F490406

General Info

Members Datasets Scaffolds Average Seq Length
1121 317 2242 224

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0118982|Ga0373926_0118982_195_965
Length 256
Sequence VIAAIRQSFGTQDDWLFFEKIMNAQTLLRIIDQISYWIGKAFAWLILGLTMVVSIEVFKRYILNAPTSWIFDLNNMLYGTLFMMCGAYTLALAGHVRADFVYIYLKPRAQAGLDLALYFLFFIPGILGLIYAGYGYAADSWRIAEHSNVTAEGPPIYYFKTVIPIAGTFVMLQGLAEIVRCIVCIRTGAWPARLDDVEEIDVIETQLSHSEYVDEESRLAAMETAHAIDDAARHRSVMEEGVVHERAIKEDERNKP

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
314 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
315 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
316 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
317 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.09
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0.36
Rhizoplane 1.34
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0118982 3300035083 Bacteria 995
2 SwRhRL2b_contig_3104459 2162886007 Bacteria 2695
3 JGI24738J21930_10032268 3300002075 Bacteria 1068
4 JGI25406J46586_10036074 3300003203 Bacteria 1798
5 JGI25405J52794_10006434 3300003911 Bacteria 2147
6 Ga0058860_12218305 3300004801 Bacteria 2061
7 Ga0065704_10007501 3300005289 Bacteria 3529
8 Ga0065712_10068036 3300005290 Bacteria 16427
9 Ga0065712_10101614 3300005290 Bacteria 2029
10 Ga0065715_10000722 3300005293 Bacteria 10256
11 Ga0065715_10102386 3300005293 Bacteria 3082
12 Ga0065707_10084079 3300005295 Bacteria 7720
13 Ga0065707_10142005 3300005295 Bacteria 1760
14 Ga0065707_10208515 3300005295 Unclassified 1249
15 Ga0070658_10060816 3300005327 Bacteria 3076
16 Ga0070658_10235695 3300005327 Bacteria 1550
17 Ga0070676_10077293 3300005328 Bacteria 2011
18 Ga0070676_10113770 3300005328 Bacteria 1689
19 Ga0070676_10346632 3300005328 Bacteria 1020
20 Ga0070683_100010705 3300005329 Bacteria 7886
21 Ga0070683_100044531 3300005329 Bacteria 4092
22 Ga0070690_100000084 3300005330 Bacteria 46084
23 Ga0070690_100023676 3300005330 Bacteria 3769
24 Ga0070690_100348513 3300005330 Bacteria 1074
25 Ga0070690_100442689 3300005330 Bacteria 962
26 Ga0070690_100676094 3300005330 Bacteria 791
27 Ga0070670_100008967 3300005331 Bacteria 8544
28 Ga0070670_100017353 3300005331 Bacteria 6174
29 Ga0070670_100417538 3300005331 Bacteria 1186
30 Ga0070677_10004487 3300005333 Bacteria 4561
31 Ga0068869_100002231 3300005334 Bacteria 11651
32 Ga0068869_100020315 3300005334 Bacteria 4553
33 Ga0068869_100024645 3300005334 Bacteria 4169
34 Ga0070666_10021322 3300005335 Bacteria 4199
35 Ga0070680_100001288 3300005336 Bacteria 18128
36 Ga0070680_100048294 3300005336 Bacteria 3468
37 Ga0070680_100073083 3300005336 Bacteria 2819
38 Ga0070680_100335734 3300005336 Bacteria 1284
39 Ga0070682_100004268 3300005337 Bacteria 7930
40 Ga0068868_100004364 3300005338 Bacteria 9913
41 Ga0070660_100008802 3300005339 Bacteria 7072
42 Ga0070660_100059938 3300005339 Bacteria 2953
43 Ga0070660_100065693 3300005339 Bacteria 2823
44 Ga0070689_100001346 3300005340 Bacteria 15600
45 Ga0070689_100051444 3300005340 Bacteria 3185
46 Ga0070689_100106928 3300005340 Bacteria 2221
47 Ga0070689_100311882 3300005340 Bacteria 1312
48 Ga0070691_10005629 3300005341 Bacteria 5708
49 Ga0070691_10012905 3300005341 Bacteria 3826
50 Ga0070687_100000044 3300005343 Bacteria 40074
51 Ga0070687_100052602 3300005343 Bacteria 2114
52 Ga0070661_100028601 3300005344 Bacteria 4021
53 Ga0070661_100134069 3300005344 Bacteria 1862
54 Ga0070661_100164101 3300005344 Bacteria 1684
55 Ga0070692_10001178 3300005345 Bacteria 9231
56 Ga0070692_10026452 3300005345 Bacteria 2868
57 Ga0070692_10050282 3300005345 Bacteria 2164
58 Ga0070692_10308902 3300005345 Bacteria 968
59 Ga0070668_100026523 3300005347 Bacteria 4398
60 Ga0070668_100054882 3300005347 Bacteria 3074
61 Ga0070668_100080982 3300005347 Bacteria 2545
62 Ga0070669_100022482 3300005353 Bacteria 4508
63 Ga0070669_100033788 3300005353 Bacteria 3700
64 Ga0070669_100056856 3300005353 Bacteria 2869
65 Ga0070669_100110240 3300005353 Bacteria 2088
66 Ga0070669_100125321 3300005353 Bacteria 1965
67 Ga0070669_100762992 3300005353 Bacteria 820
68 Ga0070675_100015248 3300005354 Bacteria 6070
69 Ga0070675_100085139 3300005354 Bacteria 2641
70 Ga0070671_100353106 3300005355 Bacteria 1255
71 Ga0070674_100105098 3300005356 Bacteria 2064
72 Ga0070674_100109819 3300005356 Bacteria 2023
73 Ga0070674_100422668 3300005356 Bacteria 1094
74 Ga0070673_100073258 3300005364 Bacteria 2756
75 Ga0070688_100184808 3300005365 Bacteria 1448
76 Ga0070688_100285727 3300005365 Bacteria 1187
77 Ga0070659_100059096 3300005366 Bacteria 3027
78 Ga0070659_100149206 3300005366 Bacteria 1907
79 Ga0070659_100389276 3300005366 Bacteria 1175
80 Ga0070667_100033667 3300005367 Bacteria 4286
81 Ga0070703_10009462 3300005406 Bacteria 2748
82 Ga0070703_10035602 3300005406 Bacteria 1526
83 Ga0070713_100095114 3300005436 Bacteria 2569
84 Ga0070701_10000117 3300005438 Bacteria 23146
85 Ga0070705_100001347 3300005440 Bacteria 13114
86 Ga0070705_100005643 3300005440 Bacteria 6106
87 Ga0070705_100013827 3300005440 Bacteria 4136
88 Ga0070705_100158369 3300005440 Bacteria 1511
89 Ga0070700_100002094 3300005441 Bacteria 10133
90 Ga0070700_100005882 3300005441 Bacteria 6518
91 Ga0070700_100012818 3300005441 Bacteria 4696
92 Ga0070700_100119180 3300005441 Bacteria 1766
93 Ga0070700_100414008 3300005441 Bacteria 1017
94 Ga0070694_100000077 3300005444 Bacteria 47645
95 Ga0070694_100041569 3300005444 Bacteria 3068
96 Ga0070694_100064623 3300005444 Bacteria 2505
97 Ga0070694_100066782 3300005444 Bacteria 2468
98 Ga0070694_100156132 3300005444 Bacteria 1670
99 Ga0070694_100161902 3300005444 Bacteria 1642
100 Ga0070694_100182592 3300005444 Bacteria 1552
101 Ga0070694_100260247 3300005444 Bacteria 1316
102 Ga0070694_100313813 3300005444 Bacteria 1205
103 Ga0070708_100000447 3300005445 Bacteria 30884
104 Ga0070708_100066904 3300005445 Bacteria 3225
105 Ga0070708_100093428 3300005445 Bacteria 2742
106 Ga0070708_100322849 3300005445 Bacteria 1454
107 Ga0070708_100458516 3300005445 Bacteria 1203
108 Ga0070663_100210513 3300005455 Bacteria 1522
109 Ga0070678_100046572 3300005456 Bacteria 3110
110 Ga0070662_100082013 3300005457 Bacteria 2404
111 Ga0070662_100256529 3300005457 Bacteria 1407
112 Ga0070662_100312700 3300005457 Bacteria 1279
113 Ga0070662_100625626 3300005457 Bacteria 907
114 Ga0070681_10004422 3300005458 Bacteria 13387
115 Ga0070681_10038897 3300005458 Bacteria 4769
116 Ga0070681_10126094 3300005458 Bacteria 2493
117 Ga0070681_10588690 3300005458 Bacteria 1027
118 Ga0068867_100000107 3300005459 Bacteria 53378
119 Ga0068867_100002038 3300005459 Bacteria 14143
120 Ga0068867_100012872 3300005459 Bacteria 5920
121 Ga0068867_100126519 3300005459 Bacteria 1981
122 Ga0068867_100326898 3300005459 Bacteria 1272
123 Ga0070706_100141430 3300005467 Bacteria 2246
124 Ga0070706_100205318 3300005467 Bacteria 1840
125 Ga0070706_100540994 3300005467 Bacteria 1083
126 Ga0070706_100685187 3300005467 Bacteria 951
127 Ga0070707_100004382 3300005468 Bacteria 13216
128 Ga0070707_100015647 3300005468 Bacteria 7119
129 Ga0070707_100066699 3300005468 Bacteria 3459
130 Ga0070707_100080332 3300005468 Bacteria 3147
131 Ga0070707_100160535 3300005468 Bacteria 2190
132 Ga0070707_100282909 3300005468 Bacteria 1612
133 Ga0070707_100358050 3300005468 Bacteria 1417
134 Ga0070698_100040784 3300005471 Bacteria 4769
135 Ga0070698_100081691 3300005471 Bacteria 3225
136 Ga0070698_100084248 3300005471 Bacteria 3167
137 Ga0070698_100091131 3300005471 Bacteria 3031
138 Ga0070698_100160336 3300005471 Bacteria 2193
139 Ga0070698_100193037 3300005471 Bacteria 1973
140 Ga0070698_100303632 3300005471 Bacteria 1527
141 Ga0070699_100019933 3300005518 Bacteria 5779
142 Ga0070699_100036447 3300005518 Bacteria 4255
143 Ga0070699_100048457 3300005518 Bacteria 3677
144 Ga0070699_100063566 3300005518 Bacteria 3200
145 Ga0070699_100102187 3300005518 Bacteria 2513
146 Ga0070699_100355758 3300005518 Bacteria 1320
147 Ga0070699_100430922 3300005518 Bacteria 1194
148 Ga0070679_100004443 3300005530 Bacteria 12957
149 Ga0070679_100008492 3300005530 Bacteria 9674
150 Ga0070679_100089471 3300005530 Bacteria 3065
151 Ga0070684_100011752 3300005535 Bacteria 6984
152 Ga0070684_100045196 3300005535 Bacteria 3813
153 Ga0070697_100009294 3300005536 Bacteria 7683
154 Ga0070697_100043380 3300005536 Bacteria 3642
155 Ga0070697_100057780 3300005536 Bacteria 3156
156 Ga0070697_100173029 3300005536 Bacteria 1828
157 Ga0070697_100176917 3300005536 Bacteria 1808
158 Ga0070697_100224619 3300005536 Bacteria 1601
159 Ga0070697_100275228 3300005536 Bacteria 1443
160 Ga0070697_100472793 3300005536 Bacteria 1094
161 Ga0068853_100062007 3300005539 Bacteria 3235
162 Ga0068853_100788390 3300005539 Bacteria 909
163 Ga0070672_100021278 3300005543 Bacteria 4744
164 Ga0070672_100659388 3300005543 Bacteria 914
165 Ga0070686_100000168 3300005544 Bacteria 45696
166 Ga0070686_100004664 3300005544 Bacteria 7560
167 Ga0070686_100017936 3300005544 Bacteria 4145
168 Ga0070686_100226882 3300005544 Bacteria 1353
169 Ga0070686_100289036 3300005544 Bacteria 1212
170 Ga0070695_100001073 3300005545 Bacteria 14936
171 Ga0070695_100003939 3300005545 Bacteria 8670
172 Ga0070695_100005491 3300005545 Bacteria 7468
173 Ga0070695_100006201 3300005545 Bacteria 7061
174 Ga0070695_100165884 3300005545 Bacteria 1554
175 Ga0070695_100454273 3300005545 Bacteria 982
176 Ga0070696_100000128 3300005546 Bacteria 40522
177 Ga0070696_100017960 3300005546 Bacteria 4777
178 Ga0070696_100019476 3300005546 Bacteria 4595
179 Ga0070696_100019757 3300005546 Bacteria 4565
180 Ga0070696_100027637 3300005546 Bacteria 3867
181 Ga0070696_100109526 3300005546 Bacteria 1988
182 Ga0070696_100130769 3300005546 Bacteria 1826
183 Ga0070696_100285374 3300005546 Bacteria 1260
184 Ga0070693_100000040 3300005547 Bacteria 49709
185 Ga0070693_100045559 3300005547 Bacteria 2487
186 Ga0070693_100275398 3300005547 Bacteria 1125
187 Ga0070704_100000120 3300005549 Bacteria 28329
188 Ga0070704_100015872 3300005549 Bacteria 4743
189 Ga0070704_100104880 3300005549 Bacteria 2139
190 Ga0070704_100218326 3300005549 Bacteria 1549
191 Ga0070704_100478428 3300005549 Bacteria 1077
192 Ga0070704_100484383 3300005549 Bacteria 1071
193 Ga0068855_100004919 3300005563 Bacteria 16308
194 Ga0068855_100045298 3300005563 Bacteria 5202
195 Ga0068855_100070510 3300005563 Bacteria 4065
196 Ga0070664_100000225 3300005564 Bacteria 40336
197 Ga0070664_100066904 3300005564 Bacteria 3069
198 Ga0068857_100084731 3300005577 Bacteria 2832
199 Ga0068854_100003643 3300005578 Bacteria 9639
