003120_7145_7987 247
13 3300037418 Ga0395900_0117132 Ga0395900_0117132_1646_2488 247
14 3300037466 Ga0395898_0069858 Ga0395898_0069858_223_1065 247
15 3300037466 Ga0395898_0085484 Ga0395898_0085484_937_1779 247
16 3300037471 Ga0395905_0072295 Ga0395905_0072295_336_1178 247
17 3300037471 Ga0395905_0139333 Ga0395905_0139333_390_1232 247
18 3300005344 Ga0070661_100014629 Ga0070661_1000146292 249
19 3300005614 Ga0068856_100162492 Ga0068856_1001624923 249
20 3300005616 Ga0068852_100178848 Ga0068852_1001788482 249
21 3300005618 Ga0068864_100001503 Ga0068864_1000015034 249
22 3300005841 Ga0068863_100026719 Ga0068863_1000267194 249
23 3300009177 Ga0105248_10003561 Ga0105248_1000356114 249
24 3300013296 Ga0157374_10124608 Ga0157374_101246083 249
25 3300025919 Ga0207657_10014211 Ga0207657_100142112 249
26 3300025925 Ga0207650_10138287 Ga0207650_101382873 249
27 3300025931 Ga0207644_10000135 Ga0207644_1000013542 249
28 3300025941 Ga0207711_10002235 Ga0207711_1000223513 249
29 3300026078 Ga0207702_10171809 Ga0207702_101718092 249
30 3300026088 Ga0207641_10035838 Ga0207641_100358384 249
31 3300026142 Ga0207698_10287824 Ga0207698_102878242 249
32 3300048915 Ga0496112_0338893 Ga0496112_0338893_408_1247 249
33 3300049675 Ga0501243_019847 Ga0501243_019847_217_1059 249
34 3300005329 Ga0070683_100020099 Ga0070683_1000200997 250
35 3300005336 Ga0070680_100023129 Ga0070680_1000231293 250
36 3300005339 Ga0070660_100017761 Ga0070660_1000177615 250
37 3300005458 Ga0070681_10047943 Ga0070681_100479434 250
38 3300005530 Ga0070679_100018589 Ga0070679_1000185894 250
39 3300005563 Ga0068855_100095847 Ga0068855_1000958474 250
40 3300013105 Ga0157369_10243301 Ga0157369_102433012 250
41 3300013307 Ga0157372_10120967 Ga0157372_101209672 250
42 3300025912 Ga0207707_10063252 Ga0207707_100632525 250
43 3300025917 Ga0207660_10033154 Ga0207660_100331542 250
44 3300025919 Ga0207657_10031010 Ga0207657_100310106 250
45 3300025921 Ga0207652_10014820 Ga0207652_100148205 250
46 3300025949 Ga0207667_10214887 Ga0207667_102148873 250
47 3300025981 Ga0207640_10130215 Ga0207640_101302152 250
48 3300026067 Ga0207678_10006809 Ga0207678_100068092 250
49 3300037471 Ga0395905_0006083 Ga0395905_0006083_3768_4616 250
50 3300012510 Ga0157316_1001696 Ga0157316_10016962 251
51 3300048911 Ga0496108_0044873 Ga0496108_0044873_479_1324 251
52 3300048912 Ga0496109_0030312 Ga0496109_0030312_1513_2358 251
53 3300048914 Ga0496111_0087072 Ga0496111_0087072_1025_1870 251
54 3300048915 Ga0496112_0026334 Ga0496112_0026334_406_1251 251
55 3300048916 Ga0496113_0037030 Ga0496113_0037030_316_1161 251
56 3300049663 Ga0501223_025995 Ga0501223_025995_122_964 251
57 3300049668 Ga0501233_043510 Ga0501233_043510_84_926 251
58 3300001979 JGI24740J21852_10008900 JGI24740J21852_100089003 252
59 3300005327 Ga0070658_10016046 Ga0070658_100160466 253
60 3300005834 Ga0068851_10048496 Ga0068851_100484962 253
61 3300025909 Ga0207705_10080789 Ga0207705_100807893 253
62 3300038443 Ga0395901_0880702 Ga0395901_0880702_100_864 253
63 3300048911 Ga0496108_0008368 Ga0496108_0008368_1317_2159 253
64 3300048912 Ga0496109_0019073 Ga0496109_0019073_4572_5414 253
65 3300048914 Ga0496111_0006647 Ga0496111_0006647_5445_6287 253
66 3300048916 Ga0496113_0191880 Ga0496113_0191880_335_1177 253
67 3300005367 Ga0070667_100089940 Ga0070667_1000899403 254
68 3300009177 Ga0105248_10804786 Ga0105248_108047861 254
69 3300013296 Ga0157374_10073128 Ga0157374_100731284 254
70 3300025986 Ga0207658_10068747 Ga0207658_100687472 254
71 3300028379 Ga0268266_10541734 Ga0268266_105417342 254
72 3300028379 Ga0268266_10638062 Ga0268266_106380622 254
73 3300044842 Ga0466957_0020054 Ga0466957_0020054_1842_2693 254
74 3300044901 Ga0466960_0277887 Ga0466960_0277887_55_894 254
75 3300048915 Ga0496112_0274273 Ga0496112_0274273_287_1129 254
76 3300060344 Ga0587071_035743 Ga0587071_035743_55_897 254
77 3300005335 Ga0070666_10028217 Ga0070666_100282172 255
78 3300005367 Ga0070667_100007452 Ga0070667_1000074525 255
79 3300005578 Ga0068854_100239021 Ga0068854_1002390212 255
80 3300005985 Ga0081539_10012171 Ga0081539_100121714 255
81 3300013105 Ga0157369_10003544 Ga0157369_100035447 255
82 3300025961 Ga0207712_10218705 Ga0207712_102187052 255
83 3300025986 Ga0207658_10053329 Ga0207658_100533292 255
84 3300028380 Ga0268265_10250175 Ga0268265_102501752 255
85 3300031901 Ga0307406_10281584 Ga0307406_102815842 255
86 3300031903 Ga0307407_10139115 Ga0307407_101391151 255
87 3300031995 Ga0307409_100100155 Ga0307409_1001001554 255
88 3300005435 Ga0070714_100099690 Ga0070714_1000996903 256
89 3300005578 Ga0068854_100031971 Ga0068854_1000319713 256
90 3300009545 Ga0105237_10302849 Ga0105237_103028492 256
91 3300010375 Ga0105239_10388017 Ga0105239_103880172 256
92 3300013105 Ga0157369_10165984 Ga0157369_101659842 256
93 3300025913 Ga0207695_10151392 Ga0207695_101513922 256
94 3300025949 Ga0207667_10076813 Ga0207667_100768133 256
95 3300046558 Ga0495633_0065176 Ga0495633_0065176_294_1142 256
96 3300005327 Ga0070658_10024782 Ga0070658_100247824 257
97 3300013104 Ga0157370_10015351 Ga0157370_100153519 257
98 3300013104 Ga0157370_10183781 Ga0157370_101837812 257
99 3300025909 Ga0207705_10005118 Ga0207705_100051184 257
100 3300005331 Ga0070670_100113799 Ga0070670_1001137993 258
101 3300031824 Ga0307413_10366595 Ga0307413_103665952 258
102 3300031852 Ga0307410_10015712 Ga0307410_100157124 258
103 3300032002 Ga0307416_100411816 Ga0307416_1004118162 258
104 3300032005 Ga0307411_10001878 Ga0307411_100018786 258
105 3300032126 Ga0307415_100009570 Ga0307415_1000095706 258
106 3300032005 Ga0307411_10023318 Ga0307411_100233183 259
107 3300005844 Ga0068862_100002790 Ga0068862_10000279010 260
108 3300028380 Ga0268265_10002345 Ga0268265_1000234510 260
109 3300005327 Ga0070658_10079178 Ga0070658_100791782 261
110 3300005339 Ga0070660_100095606 Ga0070660_1000956063 261
111 3300005344 Ga0070661_100113588 Ga0070661_1001135882 261
112 3300005355 Ga0070671_100099574 Ga0070671_1000995743 261
113 3300005530 Ga0070679_100282324 Ga0070679_1002823242 261
114 3300005563 Ga0068855_100172857 Ga0068855_1001728573 261
115 3300005564 Ga0070664_100210748 Ga0070664_1002107483 261
116 3300005564 Ga0070664_100250049 Ga0070664_1002500492 261
117 3300005614 Ga0068856_100117762 Ga0068856_1001177623 261
118 3300005616 Ga0068852_100116423 Ga0068852_1001164233 261
119 3300025909 Ga0207705_10050714 Ga0207705_100507144 261
120 3300025921 Ga0207652_10234653 Ga0207652_102346532 261
121 3300025949 Ga0207667_10185603 Ga0207667_101856032 261
122 3300026142 Ga0207698_10656844 Ga0207698_106568441 261
123 3300037471 Ga0395905_0212880 Ga0395905_0212880_244_1095 261
124 3300005355 Ga0070671_100004394 Ga0070671_10000439413 262
125 3300044658 Ga0466972_0051722 Ga0466972_0051722_61_918 262
126 3300048917 Ga0496114_0016874 Ga0496114_0016874_4020_4862 262
127 3300048918 Ga0496115_0001032 Ga0496115_0001032_12613_13455 262
128 3300003320 rootH2_10078034 rootH2_100780342 263
129 3300031456 Ga0307513_10227254 Ga0307513_102272542 263
130 3300001990 JGI24737J22298_10020665 JGI24737J22298_100206653 264
131 3300005339 Ga0070660_100019076 Ga0070660_1000190763 264
132 3300005539 Ga0068853_100020292 Ga0068853_1000202924 264
133 3300005543 Ga0070672_100071824 Ga0070672_1000718244 264
134 3300005563 Ga0068855_100025338 Ga0068855_1000253382 264
135 3300025919 Ga0207657_10013132 Ga0207657_100131325 264
136 3300025933 Ga0207706_10041370 Ga0207706_100413704 264
137 3300025940 Ga0207691_10037001 Ga0207691_100370014 264
138 3300025949 Ga0207667_10087122 Ga0207667_100871224 264
139 3300025961 Ga0207712_10000195 Ga0207712_1000019521 264
140 3300025972 Ga0207668_10397456 Ga0207668_103974561 264
141 3300026041 Ga0207639_10026235 Ga0207639_100262353 264
142 3300028381 Ga0268264_10001156 Ga0268264_100011564 264
143 3300005457 Ga0070662_100345172 Ga0070662_1003451722 265
144 3300013105 Ga0157369_10273658 Ga0157369_102736582 265
145 3300025900 Ga0207710_10095528 Ga0207710_100955281 265
146 3300025933 Ga0207706_10097907 Ga0207706_100979073 265
147 3300001979 JGI24740J21852_10017908 JGI24740J21852_100179084 266
148 3300005327 Ga0070658_10075997 Ga0070658_100759971 266
149 3300005329 Ga0070683_100057473 Ga0070683_1000574731 266
150 3300005455 Ga0070663_100124560 Ga0070663_1001245602 266
151 3300005535 Ga0070684_100006344 Ga0070684_1000063448 266
152 3300005539 Ga0068853_100102407 Ga0068853_1001024071 266
153 3300005563 Ga0068855_100500508 Ga0068855_1005005082 266
154 3300005564 Ga0070664_100022999 Ga0070664_1000229992 266
155 3300009551 Ga0105238_10599926 Ga0105238_105999262 266
156 3300013104 Ga0157370_10329157 Ga0157370_103291572 266
