F490357

General Info

Members Datasets Scaffolds Average Seq Length
1119 611 2238 221

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100010904|Ga0070714_1000109046
Length 260
Sequence LIPKFASDVATIGCELRNRSSSALHSRNRYRMTNDMPERPPQIAAPTRRIPYVAGAVLVGAIIGFAGIYGVGGLKRNAAGDPGCASAVDLSRKLAPLAHGEVAALTMATAPLRLPDLAFEDADGKPKKLSDWRGRTVLVNLWATWCVPCRKEMPALDRLQTKLENKDFEVVAINIDTRDPEKPRNFLKEANLTRLGYFSDQKAKVFQDLKAVGRALGMPTSVLVDGQGCEIATIAGPAEWDSDDAIKLITAAIKPVAAGF

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
118 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
119 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
120 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
189 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
401 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
402 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
419 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
420 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
421 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
422 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
423 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
424 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
425 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
426 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
427 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
428 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
429 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
433 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
434 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
435 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
436 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
437 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
438 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
439 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
440 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
441 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
442 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
443 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
444 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
445 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
446 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
447 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
448 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
449 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
450 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
451 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
452 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
453 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
454 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
455 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
456 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
457 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
458 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
459 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
460 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
461 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
462 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
463 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
464 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
465 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
466 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
467 2791355199
468 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
469 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
470 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
471 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
472 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
473 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
474 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
475 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
476 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
477 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
478 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
479 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
480 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
481 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
482 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
483 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
484 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
485 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
486 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
487 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
488 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
489 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
490 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
491 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
492 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
493 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
494 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
495 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
496 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
497 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
498 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
499 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
500 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
501 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
502 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
503 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
504 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
505 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
506 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
507 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
508 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
509 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
510 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
511 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
512 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
513 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
514 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
515 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
516 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
517 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
518 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
519 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
520 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
521 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
522 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
523 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
524 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
525 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
526 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
527 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
528 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
529 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
530 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
531 2904699407
532 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
533 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
534 2906610324
535 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
536 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
537 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
538 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
539 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
540 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
541 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
542 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
543 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
544 2922425934
545 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
546 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
547 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
548 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
549 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
550 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
551 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
552 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
553 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
554 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
555 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
556 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
557 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
558 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
559 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
560 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
561 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
562 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
563 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
564 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