200 Ga0068854_100069349 3300005578 Bacteria 2573
201 Ga0068854_100391871 3300005578 Bacteria 1147
202 Ga0068856_100028131 3300005614 Bacteria 5487
203 Ga0068856_100029845 3300005614 Bacteria 5329
204 Ga0068856_100030872 3300005614 Bacteria 5240
205 Ga0068856_100106660 3300005614 Bacteria 2796
206 Ga0068856_100239498 3300005614 Bacteria 1830
207 Ga0070702_100000052 3300005615 Bacteria 32738
208 Ga0070702_100012889 3300005615 Bacteria 4209
209 Ga0070702_100068093 3300005615 Bacteria 2094
210 Ga0070702_100184646 3300005615 Bacteria 1367
211 Ga0070702_100269926 3300005615 Bacteria 1163
212 Ga0068852_100001351 3300005616 Bacteria 16461
213 Ga0068852_100039939 3300005616 Bacteria 3954
214 Ga0068859_100000332 3300005617 Bacteria 47130
215 Ga0068859_100005210 3300005617 Bacteria 13210
216 Ga0068859_100028755 3300005617 Bacteria 5573
217 Ga0068859_100109043 3300005617 Bacteria 2830
218 Ga0068859_100477108 3300005617 Bacteria 1343
219 Ga0068859_100528367 3300005617 Bacteria 1274
220 Ga0068859_101083206 3300005617 Bacteria 881
221 Ga0068864_100165122 3300005618 Bacteria 2015
222 Ga0068866_10070018 3300005718 Bacteria 1850
223 Ga0068866_10103504 3300005718 Bacteria 1575
224 Ga0068866_10111228 3300005718 Bacteria 1529
225 Ga0068866_10284544 3300005718 Bacteria 1026
226 Ga0068861_100000100 3300005719 Bacteria 42431
227 Ga0068861_100002872 3300005719 Bacteria 11350
228 Ga0068861_100093675 3300005719 Bacteria 2375
229 Ga0068861_100571722 3300005719 Bacteria 1033
230 Ga0068861_100683041 3300005719 Bacteria 952
231 Ga0068870_10054086 3300005840 Bacteria 2134
232 Ga0068870_10095820 3300005840 Bacteria 1668
233 Ga0068863_100173562 3300005841 Bacteria 2068
234 Ga0068863_100280326 3300005841 Bacteria 1615
235 Ga0068863_100289817 3300005841 Bacteria 1587
236 Ga0068858_100000941 3300005842 Bacteria 30171
237 Ga0068858_100363221 3300005842 Bacteria 1388
238 Ga0068860_100000773 3300005843 Bacteria 35982
239 Ga0068860_100059007 3300005843 Bacteria 3649
240 Ga0068860_100618026 3300005843 Bacteria 1090
241 Ga0068862_100002566 3300005844 Bacteria 16051
242 Ga0068862_100005061 3300005844 Bacteria 11093
243 Ga0068862_100048026 3300005844 Bacteria 3643
244 Ga0068862_100079230 3300005844 Bacteria 2847
245 Ga0068862_100207819 3300005844 Bacteria 1768
246 Ga0068862_100209028 3300005844 Bacteria 1763
247 Ga0081455_10000141 3300005937 Bacteria 84891
248 Ga0081455_10004492 3300005937 Bacteria 15607
249 Ga0081455_10039250 3300005937 Bacteria 4186
250 Ga0081455_10243393 3300005937 Unclassified 1320
251 Ga0081455_10317564 3300005937 Bacteria 1111
252 Ga0081538_10049725 3300005981 Bacteria 2540
253 Ga0081538_10163332 3300005981 Bacteria 985
254 Ga0081540_1012177 3300005983 Bacteria 5687
255 Ga0081540_1077615 3300005983 Bacteria 1509
256 Ga0081539_10000166 3300005985 Bacteria 153758
257 Ga0070717_10088575 3300006028 Bacteria 2609
258 Ga0075368_10075510 3300006042 Bacteria 1367
259 Ga0075363_100326870 3300006048 Bacteria 893
260 Ga0075432_10168729 3300006058 Bacteria 850
261 Ga0070716_100008899 3300006173 Bacteria 4992
262 Ga0075362_10078939 3300006177 Bacteria 1514
263 Ga0075362_10084870 3300006177 Bacteria 1463
264 Ga0075367_10031261 3300006178 Bacteria 3056
265 Ga0075366_10080492 3300006195 Bacteria 1945
266 Ga0097621_100003035 3300006237 Bacteria 11532
267 Ga0097621_100352151 3300006237 Bacteria 1310
268 Ga0068871_100000238 3300006358 Bacteria 38970
269 Ga0075428_100000538 3300006844 Bacteria 38617
270 Ga0075428_100002073 3300006844 Bacteria 21627
271 Ga0075428_100003176 3300006844 Bacteria 17959
272 Ga0075428_100031605 3300006844 Bacteria 5849
273 Ga0075428_100045633 3300006844 Bacteria 4814
274 Ga0075428_100048090 3300006844 Bacteria 4682
275 Ga0075428_100060357 3300006844 Bacteria 4152
276 Ga0075428_100084090 3300006844 Bacteria 3472
277 Ga0075428_100168622 3300006844 Bacteria 2374
278 Ga0075428_100863089 3300006844 Bacteria 961
279 Ga0075430_100000022 3300006846 Bacteria 81752
280 Ga0075430_100000126 3300006846 Bacteria 48056
281 Ga0075430_100016400 3300006846 Bacteria 6307
282 Ga0075430_100022072 3300006846 Bacteria 5411
283 Ga0075430_100025967 3300006846 Bacteria 4984
284 Ga0075430_100047425 3300006846 Bacteria 3628
285 Ga0075430_100361964 3300006846 Bacteria 1198
286 Ga0075431_100000203 3300006847 Bacteria 43754
287 Ga0075431_100001584 3300006847 Bacteria 21166
288 Ga0075431_100010580 3300006847 Bacteria 9276
289 Ga0075431_100011301 3300006847 Bacteria 8993
290 Ga0075431_100028790 3300006847 Bacteria 5711
291 Ga0075431_100045579 3300006847 Bacteria 4521
292 Ga0075431_100057706 3300006847 Bacteria 4004
293 Ga0075431_100087405 3300006847 Bacteria 3217
294 Ga0075431_100118175 3300006847 Bacteria 2736
295 Ga0075431_100165806 3300006847 Bacteria 2271
296 Ga0075431_100186610 3300006847 Bacteria 2126
297 Ga0075431_100191949 3300006847 Bacteria 2093
298 Ga0075431_100256458 3300006847 Bacteria 1776
299 Ga0075431_100270974 3300006847 Bacteria 1720
300 Ga0075431_100276275 3300006847 Bacteria 1701
301 Ga0075431_100416766 3300006847 Bacteria 1343
302 Ga0075431_100873770 3300006847 Bacteria 870
303 Ga0075433_10000983 3300006852 Bacteria 20252
304 Ga0075433_10003421 3300006852 Bacteria 12242
305 Ga0075433_10006374 3300006852 Bacteria 9330
306 Ga0075433_10058657 3300006852 Bacteria 3367
307 Ga0075433_10102968 3300006852 Bacteria 2529
308 Ga0075433_10115934 3300006852 Bacteria 2377
309 Ga0075433_10186278 3300006852 Bacteria 1847
310 Ga0075433_10621692 3300006852 Bacteria 948
311 Ga0075433_10709781 3300006852 Bacteria 881
312 Ga0075434_100005320 3300006871 Bacteria 11709
313 Ga0075434_100021906 3300006871 Bacteria 6220
314 Ga0075434_100029173 3300006871 Bacteria 5426
315 Ga0075434_100042458 3300006871 Bacteria 4508
316 Ga0075434_100080488 3300006871 Bacteria 3254
317 Ga0075434_100090538 3300006871 Bacteria 3060
318 Ga0075434_100095155 3300006871 Bacteria 2984
319 Ga0075434_100121477 3300006871 Bacteria 2628
320 Ga0075434_100128687 3300006871 Bacteria 2550
321 Ga0075434_100188202 3300006871 Bacteria 2084
322 Ga0075434_100669637 3300006871 Bacteria 1056
323 Ga0075429_100000069 3300006880 Bacteria 51472
324 Ga0075429_100016733 3300006880 Bacteria 6351
325 Ga0075429_100027496 3300006880 Bacteria 4938
326 Ga0075429_100041037 3300006880 Bacteria 4030
327 Ga0075429_100138609 3300006880 Bacteria 2129
328 Ga0075429_100178190 3300006880 Bacteria 1863
329 Ga0075429_100201299 3300006880 Bacteria 1745
330 Ga0075429_100223674 3300006880 Bacteria 1649
331 Ga0075429_100303681 3300006880 Bacteria 1397
332 Ga0075429_100328444 3300006880 Bacteria 1338
333 Ga0068865_100000142 3300006881 Bacteria 37988
334 Ga0068865_100016167 3300006881 Bacteria 4768
335 Ga0068865_100053876 3300006881 Bacteria 2792
336 Ga0068865_100657581 3300006881 Bacteria 891
337 Ga0075436_100000311 3300006914 Bacteria 31075
338 Ga0075436_100003545 3300006914 Bacteria 10707
339 Ga0075436_100006889 3300006914 Bacteria 7772
340 Ga0075436_100006942 3300006914 Bacteria 7748
341 Ga0075436_100018642 3300006914 Bacteria 4750
342 Ga0075436_100042430 3300006914 Bacteria 3137
343 Ga0075436_100045133 3300006914 Bacteria 3040
344 Ga0075436_100080636 3300006914 Bacteria 2255
345 Ga0075436_100196297 3300006914 Bacteria 1429
346 Ga0075436_100238506 3300006914 Bacteria 1293
347 Ga0097620_100000332 3300006931 Bacteria 47130
348 Ga0097620_100005210 3300006931 Bacteria 13210
349 Ga0097620_100028754 3300006931 Bacteria 5573
350 Ga0097620_100109045 3300006931 Bacteria 2830
351 Ga0097620_100477059 3300006931 Bacteria 1343
352 Ga0097620_100528369 3300006931 Bacteria 1274
353 Ga0097620_101083328 3300006931 Bacteria 881
354 Ga0075435_100000118 3300007076 Bacteria 44235
355 Ga0075435_100006807 3300007076 Bacteria 8111
356 Ga0075435_100015059 3300007076 Bacteria 5805
357 Ga0075435_100020128 3300007076 Bacteria 5105
358 Ga0075435_100026122 3300007076 Bacteria 4552
359 Ga0075435_100028269 3300007076 Bacteria 4396
360 Ga0075435_100050039 3300007076 Bacteria 3362
361 Ga0075435_100058145 3300007076 Bacteria 3131
362 Ga0075435_100069979 3300007076 Bacteria 2863
363 Ga0075435_100127378 3300007076 Bacteria 2129
364 Ga0075435_100134997 3300007076 Bacteria 2066
365 Ga0075435_100638884 3300007076 Bacteria 924
366 Ga0099794_10001420 3300007265 Bacteria 8385
367 Ga0099794_10003300 3300007265 Bacteria 6128
368 Ga0099794_10022811 3300007265 Bacteria 2857
369 Ga0099794_10025161 3300007265 Bacteria 2739
370 Ga0099794_10253768 3300007265 Bacteria 907
371 Ga0105250_10020340 3300009092 Bacteria 2685
372 Ga0105240_10116472 3300009093 Bacteria 3224
373 Ga0105240_10345454 3300009093 Bacteria 1689
374 Ga0111539_10000819 3300009094 Bacteria 40336
375 Ga0111539_10011469 3300009094 Bacteria 11123
376 Ga0111539_10017237 3300009094 Bacteria 8938
377 Ga0111539_10021244 3300009094 Bacteria 7992
378 Ga0111539_10021390 3300009094 Bacteria 7963
379 Ga0111539_10097380 3300009094 Bacteria 3456
380 Ga0111539_10143342 3300009094 Bacteria 2797
381 Ga0111539_10304750 3300009094 Bacteria 1854
382 Ga0111539_10396906 3300009094 Bacteria 1606
383 Ga0111539_10412015 3300009094 Bacteria 1574
384 Ga0111539_10478850 3300009094 Bacteria 1450
385 Ga0111539_10664136 3300009094 Bacteria 1214
386 Ga0111539_10692934 3300009094 Bacteria 1186
387 Ga0105245_10000115 3300009098 Bacteria 77632
388 Ga0105245_10227447 3300009098 Bacteria 1803
389 Ga0105245_10239705 3300009098 Bacteria 1757
390 Ga0105245_10315192 3300009098 Bacteria 1539
391 Ga0105247_10045814 3300009101 Bacteria 2684
392 Ga0105247_10167674 3300009101 Bacteria 1458
393 Ga0114129_10000865 3300009147 Bacteria 39394
394 Ga0114129_10001132 3300009147 Bacteria 35229
395 Ga0114129_10004345 3300009147 Bacteria 20018
396 Ga0114129_10006933 3300009147 Bacteria 16118
397 Ga0114129_10015092 3300009147 Bacteria 10995
398 Ga0114129_10015802 3300009147 Bacteria 10732
399 Ga0114129_10019885 3300009147 Bacteria 9556
400 Ga0114129_10028016 3300009147 Bacteria 7979
401 Ga0114129_10040592 3300009147 Bacteria 6559
402 Ga0114129_10050132 3300009147 Bacteria 5865
403 Ga0114129_10093234 3300009147 Bacteria 4171
404 Ga0114129_10179398 3300009147 Bacteria 2883
405 Ga0114129_10216580 3300009147 Bacteria 2586
406 Ga0114129_10326475 3300009147 Bacteria 2039
407 Ga0114129_10337573 3300009147 Bacteria 1999
408 Ga0114129_10422540 3300009147 Bacteria 1753
409 Ga0114129_10473590 3300009147 Bacteria 1639
410 Ga0114129_10640269 3300009147 Bacteria 1373
411 Ga0114129_10802328 3300009147 Bacteria 1201
412 Ga0114129_10823742 3300009147 Bacteria 1182
413 Ga0114129_11327596 3300009147 Bacteria 890
414 Ga0105243_10000035 3300009148 Bacteria 177598
415 Ga0105243_10018411 3300009148 Bacteria 5290