157 3300013307 Ga0157372_10136055 Ga0157372_101360552 266
158 3300025321 Ga0207656_10012456 Ga0207656_100124562 266
159 3300025919 Ga0207657_10011912 Ga0207657_100119126 266
160 3300025944 Ga0207661_10002460 Ga0207661_100024602 266
161 3300025945 Ga0207679_10144404 Ga0207679_101444043 266
162 3300025981 Ga0207640_10013090 Ga0207640_100130905 266
163 3300026041 Ga0207639_10026556 Ga0207639_100265562 266
164 3300026067 Ga0207678_10031647 Ga0207678_100316475 266
165 3300026078 Ga0207702_10017313 Ga0207702_100173136 266
166 3300026116 Ga0207674_10009547 Ga0207674_100095475 266
167 3300026142 Ga0207698_10261432 Ga0207698_102614322 266
168 3300031903 Ga0307407_10373387 Ga0307407_103733871 266
169 3300031995 Ga0307409_100378879 Ga0307409_1003788792 266
170 3300037418 Ga0395900_0627211 Ga0395900_0627211_195_995 266
171 3300038443 Ga0395901_0619224 Ga0395901_0619224_38_838 266
172 3300001979 JGI24740J21852_10001189 JGI24740J21852_100011894 267
173 3300048910 Ga0496107_0010084 Ga0496107_0010084_20_829 267
174 3300010375 Ga0105239_10649291 Ga0105239_106492912 268
175 3300011119 Ga0105246_10093511 Ga0105246_100935112 268
176 3300014968 Ga0157379_10118826 Ga0157379_101188263 268
177 3300037466 Ga0395898_0511199 Ga0395898_0511199_243_1085 268
178 3300037471 Ga0395905_0029756 Ga0395905_0029756_2523_3365 268
179 3300037471 Ga0395905_0398194 Ga0395905_0398194_248_1078 268
180 3300048904 Ga0496101_0166347 Ga0496101_0166347_39_869 268
181 3300048905 Ga0496102_0096131 Ga0496102_0096131_1129_1959 268
182 3300049588 Ga0501072_0635151 Ga0501072_0635151_12_821 268
183 3300001915 JGI24741J21665_1009337 JGI24741J21665_10093372 271
184 3300002067 JGI24735J21928_10008880 JGI24735J21928_100088802 271
185 3300005577 Ga0068857_100008558 Ga0068857_1000085586 271
186 3300005578 Ga0068854_100008675 Ga0068854_1000086755 271
187 3300006237 Ga0097621_100033930 Ga0097621_1000339302 271
188 3300006358 Ga0068871_100017299 Ga0068871_1000172992 271
189 3300009545 Ga0105237_10057753 Ga0105237_100577533 271
190 3300009551 Ga0105238_10037891 Ga0105238_100378913 271
191 3300010375 Ga0105239_10274328 Ga0105239_102743282 271
192 3300013100 Ga0157373_10014037 Ga0157373_100140375 271
193 3300013105 Ga0157369_10140985 Ga0157369_101409854 271
194 3300013307 Ga0157372_10354435 Ga0157372_103544353 271
195 3300025904 Ga0207647_10021448 Ga0207647_100214485 271
196 3300025909 Ga0207705_10064533 Ga0207705_100645333 271
197 3300026067 Ga0207678_10005341 Ga0207678_100053415 271
198 3300026116 Ga0207674_10009197 Ga0207674_100091977 271
199 3300048909 Ga0496106_0058387 Ga0496106_0058387_1801_2640 271
200 3300048911 Ga0496108_0000946 Ga0496108_0000946_18285_19124 271
201 3300048914 Ga0496111_0012157 Ga0496111_0012157_944_1783 271
202 3300005345 Ga0070692_10079536 Ga0070692_100795362 272
203 3300005535 Ga0070684_100261382 Ga0070684_1002613822 272
204 3300005577 Ga0068857_100107040 Ga0068857_1001070404 272
205 3300013102 Ga0157371_10102510 Ga0157371_101025103 272
206 3300025919 Ga0207657_10045431 Ga0207657_100454315 272
207 3300025933 Ga0207706_10037929 Ga0207706_100379293 272
208 3300026041 Ga0207639_10543258 Ga0207639_105432582 272
209 3300037471 Ga0395905_0154657 Ga0395905_0154657_437_1279 272
210 3300048904 Ga0496101_0208039 Ga0496101_0208039_14_835 272
211 3300037312 Ga0395899_0271607 Ga0395899_0271607_169_1020 273
212 3300037418 Ga0395900_0102814 Ga0395900_0102814_1988_2839 273
213 3300037471 Ga0395905_0331705 Ga0395905_0331705_107_958 273
214 3300038443 Ga0395901_0766916 Ga0395901_0766916_44_895 273
215 3300045976 Ga0466967_0067557 Ga0466967_0067557_86_928 273
216 3300009177 Ga0105248_10300796 Ga0105248_103007962 274
217 3300037466 Ga0395898_0449319 Ga0395898_0449319_326_1168 274
218 3300037471 Ga0395905_0268326 Ga0395905_0268326_371_1213 274
219 3300048906 Ga0496103_0014132 Ga0496103_0014132_578_1408 274
220 3300048912 Ga0496109_0017156 Ga0496109_0017156_429_1259 274
221 3300048915 Ga0496112_0015539 Ga0496112_0015539_3896_4726 274
222 3300048916 Ga0496113_0004673 Ga0496113_0004673_4040_4870 274
223 3300044656 Ga0466969_0182579 Ga0466969_0182579_66_911 275
224 3300005355 Ga0070671_100133549 Ga0070671_1001335493 276
225 3300005618 Ga0068864_100246477 Ga0068864_1002464772 276
226 3300013308 Ga0157375_10026310 Ga0157375_100263106 276
227 3300017792 Ga0163161_10184028 Ga0163161_101840282 276
228 3300021388 Ga0213875_10002752 Ga0213875_100027528 276
229 3300025315 Ga0207697_10063340 Ga0207697_100633401 276
230 3300025925 Ga0207650_10147707 Ga0207650_101477072 276
231 3300037853 Ga0436364_0512909 Ga0436364_0512909_8098_8952 276
232 3300048912 Ga0496109_0103793 Ga0496109_0103793_1100_1972 276
233 3300048914 Ga0496111_0177994 Ga0496111_0177994_655_1512 276
234 3300048917 Ga0496114_0022415 Ga0496114_0022415_4126_4983 276
235 3300005344 Ga0070661_100069006 Ga0070661_1000690063 277
236 3300005366 Ga0070659_100048069 Ga0070659_1000480694 277
237 3300005367 Ga0070667_100004350 Ga0070667_1000043506 277
238 3300005834 Ga0068851_10014094 Ga0068851_100140945 277
239 3300025919 Ga0207657_10040580 Ga0207657_100405802 277
240 3300025920 Ga0207649_10161231 Ga0207649_101612312 277
241 3300025932 Ga0207690_10020183 Ga0207690_100201834 277
242 3300025945 Ga0207679_10047868 Ga0207679_100478682 277
243 3300025986 Ga0207658_10080767 Ga0207658_100807672 277
244 3300026088 Ga0207641_10007958 Ga0207641_100079586 277
245 3300037418 Ga0395900_0022469 Ga0395900_0022469_1007_1849 277
246 3300037471 Ga0395905_0004516 Ga0395905_0004516_5415_6257 277
247 3300038443 Ga0395901_0175067 Ga0395901_0175067_931_1773 277
248 3300005327 Ga0070658_10106531 Ga0070658_101065313 278
249 3300005328 Ga0070676_10090397 Ga0070676_100903972 278
250 3300005330 Ga0070690_100019106 Ga0070690_1000191066 278
251 3300005331 Ga0070670_100100769 Ga0070670_1001007691 278
252 3300005335 Ga0070666_10000693 Ga0070666_100006932 278
253 3300005337 Ga0070682_100064589 Ga0070682_1000645893 278
254 3300005338 Ga0068868_100001623 Ga0068868_1000016234 278
255 3300005338 Ga0068868_100039816 Ga0068868_1000398164 278
256 3300005339 Ga0070660_100070548 Ga0070660_1000705483 278
257 3300005344 Ga0070661_100003112 Ga0070661_10000311210 278
258 3300005344 Ga0070661_100430926 Ga0070661_1004309261 278
259 3300005355 Ga0070671_100005300 Ga0070671_1000053008 278
260 3300005366 Ga0070659_100029971 Ga0070659_1000299714 278
261 3300005366 Ga0070659_100043855 Ga0070659_1000438553 278
262 3300005367 Ga0070667_100011342 Ga0070667_1000113427 278
263 3300005367 Ga0070667_100187455 Ga0070667_1001874552 278
264 3300005434 Ga0070709_10160962 Ga0070709_101609623 278
265 3300005444 Ga0070694_100357715 Ga0070694_1003577152 278
266 3300005455 Ga0070663_100003483 Ga0070663_1000034834 278
267 3300005457 Ga0070662_100095202 Ga0070662_1000952023 278
268 3300005457 Ga0070662_100157406 Ga0070662_1001574062 278
269 3300005530 Ga0070679_100261802 Ga0070679_1002618023 278
270 3300005539 Ga0068853_100024862 Ga0068853_1000248624 278
271 3300005543 Ga0070672_100060757 Ga0070672_1000607572 278
272 3300005546 Ga0070696_100005700 Ga0070696_1000057002 278
273 3300005548 Ga0070665_100741008 Ga0070665_1007410081 278
274 3300005564 Ga0070664_100001064 Ga0070664_10000106413 278
275 3300005718 Ga0068866_10004933 Ga0068866_100049331 278
276 3300005834 Ga0068851_10002427 Ga0068851_100024273 278
277 3300005834 Ga0068851_10188092 Ga0068851_101880922 278
278 3300005842 Ga0068858_100000855 Ga0068858_10000085532 278
279 3300006237 Ga0097621_100429698 Ga0097621_1004296982 278
280 3300006844 Ga0075428_100281751 Ga0075428_1002817513 278
281 3300009094 Ga0111539_10037205 Ga0111539_100372056 278
282 3300013296 Ga0157374_10237893 Ga0157374_102378933 278
283 3300013307 Ga0157372_10270453 Ga0157372_102704533 278
284 3300025321 Ga0207656_10094168 Ga0207656_100941682 278
285 3300025903 Ga0207680_10001868 Ga0207680_100018685 278
286 3300025904 Ga0207647_10007018 Ga0207647_1000701810 278
287 3300025907 Ga0207645_10007529 Ga0207645_100075296 278
288 3300025909 Ga0207705_10002578 Ga0207705_100025784 278
289 3300025909 Ga0207705_10110620 Ga0207705_101106202 278
290 3300025909 Ga0207705_10148127 Ga0207705_101481272 278
291 3300025917 Ga0207660_10212018 Ga0207660_102120182 278
292 3300025919 Ga0207657_10044849 Ga0207657_100448492 278
293 3300025920 Ga0207649_10035583 Ga0207649_100355834 278
294 3300025921 Ga0207652_10245211 Ga0207652_102452112 278
295 3300025925 Ga0207650_10126069 Ga0207650_101260693 278
296 3300025931 Ga0207644_10011879 Ga0207644_100118794 278
297 3300025933 Ga0207706_10024600 Ga0207706_100246005 278
298 3300025933 Ga0207706_10090981 Ga0207706_100909813 278
299 3300025933 Ga0207706_10233283 Ga0207706_102332832 278
300 3300025934 Ga0207686_10134817 Ga0207686_101348173 278
301 3300025938 Ga0207704_10143548 Ga0207704_101435482 278
302 3300025938 Ga0207704_10508549 Ga0207704_105085491 278
303 3300025940 Ga0207691_10111110 Ga0207691_101111103 278
304 3300025941 Ga0207711_10000107 Ga0207711_1000010738 278
305 3300025981 Ga0207640_10071155 Ga0207640_100711553 278
306 3300025986 Ga0207658_10009770 Ga0207658_100097704 278
307 3300026023 Ga0207677_10002392 Ga0207677_100023929 278
308 3300026023 Ga0207677_10098925 Ga0207677_100989252 278
309 3300026035 Ga0207703_10001701 Ga0207703_1000170116 278
310 3300026041 Ga0207639_10108556 Ga0207639_101085562 278
311 3300026067 Ga0207678_10004258 Ga0207678_100042584 278
312 3300026067 Ga0207678_10010475 Ga0207678_100104755 278
313 3300026078 Ga0207702_10334006 Ga0207702_103340062 278
314 3300026116 Ga0207674_10065368 Ga0207674_100653681 278
315 3300026142 Ga0207698_10098106 Ga0207698_100981063 278
316 3300028379 Ga0268266_10283172 Ga0268266_102831721 278
317 3300031824 Ga0307413_10003721 Ga0307413_100037214 278
318 3300031852 Ga0307410_10000196 Ga0307410_100001967 278
319 3300031903 Ga0307407_10010569 Ga0307407_100105693 278
320 3300031995 Ga0307409_100004899 Ga0307409_1000048995 278
321 3300032004 Ga0307414_10130022 Ga0307414_101300222 278
322 3300032005 Ga0307411_10000577 Ga0307411_100005774 278
323 3300037312 Ga0395899_0084612 Ga0395899_0084612_1100_1942 278
324 3300037418 Ga0395900_0556165 Ga0395900_0556165_100_942 278
325 3300037466 Ga0395898_0100792 Ga0395898_0100792_1546_2388 278
326 3300037471 Ga0395905_0010495 Ga0395905_0010495_3541_4383 278
327 3300037471 Ga0395905_0052427 Ga0395905_0052427_281_1123 278
328 3300037471 Ga0395905_0277683 Ga0395905_0277683_219_1061 278
329 3300038443 Ga0395901_0348111 Ga0395901_0348111_174_1016 278
330 3300042127 Ga0450890_003850 Ga0450890_003850_652_1494 278
331 3300042144 Ga0450889_000018 Ga0450889_000018_7131_7973 278
332 3300044658 Ga0466972_0108614 Ga0466972_0108614_214_1056 278
333 3300044683 Ga0466965_0028394 Ga0466965_0028394_379_1221 278
334 3300044684 Ga0466966_0160776 Ga0466966_0160776_156_998 278
335 3300044694 Ga0466963_0045368 Ga0466963_0045368_1810_2652 278
336 3300044694 Ga0466963_0185564 Ga0466963_0185564_49_888 278
337 3300044706 Ga0466964_0115206 Ga0466964_0115206_220_1062 278
338 3300044842 Ga0466957_0145952 Ga0466957_0145952_334_1173 278
339 3300045836 Ga0466958_0023072 Ga0466958_0023072_1981_2823 278
340 3300045836 Ga0466958_0206169 Ga0466958_0206169_242_1084 278
341 3300045976 Ga0466967_0264746 Ga0466967_0264746_381_1223 278
342 3300045976 Ga0466967_0422564 Ga0466967_0422564_194_1033 278
343 3300046684 Ga0495669_0133487 Ga0495669_0133487_137_976 278
344 3300050508 nmdc:mga09592_467587_c1 nmdc:mga09592_467587_c1_108_950 278
345 3300050511 nmdc:mga08y16_253769_c1 nmdc:mga08y16_253769_c1_912_1754 278
346 3300061719 Ga0466962_0019296 Ga0466962_0019296_905_1747 278
347 3300001904 JGI24736J21556_1007046 JGI24736J21556_10070463 279
348 3300001979 JGI24740J21852_10000927 JGI24740J21852_100009276 279
349 3300001979 JGI24740J21852_10001800 JGI24740J21852_100018007 279
350 3300001989 JGI24739J22299_10023516 JGI24739J22299_100235163 279
351 3300001990 JGI24737J22298_10000009 JGI24737J22298_1000000939 279
352 3300001990 JGI24737J22298_10036552 JGI24737J22298_100365522 279
353 3300002075 JGI24738J21930_10000008 JGI24738J21930_1000000829 279
354 3300002075 JGI24738J21930_10015019 JGI24738J21930_100150192 279
355 3300002244 JGI24742J22300_10006655 JGI24742J22300_100066553 279
356 3300005290 Ga0065712_10211065 Ga0065712_102110651 279
357 3300005327 Ga0070658_10028976 Ga0070658_100289763 279
358 3300005327 Ga0070658_10032303 Ga0070658_100323035 279
359 3300005327 Ga0070658_10221135 Ga0070658_102211352 279
360 3300005327 Ga0070658_10323268 Ga0070658_103232682 279
361 3300005328 Ga0070676_10001397 Ga0070676_1000139710 279
362 3300005328 Ga0070676_10004565 Ga0070676_100045655 279
363 3300005328 Ga0070676_10032598 Ga0070676_100325984 279
364 3300005330 Ga0070690_100051948 Ga0070690_1000519484 279
365 3300005330 Ga0070690_100085000 Ga0070690_1000850003 279
366 3300005331 Ga0070670_100007469 Ga0070670_1000074697 279
367 3300005331 Ga0070670_100010185 Ga0070670_1000101854 279
368 3300005331 Ga0070670_100011249 Ga0070670_1000112497 279
369 3300005331 Ga0070670_100029796 Ga0070670_1000297965 279
370 3300005331 Ga0070670_100246707 Ga0070670_1002467072 279
371 3300005333 Ga0070677_10088829 Ga0070677_100888292 279
372 3300005334 Ga0068869_100000682 Ga0068869_10000068211 279
373 3300005335 Ga0070666_10016668 Ga0070666_100166683 279
374 3300005335 Ga0070666_10020583 Ga0070666_100205834 279
375 3300005335 Ga0070666_10021573 Ga0070666_100215732 279
376 3300005338 Ga0068868_100001982 Ga0068868_1000019828 279
377 3300005338 Ga0068868_100002627 Ga0068868_10000262710 279
378 3300005338 Ga0068868_100022547 Ga0068868_1000225473 279
379 3300005338 Ga0068868_100174963 Ga0068868_1001749632 279
380 3300005339 Ga0070660_100004492 Ga0070660_1000044929 279
381 3300005339 Ga0070660_100006146 Ga0070660_1000061469 279
382 3300005339 Ga0070660_100012527 Ga0070660_1000125275 279
383 3300005339 Ga0070660_100388541 Ga0070660_1003885411 279
384 3300005344 Ga0070661_100057256 Ga0070661_1000572563 279
385 3300005344 Ga0070661_100076964 Ga0070661_1000769642 279
386 3300005344 Ga0070661_100128282 Ga0070661_1001282822 279
387 3300005347 Ga0070668_100000324 Ga0070668_10000032412 279
388 3300005347 Ga0070668_100058019 Ga0070668_1000580192 279
389 3300005353 Ga0070669_100000128 Ga0070669_10000012813 279
390 3300005353 Ga0070669_100021655 Ga0070669_1000216554 279
391 3300005353 Ga0070669_100117874 Ga0070669_1001178742 279
392 3300005353 Ga0070669_100256447 Ga0070669_1002564472 279
393 3300005353 Ga0070669_100513514 Ga0070669_1005135141 279
394 3300005354 Ga0070675_100008335 Ga0070675_1000083356 279
395 3300005354 Ga0070675_100044938 Ga0070675_1000449385 279
396 3300005354 Ga0070675_100049898 Ga0070675_1000498984 279
397 3300005354 Ga0070675_100102642 Ga0070675_1001026422 279
398 3300005354 Ga0070675_100598446 Ga0070675_1005984461 279
399 3300005355 Ga0070671_100007225 Ga0070671_1000072257 279
400 3300005355 Ga0070671_100024620 Ga0070671_1000246206 279
401 3300005355 Ga0070671_100044818 Ga0070671_1000448181 279
402 3300005355 Ga0070671_100164399 Ga0070671_1001643992 279
403 3300005355 Ga0070671_100314303 Ga0070671_1003143032 279
404 3300005356 Ga0070674_100027368 Ga0070674_1000273683 279
405 3300005356 Ga0070674_100126273 Ga0070674_1001262732 279
406 3300005364 Ga0070673_100000204 Ga0070673_10000020423 279
407 3300005364 Ga0070673_100014743 Ga0070673_1000147432 279
408 3300005364 Ga0070673_100041818 Ga0070673_1000418183 279
409 3300005364 Ga0070673_100043357 Ga0070673_1000433573 279
410 3300005364 Ga0070673_100060032 Ga0070673_1000600323 279
411 3300005364 Ga0070673_100064668 Ga0070673_1000646684 279
412 3300005364 Ga0070673_100334441 Ga0070673_1003344412 279
413 3300005365 Ga0070688_100243776 Ga0070688_1002437761 279
414 3300005366 Ga0070659_100003498 Ga0070659_1000034984 279
415 3300005366 Ga0070659_100018067 Ga0070659_1000180675 279
416 3300005366 Ga0070659_100018589 Ga0070659_1000185896 279
417 3300005367 Ga0070667_100001539 Ga0070667_1000015391 279
418 3300005367 Ga0070667_100001793 Ga0070667_1000017932 279
419 3300005367 Ga0070667_100095007 Ga0070667_1000950072 279
420 3300005435 Ga0070714_100058491 Ga0070714_1000584913 279
421 3300005435 Ga0070714_100171234 Ga0070714_1001712342 279
422 3300005436 Ga0070713_100003021 Ga0070713_1000030219 279
423 3300005436 Ga0070713_100159781 Ga0070713_1001597813 279
424 3300005455 Ga0070663_100010497 Ga0070663_1000104975 279
425 3300005455 Ga0070663_100017843 Ga0070663_1000178433 279
426 3300005455 Ga0070663_100154549 Ga0070663_1001545492 279
427 3300005456 Ga0070678_100057677 Ga0070678_1000576773 279
428 3300005456 Ga0070678_100355557 Ga0070678_1003555571 279
429 3300005457 Ga0070662_100002026 Ga0070662_1000020261 279
430 3300005457 Ga0070662_100009542 Ga0070662_1000095425 279
431 3300005457 Ga0070662_100011887 Ga0070662_1000118875 279
432 3300005457 Ga0070662_100028722 Ga0070662_1000287223 279
433 3300005457 Ga0070662_100032041 Ga0070662_1000320414 279
434 3300005457 Ga0070662_100039513 Ga0070662_1000395132 279
435 3300005457 Ga0070662_100265782 Ga0070662_1002657822 279
436 3300005459 Ga0068867_100000045 Ga0068867_10000004543 279
437 3300005459 Ga0068867_100001601 Ga0068867_10000160113 279
438 3300005459 Ga0068867_100020790 Ga0068867_1000207902 279
439 3300005459 Ga0068867_100143773 Ga0068867_1001437733 279
440 3300005466 Ga0070685_10113018 Ga0070685_101130182 279