416 Ga0105243_10054459 3300009148 Bacteria 3176
417 Ga0105243_10348109 3300009148 Bacteria 1360
418 Ga0105243_10629390 3300009148 Bacteria 1037
419 Ga0105243_11258461 3300009148 Bacteria 755
420 Ga0105241_10024461 3300009174 Bacteria 4484
421 Ga0105241_10025791 3300009174 Bacteria 4369
422 Ga0105241_10046542 3300009174 Bacteria 3295
423 Ga0105241_10326114 3300009174 Bacteria 1325
424 Ga0105242_10000268 3300009176 Bacteria 41263
425 Ga0105242_10001873 3300009176 Bacteria 16535
426 Ga0105242_10148652 3300009176 Bacteria 2041
427 Ga0105242_10189625 3300009176 Bacteria 1819
428 Ga0105242_10276044 3300009176 Bacteria 1524
429 Ga0105242_10443532 3300009176 Bacteria 1222
430 Ga0105237_10133297 3300009545 Bacteria 2479
431 Ga0105237_10259564 3300009545 Bacteria 1740
432 Ga0105238_10000931 3300009551 Bacteria 29986
433 Ga0105238_10119209 3300009551 Bacteria 2619
434 Ga0105249_10001725 3300009553 Bacteria 19130
435 Ga0105249_10022878 3300009553 Bacteria 5602
436 Ga0105249_10081151 3300009553 Bacteria 3014
437 Ga0105249_10099499 3300009553 Bacteria 2733
438 Ga0105249_10373258 3300009553 Bacteria 1451
439 Ga0105249_10538872 3300009553 Bacteria 1217
440 Ga0105249_10851666 3300009553 Bacteria 977
441 Ga0105249_10868595 3300009553 Bacteria 968
442 Ga0099796_10076320 3300010159 Bacteria 1220
443 Ga0099796_10144474 3300010159 Bacteria 932
444 Ga0105239_10019073 3300010375 Bacteria 7580
445 Ga0105239_10022702 3300010375 Bacteria 6917
446 Ga0105239_10243185 3300010375 Bacteria 2020
447 Ga0105246_10020609 3300011119 Bacteria 4231
448 Ga0105246_10139184 3300011119 Bacteria 1823
449 Ga0157373_10075186 3300013100 Bacteria 2383
450 Ga0157371_10096512 3300013102 Bacteria 2095
451 Ga0157371_10127659 3300013102 Bacteria 1809
452 Ga0157371_10153902 3300013102 Bacteria 1640
453 Ga0157371_10231735 3300013102 Bacteria 1327
454 Ga0157370_10005379 3300013104 Bacteria 14376
455 Ga0157370_10040092 3300013104 Bacteria 4522
456 Ga0157370_10152710 3300013104 Bacteria 2148
457 Ga0157369_10004550 3300013105 Bacteria 16308
458 Ga0157369_10121837 3300013105 Bacteria 2767
459 Ga0157374_10051116 3300013296 Bacteria 3845
460 Ga0157378_10001006 3300013297 Bacteria 25838
461 Ga0157378_10051524 3300013297 Bacteria 3663
462 Ga0157378_10065285 3300013297 Bacteria 3258
463 Ga0163162_10140509 3300013306 Bacteria 2528
464 Ga0163162_10206947 3300013306 Bacteria 2091
465 Ga0163162_10344423 3300013306 Bacteria 1623
466 Ga0163162_10354360 3300013306 Bacteria 1600
467 Ga0163162_10369273 3300013306 Bacteria 1568
468 Ga0163162_10484322 3300013306 Bacteria 1368
469 Ga0163162_10711093 3300013306 Bacteria 1126
470 Ga0157372_10065295 3300013307 Bacteria 4086
471 Ga0157372_10116308 3300013307 Bacteria 3066
472 Ga0157372_10186825 3300013307 Bacteria 2400
473 Ga0157372_10192502 3300013307 Bacteria 2362
474 Ga0157375_10243303 3300013308 Bacteria 1959
475 Ga0157375_10625128 3300013308 Bacteria 1235
476 Ga0157380_10021893 3300014326 Bacteria 4801
477 Ga0157380_10071901 3300014326 Bacteria 2800
478 Ga0157380_10371243 3300014326 Bacteria 1346
479 Ga0157377_10051052 3300014745 Bacteria 2331
480 Ga0157377_10128343 3300014745 Bacteria 1545
481 Ga0157377_10220732 3300014745 Bacteria 1213
482 Ga0157379_10045050 3300014968 Bacteria 3938
483 Ga0157379_10367757 3300014968 Bacteria 1318
484 Ga0157379_10498009 3300014968 Bacteria 1129
485 Ga0157376_10044711 3300014969 Bacteria 3641
486 Ga0163161_10404586 3300017792 Bacteria 1095
487 Ga0207697_10035475 3300025315 Bacteria 2042
488 Ga0207697_10109225 3300025315 Bacteria 1184
489 Ga0207653_10063472 3300025885 Bacteria 1250
490 Ga0207642_10080353 3300025899 Bacteria 1581
491 Ga0207642_10225370 3300025899 Bacteria 1050
492 Ga0207688_10028357 3300025901 Bacteria 3080
493 Ga0207680_10234719 3300025903 Bacteria 1262
494 Ga0207647_10074440 3300025904 Bacteria 2045
495 Ga0207645_10000424 3300025907 Bacteria 34978
496 Ga0207645_10097038 3300025907 Bacteria 1899
497 Ga0207645_10242237 3300025907 Bacteria 1191
498 Ga0207643_10030254 3300025908 Bacteria 3012
499 Ga0207643_10137350 3300025908 Bacteria 1458
500 Ga0207705_10054195 3300025909 Bacteria 2891
501 Ga0207705_10246292 3300025909 Bacteria 1362
502 Ga0207684_10001278 3300025910 Bacteria 27767
503 Ga0207684_10005462 3300025910 Bacteria 11714
504 Ga0207684_10012392 3300025910 Bacteria 7418
505 Ga0207684_10029734 3300025910 Bacteria 4651
506 Ga0207684_10038233 3300025910 Bacteria 4072
507 Ga0207684_10044090 3300025910 Bacteria 3782
508 Ga0207684_10066620 3300025910 Bacteria 3059
509 Ga0207684_10819715 3300025910 Bacteria 786
510 Ga0207654_10032791 3300025911 Bacteria 2873
511 Ga0207707_10000652 3300025912 Bacteria 34321
512 Ga0207707_10016505 3300025912 Bacteria 6439
513 Ga0207707_10102928 3300025912 Bacteria 2496
514 Ga0207707_10229174 3300025912 Bacteria 1616
515 Ga0207695_10008877 3300025913 Bacteria 12517
516 Ga0207671_10384641 3300025914 Bacteria 1115
517 Ga0207660_10000612 3300025917 Bacteria 24091
518 Ga0207660_10031947 3300025917 Bacteria 3630
519 Ga0207660_10062184 3300025917 Bacteria 2689
520 Ga0207660_10120035 3300025917 Bacteria 1990
521 Ga0207660_10122717 3300025917 Bacteria 1969
522 Ga0207660_10239338 3300025917 Bacteria 1429
523 Ga0207660_10590304 3300025917 Bacteria 904
524 Ga0207662_10000061 3300025918 Bacteria 47261
525 Ga0207662_10066875 3300025918 Bacteria 2166
526 Ga0207662_10094601 3300025918 Bacteria 1843
527 Ga0207662_10101498 3300025918 Bacteria 1783
528 Ga0207657_10014122 3300025919 Bacteria 7814
529 Ga0207657_10070832 3300025919 Bacteria 2954
530 Ga0207657_10230961 3300025919 Bacteria 1480
531 Ga0207649_10139807 3300025920 Bacteria 1655
532 Ga0207652_10084140 3300025921 Bacteria 2786
533 Ga0207646_10000311 3300025922 Bacteria 66146
534 Ga0207646_10004103 3300025922 Bacteria 16045
535 Ga0207646_10032093 3300025922 Bacteria 4752
536 Ga0207646_10043966 3300025922 Bacteria 4010
537 Ga0207646_10043993 3300025922 Bacteria 4008
538 Ga0207646_10182522 3300025922 Bacteria 1895
539 Ga0207646_10233967 3300025922 Bacteria 1660
540 Ga0207681_10019654 3300025923 Bacteria 4271
541 Ga0207681_10047751 3300025923 Bacteria 2886
542 Ga0207681_10209241 3300025923 Bacteria 1502
543 Ga0207681_10291391 3300025923 Bacteria 1288
544 Ga0207694_10004155 3300025924 Bacteria 11365
545 Ga0207650_10004695 3300025925 Bacteria 9336
546 Ga0207650_10135449 3300025925 Bacteria 1932
547 Ga0207650_10324311 3300025925 Bacteria 1262
548 Ga0207659_10186247 3300025926 Bacteria 1648
549 Ga0207659_10517336 3300025926 Bacteria 1012
550 Ga0207687_10000348 3300025927 Bacteria 30755
551 Ga0207687_10163230 3300025927 Bacteria 1712
552 Ga0207687_10179811 3300025927 Bacteria 1638
553 Ga0207687_10217462 3300025927 Bacteria 1502
554 Ga0207700_10058946 3300025928 Bacteria 2902
555 Ga0207664_10023365 3300025929 Bacteria 4630
556 Ga0207664_10928261 3300025929 Bacteria 781
557 Ga0207690_10037788 3300025932 Bacteria 3137
558 Ga0207690_10095609 3300025932 Bacteria 2111
559 Ga0207690_10118462 3300025932 Bacteria 1919
560 Ga0207690_10140957 3300025932 Bacteria 1776
561 Ga0207706_10005486 3300025933 Bacteria 11828
562 Ga0207706_10013655 3300025933 Bacteria 7375
563 Ga0207706_10025135 3300025933 Bacteria 5340
564 Ga0207706_10165252 3300025933 Bacteria 1945
565 Ga0207686_10005311 3300025934 Bacteria 6910
566 Ga0207686_10007475 3300025934 Bacteria 5882
567 Ga0207686_10085670 3300025934 Bacteria 2067
568 Ga0207709_10000878 3300025935 Bacteria 22877
569 Ga0207709_10010187 3300025935 Bacteria 5177
570 Ga0207709_10012115 3300025935 Bacteria 4754
571 Ga0207709_10420594 3300025935 Bacteria 1026
572 Ga0207670_10000311 3300025936 Bacteria 29168
573 Ga0207670_10035851 3300025936 Bacteria 3221
574 Ga0207670_10097879 3300025936 Bacteria 2090
575 Ga0207670_10271995 3300025936 Bacteria 1317
576 Ga0207670_10331407 3300025936 Bacteria 1200
577 Ga0207670_10556811 3300025936 Bacteria 937
578 Ga0207669_10348521 3300025937 Bacteria 1143
579 Ga0207704_10002514 3300025938 Bacteria 8263
580 Ga0207704_10005499 3300025938 Bacteria 5841
581 Ga0207704_10083555 3300025938 Bacteria 2072
582 Ga0207704_10682690 3300025938 Bacteria 849
583 Ga0207665_10468598 3300025939 Bacteria 969
584 Ga0207691_10001846 3300025940 Bacteria 20701
585 Ga0207691_10039045 3300025940 Bacteria 4393
586 Ga0207691_10068201 3300025940 Bacteria 3214
587 Ga0207691_10350598 3300025940 Bacteria 1263
588 Ga0207689_10000024 3300025942 Bacteria 107574
589 Ga0207689_10049546 3300025942 Bacteria 3464
590 Ga0207689_10495465 3300025942 Bacteria 1023
591 Ga0207661_10067898 3300025944 Bacteria 2901
592 Ga0207661_10341359 3300025944 Bacteria 1349
593 Ga0207679_10004100 3300025945 Bacteria 9040
594 Ga0207679_10019948 3300025945 Bacteria 4515
595 Ga0207679_10177698 3300025945 Bacteria 1758
596 Ga0207667_10001264 3300025949 Bacteria 31701
597 Ga0207667_10063812 3300025949 Bacteria 3848
598 Ga0207667_10067088 3300025949 Bacteria 3738
599 Ga0207667_10093911 3300025949 Bacteria 3097
600 Ga0207712_10002693 3300025961 Bacteria 11339
601 Ga0207712_10054389 3300025961 Bacteria 2812
602 Ga0207712_10093400 3300025961 Bacteria 2220
603 Ga0207712_10404494 3300025961 Bacteria 1148
604 Ga0207668_10007138 3300025972 Bacteria 6632
605 Ga0207668_10023460 3300025972 Bacteria 3966
606 Ga0207668_10120300 3300025972 Bacteria 1987
607 Ga0207668_10380516 3300025972 Bacteria 1188
608 Ga0207640_10003020 3300025981 Bacteria 9052
609 Ga0207640_10035416 3300025981 Bacteria 3124
610 Ga0207640_10185133 3300025981 Bacteria 1565
611 Ga0207640_10209733 3300025981 Bacteria 1483
612 Ga0207677_10002184 3300026023 Bacteria 10289
613 Ga0207703_10028843 3300026035 Bacteria 4379
614 Ga0207703_10217539 3300026035 Bacteria 1706
615 Ga0207703_10268420 3300026035 Bacteria 1545
616 Ga0207639_10388245 3300026041 Bacteria 1255
617 Ga0207708_10000905 3300026075 Bacteria 22282
618 Ga0207708_10004713 3300026075 Bacteria 10029
619 Ga0207708_10050011 3300026075 Bacteria 3182
620 Ga0207708_10083101 3300026075 Bacteria 2462
621 Ga0207702_10007398 3300026078 Bacteria 9374
622 Ga0207702_10024199 3300026078 Bacteria 5038
623 Ga0207702_10294982 3300026078 Bacteria 1537
624 Ga0207641_10223238 3300026088 Bacteria 1748
625 Ga0207641_10536599 3300026088 Bacteria 1139
626 Ga0207648_10000113 3300026089 Bacteria 78626
627 Ga0207648_10011501 3300026089 Bacteria 8333
628 Ga0207648_10015627 3300026089 Bacteria 6974
629 Ga0207648_10020579 3300026089 Bacteria 5940
630 Ga0207648_10190490 3300026089 Bacteria 1817
631 Ga0207648_10326473 3300026089 Bacteria 1380
632 Ga0207676_10043514 3300026095 Bacteria 3459
633 Ga0207676_10298762 3300026095 Bacteria 1469
634 Ga0207676_11339806 3300026095 Bacteria 711