441 3300005535 Ga0070684_100109922 Ga0070684_1001099223 279
442 3300005539 Ga0068853_100000162 Ga0068853_10000016239 279
443 3300005539 Ga0068853_100099446 Ga0068853_1000994463 279
444 3300005539 Ga0068853_100182471 Ga0068853_1001824713 279
445 3300005543 Ga0070672_100000041 Ga0070672_10000004136 279
446 3300005543 Ga0070672_100009120 Ga0070672_1000091203 279
447 3300005543 Ga0070672_100070955 Ga0070672_1000709552 279
448 3300005543 Ga0070672_100081210 Ga0070672_1000812102 279
449 3300005543 Ga0070672_100124558 Ga0070672_1001245583 279
450 3300005544 Ga0070686_100087219 Ga0070686_1000872192 279
451 3300005548 Ga0070665_100000670 Ga0070665_10000067044 279
452 3300005548 Ga0070665_100008070 Ga0070665_1000080703 279
453 3300005548 Ga0070665_100079327 Ga0070665_1000793272 279
454 3300005548 Ga0070665_100141760 Ga0070665_1001417603 279
455 3300005548 Ga0070665_100143633 Ga0070665_1001436332 279
456 3300005563 Ga0068855_100025033 Ga0068855_1000250332 279
457 3300005563 Ga0068855_100755012 Ga0068855_1007550122 279
458 3300005564 Ga0070664_100002825 Ga0070664_10000282512 279
459 3300005564 Ga0070664_100003970 Ga0070664_1000039704 279
460 3300005564 Ga0070664_100005597 Ga0070664_1000055974 279
461 3300005564 Ga0070664_100588265 Ga0070664_1005882652 279
462 3300005577 Ga0068857_100011442 Ga0068857_1000114422 279
463 3300005577 Ga0068857_100180807 Ga0068857_1001808072 279
464 3300005578 Ga0068854_100000542 Ga0068854_10000054219 279
465 3300005578 Ga0068854_100008742 Ga0068854_1000087424 279
466 3300005578 Ga0068854_100088238 Ga0068854_1000882383 279
467 3300005578 Ga0068854_100088800 Ga0068854_1000888003 279
468 3300005578 Ga0068854_100208982 Ga0068854_1002089822 279
469 3300005616 Ga0068852_100001814 Ga0068852_10000181412 279
470 3300005616 Ga0068852_100002219 Ga0068852_1000022199 279
471 3300005616 Ga0068852_100006345 Ga0068852_1000063454 279
472 3300005616 Ga0068852_100170861 Ga0068852_1001708611 279
473 3300005617 Ga0068859_100000088 Ga0068859_10000008837 279
474 3300005617 Ga0068859_100008386 Ga0068859_1000083864 279
475 3300005617 Ga0068859_100024951 Ga0068859_1000249515 279
476 3300005618 Ga0068864_100000047 Ga0068864_1000000472 279
477 3300005618 Ga0068864_100000136 Ga0068864_10000013664 279
478 3300005618 Ga0068864_100033704 Ga0068864_1000337044 279
479 3300005618 Ga0068864_100369152 Ga0068864_1003691522 279
480 3300005834 Ga0068851_10008521 Ga0068851_100085215 279
481 3300005834 Ga0068851_10040820 Ga0068851_100408203 279
482 3300005834 Ga0068851_10069288 Ga0068851_100692883 279
483 3300005841 Ga0068863_100001560 Ga0068863_10000156018 279
484 3300005841 Ga0068863_100005004 Ga0068863_1000050043 279
485 3300005841 Ga0068863_100025790 Ga0068863_1000257906 279
486 3300005842 Ga0068858_100000063 Ga0068858_10000006323 279
487 3300005842 Ga0068858_100000631 Ga0068858_10000063122 279
488 3300005842 Ga0068858_100043316 Ga0068858_1000433162 279
489 3300005842 Ga0068858_100084023 Ga0068858_1000840233 279
490 3300005842 Ga0068858_100112990 Ga0068858_1001129904 279
491 3300005843 Ga0068860_100005063 Ga0068860_1000050635 279
492 3300005843 Ga0068860_100050559 Ga0068860_1000505596 279
493 3300005843 Ga0068860_100055986 Ga0068860_1000559864 279
494 3300005843 Ga0068860_100249863 Ga0068860_1002498633 279
495 3300005843 Ga0068860_100296765 Ga0068860_1002967653 279
496 3300005844 Ga0068862_100018105 Ga0068862_1000181054 279
497 3300005844 Ga0068862_100024321 Ga0068862_1000243216 279
498 3300005844 Ga0068862_100064548 Ga0068862_1000645484 279
499 3300006028 Ga0070717_10054255 Ga0070717_100542554 279
500 3300006173 Ga0070716_100040631 Ga0070716_1000406313 279
501 3300006173 Ga0070716_100075028 Ga0070716_1000750283 279
502 3300006175 Ga0070712_100078484 Ga0070712_1000784842 279
503 3300006237 Ga0097621_100049456 Ga0097621_1000494563 279
504 3300006237 Ga0097621_100075669 Ga0097621_1000756693 279
505 3300006358 Ga0068871_100039990 Ga0068871_1000399904 279
506 3300006358 Ga0068871_100100016 Ga0068871_1001000163 279
507 3300006358 Ga0068871_100284431 Ga0068871_1002844313 279
508 3300006871 Ga0075434_100399034 Ga0075434_1003990341 279
509 3300006881 Ga0068865_100000528 Ga0068865_10000052810 279
510 3300006881 Ga0068865_100014020 Ga0068865_1000140203 279
511 3300006931 Ga0097620_100000088 Ga0097620_10000008837 279
512 3300006931 Ga0097620_100008386 Ga0097620_1000083868 279
513 3300006931 Ga0097620_100024951 Ga0097620_1000249515 279
514 3300009092 Ga0105250_10008858 Ga0105250_100088582 279
515 3300009098 Ga0105245_10000062 Ga0105245_1000006233 279
516 3300009098 Ga0105245_10020038 Ga0105245_100200385 279
517 3300009101 Ga0105247_10120037 Ga0105247_101200373 279
518 3300009148 Ga0105243_10044298 Ga0105243_100442984 279
519 3300009176 Ga0105242_10241403 Ga0105242_102414032 279
520 3300009177 Ga0105248_10000122 Ga0105248_1000012219 279
521 3300009177 Ga0105248_10000169 Ga0105248_1000016929 279
522 3300009177 Ga0105248_10039564 Ga0105248_100395643 279
523 3300009177 Ga0105248_10114740 Ga0105248_101147404 279
524 3300009177 Ga0105248_10430047 Ga0105248_104300472 279
525 3300009551 Ga0105238_10028244 Ga0105238_100282444 279
526 3300010375 Ga0105239_10105089 Ga0105239_101050893 279
527 3300013100 Ga0157373_10033380 Ga0157373_100333803 279
528 3300013102 Ga0157371_10000144 Ga0157371_10000144103 279
529 3300013102 Ga0157371_10023986 Ga0157371_100239864 279
530 3300013102 Ga0157371_10027985 Ga0157371_100279854 279
531 3300013296 Ga0157374_10004105 Ga0157374_100041059 279
532 3300013296 Ga0157374_10039984 Ga0157374_100399844 279
533 3300013297 Ga0157378_10000242 Ga0157378_1000024247 279
534 3300013297 Ga0157378_10059458 Ga0157378_100594583 279
535 3300013297 Ga0157378_10470870 Ga0157378_104708702 279
536 3300013306 Ga0163162_10518528 Ga0163162_105185282 279
537 3300013307 Ga0157372_10011773 Ga0157372_100117739 279
538 3300013307 Ga0157372_10585811 Ga0157372_105858112 279
539 3300013308 Ga0157375_10054009 Ga0157375_100540092 279
540 3300013308 Ga0157375_10057944 Ga0157375_100579444 279
541 3300014325 Ga0163163_10001969 Ga0163163_100019699 279
542 3300014968 Ga0157379_10003175 Ga0157379_100031758 279
543 3300014968 Ga0157379_10024874 Ga0157379_100248743 279
544 3300014969 Ga0157376_10029478 Ga0157376_100294782 279
545 3300014969 Ga0157376_10189938 Ga0157376_101899383 279
546 3300017792 Ga0163161_10244647 Ga0163161_102446472 279
547 3300021384 Ga0213876_10057048 Ga0213876_100570483 279
548 3300025315 Ga0207697_10000002 Ga0207697_1000000266 279
549 3300025315 Ga0207697_10076749 Ga0207697_100767492 279
550 3300025321 Ga0207656_10006879 Ga0207656_100068792 279
551 3300025321 Ga0207656_10018769 Ga0207656_100187693 279
552 3300025893 Ga0207682_10040052 Ga0207682_100400523 279
553 3300025901 Ga0207688_10000185 Ga0207688_1000018519 279
554 3300025901 Ga0207688_10011623 Ga0207688_100116232 279
555 3300025903 Ga0207680_10006526 Ga0207680_100065267 279
556 3300025903 Ga0207680_10064823 Ga0207680_100648233 279
557 3300025903 Ga0207680_10168123 Ga0207680_101681232 279
558 3300025904 Ga0207647_10000095 Ga0207647_1000009532 279
559 3300025904 Ga0207647_10032750 Ga0207647_100327504 279
560 3300025904 Ga0207647_10182842 Ga0207647_101828422 279
561 3300025906 Ga0207699_10045618 Ga0207699_100456182 279
562 3300025907 Ga0207645_10002989 Ga0207645_100029896 279
563 3300025907 Ga0207645_10003442 Ga0207645_100034427 279
564 3300025909 Ga0207705_10011516 Ga0207705_100115165 279
565 3300025909 Ga0207705_10298028 Ga0207705_102980282 279
566 3300025915 Ga0207693_10022649 Ga0207693_100226494 279
567 3300025918 Ga0207662_10102759 Ga0207662_101027593 279
568 3300025919 Ga0207657_10002671 Ga0207657_1000267114 279
569 3300025919 Ga0207657_10003856 Ga0207657_100038568 279
570 3300025919 Ga0207657_10014084 Ga0207657_100140842 279
571 3300025919 Ga0207657_10148942 Ga0207657_101489421 279
572 3300025919 Ga0207657_10175354 Ga0207657_101753543 279
573 3300025919 Ga0207657_10243919 Ga0207657_102439192 279
574 3300025920 Ga0207649_10046878 Ga0207649_100468782 279
575 3300025920 Ga0207649_10089696 Ga0207649_100896962 279
576 3300025920 Ga0207649_10091741 Ga0207649_100917412 279
577 3300025924 Ga0207694_10061872 Ga0207694_100618723 279
578 3300025924 Ga0207694_10121717 Ga0207694_101217172 279
579 3300025925 Ga0207650_10010874 Ga0207650_100108747 279
580 3300025925 Ga0207650_10018736 Ga0207650_100187364 279
581 3300025925 Ga0207650_10029150 Ga0207650_100291504 279
582 3300025926 Ga0207659_10005396 Ga0207659_100053968 279
583 3300025926 Ga0207659_10026000 Ga0207659_100260005 279
584 3300025926 Ga0207659_10036608 Ga0207659_100366084 279
585 3300025926 Ga0207659_10081491 Ga0207659_100814911 279