635 Ga0207674_10060152 3300026116 Bacteria 3843
636 Ga0207674_10067898 3300026116 Bacteria 3588
637 Ga0207674_10202131 3300026116 Bacteria 1936
638 Ga0207674_10224926 3300026116 Bacteria 1825
639 Ga0207675_100000017 3300026118 Bacteria 124338
640 Ga0207675_100001259 3300026118 Bacteria 25276
641 Ga0207675_100016991 3300026118 Bacteria 6798
642 Ga0207675_100341674 3300026118 Bacteria 1465
643 Ga0207675_100478373 3300026118 Bacteria 1237
644 Ga0207675_100580296 3300026118 Bacteria 1123
645 Ga0207683_10001072 3300026121 Bacteria 24962
646 Ga0207683_10687884 3300026121 Bacteria 948
647 Ga0207698_10256825 3300026142 Bacteria 1603
648 Ga0207698_10418389 3300026142 Bacteria 1285
649 Ga0209995_1026236 3300027471 Bacteria 972
650 Ga0209999_1032115 3300027543 Bacteria 975
651 Ga0209588_1005166 3300027671 Bacteria 3723
652 Ga0209588_1010497 3300027671 Bacteria 2784
653 Ga0209588_1070208 3300027671 Bacteria 1132
654 Ga0209588_1073613 3300027671 Bacteria 1104
655 Ga0209998_10005515 3300027717 Bacteria 2644
656 Ga0209998_10029326 3300027717 Bacteria 1213
657 Ga0209974_10001979 3300027876 Bacteria 7470
658 Ga0209974_10004251 3300027876 Bacteria 5112
659 Ga0209974_10037558 3300027876 Bacteria 1608
660 Ga0209974_10038560 3300027876 Bacteria 1588
661 Ga0207428_10000009 3300027907 Bacteria 410565
662 Ga0207428_10002133 3300027907 Bacteria 19893
663 Ga0207428_10129398 3300027907 Bacteria 1932
664 Ga0207428_10171248 3300027907 Bacteria 1644
665 Ga0207428_10188037 3300027907 Bacteria 1557
666 Ga0207428_10268241 3300027907 Bacteria 1270
667 Ga0268266_10662738 3300028379 Bacteria 1005
668 Ga0268265_10000773 3300028380 Bacteria 30842
669 Ga0268265_10008473 3300028380 Bacteria 6946
670 Ga0268265_10040327 3300028380 Bacteria 3448
671 Ga0268265_10161360 3300028380 Bacteria 1904
672 Ga0268265_10171435 3300028380 Bacteria 1855
673 Ga0268265_10179389 3300028380 Bacteria 1818
674 Ga0268265_10200893 3300028380 Bacteria 1729
675 Ga0268265_10205174 3300028380 Bacteria 1713
676 Ga0268265_10793632 3300028380 Bacteria 922
677 Ga0268265_11461954 3300028380 Unclassified 686
678 Ga0268264_10002076 3300028381 Bacteria 17879
679 Ga0268264_10083790 3300028381 Bacteria 2732
680 Ga0268264_10705338 3300028381 Bacteria 1002
681 Ga0265331_10011168 3300031250 Bacteria 4926
682 Ga0307408_100022312 3300031548 Bacteria 4300
683 Ga0307408_100073368 3300031548 Bacteria 2536
684 Ga0307408_100490300 3300031548 Bacteria 1074
685 Ga0307408_100741935 3300031548 Bacteria 886
686 Ga0307405_10015162 3300031731 Bacteria 4165
687 Ga0307405_10034312 3300031731 Bacteria 3018
688 Ga0307405_10142784 3300031731 Bacteria 1672
689 Ga0307413_10001553 3300031824 Bacteria 8834
690 Ga0307413_10033048 3300031824 Bacteria 2940
691 Ga0307410_10001543 3300031852 Bacteria 10501
692 Ga0307410_10093033 3300031852 Bacteria 2145
693 Ga0307410_10547839 3300031852 Bacteria 958
694 Ga0307410_10776276 3300031852 Bacteria 813
695 Ga0307406_10021123 3300031901 Bacteria 3846
696 Ga0307406_10073335 3300031901 Bacteria 2250
697 Ga0307406_10267440 3300031901 Bacteria 1297
698 Ga0307406_10307460 3300031901 Bacteria 1221
699 Ga0307407_10027988 3300031903 Bacteria 3007
700 Ga0307407_10063127 3300031903 Bacteria 2172
701 Ga0307407_10129696 3300031903 Bacteria 1611
702 Ga0307412_10054497 3300031911 Bacteria 2655
703 Ga0307409_100000903 3300031995 Bacteria 13753
704 Ga0307409_100033458 3300031995 Bacteria 3741
705 Ga0307409_100284038 3300031995 Bacteria 1531
706 Ga0307409_100594451 3300031995 Bacteria 1093
707 Ga0307416_100004367 3300032002 Bacteria 8510
708 Ga0307416_100076254 3300032002 Bacteria 2809
709 Ga0307414_10014676 3300032004 Bacteria 4706
710 Ga0307414_10098368 3300032004 Bacteria 2195
711 Ga0307414_10643083 3300032004 Bacteria 955
712 Ga0307411_10008367 3300032005 Bacteria 5353
713 Ga0307411_10168301 3300032005 Bacteria 1650
714 Ga0307411_10311438 3300032005 Bacteria 1267
715 Ga0307415_100002695 3300032126 Bacteria 8873
716 Ga0307415_100004603 3300032126 Bacteria 7195
717 Ga0307415_100083748 3300032126 Bacteria 2286
718 Ga0373958_0018452 3300034819 Bacteria 1265
719 Ga0373928_0088806 3300035084 Bacteria 790
720 Ga0373940_0053326 3300035088 Bacteria 1141
721 Ga0373944_0093774 3300035089 Bacteria 1006
722 Ga0373949_0024936 3300035090 Bacteria 1393
723 Ga0373952_0013575 3300035092 Bacteria 1618
724 Ga0373932_0010671 3300035112 Bacteria 2229
725 Ga0373932_0031083 3300035112 Bacteria 1485
726 Ga0373932_0039178 3300035112 Bacteria 1358
727 Ga0373945_0054933 3300035116 Bacteria 1473
728 Ga0373954_0079134 3300035118 Bacteria 1569
729 Ga0373960_0018592 3300035121 Bacteria 1815
730 Ga0373960_0151635 3300035121 Bacteria 792
731 Ga0373942_0056032 3300035207 Bacteria 1118
732 Ga0373961_0010431 3300035241 Bacteria 2290
733 Ga0373962_0035820 3300035242 Bacteria 1379
734 Ga0373962_0046294 3300035242 Bacteria 1241
735 Ga0373931_0000420 3300035691 Bacteria 17341
736 Ga0373931_0000811 3300035691 Bacteria 13104
737 Ga0373931_0005995 3300035691 Bacteria 5652
738 Ga0373931_0006310 3300035691 Bacteria 5532
739 Ga0373931_0178753 3300035691 Bacteria 1255
740 Ga0373935_0057084 3300035692 Bacteria 2490
741 Ga0373947_0078832 3300035725 Bacteria 2034
742 Ga0373925_0037746 3300037068 Bacteria 3568
743 Ga0373925_0173709 3300037068 Bacteria 1702
744 Ga0395899_0055114 3300037312 Bacteria 2941
745 Ga0395900_0030186 3300037418 Bacteria 5565
746 Ga0395900_0208585 3300037418 Bacteria 1974
747 Ga0395900_0233678 3300037418 Bacteria 1848
748 Ga0395900_0677573 3300037418 Bacteria 966
749 Ga0395898_0003573 3300037466 Bacteria 17332
750 Ga0395898_1214819 3300037466 Bacteria 685
751 Ga0395905_0079236 3300037471 Bacteria 3079
752 Ga0395905_0242500 3300037471 Bacteria 1684
753 Ga0395901_0020703 3300038443 Bacteria 6733
754 Ga0439434_0133047 3300042435 Bacteria 817
755 Ga0439444_0030702 3300042437 Bacteria 1007
756 Ga0439444_0032716 3300042437 Bacteria 985
757 Ga0439464_0005077 3300042439 Bacteria 3387
758 Ga0439460_0000593 3300042461 Bacteria 7961
759 Ga0451577_0001787 3300042876 Bacteria 27578
760 Ga0451577_0097156 3300042876 Bacteria 2630
761 Ga0451577_0235382 3300042876 Bacteria 1656
762 Ga0453683_0000988 3300044673 Bacteria 26801
763 Ga0453683_0045785 3300044673 Bacteria 2743
764 Ga0453683_0048006 3300044673 Bacteria 2678
765 Ga0453683_0096137 3300044673 Bacteria 1858
766 Ga0466966_0005805 3300044684 Bacteria 8139
767 Ga0466963_0039373 3300044694 Bacteria 3095
768 Ga0453684_0031305 3300044712 Bacteria 7482
769 Ga0453684_0042288 3300044712 Bacteria 6145
770 Ga0453684_0071338 3300044712 Bacteria 4392
771 Ga0466959_0220871 3300045049 Bacteria 1314
772 Ga0451576_0005540 3300045051 Bacteria 15773
773 Ga0451576_0046429 3300045051 Bacteria 4572
774 Ga0451576_0063462 3300045051 Bacteria 3850
775 Ga0451576_0078061 3300045051 Bacteria 3446
776 Ga0466958_0090113 3300045836 Bacteria 1897
777 Ga0495629_0332171 3300046459 Bacteria 1038
778 Ga0495580_0000562 3300046472 Bacteria 31337
779 Ga0495584_0101841 3300046491 Bacteria 1452
780 Ga0495659_0181016 3300046664 Bacteria 858
781 Ga0495669_0021718 3300046684 Bacteria 2789
782 Ga0495636_0091001 3300047318 Bacteria 1324
783 Ga0495676_0087256 3300047321 Bacteria 2345
784 Ga0496100_0039103 3300048903 Bacteria 3011
785 Ga0496100_0360717 3300048903 Bacteria 1100
786 Ga0496104_0047774 3300048907 Bacteria 4034
787 Ga0496104_0388813 3300048907 Bacteria 1307
788 Ga0496106_0170535 3300048909 Bacteria 1725
789 Ga0496109_0131403 3300048912 Bacteria 2337
790 Ga0496109_0208609 3300048912 Bacteria 1837
791 Ga0496109_0444903 3300048912 Bacteria 1224
792 Ga0496110_0071219 3300048913 Bacteria 3082
793 Ga0496111_0293311 3300048914 Bacteria 1206
794 Ga0496111_0372517 3300048914 Bacteria 1056
795 Ga0496112_0019169 3300048915 Bacteria 6451
796 Ga0496112_0084613 3300048915 Bacteria 3137
797 Ga0496113_0254233 3300048916 Bacteria 1403
798 Ga0496113_0832081 3300048916 Bacteria 732
799 Ga0501298_027109 3300049521 Bacteria 1106
800 Ga0501298_033946 3300049521 Bacteria 1013
801 Ga0501031_0021671 3300049568 Bacteria 4188
802 Ga0501031_0102210 3300049568 Bacteria 1870
803 Ga0501032_0101174 3300049569 Bacteria 1909
804 Ga0501033_0061684 3300049570 Bacteria 2763
805 Ga0501033_0155364 3300049570 Bacteria 1649
806 Ga0501033_0518115 3300049570 Bacteria 824
807 Ga0501034_0042064 3300049571 Bacteria 4624
808 Ga0501036_0033167 3300049572 Bacteria 4367
809 Ga0501036_0056506 3300049572 Bacteria 3326
810 Ga0501036_0085905 3300049572 Bacteria 2659
811 Ga0501036_0118053 3300049572 Bacteria 2240
812 Ga0501036_0236672 3300049572 Bacteria 1532
813 Ga0501036_0261072 3300049572 Bacteria 1451
814 Ga0501036_0578815 3300049572 Bacteria 932
815 Ga0501036_0844570 3300049572 Bacteria 753
816 Ga0501037_0065267 3300049573 Bacteria 2652
817 Ga0501038_0005362 3300049574 Bacteria 11910
818 Ga0501038_0043868 3300049574 Bacteria 3888
819 Ga0501038_0044219 3300049574 Bacteria 3871
820 Ga0501038_0227553 3300049574 Bacteria 1486
821 Ga0501039_0033395 3300049575 Bacteria 3967
822 Ga0501039_0040085 3300049575 Bacteria 3616
823 Ga0501039_0064784 3300049575 Bacteria 2834
824 Ga0501039_0241863 3300049575 Bacteria 1419
825 Ga0501040_0002035 3300049576 Bacteria 13020
826 Ga0501040_0006585 3300049576 Bacteria 7538
827 Ga0501040_0014540 3300049576 Bacteria 5188
828 Ga0501040_0024257 3300049576 Bacteria 4069
829 Ga0501040_0029170 3300049576 Bacteria 3723
830 Ga0501040_0181287 3300049576 Bacteria 1493
831 Ga0501040_0190749 3300049576 Bacteria 1454
832 Ga0501040_0209985 3300049576 Bacteria 1384
833 Ga0501040_0445747 3300049576 Bacteria 932
834 Ga0501041_0000015 3300049577 Bacteria 56326
835 Ga0501041_0001000 3300049577 Bacteria 15452
836 Ga0501041_0024763 3300049577 Bacteria 3604
837 Ga0501041_0033901 3300049577 Bacteria 3089
838 Ga0501041_0055237 3300049577 Bacteria 2424
839 Ga0501041_0076237 3300049577 Bacteria 2063
840 Ga0501041_0123951 3300049577 Bacteria 1607
841 Ga0501042_0000051 3300049578 Bacteria 40712
842 Ga0501042_0012078 3300049578 Bacteria 5842
843 Ga0501042_0048454 3300049578 Bacteria 3029
844 Ga0501042_0073007 3300049578 Bacteria 2455
845 Ga0501042_0351405 3300049578 Bacteria 1066
846 Ga0501043_0115727 3300049579 Bacteria 2104
847 Ga0501043_0200212 3300049579 Bacteria 1550
848 Ga0501046_0000444 3300049580 Bacteria 41627
849 Ga0501046_0002854 3300049580 Bacteria 16072
850 Ga0501046_0007557 3300049580 Bacteria 9532
851 Ga0501046_0043722 3300049580 Bacteria 3565
852 Ga0501046_0183963 3300049580 Bacteria 1561
853 Ga0501046_0208863 3300049580 Bacteria 1450
854 Ga0501046_0243763 3300049580 Bacteria 1325
855 Ga0501046_0368889 3300049580 Bacteria 1040
856 Ga0501047_0117686 3300049581 Bacteria 2539
857 Ga0501048_0003819 3300049582 Bacteria 11489
858 Ga0501048_0007480 3300049582 Bacteria 8277
859 Ga0501048_0037181 3300049582 Bacteria 3496
860 Ga0501048_0071617 3300049582 Bacteria 2447
861 Ga0501048_0119968 3300049582 Bacteria 1858
862 Ga0501068_0005458 3300049584 Bacteria 6960
863 Ga0501068_0052248 3300049584 Bacteria 2473
864 Ga0501068_0053009 3300049584 Bacteria 2454
865 Ga0501068_0131134 3300049584 Bacteria 1567
866 Ga0501069_0106172 3300049585 Bacteria 1596
867 Ga0501070_0079627 3300049586 Bacteria 2711
868 Ga0501071_0000129 3300049587 Bacteria 30524
869 Ga0501071_0020352 3300049587 Bacteria 4609
870 Ga0501071_0021494 3300049587 Bacteria 4495
871 Ga0501071_0047366 3300049587 Bacteria 3088
872 Ga0501071_0083649 3300049587 Bacteria 2338
873 Ga0501072_0001551 3300049588 Bacteria 17139
874 Ga0501072_0003591 3300049588 Bacteria 11676
875 Ga0501072_0037220 3300049588 Bacteria 3816
876 Ga0501072_0076869 3300049588 Bacteria 2642
877 Ga0501072_0153427 3300049588 Bacteria 1836
878 Ga0501072_0168888 3300049588 Bacteria 1746
879 Ga0501073_0099113 3300049589 Bacteria 2023
880 Ga0501073_0199156 3300049589 Bacteria 1385
881 Ga0501074_0009415 3300049590 Bacteria 7100
882 Ga0501074_0011091 3300049590 Bacteria 6545
883 Ga0501074_0026219 3300049590 Bacteria 4226
884 Ga0501074_0067283 3300049590 Bacteria 2577
885 Ga0501074_0442129 3300049590 Bacteria 922
886 Ga0501075_0000475 3300049591 Bacteria 23966
887 Ga0501075_0001330 3300049591 Bacteria 16052
888 Ga0501075_0028995 3300049591 Bacteria 4091
889 Ga0501075_0035716 3300049591 Bacteria 3708
890 Ga0501075_0067422 3300049591 Bacteria 2702
891 Ga0501075_0163798 3300049591 Bacteria 1696
892 Ga0501075_0167818 3300049591 Bacteria 1675
893 Ga0501075_0469367 3300049591 Bacteria 960
894 Ga0501075_0495425 3300049591 Bacteria 932
895 Ga0501076_0010629 3300049592 Bacteria 6837
896 Ga0501076_0010914 3300049592 Bacteria 6758
897 Ga0501076_0063447 3300049592 Bacteria 2943
898 Ga0501076_0112179 3300049592 Bacteria 2205
899 Ga0501076_0139494 3300049592 Bacteria 1969
900 Ga0501076_0150599 3300049592 Bacteria 1893
901 Ga0501076_0453612 3300049592 Bacteria 1056
902 Ga0501077_0000030 3300049593 Bacteria 71771
903 Ga0501077_0016913 3300049593 Bacteria 4600
904 Ga0501077_0031029 3300049593 Bacteria 3400
905 Ga0501077_0037476 3300049593 Bacteria 3088
906 Ga0501077_0039368 3300049593 Bacteria 3011
907 Ga0501077_0045098 3300049593 Bacteria 2800
908 Ga0501077_0076987 3300049593 Bacteria 2113
909 Ga0501077_0080639 3300049593 Bacteria 2061
910 Ga0501077_0231324 3300049593 Bacteria 1175
911 Ga0501077_0231664 3300049593 Bacteria 1174
912 Ga0501077_0242001 3300049593 Bacteria 1147
913 Ga0501077_0394043 3300049593 Bacteria 885
914 Ga0501259_062436 3300049688 Unclassified 781
915 Ga0501079_0000375 3300049741 Bacteria 28720
916 Ga0501079_0000465 3300049741 Bacteria 26671
917 Ga0501079_0020348 3300049741 Bacteria 5071
918 Ga0501079_0029125 3300049741 Bacteria 4238
919 Ga0501079_0029639 3300049741 Bacteria 4203
920 Ga0501079_0067329 3300049741 Bacteria 2764
921 Ga0501079_0067764 3300049741 Bacteria 2754
922 Ga0501079_0087306 3300049741 Bacteria 2415
923 Ga0501079_0163629 3300049741 Bacteria 1735
924 Ga0501079_0172587 3300049741 Bacteria 1686
925 Ga0501079_0374825 3300049741 Bacteria 1116
926 Ga0501079_0469493 3300049741 Bacteria 988
927 Ga0501080_0005161 3300049742 Bacteria 11632
928 Ga0501080_0064921 3300049742 Bacteria 3396
929 Ga0501080_0113157 3300049742 Bacteria 2516
930 Ga0501080_0158730 3300049742 Bacteria 2089
931 Ga0501081_0001057 3300049743 Bacteria 16514
932 Ga0501081_0005051 3300049743 Bacteria 8492
933 Ga0501081_0012665 3300049743 Bacteria 5545
934 Ga0501081_0048753 3300049743 Bacteria 2915
935 Ga0501081_0073098 3300049743 Bacteria 2391
936 Ga0501081_0074666 3300049743 Bacteria 2366
937 Ga0501081_0105161 3300049743 Bacteria 1999
938 Ga0501081_0133020 3300049743 Bacteria 1778
939 Ga0501081_0134148 3300049743 Bacteria 1771
940 Ga0501081_0158571 3300049743 Bacteria 1629
941 Ga0501081_0196960 3300049743 Bacteria 1460
942 Ga0501081_0252992 3300049743 Bacteria 1286
943 Ga0501083_0045442 3300049744 Bacteria 2971
944 Ga0501083_0106827 3300049744 Bacteria 1843
945 Ga0501283_006484 3300049779 Bacteria 1641
946 Ga0501035_0009164 3300049822 Bacteria 9205
947 Ga0501035_0087512 3300049822 Bacteria 2745
948 Ga0501035_0259385 3300049822 Bacteria 1474
949 Ga0501035_0259462 3300049822 Bacteria 1474
950 Ga0501035_0323082 3300049822 Bacteria 1296
951 Ga0501044_0194608 3300049823 Bacteria 1988
952 Ga0501045_0001379 3300049824 Bacteria 16194
953 Ga0501045_0001483 3300049824 Bacteria 15602
954 Ga0501045_0019881 3300049824 Bacteria 4793
955 Ga0501045_0043425 3300049824 Bacteria 3273
956 Ga0501045_0059490 3300049824 Bacteria 2799
957 Ga0501045_0081445 3300049824 Bacteria 2387
958 Ga0501045_0165898 3300049824 Bacteria 1645
959 nmdc:mga03683_5915_c1 3300050489 Bacteria 4162
960 nmdc:mga0yw44_312907_c1 3300050492 Bacteria 1054
961 nmdc:mga0k408_213099_c1 3300050493 Bacteria 1153
962 nmdc:mga06z11_311030_c1 3300050494 Bacteria 938
963 nmdc:mga05p37_127317_c1 3300050507 Bacteria 3127
964 nmdc:mga05p37_1381_c1 3300050507 Bacteria 28239
965 nmdc:mga05p37_139112_c1 3300050507 Bacteria 2975
966 nmdc:mga05p37_147905_c1 3300050507 Bacteria 2875
967 nmdc:mga05p37_15097_c1 3300050507 Bacteria 9273
968 nmdc:mga05p37_185551_c1 3300050507 Bacteria 2529
969 nmdc:mga05p37_19298_c1 3300050507 Bacteria 8246
970 nmdc:mga05p37_21037_c2 3300050507 Bacteria 3489
971 nmdc:mga05p37_21398_c1 3300050507 Bacteria 7833
972 nmdc:mga05p37_2156_c1 3300050507 Bacteria 20944
973 nmdc:mga05p37_257606_c1 3300050507 Bacteria 2090
974 nmdc:mga05p37_29351_c1 3300050507 Bacteria 6712
975 nmdc:mga05p37_31928_c1 3300050507 Bacteria 6438
976 nmdc:mga05p37_328016_c1 3300050507 Bacteria 1809
977 nmdc:mga05p37_365689_c1 3300050507 Bacteria 1694
978 nmdc:mga05p37_38769_c1 3300050507 Bacteria 5847
979 nmdc:mga05p37_426811_c1 3300050507 Bacteria 1541
980 nmdc:mga05p37_43736_c1 3300050507 Bacteria 5511
981 nmdc:mga05p37_51456_c1 3300050507 Bacteria 5066
982 nmdc:mga05p37_63439_c1 3300050507 Bacteria 4547
983 nmdc:mga05p37_64430_c1 3300050507 Bacteria 4510
984 nmdc:mga05p37_67979_c1 3300050507 Bacteria 4383
985 nmdc:mga05p37_767969_c1 3300050507 Bacteria 1060
986 nmdc:mga05p37_842668_c1 3300050507 Bacteria 997
987 nmdc:mga05p37_96392_c1 3300050507 Bacteria 3644
988 nmdc:mga09592_13135_c1 3300050508 Bacteria 6758
989 nmdc:mga09592_15617_c1 3300050508 Bacteria 6203
990 nmdc:mga09592_21085_c1 3300050508 Bacteria 5367
991 nmdc:mga09592_24963_c1 3300050508 Bacteria 4944
992 nmdc:mga09592_260864_c1 3300050508 Bacteria 1503
993 nmdc:mga09592_405_c1 3300050508 Bacteria 31613
994 nmdc:mga09592_47769_c1 3300050508 Bacteria 3608
995 nmdc:mga09592_661331_c1 3300050508 Bacteria 891
996 nmdc:mga09592_87401_c1 3300050508 Bacteria 2661
997 nmdc:mga0qj67_20152_c1 3300050509 Bacteria 5105
998 nmdc:mga0qj67_25526_c1 3300050509 Bacteria 4567
999 nmdc:mga0qj67_27533_c1 3300050509 Bacteria 4407
1000 nmdc:mga0qj67_302_c1 3300050509 Bacteria 34246
1001 nmdc:mga0qj67_36673_c1 3300050509 Bacteria 3837
1002 nmdc:mga0qj67_74772_c1 3300050509 Bacteria 2707
1003 nmdc:mga0qj67_98_c1 3300050509 Bacteria 57947
1004 nmdc:mga06r32_15127_c1 3300050510 Bacteria 7007
1005 nmdc:mga06r32_22101_c1 3300050510 Bacteria 5878
1006 nmdc:mga06r32_2221_c1 3300050510 Bacteria 17383
1007 nmdc:mga06r32_227459_c1 3300050510 Bacteria 1854
1008 nmdc:mga06r32_231038_c1 3300050510 Bacteria 1838
1009 nmdc:mga06r32_249935_c1 3300050510 Bacteria 1761
1010 nmdc:mga06r32_302162_c1 3300050510 Bacteria 1586
1011 nmdc:mga06r32_395163_c1 3300050510 Bacteria 1365
1012 nmdc:mga06r32_443322_c1 3300050510 Bacteria 1278
1013 nmdc:mga06r32_45248_c1 3300050510 Bacteria 4194
1014 nmdc:mga06r32_46667_c1 3300050510 Bacteria 4134
1015 nmdc:mga06r32_487713_c1 3300050510 Bacteria 1210
1016 nmdc:mga06r32_50437_c1 3300050510 Bacteria 3981
1017 nmdc:mga06r32_550293_c1 3300050510 Bacteria 1128
1018 nmdc:mga06r32_706408_c1 3300050510 Bacteria 974
1019 nmdc:mga06r32_715040_c1 3300050510 Bacteria 966
1020 nmdc:mga06r32_715242_c1 3300050510 Bacteria 966
1021 nmdc:mga06r32_936824_c1 3300050510 Bacteria 821
1022 nmdc:mga06r32_9529_c1 3300050510 Bacteria 8768
1023 nmdc:mga08y16_100290_c1 3300050511 Bacteria 3015
1024 nmdc:mga08y16_161937_c1 3300050511 Bacteria 2325
1025 nmdc:mga08y16_16428_c1 3300050511 Bacteria 7783
1026 nmdc:mga08y16_208940_c1 3300050511 Bacteria 2022
1027 nmdc:mga08y16_241143_c1 3300050511 Bacteria 1869
1028 nmdc:mga08y16_34508_c1 3300050511 Bacteria 5314
1029 nmdc:mga08y16_361923_c1 3300050511 Bacteria 1489
1030 nmdc:mga08y16_419297_c1 3300050511 Bacteria 1368
1031 nmdc:mga08y16_547_c1 3300050511 Bacteria 34801
1032 nmdc:mga08y16_550762_c1 3300050511 Bacteria 1167
1033 nmdc:mga08y16_598277_c1 3300050511 Bacteria 1112
1034 nmdc:mga08y16_703899_c1 3300050511 Bacteria 1010
1035 nmdc:mga08y16_9940_c1 3300050511 Bacteria 9985
1036 nmdc:mga0n895_125591_c1 3300050512 Bacteria 2589
1037 nmdc:mga0n895_134545_c1 3300050512 Bacteria 2498
1038 nmdc:mga0n895_157040_c1 3300050512 Bacteria 2305
1039 nmdc:mga0n895_164651_c1 3300050512 Bacteria 2249
1040 nmdc:mga0n895_184498_c1 3300050512 Bacteria 2118
1041 nmdc:mga0n895_22544_c1 3300050512 Bacteria 5906
1042 nmdc:mga0n895_226890_c1 3300050512 Bacteria 1896
1043 nmdc:mga0n895_231497_c1 3300050512 Bacteria 1875
1044 nmdc:mga0n895_24691_c1 3300050512 Bacteria 5667
1045 nmdc:mga0n895_24957_c1 3300050512 Bacteria 5642
1046 nmdc:mga0n895_305126_c1 3300050512 Bacteria 1614
1047 nmdc:mga0n895_401431_c1 3300050512 Bacteria 1386
1048 nmdc:mga0n895_52269_c1 3300050512 Bacteria 4010
1049 nmdc:mga0n895_685758_c1 3300050512 Bacteria 1021
1050 nmdc:mga0rr50_165878_c1 3300050513 Bacteria 1796
1051 nmdc:mga0rr50_24883_c1 3300050513 Bacteria 4154
1052 nmdc:mga0rr50_347900_c1 3300050513 Bacteria 1246
1053 nmdc:mga0rr50_37631_c1 3300050513 Bacteria 3495
1054 nmdc:mga0rr50_5240_c1 3300050513 Bacteria 7714
1055 nmdc:mga0rr50_837590_c1 3300050513 Bacteria 785
1056 nmdc:mga0rr50_8421_c1 3300050513 Bacteria 6420
1057 nmdc:mga0rr50_88989_c1 3300050513 Bacteria 2400
1058 nmdc:mga0rr50_99099_c1 3300050513 Bacteria 2286
1059 nmdc:mga08x19_121846_c1 3300050514 Bacteria 1749
1060 nmdc:mga08x19_15913_c1 3300050514 Bacteria 4582
1061 nmdc:mga08x19_16964_c1 3300050514 Bacteria 4450
1062 nmdc:mga08x19_171647_c1 3300050514 Bacteria 1477
1063 nmdc:mga08x19_22151_c1 3300050514 Bacteria 3932
1064 nmdc:mga08x19_348369_c1 3300050514 Bacteria 1034
1065 nmdc:mga08x19_3776_c1 3300050514 Bacteria 9014
1066 nmdc:mga08x19_397_c1 3300050514 Bacteria 30659