586 3300025927 Ga0207687_10000899 Ga0207687_1000089914 279
587 3300025927 Ga0207687_10115375 Ga0207687_101153752 279
588 3300025927 Ga0207687_10178354 Ga0207687_101783542 279
589 3300025928 Ga0207700_10027074 Ga0207700_100270743 279
590 3300025928 Ga0207700_10146015 Ga0207700_101460152 279
591 3300025929 Ga0207664_10003705 Ga0207664_100037059 279
592 3300025929 Ga0207664_10094392 Ga0207664_100943923 279
593 3300025931 Ga0207644_10003132 Ga0207644_1000313210 279
594 3300025931 Ga0207644_10034692 Ga0207644_100346924 279
595 3300025931 Ga0207644_10110317 Ga0207644_101103172 279
596 3300025931 Ga0207644_10316841 Ga0207644_103168412 279
597 3300025932 Ga0207690_10004247 Ga0207690_100042479 279
598 3300025932 Ga0207690_10005603 Ga0207690_100056035 279
599 3300025932 Ga0207690_10031963 Ga0207690_100319634 279
600 3300025932 Ga0207690_10113502 Ga0207690_101135022 279
601 3300025933 Ga0207706_10000020 Ga0207706_10000020167 279
602 3300025933 Ga0207706_10002559 Ga0207706_1000255911 279
603 3300025933 Ga0207706_10006178 Ga0207706_100061786 279
604 3300025933 Ga0207706_10007937 Ga0207706_1000793710 279
605 3300025933 Ga0207706_10017823 Ga0207706_100178234 279
606 3300025933 Ga0207706_10038918 Ga0207706_100389182 279
607 3300025933 Ga0207706_10219199 Ga0207706_102191992 279
608 3300025933 Ga0207706_10248378 Ga0207706_102483782 279
609 3300025933 Ga0207706_10313479 Ga0207706_103134792 279
610 3300025934 Ga0207686_10166013 Ga0207686_101660132 279
611 3300025937 Ga0207669_10040242 Ga0207669_100402422 279
612 3300025937 Ga0207669_10070130 Ga0207669_100701302 279
613 3300025937 Ga0207669_10074198 Ga0207669_100741983 279
614 3300025938 Ga0207704_10011660 Ga0207704_100116604 279
615 3300025938 Ga0207704_10048673 Ga0207704_100486732 279
616 3300025939 Ga0207665_10115100 Ga0207665_101151002 279
617 3300025939 Ga0207665_10121470 Ga0207665_101214702 279
618 3300025940 Ga0207691_10000133 Ga0207691_1000013340 279
619 3300025940 Ga0207691_10007876 Ga0207691_1000787610 279
620 3300025940 Ga0207691_10013203 Ga0207691_100132038 279
621 3300025940 Ga0207691_10051976 Ga0207691_100519766 279
622 3300025940 Ga0207691_10076950 Ga0207691_100769503 279
623 3300025941 Ga0207711_10000543 Ga0207711_1000054341 279
624 3300025941 Ga0207711_10001711 Ga0207711_1000171114 279
625 3300025941 Ga0207711_10003051 Ga0207711_100030515 279
626 3300025941 Ga0207711_10004444 Ga0207711_1000444412 279
627 3300025941 Ga0207711_10083191 Ga0207711_100831913 279
628 3300025941 Ga0207711_10209316 Ga0207711_102093162 279
629 3300025941 Ga0207711_10454557 Ga0207711_104545572 279
630 3300025942 Ga0207689_10000002 Ga0207689_10000002180 279
631 3300025945 Ga0207679_10003893 Ga0207679_100038934 279
632 3300025945 Ga0207679_10005368 Ga0207679_100053686 279
633 3300025945 Ga0207679_10110973 Ga0207679_101109731 279
634 3300025945 Ga0207679_10260201 Ga0207679_102602011 279
635 3300025949 Ga0207667_10037156 Ga0207667_100371563 279
636 3300025949 Ga0207667_10601584 Ga0207667_106015842 279
637 3300025960 Ga0207651_10001472 Ga0207651_100014723 279
638 3300025960 Ga0207651_10002855 Ga0207651_100028558 279
639 3300025960 Ga0207651_10019925 Ga0207651_100199254 279
640 3300025960 Ga0207651_10021057 Ga0207651_100210572 279
641 3300025960 Ga0207651_10081593 Ga0207651_100815932 279
642 3300025960 Ga0207651_10308062 Ga0207651_103080622 279
643 3300025972 Ga0207668_10000176 Ga0207668_100001769 279
644 3300025972 Ga0207668_10022305 Ga0207668_100223052 279
645 3300025981 Ga0207640_10002835 Ga0207640_1000283510 279
646 3300025981 Ga0207640_10011803 Ga0207640_100118032 279
647 3300025981 Ga0207640_10073015 Ga0207640_100730151 279
648 3300025981 Ga0207640_10135423 Ga0207640_101354232 279
649 3300025986 Ga0207658_10002281 Ga0207658_100022818 279
650 3300025986 Ga0207658_10004177 Ga0207658_100041776 279
651 3300025986 Ga0207658_10005694 Ga0207658_100056943 279
652 3300025986 Ga0207658_10091107 Ga0207658_100911073 279
653 3300025986 Ga0207658_10193044 Ga0207658_101930442 279
654 3300025986 Ga0207658_10237628 Ga0207658_102376282 279
655 3300026023 Ga0207677_10015775 Ga0207677_100157752 279
656 3300026023 Ga0207677_10034695 Ga0207677_100346954 279
657 3300026023 Ga0207677_10271920 Ga0207677_102719202 279
658 3300026023 Ga0207677_10347166 Ga0207677_103471662 279
659 3300026023 Ga0207677_10383509 Ga0207677_103835092 279
660 3300026023 Ga0207677_10437238 Ga0207677_104372381 279
661 3300026035 Ga0207703_10000327 Ga0207703_1000032750 279
662 3300026035 Ga0207703_10003896 Ga0207703_1000389613 279
663 3300026035 Ga0207703_10091979 Ga0207703_100919792 279
664 3300026035 Ga0207703_10095097 Ga0207703_100950974 279
665 3300026041 Ga0207639_10015038 Ga0207639_100150383 279
666 3300026041 Ga0207639_10056995 Ga0207639_100569953 279
667 3300026041 Ga0207639_10266809 Ga0207639_102668093 279
668 3300026067 Ga0207678_10004189 Ga0207678_100041898 279
669 3300026067 Ga0207678_10043667 Ga0207678_100436671 279
670 3300026067 Ga0207678_10050123 Ga0207678_100501234 279
671 3300026078 Ga0207702_10019757 Ga0207702_100197572 279
672 3300026088 Ga0207641_10000138 Ga0207641_1000013883 279
673 3300026089 Ga0207648_10000088 Ga0207648_1000008847 279
674 3300026089 Ga0207648_10002364 Ga0207648_1000236418 279
675 3300026089 Ga0207648_10006357 Ga0207648_1000635712 279
676 3300026089 Ga0207648_10007110 Ga0207648_1000711012 279
677 3300026089 Ga0207648_10171055 Ga0207648_101710553 279
678 3300026095 Ga0207676_10000245 Ga0207676_1000024518 279
679 3300026095 Ga0207676_10003364 Ga0207676_100033646 279
680 3300026095 Ga0207676_10091060 Ga0207676_100910603 279
681 3300026095 Ga0207676_10179519 Ga0207676_101795193 279
682 3300026116 Ga0207674_10001363 Ga0207674_100013634 279
683 3300026116 Ga0207674_10002644 Ga0207674_1000264414 279
684 3300026118 Ga0207675_100235673 Ga0207675_1002356732 279
685 3300026121 Ga0207683_10005286 Ga0207683_1000528611 279
686 3300026121 Ga0207683_10025793 Ga0207683_100257936 279
687 3300026121 Ga0207683_10032732 Ga0207683_100327324 279
688 3300026121 Ga0207683_10197151 Ga0207683_101971513 279
689 3300026121 Ga0207683_10355416 Ga0207683_103554162 279
690 3300026142 Ga0207698_10000701 Ga0207698_100007019 279
691 3300026142 Ga0207698_10040576 Ga0207698_100405765 279
692 3300026142 Ga0207698_10067498 Ga0207698_100674983 279
693 3300026142 Ga0207698_10649001 Ga0207698_106490012 279
694 3300027617 Ga0210002_1011703 Ga0210002_10117032 279
695 3300028379 Ga0268266_10000332 Ga0268266_100003321 279
696 3300028379 Ga0268266_10201734 Ga0268266_102017342 279
697 3300028379 Ga0268266_10668994 Ga0268266_106689941 279
698 3300028380 Ga0268265_10003839 Ga0268265_100038396 279
699 3300028380 Ga0268265_10020542 Ga0268265_100205422 279
700 3300028380 Ga0268265_10063659 Ga0268265_100636593 279
701 3300028381 Ga0268264_10000644 Ga0268264_1000064429 279
702 3300028381 Ga0268264_10016134 Ga0268264_100161342 279
703 3300028381 Ga0268264_10018719 Ga0268264_100187193 279
704 3300028381 Ga0268264_10047635 Ga0268264_100476354 279
705 3300028381 Ga0268264_10055347 Ga0268264_100553472 279
706 3300031731 Ga0307405_10044520 Ga0307405_100445202 279
707 3300031731 Ga0307405_10383404 Ga0307405_103834042 279
708 3300031824 Ga0307413_10109806 Ga0307413_101098063 279
709 3300031852 Ga0307410_10038646 Ga0307410_100386463 279
710 3300031901 Ga0307406_10278144 Ga0307406_102781442 279
711 3300031903 Ga0307407_10038715 Ga0307407_100387153 279
712 3300031911 Ga0307412_10023269 Ga0307412_100232693 279
713 3300032002 Ga0307416_100375558 Ga0307416_1003755582 279
714 3300032005 Ga0307411_10240765 Ga0307411_102407652 279
715 3300032005 Ga0307411_10452093 Ga0307411_104520931 279
716 3300032126 Ga0307415_100093324 Ga0307415_1000933243 279
717 3300032126 Ga0307415_100460017 Ga0307415_1004600171 279
718 3300035088 Ga0373940_0046785 Ga0373940_0046785_270_1109 279
719 3300035691 Ga0373931_0116522 Ga0373931_0116522_80_919 279
720 3300035692 Ga0373935_0007844 Ga0373935_0007844_4488_5327 279
721 3300037312 Ga0395899_0007898 Ga0395899_0007898_5910_6758 279
722 3300037312 Ga0395899_0113403 Ga0395899_0113403_688_1536 279
723 3300037418 Ga0395900_0082383 Ga0395900_0082383_433_1275 279
724 3300037418 Ga0395900_0110341 Ga0395900_0110341_922_1764 279
725 3300037418 Ga0395900_0187652 Ga0395900_0187652_1206_2048 279
726 3300037418 Ga0395900_0300045 Ga0395900_0300045_183_1025 279
727 3300037418 Ga0395900_0340483 Ga0395900_0340483_526_1374 279
728 3300037418 Ga0395900_0366909 Ga0395900_0366909_161_1000 279
729 3300037466 Ga0395898_0009764 Ga0395898_0009764_3764_4603 279
730 3300037466 Ga0395898_0044225 Ga0395898_0044225_729_1571 279
731 3300037466 Ga0395898_0097169 Ga0395898_0097169_1546_2385 279
732 3300037466 Ga0395898_0151047 Ga0395898_0151047_509_1357 279
733 3300037471 Ga0395905_0000793 Ga0395905_0000793_14406_15248 279
734 3300037471 Ga0395905_0000958 Ga0395905_0000958_25356_26198 279
735 3300037471 Ga0395905_0024182 Ga0395905_0024182_1256_2104 279
736 3300037471 Ga0395905_0031344 Ga0395905_0031344_1264_2103 279
737 3300037471 Ga0395905_0032596 Ga0395905_0032596_153_992 279
738 3300037471 Ga0395905_0076035 Ga0395905_0076035_157_996 279
739 3300037471 Ga0395905_0172184 Ga0395905_0172184_463_1311 279
740 3300037471 Ga0395905_0179693 Ga0395905_0179693_928_1776 279
741 3300037471 Ga0395905_0497954 Ga0395905_0497954_50_889 279
742 3300037471 Ga0395905_0498010 Ga0395905_0498010_50_889 279
743 3300038443 Ga0395901_0005101 Ga0395901_0005101_9227_10066 279
744 3300038443 Ga0395901_0006716 Ga0395901_0006716_3767_4609 279
745 3300038443 Ga0395901_0042906 Ga0395901_0042906_805_1647 279
746 3300038443 Ga0395901_0044056 Ga0395901_0044056_323_1165 279
747 3300038443 Ga0395901_0049993 Ga0395901_0049993_2904_3743 279
748 3300038443 Ga0395901_0073852 Ga0395901_0073852_2674_3513 279
749 3300038443 Ga0395901_0292420 Ga0395901_0292420_608_1447 279
750 3300038443 Ga0395901_0318573 Ga0395901_0318573_322_1170 279
751 3300039437 Ga0436365_1036392 Ga0436365_1036392_5125_5964 279
752 3300042005 Ga0439448_0007024 Ga0439448_0007024_86_928 279
753 3300042157 Ga0439458_0001542 Ga0439458_0001542_1163_2005 279
754 3300042157 Ga0439458_0023257 Ga0439458_0023257_488_1330 279
755 3300044842 Ga0466957_0060528 Ga0466957_0060528_126_983 279
756 3300044901 Ga0466960_0041111 Ga0466960_0041111_834_1676 279
757 3300045976 Ga0466967_0144782 Ga0466967_0144782_1030_1890 279
758 3300046515 Ga0495620_0108762 Ga0495620_0108762_129_968 279
759 3300046539 Ga0495621_0002061 Ga0495621_0002061_3308_4147 279
760 3300046616 Ga0495668_0008525 Ga0495668_0008525_1033_1872 279
761 3300046684 Ga0495669_0003874 Ga0495669_0003874_4185_5024 279
762 3300046684 Ga0495669_0004827 Ga0495669_0004827_3410_4255 279
763 3300046684 Ga0495669_0005572 Ga0495669_0005572_3103_3942 279
764 3300046684 Ga0495669_0020550 Ga0495669_0020550_449_1288 279
765 3300046684 Ga0495669_0054404 Ga0495669_0054404_439_1278 279
766 3300046691 Ga0495670_0001717 Ga0495670_0001717_6674_7513 279
767 3300047445 Ga0495677_0040317 Ga0495677_0040317_809_1648 279
768 3300048903 Ga0496100_0004354 Ga0496100_0004354_4166_5005 279
769 3300048904 Ga0496101_0003296 Ga0496101_0003296_8625_9464 279
770 3300048904 Ga0496101_0312892 Ga0496101_0312892_343_1182 279
771 3300048906 Ga0496103_0135747 Ga0496103_0135747_604_1443 279
772 3300048908 Ga0496105_0007221 Ga0496105_0007221_448_1287 279
773 3300048910 Ga0496107_0039646 Ga0496107_0039646_961_1800 279
774 3300048911 Ga0496108_0003253 Ga0496108_0003253_5869_6708 279
775 3300048911 Ga0496108_0047185 Ga0496108_0047185_2181_3020 279
776 3300048912 Ga0496109_0047689 Ga0496109_0047689_397_1236 279
777 3300048913 Ga0496110_0003761 Ga0496110_0003761_7513_8352 279
778 3300048914 Ga0496111_0002605 Ga0496111_0002605_9394_10233 279
779 3300048915 Ga0496112_0030363 Ga0496112_0030363_2484_3323 279
780 3300048916 Ga0496113_0001095 Ga0496113_0001095_3730_4569 279
781 3300048917 Ga0496114_0000006 Ga0496114_0000006_349041_349880 279
782 3300048917 Ga0496114_0250837 Ga0496114_0250837_414_1253 279
783 3300053083 Ga0495655_0007056 Ga0495655_0007056_340_1185 279
784 3300000531 CNBas_1001648 CNBas_10016482 280
785 3300001904 JGI24736J21556_1007403 JGI24736J21556_10074032 280
786 3300001990 JGI24737J22298_10008786 JGI24737J22298_100087864 280
787 3300001990 JGI24737J22298_10056164 JGI24737J22298_100561641 280
788 3300001990 JGI24737J22298_10062314 JGI24737J22298_100623141 280
789 3300002067 JGI24735J21928_10003960 JGI24735J21928_100039601 280
790 3300002067 JGI24735J21928_10076088 JGI24735J21928_100760881 280
791 3300002075 JGI24738J21930_10008995 JGI24738J21930_100089952 280
792 3300005290 Ga0065712_10100388 Ga0065712_101003882 280
793 3300005327 Ga0070658_10030513 Ga0070658_100305131 280
794 3300005327 Ga0070658_10545165 Ga0070658_105451651 280
795 3300005328 Ga0070676_10009749 Ga0070676_100097492 280
796 3300005328 Ga0070676_10085555 Ga0070676_100855552 280
797 3300005331 Ga0070670_100002414 Ga0070670_10000241412 280
798 3300005331 Ga0070670_100005886 Ga0070670_1000058869 280
799 3300005331 Ga0070670_100097414 Ga0070670_1000974141 280
800 3300005331 Ga0070670_100107615 Ga0070670_1001076154 280
801 3300005331 Ga0070670_100146461 Ga0070670_1001464612 280
802 3300005333 Ga0070677_10013023 Ga0070677_100130234 280
803 3300005333 Ga0070677_10074720 Ga0070677_100747201 280
804 3300005335 Ga0070666_10032630 Ga0070666_100326303 280
805 3300005336 Ga0070680_100054926 Ga0070680_1000549264 280
806 3300005337 Ga0070682_100080781 Ga0070682_1000807813 280
807 3300005339 Ga0070660_100024658 Ga0070660_1000246585 280
808 3300005339 Ga0070660_100029093 Ga0070660_1000290932 280
809 3300005339 Ga0070660_100175184 Ga0070660_1001751842 280
810 3300005341 Ga0070691_10014238 Ga0070691_100142383 280
811 3300005344 Ga0070661_100003585 Ga0070661_1000035859 280
812 3300005344 Ga0070661_100007620 Ga0070661_1000076205 280
813 3300005344 Ga0070661_100017757 Ga0070661_1000177572 280
814 3300005344 Ga0070661_100175566 Ga0070661_1001755661 280
815 3300005347 Ga0070668_100159761 Ga0070668_1001597613 280
816 3300005353 Ga0070669_100399190 Ga0070669_1003991902 280
817 3300005354 Ga0070675_100004665 Ga0070675_10000466510 280
818 3300005354 Ga0070675_100022362 Ga0070675_1000223623 280
819 3300005355 Ga0070671_100009611 Ga0070671_1000096116 280
820 3300005356 Ga0070674_100019310 Ga0070674_1000193105 280
821 3300005356 Ga0070674_100473603 Ga0070674_1004736031 280
822 3300005364 Ga0070673_100012375 Ga0070673_1000123753 280
823 3300005364 Ga0070673_100034179 Ga0070673_1000341793 280
824 3300005366 Ga0070659_100029553 Ga0070659_1000295534 280
825 3300005366 Ga0070659_100035102 Ga0070659_1000351024 280
826 3300005366 Ga0070659_100085208 Ga0070659_1000852084 280
827 3300005367 Ga0070667_100002452 Ga0070667_1000024526 280
828 3300005367 Ga0070667_100048291 Ga0070667_1000482912 280
829 3300005440 Ga0070705_100216182 Ga0070705_1002161822 280
830 3300005455 Ga0070663_100019953 Ga0070663_1000199533 280
831 3300005455 Ga0070663_100056909 Ga0070663_1000569093 280
832 3300005455 Ga0070663_100077100 Ga0070663_1000771003 280
833 3300005455 Ga0070663_100205415 Ga0070663_1002054151 280
834 3300005456 Ga0070678_100296052 Ga0070678_1002960521 280
835 3300005456 Ga0070678_100632300 Ga0070678_1006323001 280
836 3300005457 Ga0070662_100015942 Ga0070662_1000159424 280
837 3300005457 Ga0070662_100024689 Ga0070662_1000246892 280
838 3300005457 Ga0070662_100102609 Ga0070662_1001026093 280
839 3300005457 Ga0070662_100115852 Ga0070662_1001158523 280
840 3300005457 Ga0070662_100332977 Ga0070662_1003329771 280
841 3300005457 Ga0070662_100417214 Ga0070662_1004172142 280
842 3300005457 Ga0070662_100492526 Ga0070662_1004925261 280
843 3300005458 Ga0070681_10326943 Ga0070681_103269432 280
844 3300005459 Ga0068867_100149890 Ga0068867_1001498903 280
845 3300005530 Ga0070679_100014156 Ga0070679_1000141564 280
846 3300005535 Ga0070684_100002928 Ga0070684_10000292812 280
847 3300005539 Ga0068853_100327313 Ga0068853_1003273132 280
848 3300005543 Ga0070672_100002633 Ga0070672_1000026339 280
849 3300005543 Ga0070672_100042844 Ga0070672_1000428443 280
850 3300005546 Ga0070696_100025535 Ga0070696_1000255355 280
851 3300005547 Ga0070693_100088119 Ga0070693_1000881192 280
852 3300005564 Ga0070664_100009841 Ga0070664_1000098417 280
853 3300005564 Ga0070664_100013227 Ga0070664_1000132273 280
854 3300005564 Ga0070664_100016775 Ga0070664_1000167754 280
855 3300005564 Ga0070664_100080605 Ga0070664_1000806054 280
856 3300005564 Ga0070664_100098160 Ga0070664_1000981601 280
857 3300005564 Ga0070664_100404609 Ga0070664_1004046092 280
858 3300005577 Ga0068857_100001542 Ga0068857_1000015423 280
859 3300005577 Ga0068857_100009896 Ga0068857_1000098963 280
860 3300005577 Ga0068857_100130035 Ga0068857_1001300352 280
861 3300005577 Ga0068857_100147994 Ga0068857_1001479943 280
862 3300005578 Ga0068854_100001932 Ga0068854_1000019324 280
863 3300005578 Ga0068854_100021848 Ga0068854_1000218484 280
864 3300005578 Ga0068854_100055259 Ga0068854_1000552594 280
865 3300005578 Ga0068854_100084692 Ga0068854_1000846923 280
866 3300005614 Ga0068856_100029066 Ga0068856_1000290664 280
867 3300005614 Ga0068856_100294565 Ga0068856_1002945652 280
868 3300005616 Ga0068852_100259604 Ga0068852_1002596042 280
869 3300005617 Ga0068859_100008428 Ga0068859_10000842811 280