1067 nmdc:mga08x19_45404_c1 3300050514 Bacteria 2808
1068 nmdc:mga08x19_60275_c1 3300050514 Bacteria 2458
1069 nmdc:mga0a205_12005_c1 3300050515 Bacteria 8000
1070 nmdc:mga0a205_133679_c1 3300050515 Bacteria 2381
1071 nmdc:mga0a205_135974_c1 3300050515 Bacteria 2358
1072 nmdc:mga0a205_1750_c1 3300050515 Bacteria 16900
1073 nmdc:mga0a205_27605_c1 3300050515 Bacteria 5421
1074 nmdc:mga0a205_327959_c1 3300050515 Bacteria 1401
1075 nmdc:mga0a205_34714_c1 3300050515 Bacteria 4840
1076 nmdc:mga0a205_364581_c1 3300050515 Bacteria 1311
1077 nmdc:mga0a205_38_c1 3300050515 Bacteria 73135
1078 nmdc:mga0a205_4505_c1 3300050515 Bacteria 12501
1079 nmdc:mga0a205_4714_c1 3300050515 Bacteria 12242
1080 nmdc:mga0a205_5021_c1 3300050515 Bacteria 11919
1081 nmdc:mga0a205_55072_c1 3300050515 Bacteria 3841
1082 nmdc:mga0a205_621862_c1 3300050515 Bacteria 932
1083 nmdc:mga0a205_84246_c1 3300050515 Bacteria 3071
1084 nmdc:mga0a205_87397_c1 3300050515 Bacteria 3012
1085 nmdc:mga0a205_96451_c1 3300050515 Bacteria 2856
1086 Ga0500644_0080340 3300053088 Bacteria 1198
1087 Ga0501084_0011657 3300054114 Bacteria 7278
1088 Ga0501084_0023529 3300054114 Bacteria 5139
1089 Ga0501084_0025251 3300054114 Bacteria 4956
1090 Ga0501084_0116781 3300054114 Bacteria 2243
1091 Ga0501084_0249740 3300054114 Bacteria 1498
1092 Ga0501084_0253116 3300054114 Bacteria 1486
1093 Ga0501084_0295575 3300054114 Bacteria 1368
1094 Ga0501084_0395075 3300054114 Bacteria 1169
1095 Ga0501084_0485948 3300054114 Bacteria 1044
1096 Ga0501084_0561290 3300054114 Bacteria 965
1097 Ga0590071_003743 3300059421 Bacteria 3731
1098 Ga0501082_0000982 3300060353 Bacteria 25167
1099 Ga0501082_0005754 3300060353 Bacteria 10756
1100 Ga0501082_0026863 3300060353 Bacteria 4959
1101 Ga0501082_0031478 3300060353 Bacteria 4575
1102 Ga0501082_0057896 3300060353 Bacteria 3338
1103 Ga0501082_0058012 3300060353 Bacteria 3335
1104 Ga0501082_0170226 3300060353 Bacteria 1894
1105 Ga0501082_0240107 3300060353 Bacteria 1577
1106 Ga0501082_0280844 3300060353 Bacteria 1449
1107 Ga0501082_0417935 3300060353 Bacteria 1171
1108 Ga0466962_0012226 3300061719 Bacteria 4127
1109 Ga0530510_0000719 3300061734 Bacteria 21517
1110 Ga0530510_0019591 3300061734 Bacteria 4803
1111 Ga0530510_0024391 3300061734 Bacteria 4315
1112 Ga0530510_0073914 3300061734 Bacteria 2475
1113 Ga0530510_0087763 3300061734 Bacteria 2266
1114 Ga0530510_0126391 3300061734 Bacteria 1879
1115 Ga0530510_0264879 3300061734 Bacteria 1282
1116 Ga0530510_0289367 3300061734 Bacteria 1225
1117 2841963889 2841957949 Bacteria 8652217
1118 8006936133 8006933436 Bacteria 10410654
1119 8006976059 8006973647 Bacteria 10679141
1120 8016588394 8016583857 Bacteria 10421953
1121 8019653374 8019648815 Bacteria 10014479
1122 Ga0373926_0118982
1123 SwRhRL2b_contig_3104459
1124 JGI24738J21930_10032268
1125 JGI25406J46586_10036074
1126 JGI25405J52794_10006434
1127 Ga0058860_12218305
1128 Ga0065704_10007501
1129 Ga0065712_10068036
1130 Ga0065712_10101614
1131 Ga0065715_10000722
1132 Ga0065715_10102386
1133 Ga0065707_10084079
1134 Ga0065707_10142005
1135 Ga0065707_10208515
1136 Ga0070658_10060816
1137 Ga0070658_10235695
1138 Ga0070676_10077293
1139 Ga0070676_10113770
1140 Ga0070676_10346632
1141 Ga0070683_100010705
1142 Ga0070683_100044531
1143 Ga0070690_100000084
1144 Ga0070690_100023676
1145 Ga0070690_100348513
1146 Ga0070690_100442689
1147 Ga0070690_100676094
1148 Ga0070670_100008967
1149 Ga0070670_100017353
1150 Ga0070670_100417538
1151 Ga0070677_10004487
1152 Ga0068869_100002231
1153 Ga0068869_100020315
1154 Ga0068869_100024645
1155 Ga0070666_10021322
1156 Ga0070680_100001288
1157 Ga0070680_100048294
1158 Ga0070680_100073083
1159 Ga0070680_100335734
1160 Ga0070682_100004268
1161 Ga0068868_100004364
1162 Ga0070660_100008802
1163 Ga0070660_100059938
1164 Ga0070660_100065693
1165 Ga0070689_100001346
1166 Ga0070689_100051444
1167 Ga0070689_100106928
1168 Ga0070689_100311882
1169 Ga0070691_10005629
1170 Ga0070691_10012905
1171 Ga0070687_100000044
1172 Ga0070687_100052602
1173 Ga0070661_100028601
1174 Ga0070661_100134069
1175 Ga0070661_100164101
1176 Ga0070692_10001178
1177 Ga0070692_10026452
1178 Ga0070692_10050282
1179 Ga0070692_10308902
1180 Ga0070668_100026523
1181 Ga0070668_100054882
1182 Ga0070668_100080982
1183 Ga0070669_100022482
1184 Ga0070669_100033788
1185 Ga0070669_100056856
1186 Ga0070669_100110240
1187 Ga0070669_100125321
1188 Ga0070669_100762992
1189 Ga0070675_100015248
1190 Ga0070675_100085139
1191 Ga0070671_100353106
1192 Ga0070674_100105098
1193 Ga0070674_100109819
1194 Ga0070674_100422668
1195 Ga0070673_100073258
1196 Ga0070688_100184808
1197 Ga0070688_100285727
1198 Ga0070659_100059096
1199 Ga0070659_100149206
1200 Ga0070659_100389276
1201 Ga0070667_100033667
1202 Ga0070703_10009462
1203 Ga0070703_10035602
1204 Ga0070713_100095114
1205 Ga0070701_10000117
1206 Ga0070705_100001347
1207 Ga0070705_100005643
1208 Ga0070705_100013827
1209 Ga0070705_100158369
1210 Ga0070700_100002094
1211 Ga0070700_100005882
1212 Ga0070700_100012818
1213 Ga0070700_100119180
1214 Ga0070700_100414008
1215 Ga0070694_100000077
1216 Ga0070694_100041569
1217 Ga0070694_100064623
1218 Ga0070694_100066782
1219 Ga0070694_100156132
1220 Ga0070694_100161902
1221 Ga0070694_100182592
1222 Ga0070694_100260247
1223 Ga0070694_100313813
1224 Ga0070708_100000447
1225 Ga0070708_100066904
1226 Ga0070708_100093428
1227 Ga0070708_100322849
1228 Ga0070708_100458516
1229 Ga0070663_100210513
1230 Ga0070678_100046572
1231 Ga0070662_100082013
1232 Ga0070662_100256529
1233 Ga0070662_100312700
1234 Ga0070662_100625626
1235 Ga0070681_10004422
1236 Ga0070681_10038897
1237 Ga0070681_10126094
1238 Ga0070681_10588690
1239 Ga0068867_100000107
1240 Ga0068867_100002038
1241 Ga0068867_100012872
1242 Ga0068867_100126519
1243 Ga0068867_100326898
1244 Ga0070706_100141430
1245 Ga0070706_100205318
1246 Ga0070706_100540994
1247 Ga0070706_100685187
1248 Ga0070707_100004382
1249 Ga0070707_100015647
1250 Ga0070707_100066699
1251 Ga0070707_100080332
1252 Ga0070707_100160535
1253 Ga0070707_100282909
1254 Ga0070707_100358050
1255 Ga0070698_100040784
1256 Ga0070698_100081691
1257 Ga0070698_100084248
1258 Ga0070698_100091131
1259 Ga0070698_100160336
1260 Ga0070698_100193037
1261 Ga0070698_100303632
1262 Ga0070699_100019933
1263 Ga0070699_100036447
1264 Ga0070699_100048457
1265 Ga0070699_100063566
1266 Ga0070699_100102187
1267 Ga0070699_100355758
1268 Ga0070699_100430922
1269 Ga0070679_100004443
1270 Ga0070679_100008492
1271 Ga0070679_100089471
1272 Ga0070684_100011752
1273 Ga0070684_100045196
1274 Ga0070697_100009294
1275 Ga0070697_100043380
1276 Ga0070697_100057780
1277 Ga0070697_100173029
1278 Ga0070697_100176917
1279 Ga0070697_100224619
1280 Ga0070697_100275228
1281 Ga0070697_100472793
1282 Ga0068853_100062007
1283 Ga0068853_100788390
1284 Ga0070672_100021278
1285 Ga0070672_100659388
1286 Ga0070686_100000168
1287 Ga0070686_100004664
1288 Ga0070686_100017936
1289 Ga0070686_100226882
1290 Ga0070686_100289036
1291 Ga0070695_100001073
1292 Ga0070695_100003939
1293 Ga0070695_100005491
1294 Ga0070695_100006201
1295 Ga0070695_100165884
1296 Ga0070695_100454273
1297 Ga0070696_100000128
1298 Ga0070696_100017960
1299 Ga0070696_100019476
1300 Ga0070696_100019757
1301 Ga0070696_100027637
1302 Ga0070696_100109526
1303 Ga0070696_100130769
1304 Ga0070696_100285374
1305 Ga0070693_100000040
1306 Ga0070693_100045559
1307 Ga0070693_100275398
1308 Ga0070704_100000120
1309 Ga0070704_100015872
1310 Ga0070704_100104880
1311 Ga0070704_100218326
1312 Ga0070704_100478428
1313 Ga0070704_100484383
1314 Ga0068855_100004919
1315 Ga0068855_100045298
1316 Ga0068855_100070510
1317 Ga0070664_100000225
1318 Ga0070664_100066904
1319 Ga0068857_100084731
1320 Ga0068854_100003643
1321 Ga0068854_100069349
1322 Ga0068854_100391871
1323 Ga0068856_100028131
1324 Ga0068856_100029845
1325 Ga0068856_100030872
1326 Ga0068856_100106660
1327 Ga0068856_100239498
1328 Ga0070702_100000052
1329 Ga0070702_100012889
1330 Ga0070702_100068093
1331 Ga0070702_100184646
1332 Ga0070702_100269926
1333 Ga0068852_100001351
1334 Ga0068852_100039939
1335 Ga0068859_100000332
1336 Ga0068859_100005210
1337 Ga0068859_100028755
1338 Ga0068859_100109043
1339 Ga0068859_100477108
1340 Ga0068859_100528367
1341 Ga0068859_101083206
1342 Ga0068864_100165122
1343 Ga0068866_10070018
1344 Ga0068866_10103504
1345 Ga0068866_10111228
1346 Ga0068866_10284544
1347 Ga0068861_100000100
1348 Ga0068861_100002872
1349 Ga0068861_100093675
1350 Ga0068861_100571722
1351 Ga0068861_100683041
1352 Ga0068870_10054086
1353 Ga0068870_10095820
1354 Ga0068863_100173562
1355 Ga0068863_100280326
1356 Ga0068863_100289817
1357 Ga0068858_100000941
1358 Ga0068858_100363221
1359 Ga0068860_100000773
1360 Ga0068860_100059007
1361 Ga0068860_100618026
1362 Ga0068862_100002566
1363 Ga0068862_100005061
1364 Ga0068862_100048026
1365 Ga0068862_100079230
1366 Ga0068862_100207819
1367 Ga0068862_100209028
1368 Ga0081455_10000141
1369 Ga0081455_10004492
1370 Ga0081455_10039250
1371 Ga0081455_10243393
1372 Ga0081455_10317564
1373 Ga0081538_10049725
1374 Ga0081538_10163332
1375 Ga0081540_1012177
1376 Ga0081540_1077615
1377 Ga0081539_10000166
1378 Ga0070717_10088575
1379 Ga0075368_10075510
1380 Ga0075363_100326870
1381 Ga0075432_10168729
1382 Ga0070716_100008899
1383 Ga0075362_10078939
1384 Ga0075362_10084870
1385 Ga0075367_10031261
1386 Ga0075366_10080492
1387 Ga0097621_100003035
1388 Ga0097621_100352151
1389 Ga0068871_100000238
1390 Ga0075428_100000538
1391 Ga0075428_100002073
1392 Ga0075428_100003176
1393 Ga0075428_100031605
1394 Ga0075428_100045633
1395 Ga0075428_100048090
1396 Ga0075428_100060357
1397 Ga0075428_100084090
1398 Ga0075428_100168622
1399 Ga0075428_100863089
1400 Ga0075430_100000022
1401 Ga0075430_100000126
1402 Ga0075430_100016400
1403 Ga0075430_100022072
1404 Ga0075430_100025967
1405 Ga0075430_100047425
1406 Ga0075430_100361964
1407 Ga0075431_100000203
1408 Ga0075431_100001584
1409 Ga0075431_100010580
1410 Ga0075431_100011301
1411 Ga0075431_100028790
1412 Ga0075431_100045579
1413 Ga0075431_100057706
1414 Ga0075431_100087405
1415 Ga0075431_100118175
1416 Ga0075431_100165806
1417 Ga0075431_100186610
1418 Ga0075431_100191949
1419 Ga0075431_100256458
1420 Ga0075431_100270974
1421 Ga0075431_100276275
1422 Ga0075431_100416766
1423 Ga0075431_100873770
1424 Ga0075433_10000983
1425 Ga0075433_10003421
1426 Ga0075433_10006374
1427 Ga0075433_10058657
1428 Ga0075433_10102968
1429 Ga0075433_10115934
1430 Ga0075433_10186278
1431 Ga0075433_10621692
1432 Ga0075433_10709781
1433 Ga0075434_100005320
1434 Ga0075434_100021906
1435 Ga0075434_100029173