870 3300005617 Ga0068859_100011079 Ga0068859_1000110799 280
871 3300005617 Ga0068859_100016383 Ga0068859_1000163834 280
872 3300005618 Ga0068864_100017849 Ga0068864_1000178496 280
873 3300005718 Ga0068866_10003876 Ga0068866_100038768 280
874 3300005719 Ga0068861_100026007 Ga0068861_1000260075 280
875 3300005719 Ga0068861_100707054 Ga0068861_1007070541 280
876 3300005834 Ga0068851_10009986 Ga0068851_100099862 280
877 3300005841 Ga0068863_100009138 Ga0068863_1000091388 280
878 3300005841 Ga0068863_100029918 Ga0068863_1000299184 280
879 3300005841 Ga0068863_100078262 Ga0068863_1000782623 280
880 3300005842 Ga0068858_100130303 Ga0068858_1001303033 280
881 3300005843 Ga0068860_100029004 Ga0068860_1000290045 280
882 3300005844 Ga0068862_100008241 Ga0068862_1000082415 280
883 3300005844 Ga0068862_100059853 Ga0068862_1000598534 280
884 3300005844 Ga0068862_100087072 Ga0068862_1000870723 280
885 3300005844 Ga0068862_100170619 Ga0068862_1001706193 280
886 3300005985 Ga0081539_10042924 Ga0081539_100429243 280
887 3300006051 Ga0075364_10132900 Ga0075364_101329002 280
888 3300006175 Ga0070712_100058440 Ga0070712_1000584403 280
889 3300006844 Ga0075428_100205562 Ga0075428_1002055623 280
890 3300006881 Ga0068865_100054049 Ga0068865_1000540491 280
891 3300006881 Ga0068865_100330593 Ga0068865_1003305932 280
892 3300006931 Ga0097620_100008428 Ga0097620_10000842811 280
893 3300006931 Ga0097620_100011079 Ga0097620_1000110799 280
894 3300006931 Ga0097620_100016383 Ga0097620_1000163834 280
895 3300009098 Ga0105245_10031755 Ga0105245_100317552 280
896 3300009148 Ga0105243_10013997 Ga0105243_100139976 280
897 3300009148 Ga0105243_10027550 Ga0105243_100275504 280
898 3300009148 Ga0105243_10049422 Ga0105243_100494223 280
899 3300009176 Ga0105242_10266405 Ga0105242_102664053 280
900 3300009177 Ga0105248_10001030 Ga0105248_100010306 280
901 3300009177 Ga0105248_10020997 Ga0105248_100209976 280
902 3300009177 Ga0105248_10023443 Ga0105248_100234435 280
903 3300009177 Ga0105248_10248369 Ga0105248_102483692 280
904 3300009545 Ga0105237_10756721 Ga0105237_107567211 280
905 3300009553 Ga0105249_10154617 Ga0105249_101546173 280
906 3300011119 Ga0105246_10044648 Ga0105246_100446484 280
907 3300011119 Ga0105246_10048303 Ga0105246_100483034 280
908 3300013100 Ga0157373_10027750 Ga0157373_100277505 280
909 3300013100 Ga0157373_10028389 Ga0157373_100283892 280
910 3300013100 Ga0157373_10328506 Ga0157373_103285062 280
911 3300013105 Ga0157369_10073070 Ga0157369_100730702 280
912 3300013306 Ga0163162_10168196 Ga0163162_101681962 280
913 3300013306 Ga0163162_10365055 Ga0163162_103650552 280
914 3300013307 Ga0157372_10067590 Ga0157372_100675902 280
915 3300013307 Ga0157372_10380432 Ga0157372_103804323 280
916 3300013308 Ga0157375_10039482 Ga0157375_100394823 280
917 3300013308 Ga0157375_10087808 Ga0157375_100878084 280
918 3300013308 Ga0157375_10733379 Ga0157375_107333792 280
919 3300014325 Ga0163163_10044035 Ga0163163_100440354 280
920 3300014326 Ga0157380_10030248 Ga0157380_100302482 280
921 3300014326 Ga0157380_10043133 Ga0157380_100431332 280
922 3300014745 Ga0157377_10014277 Ga0157377_100142774 280
923 3300014968 Ga0157379_10169445 Ga0157379_101694452 280
924 3300017792 Ga0163161_10015176 Ga0163161_100151766 280
925 3300017792 Ga0163161_10223498 Ga0163161_102234982 280
926 3300020070 Ga0206356_11487008 Ga0206356_114870081 280
927 3300020081 Ga0206354_11203043 Ga0206354_112030431 280
928 3300025315 Ga0207697_10021898 Ga0207697_100218982 280
929 3300025893 Ga0207682_10004530 Ga0207682_100045304 280
930 3300025893 Ga0207682_10007248 Ga0207682_100072483 280
931 3300025899 Ga0207642_10012258 Ga0207642_100122582 280
932 3300025899 Ga0207642_10131509 Ga0207642_101315092 280
933 3300025901 Ga0207688_10009119 Ga0207688_100091195 280
934 3300025903 Ga0207680_10024768 Ga0207680_100247684 280
935 3300025904 Ga0207647_10001001 Ga0207647_100010019 280
936 3300025904 Ga0207647_10001765 Ga0207647_100017651 280
937 3300025904 Ga0207647_10092240 Ga0207647_100922402 280
938 3300025907 Ga0207645_10032192 Ga0207645_100321924 280
939 3300025907 Ga0207645_10035509 Ga0207645_100355093 280
940 3300025907 Ga0207645_10088599 Ga0207645_100885992 280
941 3300025907 Ga0207645_10089083 Ga0207645_100890833 280
942 3300025909 Ga0207705_10003350 Ga0207705_100033504 280
943 3300025909 Ga0207705_10007626 Ga0207705_100076266 280
944 3300025912 Ga0207707_10321809 Ga0207707_103218091 280
945 3300025914 Ga0207671_10181484 Ga0207671_101814842 280
946 3300025915 Ga0207693_10062363 Ga0207693_100623633 280
947 3300025918 Ga0207662_10191728 Ga0207662_101917282 280
948 3300025919 Ga0207657_10000594 Ga0207657_1000059427 280
949 3300025919 Ga0207657_10003798 Ga0207657_100037986 280
950 3300025919 Ga0207657_10017472 Ga0207657_100174728 280
951 3300025919 Ga0207657_10245547 Ga0207657_102455472 280
952 3300025919 Ga0207657_10263266 Ga0207657_102632662 280
953 3300025919 Ga0207657_10492318 Ga0207657_104923181 280
954 3300025920 Ga0207649_10004210 Ga0207649_100042108 280
955 3300025920 Ga0207649_10035552 Ga0207649_100355523 280
956 3300025923 Ga0207681_10044337 Ga0207681_100443374 280
957 3300025923 Ga0207681_10080381 Ga0207681_100803812 280
958 3300025924 Ga0207694_10007832 Ga0207694_100078327 280
959 3300025925 Ga0207650_10001178 Ga0207650_1000117814 280
960 3300025925 Ga0207650_10040177 Ga0207650_100401774 280
961 3300025925 Ga0207650_10041703 Ga0207650_100417032 280
962 3300025926 Ga0207659_10019830 Ga0207659_100198304 280
963 3300025926 Ga0207659_10022827 Ga0207659_100228272 280
964 3300025926 Ga0207659_10386862 Ga0207659_103868622 280
965 3300025927 Ga0207687_10030308 Ga0207687_100303083 280
966 3300025931 Ga0207644_10011767 Ga0207644_100117673 280
967 3300025931 Ga0207644_10029120 Ga0207644_100291202 280
968 3300025932 Ga0207690_10118996 Ga0207690_101189962 280
969 3300025933 Ga0207706_10010553 Ga0207706_100105538 280
970 3300025933 Ga0207706_10013013 Ga0207706_100130136 280
971 3300025933 Ga0207706_10025629 Ga0207706_100256293 280
972 3300025933 Ga0207706_10037891 Ga0207706_100378911 280
973 3300025933 Ga0207706_10112829 Ga0207706_101128293 280
974 3300025933 Ga0207706_10148206 Ga0207706_101482063 280
975 3300025933 Ga0207706_10384527 Ga0207706_103845272 280
976 3300025933 Ga0207706_10577852 Ga0207706_105778521 280
977 3300025935 Ga0207709_10033052 Ga0207709_100330523 280
978 3300025937 Ga0207669_10006996 Ga0207669_100069966 280
979 3300025937 Ga0207669_10041599 Ga0207669_100415994 280
980 3300025937 Ga0207669_10278378 Ga0207669_102783781 280
981 3300025938 Ga0207704_10020346 Ga0207704_100203463 280
982 3300025940 Ga0207691_10002368 Ga0207691_100023686 280
983 3300025940 Ga0207691_10030931 Ga0207691_100309313 280
984 3300025940 Ga0207691_10466874 Ga0207691_104668742 280
985 3300025940 Ga0207691_10539532 Ga0207691_105395322 280
986 3300025941 Ga0207711_10001496 Ga0207711_1000149612 280
987 3300025941 Ga0207711_10003726 Ga0207711_100037265 280
988 3300025942 Ga0207689_10003262 Ga0207689_100032627 280
989 3300025942 Ga0207689_10019276 Ga0207689_100192763 280
990 3300025944 Ga0207661_10039512 Ga0207661_100395124 280
991 3300025945 Ga0207679_10044121 Ga0207679_100441213 280
992 3300025945 Ga0207679_10046901 Ga0207679_100469014 280
993 3300025945 Ga0207679_10052921 Ga0207679_100529214 280
994 3300025945 Ga0207679_10176475 Ga0207679_101764752 280
995 3300025945 Ga0207679_10508568 Ga0207679_105085682 280
996 3300025949 Ga0207667_10023065 Ga0207667_100230651 280
997 3300025961 Ga0207712_10135091 Ga0207712_101350912 280
998 3300025972 Ga0207668_10079916 Ga0207668_100799163 280
999 3300025972 Ga0207668_10082301 Ga0207668_100823012 280
1000 3300025981 Ga0207640_10028910 Ga0207640_100289104 280
1001 3300025981 Ga0207640_10054601 Ga0207640_100546011 280
1002 3300025986 Ga0207658_10012484 Ga0207658_100124843 280
1003 3300025986 Ga0207658_10123470 Ga0207658_101234701 280
1004 3300026035 Ga0207703_10015295 Ga0207703_100152955 280
1005 3300026035 Ga0207703_10015361 Ga0207703_100153613 280
1006 3300026041 Ga0207639_10029438 Ga0207639_100294383 280
1007 3300026067 Ga0207678_10014855 Ga0207678_100148552 280
1008 3300026067 Ga0207678_10033586 Ga0207678_100335864 280
1009 3300026067 Ga0207678_10089836 Ga0207678_100898361 280
1010 3300026067 Ga0207678_10114073 Ga0207678_101140733 280
1011 3300026075 Ga0207708_10490678 Ga0207708_104906781 280
1012 3300026088 Ga0207641_10043214 Ga0207641_100432145 280
1013 3300026088 Ga0207641_10106860 Ga0207641_101068604 280
1014 3300026088 Ga0207641_10454254 Ga0207641_104542541 280
1015 3300026089 Ga0207648_10139243 Ga0207648_101392434 280
1016 3300026089 Ga0207648_10252238 Ga0207648_102522382 280