1436 Ga0075434_100042458
1437 Ga0075434_100080488
1438 Ga0075434_100090538
1439 Ga0075434_100095155
1440 Ga0075434_100121477
1441 Ga0075434_100128687
1442 Ga0075434_100188202
1443 Ga0075434_100669637
1444 Ga0075429_100000069
1445 Ga0075429_100016733
1446 Ga0075429_100027496
1447 Ga0075429_100041037
1448 Ga0075429_100138609
1449 Ga0075429_100178190
1450 Ga0075429_100201299
1451 Ga0075429_100223674
1452 Ga0075429_100303681
1453 Ga0075429_100328444
1454 Ga0068865_100000142
1455 Ga0068865_100016167
1456 Ga0068865_100053876
1457 Ga0068865_100657581
1458 Ga0075436_100000311
1459 Ga0075436_100003545
1460 Ga0075436_100006889
1461 Ga0075436_100006942
1462 Ga0075436_100018642
1463 Ga0075436_100042430
1464 Ga0075436_100045133
1465 Ga0075436_100080636
1466 Ga0075436_100196297
1467 Ga0075436_100238506
1468 Ga0097620_100000332
1469 Ga0097620_100005210
1470 Ga0097620_100028754
1471 Ga0097620_100109045
1472 Ga0097620_100477059
1473 Ga0097620_100528369
1474 Ga0097620_101083328
1475 Ga0075435_100000118
1476 Ga0075435_100006807
1477 Ga0075435_100015059
1478 Ga0075435_100020128
1479 Ga0075435_100026122
1480 Ga0075435_100028269
1481 Ga0075435_100050039
1482 Ga0075435_100058145
1483 Ga0075435_100069979
1484 Ga0075435_100127378
1485 Ga0075435_100134997
1486 Ga0075435_100638884
1487 Ga0099794_10001420
1488 Ga0099794_10003300
1489 Ga0099794_10022811
1490 Ga0099794_10025161
1491 Ga0099794_10253768
1492 Ga0105250_10020340
1493 Ga0105240_10116472
1494 Ga0105240_10345454
1495 Ga0111539_10000819
1496 Ga0111539_10011469
1497 Ga0111539_10017237
1498 Ga0111539_10021244
1499 Ga0111539_10021390
1500 Ga0111539_10097380
1501 Ga0111539_10143342
1502 Ga0111539_10304750
1503 Ga0111539_10396906
1504 Ga0111539_10412015
1505 Ga0111539_10478850
1506 Ga0111539_10664136
1507 Ga0111539_10692934
1508 Ga0105245_10000115
1509 Ga0105245_10227447
1510 Ga0105245_10239705
1511 Ga0105245_10315192
1512 Ga0105247_10045814
1513 Ga0105247_10167674
1514 Ga0114129_10000865
1515 Ga0114129_10001132
1516 Ga0114129_10004345
1517 Ga0114129_10006933
1518 Ga0114129_10015092
1519 Ga0114129_10015802
1520 Ga0114129_10019885
1521 Ga0114129_10028016
1522 Ga0114129_10040592
1523 Ga0114129_10050132
1524 Ga0114129_10093234
1525 Ga0114129_10179398
1526 Ga0114129_10216580
1527 Ga0114129_10326475
1528 Ga0114129_10337573
1529 Ga0114129_10422540
1530 Ga0114129_10473590
1531 Ga0114129_10640269
1532 Ga0114129_10802328
1533 Ga0114129_10823742
1534 Ga0114129_11327596
1535 Ga0105243_10000035
1536 Ga0105243_10018411
1537 Ga0105243_10054459
1538 Ga0105243_10348109
1539 Ga0105243_10629390
1540 Ga0105243_11258461
1541 Ga0105241_10024461
1542 Ga0105241_10025791
1543 Ga0105241_10046542
1544 Ga0105241_10326114
1545 Ga0105242_10000268
1546 Ga0105242_10001873
1547 Ga0105242_10148652
1548 Ga0105242_10189625
1549 Ga0105242_10276044
1550 Ga0105242_10443532
1551 Ga0105237_10133297
1552 Ga0105237_10259564
1553 Ga0105238_10000931
1554 Ga0105238_10119209
1555 Ga0105249_10001725
1556 Ga0105249_10022878
1557 Ga0105249_10081151
1558 Ga0105249_10099499
1559 Ga0105249_10373258
1560 Ga0105249_10538872
1561 Ga0105249_10851666
1562 Ga0105249_10868595
1563 Ga0099796_10076320
1564 Ga0099796_10144474
1565 Ga0105239_10019073
1566 Ga0105239_10022702
1567 Ga0105239_10243185
1568 Ga0105246_10020609
1569 Ga0105246_10139184
1570 Ga0157373_10075186
1571 Ga0157371_10096512
1572 Ga0157371_10127659
1573 Ga0157371_10153902
1574 Ga0157371_10231735
1575 Ga0157370_10005379
1576 Ga0157370_10040092
1577 Ga0157370_10152710
1578 Ga0157369_10004550
1579 Ga0157369_10121837
1580 Ga0157374_10051116
1581 Ga0157378_10001006
1582 Ga0157378_10051524
1583 Ga0157378_10065285
1584 Ga0163162_10140509
1585 Ga0163162_10206947
1586 Ga0163162_10344423
1587 Ga0163162_10354360
1588 Ga0163162_10369273
1589 Ga0163162_10484322
1590 Ga0163162_10711093
1591 Ga0157372_10065295
1592 Ga0157372_10116308
1593 Ga0157372_10186825
1594 Ga0157372_10192502
1595 Ga0157375_10243303
1596 Ga0157375_10625128
1597 Ga0157380_10021893
1598 Ga0157380_10071901
1599 Ga0157380_10371243
1600 Ga0157377_10051052
1601 Ga0157377_10128343
1602 Ga0157377_10220732
1603 Ga0157379_10045050
1604 Ga0157379_10367757
1605 Ga0157379_10498009
1606 Ga0157376_10044711
1607 Ga0163161_10404586
1608 Ga0207697_10035475
1609 Ga0207697_10109225
1610 Ga0207653_10063472
1611 Ga0207642_10080353
1612 Ga0207642_10225370
1613 Ga0207688_10028357
1614 Ga0207680_10234719
1615 Ga0207647_10074440
1616 Ga0207645_10000424
1617 Ga0207645_10097038
1618 Ga0207645_10242237
1619 Ga0207643_10030254
1620 Ga0207643_10137350
1621 Ga0207705_10054195
1622 Ga0207705_10246292
1623 Ga0207684_10001278
1624 Ga0207684_10005462
1625 Ga0207684_10012392
1626 Ga0207684_10029734
1627 Ga0207684_10038233
1628 Ga0207684_10044090
1629 Ga0207684_10066620
1630 Ga0207684_10819715
1631 Ga0207654_10032791
1632 Ga0207707_10000652
1633 Ga0207707_10016505
1634 Ga0207707_10102928
1635 Ga0207707_10229174
1636 Ga0207695_10008877
1637 Ga0207671_10384641
1638 Ga0207660_10000612
1639 Ga0207660_10031947
1640 Ga0207660_10062184
1641 Ga0207660_10120035
1642 Ga0207660_10122717
1643 Ga0207660_10239338
1644 Ga0207660_10590304
1645 Ga0207662_10000061
1646 Ga0207662_10066875
1647 Ga0207662_10094601
1648 Ga0207662_10101498
1649 Ga0207657_10014122
1650 Ga0207657_10070832
1651 Ga0207657_10230961
1652 Ga0207649_10139807
1653 Ga0207652_10084140
1654 Ga0207646_10000311
1655 Ga0207646_10004103
1656 Ga0207646_10032093
1657 Ga0207646_10043966
1658 Ga0207646_10043993
1659 Ga0207646_10182522
1660 Ga0207646_10233967
1661 Ga0207681_10019654
1662 Ga0207681_10047751
1663 Ga0207681_10209241
1664 Ga0207681_10291391
1665 Ga0207694_10004155
1666 Ga0207650_10004695
1667 Ga0207650_10135449
1668 Ga0207650_10324311
1669 Ga0207659_10186247
1670 Ga0207659_10517336
1671 Ga0207687_10000348
1672 Ga0207687_10163230
1673 Ga0207687_10179811
1674 Ga0207687_10217462
1675 Ga0207700_10058946
1676 Ga0207664_10023365
1677 Ga0207664_10928261
1678 Ga0207690_10037788
1679 Ga0207690_10095609
1680 Ga0207690_10118462
1681 Ga0207690_10140957
1682 Ga0207706_10005486
1683 Ga0207706_10013655
1684 Ga0207706_10025135
1685 Ga0207706_10165252
1686 Ga0207686_10005311
1687 Ga0207686_10007475
1688 Ga0207686_10085670
1689 Ga0207709_10000878
1690 Ga0207709_10010187
1691 Ga0207709_10012115
1692 Ga0207709_10420594
1693 Ga0207670_10000311
1694 Ga0207670_10035851
1695 Ga0207670_10097879
1696 Ga0207670_10271995
1697 Ga0207670_10331407
1698 Ga0207670_10556811
1699 Ga0207669_10348521
1700 Ga0207704_10002514
1701 Ga0207704_10005499
1702 Ga0207704_10083555
1703 Ga0207704_10682690
1704 Ga0207665_10468598
1705 Ga0207691_10001846
1706 Ga0207691_10039045
1707 Ga0207691_10068201
1708 Ga0207691_10350598
1709 Ga0207689_10000024
1710 Ga0207689_10049546
1711 Ga0207689_10495465
1712 Ga0207661_10067898
1713 Ga0207661_10341359
1714 Ga0207679_10004100
1715 Ga0207679_10019948
1716 Ga0207679_10177698
1717 Ga0207667_10001264
1718 Ga0207667_10063812
1719 Ga0207667_10067088
1720 Ga0207667_10093911
1721 Ga0207712_10002693
1722 Ga0207712_10054389
1723 Ga0207712_10093400
1724 Ga0207712_10404494
1725 Ga0207668_10007138
1726 Ga0207668_10023460
1727 Ga0207668_10120300
1728 Ga0207668_10380516
1729 Ga0207640_10003020
1730 Ga0207640_10035416
1731 Ga0207640_10185133
1732 Ga0207640_10209733
1733 Ga0207677_10002184
1734 Ga0207703_10028843
1735 Ga0207703_10217539
1736 Ga0207703_10268420
1737 Ga0207639_10388245
1738 Ga0207708_10000905
1739 Ga0207708_10004713
1740 Ga0207708_10050011
1741 Ga0207708_10083101
1742 Ga0207702_10007398
1743 Ga0207702_10024199
1744 Ga0207702_10294982
1745 Ga0207641_10223238
1746 Ga0207641_10536599
1747 Ga0207648_10000113
1748 Ga0207648_10011501
1749 Ga0207648_10015627
1750 Ga0207648_10020579
1751 Ga0207648_10190490
1752 Ga0207648_10326473
1753 Ga0207676_10043514
1754 Ga0207676_10298762
1755 Ga0207676_11339806
1756 Ga0207674_10060152
1757 Ga0207674_10067898
1758 Ga0207674_10202131
1759 Ga0207674_10224926
1760 Ga0207675_100000017
1761 Ga0207675_100001259
1762 Ga0207675_100016991
1763 Ga0207675_100341674
1764 Ga0207675_100478373
1765 Ga0207675_100580296
1766 Ga0207683_10001072
1767 Ga0207683_10687884
1768 Ga0207698_10256825
1769 Ga0207698_10418389
1770 Ga0209995_1026236
1771 Ga0209999_1032115
1772 Ga0209588_1005166
1773 Ga0209588_1010497
1774 Ga0209588_1070208
1775 Ga0209588_1073613
1776 Ga0209998_10005515
1777 Ga0209998_10029326
1778 Ga0209974_10001979
1779 Ga0209974_10004251
1780 Ga0209974_10037558
1781 Ga0209974_10038560
1782 Ga0207428_10000009
1783 Ga0207428_10002133
1784 Ga0207428_10129398
1785 Ga0207428_10171248
1786 Ga0207428_10188037
1787 Ga0207428_10268241
1788 Ga0268266_10662738
1789 Ga0268265_10000773
1790 Ga0268265_10008473
1791 Ga0268265_10040327
1792 Ga0268265_10161360
1793 Ga0268265_10171435
1794 Ga0268265_10179389
1795 Ga0268265_10200893
1796 Ga0268265_10205174
1797 Ga0268265_10793632
1798 Ga0268265_11461954
1799 Ga0268264_10002076
1800 Ga0268264_10083790
1801 Ga0268264_10705338
1802 Ga0265331_10011168
1803 Ga0307408_100022312
1804 Ga0307408_100073368
1805 Ga0307408_100490300
1806 Ga0307408_100741935
1807 Ga0307405_10015162
1808 Ga0307405_10034312
1809 Ga0307405_10142784
1810 Ga0307413_10001553
1811 Ga0307413_10033048
1812 Ga0307410_10001543
1813 Ga0307410_10093033
1814 Ga0307410_10547839
1815 Ga0307410_10776276
1816 Ga0307406_10021123
1817 Ga0307406_10073335
1818 Ga0307406_10267440
1819 Ga0307406_10307460
1820 Ga0307407_10027988
1821 Ga0307407_10063127
1822 Ga0307407_10129696
1823 Ga0307412_10054497
1824 Ga0307409_100000903
1825 Ga0307409_100033458
1826 Ga0307409_100284038
1827 Ga0307409_100594451
1828 Ga0307416_100004367
1829 Ga0307416_100076254
1830 Ga0307414_10014676
1831 Ga0307414_10098368
1832 Ga0307414_10643083
1833 Ga0307411_10008367
1834 Ga0307411_10168301
1835 Ga0307411_10311438
1836 Ga0307415_100002695
1837 Ga0307415_100004603
1838 Ga0307415_100083748
1839 Ga0373958_0018452
1840 Ga0373928_0088806
1841 Ga0373940_0053326
1842 Ga0373944_0093774
1843 Ga0373949_0024936
1844 Ga0373952_0013575
1845 Ga0373932_0010671
1846 Ga0373932_0031083
1847 Ga0373932_0039178
1848 Ga0373945_0054933
1849 Ga0373954_0079134
1850 Ga0373960_0018592
1851 Ga0373960_0151635
1852 Ga0373942_0056032
1853 Ga0373961_0010431
1854 Ga0373962_0035820
1855 Ga0373962_0046294
1856 Ga0373931_0000420
1857 Ga0373931_0000811
1858 Ga0373931_0005995
1859 Ga0373931_0006310
1860 Ga0373931_0178753
1861 Ga0373935_0057084
1862 Ga0373947_0078832
1863 Ga0373925_0037746
1864 Ga0373925_0173709
1865 Ga0395899_0055114
1866 Ga0395900_0030186
1867 Ga0395900_0208585
1868 Ga0395900_0233678
1869 Ga0395900_0677573
1870 Ga0395898_0003573
1871 Ga0395898_1214819
1872 Ga0395905_0079236
1873 Ga0395905_0242500
1874 Ga0395901_0020703
1875 Ga0439434_0133047
1876 Ga0439444_0030702
1877 Ga0439444_0032716
1878 Ga0439464_0005077
1879 Ga0439460_0000593
1880 Ga0451577_0001787
1881 Ga0451577_0097156
1882 Ga0451577_0235382
1883 Ga0453683_0000988
1884 Ga0453683_0045785
1885 Ga0453683_0048006
1886 Ga0453683_0096137
1887 Ga0466966_0005805
1888 Ga0466963_0039373
1889 Ga0453684_0031305
1890 Ga0453684_0042288
1891 Ga0453684_0071338
1892 Ga0466959_0220871
1893 Ga0451576_0005540
1894 Ga0451576_0046429
1895 Ga0451576_0063462
1896 Ga0451576_0078061
1897 Ga0466958_0090113
1898 Ga0495629_0332171
1899 Ga0495580_0000562
1900 Ga0495584_0101841
1901 Ga0495659_0181016
1902 Ga0495669_0021718
1903 Ga0495636_0091001
1904 Ga0495676_0087256
1905 Ga0496100_0039103
1906 Ga0496100_0360717
1907 Ga0496104_0047774
1908 Ga0496104_0388813
1909 Ga0496106_0170535
1910 Ga0496109_0131403
1911 Ga0496109_0208609
1912 Ga0496109_0444903
1913 Ga0496110_0071219
1914 Ga0496111_0293311
1915 Ga0496111_0372517
1916 Ga0496112_0019169
1917 Ga0496112_0084613
1918 Ga0496113_0254233
1919 Ga0496113_0832081
1920 Ga0501298_027109
1921 Ga0501298_033946
1922 Ga0501031_0021671
1923 Ga0501031_0102210
1924 Ga0501032_0101174
1925 Ga0501033_0061684
1926 Ga0501033_0155364
1927 Ga0501033_0518115
1928 Ga0501034_0042064
1929 Ga0501036_0033167
1930 Ga0501036_0056506
1931 Ga0501036_0085905
1932 Ga0501036_0118053
1933 Ga0501036_0236672
1934 Ga0501036_0261072
1935 Ga0501036_0578815
1936 Ga0501036_0844570
1937 Ga0501037_0065267
1938 Ga0501038_0005362
1939 Ga0501038_0043868
1940 Ga0501038_0044219
1941 Ga0501038_0227553
1942 Ga0501039_0033395
1943 Ga0501039_0040085
1944 Ga0501039_0064784
1945 Ga0501039_0241863
1946 Ga0501040_0002035
1947 Ga0501040_0006585
1948 Ga0501040_0014540
1949 Ga0501040_0024257
1950 Ga0501040_0029170
1951 Ga0501040_0181287
1952 Ga0501040_0190749
1953 Ga0501040_0209985
1954 Ga0501040_0445747
1955 Ga0501041_0000015
1956 Ga0501041_0001000
1957 Ga0501041_0024763
1958 Ga0501041_0033901
1959 Ga0501041_0055237
1960 Ga0501041_0076237
1961 Ga0501041_0123951
1962 Ga0501042_0000051
1963 Ga0501042_0012078
1964 Ga0501042_0048454
1965 Ga0501042_0073007
1966 Ga0501042_0351405
1967 Ga0501043_0115727
1968 Ga0501043_0200212
1969 Ga0501046_0000444
1970 Ga0501046_0002854
1971 Ga0501046_0007557
1972 Ga0501046_0043722
1973 Ga0501046_0183963
1974 Ga0501046_0208863
1975 Ga0501046_0243763
1976 Ga0501046_0368889
1977 Ga0501047_0117686
1978 Ga0501048_0003819
1979 Ga0501048_0007480
1980 Ga0501048_0037181
1981 Ga0501048_0071617
1982 Ga0501048_0119968
1983 Ga0501068_0005458
1984 Ga0501068_0052248
1985 Ga0501068_0053009
1986 Ga0501068_0131134
1987 Ga0501069_0106172
1988 Ga0501070_0079627
1989 Ga0501071_0000129
1990 Ga0501071_0020352
1991 Ga0501071_0021494
1992 Ga0501071_0047366
1993 Ga0501071_0083649
1994 Ga0501072_0001551
1995 Ga0501072_0003591
1996 Ga0501072_0037220
1997 Ga0501072_0076869
1998 Ga0501072_0153427
1999 Ga0501072_0168888
2000 Ga0501073_0099113
2001 Ga0501073_0199156
2002 Ga0501074_0009415
2003 Ga0501074_0011091
2004 Ga0501074_0026219
2005 Ga0501074_0067283
2006 Ga0501074_0442129
2007 Ga0501075_0000475
2008 Ga0501075_0001330
2009 Ga0501075_0028995
2010 Ga0501075_0035716
2011 Ga0501075_0067422
2012 Ga0501075_0163798
2013 Ga0501075_0167818
2014 Ga0501075_0469367
2015 Ga0501075_0495425
2016 Ga0501076_0010629
2017 Ga0501076_0010914
2018 Ga0501076_0063447
2019 Ga0501076_0112179
2020 Ga0501076_0139494
2021 Ga0501076_0150599
2022 Ga0501076_0453612
2023 Ga0501077_0000030
2024 Ga0501077_0016913
2025 Ga0501077_0031029
2026 Ga0501077_0037476
2027 Ga0501077_0039368
2028 Ga0501077_0045098
2029 Ga0501077_0076987
2030 Ga0501077_0080639
2031 Ga0501077_0231324
2032 Ga0501077_0231664
2033 Ga0501077_0242001
2034 Ga0501077_0394043
2035 Ga0501259_062436
2036 Ga0501079_0000375
2037 Ga0501079_0000465
2038 Ga0501079_0020348
2039 Ga0501079_0029125
2040 Ga0501079_0029639
2041 Ga0501079_0067329
2042 Ga0501079_0067764
2043 Ga0501079_0087306
2044 Ga0501079_0163629
2045 Ga0501079_0172587
2046 Ga0501079_0374825
2047 Ga0501079_0469493
2048 Ga0501080_0005161
2049 Ga0501080_0064921
2050 Ga0501080_0113157
2051 Ga0501080_0158730
2052 Ga0501081_0001057
2053 Ga0501081_0005051
2054 Ga0501081_0012665
2055 Ga0501081_0048753
2056 Ga0501081_0073098
2057 Ga0501081_0074666
2058 Ga0501081_0105161
2059 Ga0501081_0133020
2060 Ga0501081_0134148
2061 Ga0501081_0158571
2062 Ga0501081_0196960
2063 Ga0501081_0252992
2064 Ga0501083_0045442
2065 Ga0501083_0106827
2066 Ga0501283_006484
2067 Ga0501035_0009164
2068 Ga0501035_0087512
2069 Ga0501035_0259385
2070 Ga0501035_0259462
2071 Ga0501035_0323082
2072 Ga0501044_0194608
2073 Ga0501045_0001379
2074 Ga0501045_0001483
2075 Ga0501045_0019881
2076 Ga0501045_0043425
2077 Ga0501045_0059490
2078 Ga0501045_0081445
2079 Ga0501045_0165898
2080 nmdc:mga03683_5915_c1
2081 nmdc:mga0yw44_312907_c1
2082 nmdc:mga0k408_213099_c1
2083 nmdc:mga06z11_311030_c1
2084 nmdc:mga05p37_127317_c1
2085 nmdc:mga05p37_1381_c1
2086 nmdc:mga05p37_139112_c1
2087 nmdc:mga05p37_147905_c1
2088 nmdc:mga05p37_15097_c1
2089 nmdc:mga05p37_185551_c1
2090 nmdc:mga05p37_19298_c1
2091 nmdc:mga05p37_21037_c2
2092 nmdc:mga05p37_21398_c1
2093 nmdc:mga05p37_2156_c1
2094 nmdc:mga05p37_257606_c1
2095 nmdc:mga05p37_29351_c1
2096 nmdc:mga05p37_31928_c1
2097 nmdc:mga05p37_328016_c1
2098 nmdc:mga05p37_365689_c1
2099 nmdc:mga05p37_38769_c1
2100 nmdc:mga05p37_426811_c1
2101 nmdc:mga05p37_43736_c1
2102 nmdc:mga05p37_51456_c1
2103 nmdc:mga05p37_63439_c1
2104 nmdc:mga05p37_64430_c1
2105 nmdc:mga05p37_67979_c1
2106 nmdc:mga05p37_767969_c1
2107 nmdc:mga05p37_842668_c1
2108 nmdc:mga05p37_96392_c1
2109 nmdc:mga09592_13135_c1
2110 nmdc:mga09592_15617_c1
2111 nmdc:mga09592_21085_c1
2112 nmdc:mga09592_24963_c1
2113 nmdc:mga09592_260864_c1
2114 nmdc:mga09592_405_c1
2115 nmdc:mga09592_47769_c1
2116 nmdc:mga09592_661331_c1
2117 nmdc:mga09592_87401_c1
2118 nmdc:mga0qj67_20152_c1
2119 nmdc:mga0qj67_25526_c1
2120 nmdc:mga0qj67_27533_c1
2121 nmdc:mga0qj67_302_c1
2122 nmdc:mga0qj67_36673_c1
2123 nmdc:mga0qj67_74772_c1
2124 nmdc:mga0qj67_98_c1
2125 nmdc:mga06r32_15127_c1
2126 nmdc:mga06r32_22101_c1
2127 nmdc:mga06r32_2221_c1
2128 nmdc:mga06r32_227459_c1
2129 nmdc:mga06r32_231038_c1
2130 nmdc:mga06r32_249935_c1
2131 nmdc:mga06r32_302162_c1
2132 nmdc:mga06r32_395163_c1
2133 nmdc:mga06r32_443322_c1
2134 nmdc:mga06r32_45248_c1
2135 nmdc:mga06r32_46667_c1
2136 nmdc:mga06r32_487713_c1
2137 nmdc:mga06r32_50437_c1
2138 nmdc:mga06r32_550293_c1
2139 nmdc:mga06r32_706408_c1
2140 nmdc:mga06r32_715040_c1
2141 nmdc:mga06r32_715242_c1
2142 nmdc:mga06r32_936824_c1
2143 nmdc:mga06r32_9529_c1
2144 nmdc:mga08y16_100290_c1
2145 nmdc:mga08y16_161937_c1
2146 nmdc:mga08y16_16428_c1
2147 nmdc:mga08y16_208940_c1
2148 nmdc:mga08y16_241143_c1
2149 nmdc:mga08y16_34508_c1
2150 nmdc:mga08y16_361923_c1
2151 nmdc:mga08y16_419297_c1
2152 nmdc:mga08y16_547_c1
2153 nmdc:mga08y16_550762_c1
2154 nmdc:mga08y16_598277_c1
2155 nmdc:mga08y16_703899_c1
2156 nmdc:mga08y16_9940_c1
2157 nmdc:mga0n895_125591_c1
2158 nmdc:mga0n895_134545_c1
2159 nmdc:mga0n895_157040_c1
2160 nmdc:mga0n895_164651_c1
2161 nmdc:mga0n895_184498_c1
2162 nmdc:mga0n895_22544_c1
2163 nmdc:mga0n895_226890_c1
2164 nmdc:mga0n895_231497_c1
2165 nmdc:mga0n895_24691_c1
2166 nmdc:mga0n895_24957_c1
2167 nmdc:mga0n895_305126_c1
2168 nmdc:mga0n895_401431_c1
2169 nmdc:mga0n895_52269_c1
2170 nmdc:mga0n895_685758_c1
2171 nmdc:mga0rr50_165878_c1
2172 nmdc:mga0rr50_24883_c1
2173 nmdc:mga0rr50_347900_c1
2174 nmdc:mga0rr50_37631_c1
2175 nmdc:mga0rr50_5240_c1
2176 nmdc:mga0rr50_837590_c1
2177 nmdc:mga0rr50_8421_c1
2178 nmdc:mga0rr50_88989_c1
2179 nmdc:mga0rr50_99099_c1
2180 nmdc:mga08x19_121846_c1
2181 nmdc:mga08x19_15913_c1
2182 nmdc:mga08x19_16964_c1
2183 nmdc:mga08x19_171647_c1
2184 nmdc:mga08x19_22151_c1
2185 nmdc:mga08x19_348369_c1
2186 nmdc:mga08x19_3776_c1
2187 nmdc:mga08x19_397_c1
2188 nmdc:mga08x19_45404_c1
2189 nmdc:mga08x19_60275_c1
2190 nmdc:mga0a205_12005_c1
2191 nmdc:mga0a205_133679_c1
2192 nmdc:mga0a205_135974_c1
2193 nmdc:mga0a205_1750_c1
2194 nmdc:mga0a205_27605_c1
2195 nmdc:mga0a205_327959_c1
2196 nmdc:mga0a205_34714_c1
2197 nmdc:mga0a205_364581_c1
2198 nmdc:mga0a205_38_c1
2199 nmdc:mga0a205_4505_c1
2200 nmdc:mga0a205_4714_c1
2201 nmdc:mga0a205_5021_c1
2202 nmdc:mga0a205_55072_c1
2203 nmdc:mga0a205_621862_c1
2204 nmdc:mga0a205_84246_c1
2205 nmdc:mga0a205_87397_c1
2206 nmdc:mga0a205_96451_c1
2207 Ga0500644_0080340
2208 Ga0501084_0011657
2209 Ga0501084_0023529
2210 Ga0501084_0025251
2211 Ga0501084_0116781
2212 Ga0501084_0249740
2213 Ga0501084_0253116
2214 Ga0501084_0295575
2215 Ga0501084_0395075
2216 Ga0501084_0485948
2217 Ga0501084_0561290
2218 Ga0590071_003743
2219 Ga0501082_0000982
2220 Ga0501082_0005754
2221 Ga0501082_0026863
2222 Ga0501082_0031478
2223 Ga0501082_0057896
2224 Ga0501082_0058012
2225 Ga0501082_0170226
2226 Ga0501082_0240107
2227 Ga0501082_0280844
2228 Ga0501082_0417935
2229 Ga0466962_0012226
2230 Ga0530510_0000719
2231 Ga0530510_0019591
2232 Ga0530510_0024391
2233 Ga0530510_0073914
2234 Ga0530510_0087763
2235 Ga0530510_0126391
2236 Ga0530510_0264879
2237 Ga0530510_0289367
2238 2841963889
2239 8006936133
2240 8006976059
2241 8016588394
2242 8019653374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

49

184

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7323 29 178
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.6966 29 178
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5541 28 205
8u4v-assembly1.cif.gz_A cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody 0.4874 67 174
6akf-assembly1.cif.gz_A crystal structure of mouse claudin-3 p134a mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.455 57 174
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8022 45 178 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7865 45 178 1.20.120.550
af_Q03395_1_126_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6848 4 86 1.20.140.150
af_A9JRF5_1_118_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6558 1 86 1.20.140.150
af_A0A2R8QPH7_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5238 104 203 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A519FSQ0-F1-model_v4 deleted 0.9323 20 188
AF-A0A101EDC6-F1-model_v4 Tripartite ATP-independent periplasmic transporter DctQ component 0.9284 62 186 GO:0005886
AF-A0A1V5DX90-F1-model_v4 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM 0.9266 17 190 GO:0005886
AF-A0A0F9VR89-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.9242 15 181 GO:0005886
AF-A0A1Y5FRM8-F1-model_v4 TRAP transporter small permease protein 0.9242 26 182 GO:0005886
GO:0022857

Map