1017 3300026095 Ga0207676_10112014 Ga0207676_101120142 280
1018 3300026095 Ga0207676_10291756 Ga0207676_102917563 280
1019 3300026116 Ga0207674_10000065 Ga0207674_1000006554 280
1020 3300026116 Ga0207674_10004380 Ga0207674_100043805 280
1021 3300026116 Ga0207674_10015599 Ga0207674_100155999 280
1022 3300026116 Ga0207674_10057996 Ga0207674_100579963 280
1023 3300026116 Ga0207674_10099350 Ga0207674_100993504 280
1024 3300026118 Ga0207675_100034448 Ga0207675_1000344484 280
1025 3300026118 Ga0207675_100824641 Ga0207675_1008246411 280
1026 3300026121 Ga0207683_10029343 Ga0207683_100293436 280
1027 3300026142 Ga0207698_10005578 Ga0207698_100055789 280
1028 3300027876 Ga0209974_10037740 Ga0209974_100377401 280
1029 3300028380 Ga0268265_10012425 Ga0268265_100124252 280
1030 3300028380 Ga0268265_10120128 Ga0268265_101201282 280
1031 3300031548 Ga0307408_100119242 Ga0307408_1001192423 280
1032 3300031548 Ga0307408_100188036 Ga0307408_1001880361 280
1033 3300031548 Ga0307408_100373120 Ga0307408_1003731202 280
1034 3300031731 Ga0307405_10004772 Ga0307405_100047724 280
1035 3300031731 Ga0307405_10015098 Ga0307405_100150982 280
1036 3300031731 Ga0307405_10058144 Ga0307405_100581443 280
1037 3300031731 Ga0307405_10115165 Ga0307405_101151653 280
1038 3300031824 Ga0307413_10063312 Ga0307413_100633123 280
1039 3300031824 Ga0307413_10116342 Ga0307413_101163423 280
1040 3300031824 Ga0307413_10301333 Ga0307413_103013332 280
1041 3300031852 Ga0307410_10000537 Ga0307410_100005379 280
1042 3300031852 Ga0307410_10024837 Ga0307410_100248372 280
1043 3300031852 Ga0307410_10027374 Ga0307410_100273742 280
1044 3300031852 Ga0307410_10165041 Ga0307410_101650412 280
1045 3300031852 Ga0307410_10307986 Ga0307410_103079862 280
1046 3300031852 Ga0307410_10459307 Ga0307410_104593071 280
1047 3300031901 Ga0307406_10047666 Ga0307406_100476662 280
1048 3300031901 Ga0307406_10309463 Ga0307406_103094632 280
1049 3300031903 Ga0307407_10096333 Ga0307407_100963332 280
1050 3300031911 Ga0307412_10016705 Ga0307412_100167052 280
1051 3300031911 Ga0307412_10228519 Ga0307412_102285192 280
1052 3300031911 Ga0307412_10314523 Ga0307412_103145232 280
1053 3300031995 Ga0307409_100039334 Ga0307409_1000393343 280
1054 3300031995 Ga0307409_100127426 Ga0307409_1001274263 280
1055 3300031995 Ga0307409_100127836 Ga0307409_1001278363 280
1056 3300031995 Ga0307409_100681024 Ga0307409_1006810241 280
1057 3300032002 Ga0307416_100083287 Ga0307416_1000832872 280
1058 3300032002 Ga0307416_100183199 Ga0307416_1001831991 280
1059 3300032002 Ga0307416_100313143 Ga0307416_1003131433 280
1060 3300032002 Ga0307416_100409533 Ga0307416_1004095332 280
1061 3300032002 Ga0307416_100477490 Ga0307416_1004774902 280
1062 3300032004 Ga0307414_10287069 Ga0307414_102870691 280
1063 3300032004 Ga0307414_10526957 Ga0307414_105269572 280
1064 3300032005 Ga0307411_10000314 Ga0307411_100003146 280
1065 3300032005 Ga0307411_10042622 Ga0307411_100426222 280
1066 3300032005 Ga0307411_10215982 Ga0307411_102159822 280
1067 3300032005 Ga0307411_10538208 Ga0307411_105382081 280
1068 3300032126 Ga0307415_100002988 Ga0307415_1000029889 280
1069 3300032126 Ga0307415_100005774 Ga0307415_1000057742 280
1070 3300032126 Ga0307415_100247987 Ga0307415_1002479872 280
1071 3300032126 Ga0307415_100289470 Ga0307415_1002894702 280
1072 3300032126 Ga0307415_100377435 Ga0307415_1003774352 280
1073 3300032126 Ga0307415_100647943 Ga0307415_1006479431 280
1074 3300035725 Ga0373947_0243845 Ga0373947_0243845_78_926 280
1075 3300037068 Ga0373925_0004938 Ga0373925_0004938_3241_4089 280
1076 3300037312 Ga0395899_0037734 Ga0395899_0037734_1399_2241 280
1077 3300037312 Ga0395899_0222125 Ga0395899_0222125_141_986 280
1078 3300037418 Ga0395900_0035574 Ga0395900_0035574_3694_4539 280
1079 3300037418 Ga0395900_0090444 Ga0395900_0090444_45_929 280
1080 3300037418 Ga0395900_0200573 Ga0395900_0200573_438_1280 280
1081 3300037418 Ga0395900_0226160 Ga0395900_0226160_466_1308 280
1082 3300037466 Ga0395898_0009147 Ga0395898_0009147_9533_10375 280
1083 3300037466 Ga0395898_0064526 Ga0395898_0064526_707_1552 280
1084 3300037471 Ga0395905_0000886 Ga0395905_0000886_19488_20333 280
1085 3300037471 Ga0395905_0008116 Ga0395905_0008116_4072_4914 280
1086 3300037471 Ga0395905_0009274 Ga0395905_0009274_8690_9532 280
1087 3300037471 Ga0395905_0044096 Ga0395905_0044096_44_928 280
1088 3300037471 Ga0395905_0522555 Ga0395905_0522555_86_928 280
1089 3300042006 Ga0439432_020678 Ga0439432_020678_593_1447 280
1090 3300042007 Ga0439449_0023653 Ga0439449_0023653_1355_2209 280
1091 3300042012 Ga0439455_0047310 Ga0439455_0047310_62_904 280
1092 3300042439 Ga0439464_0018202 Ga0439464_0018202_957_1799 280
1093 3300044693 Ga0466961_0130005 Ga0466961_0130005_422_1270 280
1094 3300044706 Ga0466964_0051973 Ga0466964_0051973_285_1133 280
1095 3300045049 Ga0466959_0105669 Ga0466959_0105669_816_1664 280
1096 3300046525 Ga0495663_0002264 Ga0495663_0002264_4648_5502 280
1097 3300046539 Ga0495621_0000081 Ga0495621_0000081_5337_6191 280
1098 3300046539 Ga0495621_0011164 Ga0495621_0011164_1370_2212 280
1099 3300046558 Ga0495633_0003855 Ga0495633_0003855_4668_5522 280
1100 3300046616 Ga0495668_0010487 Ga0495668_0010487_2349_3191 280
1101 3300046665 Ga0495661_0017672 Ga0495661_0017672_1299_2153 280
1102 3300046684 Ga0495669_0002139 Ga0495669_0002139_6134_6976 280
1103 3300046684 Ga0495669_0003400 Ga0495669_0003400_3459_4313 280
1104 3300046684 Ga0495669_0122239 Ga0495669_0122239_134_976 280
1105 3300047445 Ga0495677_0004198 Ga0495677_0004198_1198_2052 280
1106 3300047445 Ga0495677_0064434 Ga0495677_0064434_28_870 280
1107 3300047445 Ga0495677_0068693 Ga0495677_0068693_96_950 280
1108 3300048905 Ga0496102_0136919 Ga0496102_0136919_436_1278 280
1109 3300048906 Ga0496103_0080737 Ga0496103_0080737_137_979 280
1110 3300048910 Ga0496107_0020379 Ga0496107_0020379_2027_2869 280
1111 3300048911 Ga0496108_0128989 Ga0496108_0128989_408_1262 280
1112 3300048912 Ga0496109_0090286 Ga0496109_0090286_499_1353 280
1113 3300048912 Ga0496109_0152044 Ga0496109_0152044_399_1253 280
1114 3300048912 Ga0496109_0393572 Ga0496109_0393572_376_1221 280
1115 3300048913 Ga0496110_0001109 Ga0496110_0001109_3357_4211 280
1116 3300049583 Ga0501067_0018792 Ga0501067_0018792_2264_3106 280
1117 3300049585 Ga0501069_0180985 Ga0501069_0180985_153_995 280
1118 3300049686 Ga0501257_036995 Ga0501257_036995_174_1016 280
1119 3300049707 Ga0501234_015312 Ga0501234_015312_295_1137 280
1120 3300049759 Ga0501262_006024 Ga0501262_006024_34_876 280
1121 3300049765 Ga0501268_003298 Ga0501268_003298_600_1442 280
1122 3300050491 nmdc:mga00v17_88258_c1 nmdc:mga00v17_88258_c1_256_1098 280
1123 3300050515 nmdc:mga0a205_696_c1 nmdc:mga0a205_696_c1_25336_26187 280
1124 3300053134 Ga0500658_0000022 Ga0500658_0000022_87447_88289 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

34

232

0.96

PF02113

Peptidase_S13

D-Ala-D-Ala carboxypeptidase 3 (S13) family

147

255

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c6y-assembly2.cif.gz_B ancestral pnca (last common ancestors of gram-positive and gram- negative bacteria) beta-lactamase class a 0.9546 29 265
4b88-assembly1.cif.gz_A ancestral (gnca) beta-lactamase class a 0.9537 29 265
4uhu-assembly1.cif.gz_A w229d mutant of the last common ancestor of gram-negative bacteria (gnca) beta-lactamase class a 0.943 29 269
5fqq-assembly1.cif.gz_A last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a 0.943 28 265
6pq9-assembly1.cif.gz_A crystal structure of tla-1 s70g extended spectrum beta-lactamase 0.9423 26 267
ID Description Score Start End Superfamily
1bsgA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9235 28 263 3.40.710.10
5hw3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9214 28 268 3.40.710.10
1g6aA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9207 25 265 3.40.710.10
6dguD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9191 29 263 3.40.710.10
4yfmB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9172 29 265 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A0Q4J826-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.9935 29 266 GO:0008800
GO:0030655
GO:0046677
AF-A0A4Q3JTY0-F1-model_v4 deleted 0.9923 61 266
AF-A0A0Q4L612-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.9892 21 266 GO:0008800
GO:0030655
GO:0046677
AF-A0A537MKH7-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.986 22 265 GO:0008800
GO:0030655
GO:0046677
AF-A0A437N0Q3-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.9737 28 262 GO:0008800
GO:0030655
GO:0046677

Feature Viewer

pLDDT pTM Quality
89.01 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map