565 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
566 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
567 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
568 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
569 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
570 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
571 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
572 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
573 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
574 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
575 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
576 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
577 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
578 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
579 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
580 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
581 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
582 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
583 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
584 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
585 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
586 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
587 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
588 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
589 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
590 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
591 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
592 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
593 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
594 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
595 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
596 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
597 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
598 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
599 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
600 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
601 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
602 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
603 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
604 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
605 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
606 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
607 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
608 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
609 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
610 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
611 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.84
Metatranscriptomes 0.09
Isolates 15.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 11.97
Rhizoplane 5.9
Rhizosphere 60.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100010904 3300005435 Bacteria 7195
2 LJQas_1005275 3300000549 Bacteria 1646
3 JGI24739J22299_10066317 3300001989 Bacteria 1130
4 JGI24742J22300_10019112 3300002244 Bacteria 1163
5 JGI25406J46586_10002664 3300003203 Bacteria 8409
6 JGI25165J46597_1004162 3300003214 Bacteria 3207
7 JGI25153J46596_10003773 3300003215 Bacteria 8366
8 JGI25153J46596_10012875 3300003215 Bacteria 3575
9 JGI25153J46596_10012878 3300003215 Bacteria 3574
10 JGI25153J46596_10040141 3300003215 Bacteria 1455
11 JGI25160J50197_1002453 3300003354 Bacteria 8630
12 JGI25160J50197_1007063 3300003354 Bacteria 4440
13 JGI25160J50197_1029015 3300003354 Bacteria 1472
14 JGI25404J52841_10023877 3300003659 Bacteria 1318
15 Ga0055526_1025587 3300003771 Bacteria 1889
16 Ga0055526_1036448 3300003771 Bacteria 1304
17 Ga0055531_10022052 3300003794 Bacteria 2443
18 Ga0065165_1000370 3300005262 Bacteria 73604
19 Ga0065165_1020076 3300005262 Bacteria 2365
20 Ga0065165_1033428 3300005262 Bacteria 1600
21 Ga0070658_10388586 3300005327 Bacteria 1198
22 Ga0070676_10326877 3300005328 Bacteria 1048
23 Ga0070683_100047208 3300005329 Bacteria 3979
24 Ga0070683_100361940 3300005329 Bacteria 1381
25 Ga0070690_100029664 3300005330 Bacteria 3395
26 Ga0068869_100048883 3300005334 Bacteria 3060
27 Ga0070680_100022477 3300005336 Bacteria 5024
28 Ga0070680_100085474 3300005336 Bacteria 2606
29 Ga0070680_100106831 3300005336 Bacteria 2328
30 Ga0070680_100388993 3300005336 Bacteria 1188
31 Ga0070682_100060860 3300005337 Bacteria 2389
32 Ga0068868_100419393 3300005338 Bacteria 1159
33 Ga0070660_100076421 3300005339 Bacteria 2623
34 Ga0070660_100162547 3300005339 Bacteria 1800
35 Ga0070689_100162505 3300005340 Bacteria 1806
36 Ga0070689_100497687 3300005340 Bacteria 1044
37 Ga0070668_100055997 3300005347 Bacteria 3044
38 Ga0070668_100564809 3300005347 Bacteria 992
39 Ga0070669_100177265 3300005353 Bacteria 1665
40 Ga0070669_100451495 3300005353 Bacteria 1060
41 Ga0070675_100525976 3300005354 Bacteria 1067
42 Ga0070671_100054653 3300005355 Bacteria 3320
43 Ga0070671_100083780 3300005355 Bacteria 2666
44 Ga0070671_100284059 3300005355 Bacteria 1408
45 Ga0070674_100047262 3300005356 Bacteria 2947
46 Ga0070674_100629873 3300005356 Bacteria 910
47 Ga0070659_100576381 3300005366 Bacteria 965
48 Ga0070667_100407242 3300005367 Bacteria 1238
49 Ga0070667_100494704 3300005367 Bacteria 1120
50 Ga0070709_10009497 3300005434 Bacteria 5368
51 Ga0070709_10035366 3300005434 Bacteria 3035
52 Ga0070714_100065958 3300005435 Bacteria 3119
53 Ga0070714_100071509 3300005435 Bacteria 3000
54 Ga0070714_100335605 3300005435 Bacteria 1416
55 Ga0070713_100073819 3300005436 Bacteria 2889
56 Ga0070713_100153901 3300005436 Bacteria 2048
57 Ga0070710_10002662 3300005437 Bacteria 8484
58 Ga0070710_10005145 3300005437 Bacteria 6191
59 Ga0070710_10566174 3300005437 Bacteria 787
60 Ga0070711_100007717 3300005439 Bacteria 6553
61 Ga0070711_100065325 3300005439 Bacteria 2544
62 Ga0070711_100131461 3300005439 Bacteria 1864
63 Ga0070711_100399242 3300005439 Bacteria 1116
64 Ga0070711_100556928 3300005439 Bacteria 952
65 Ga0070694_100472321 3300005444 Bacteria 994
66 Ga0070663_100032843 3300005455 Bacteria 3581
67 Ga0070663_100045790 3300005455 Bacteria 3092
68 Ga0070663_100221250 3300005455 Bacteria 1486
69 Ga0070663_100232099 3300005455 Bacteria 1453
70 Ga0070678_100077627 3300005456 Bacteria 2506
71 Ga0070678_100110089 3300005456 Bacteria 2153
72 Ga0070678_100818795 3300005456 Bacteria 846
73 Ga0070662_100102813 3300005457 Bacteria 2165
74 Ga0070662_100280423 3300005457 Bacteria 1348
75 Ga0070662_100612432 3300005457 Bacteria 916
76 Ga0070681_10006981 3300005458 Bacteria 10991
77 Ga0070681_10133159 3300005458 Bacteria 2417
78 Ga0070681_10416394 3300005458 Bacteria 1255
79 Ga0068867_100032215 3300005459 Bacteria 3789
80 Ga0068867_100620064 3300005459 Bacteria 946
81 Ga0068867_100903324 3300005459 Bacteria 795
82 Ga0070685_10155086 3300005466 Bacteria 1454
83 Ga0070685_10359585 3300005466 Bacteria 998
84 Ga0070707_100030468 3300005468 Bacteria 5137
85 Ga0070679_100015866 3300005530 Bacteria 7249
86 Ga0070679_100021860 3300005530 Bacteria 6248
87 Ga0070679_100101450 3300005530 Bacteria 2864
88 Ga0070679_100569265 3300005530 Bacteria 1076
89 Ga0070684_100012882 3300005535 Bacteria 6721
90 Ga0070684_100024614 3300005535 Bacteria 5052
91 Ga0070684_100214974 3300005535 Bacteria 1753
92 Ga0070697_100111993 3300005536 Bacteria 2275
93 Ga0070697_100496426 3300005536 Bacteria 1067
94 Ga0068853_100006064 3300005539 Bacteria 9566
95 Ga0068853_100157206 3300005539 Bacteria 2049
96 Ga0068853_100171361 3300005539 Bacteria 1964
97 Ga0068853_100334629 3300005539 Bacteria 1406
98 Ga0068853_100930454 3300005539 Bacteria 835
99 Ga0070696_100232461 3300005546 Bacteria 1387
100 Ga0070665_100122399 3300005548 Bacteria 2603
101 Ga0070665_100133169 3300005548 Bacteria 2487
102 Ga0070665_100145702 3300005548 Bacteria 2371
103 Ga0070665_100414544 3300005548 Bacteria 1355
104 Ga0070704_100266789 3300005549 Bacteria 1412
105 Ga0068855_100036277 3300005563 Bacteria 5870
106 Ga0068855_100051465 3300005563 Bacteria 4851
107 Ga0068855_100067274 3300005563 Bacteria 4175
108 Ga0068855_100196626 3300005563 Bacteria 2272
109 Ga0068855_100305096 3300005563 Bacteria 1762
110 Ga0068855_100668708 3300005563 Bacteria 1114
111 Ga0070664_100097548 3300005564 Bacteria 2552
112 Ga0070664_100381999 3300005564 Bacteria 1286
113 Ga0070664_100495603 3300005564 Bacteria 1125
114 Ga0070664_100754298 3300005564 Bacteria 908
115 Ga0068857_100248718 3300005577 Bacteria 1629
116 Ga0068857_100422028 3300005577 Bacteria 1244
117 Ga0068854_100050162 3300005578 Bacteria 2985
118 Ga0068854_100120969 3300005578 Bacteria 1987
119 Ga0068854_100204649 3300005578 Bacteria 1554
120 Ga0068854_100649458 3300005578 Bacteria 906
121 Ga0068856_100000226 3300005614 Bacteria 61246
122 Ga0068856_100083698 3300005614 Bacteria 3168
123 Ga0068856_100127315 3300005614 Bacteria 2550
124 Ga0068856_100910966 3300005614 Bacteria 898
125 Ga0068856_101030508 3300005614 Bacteria 841
126 Ga0070702_100039695 3300005615 Bacteria 2628
127 Ga0070702_100210953 3300005615 Bacteria 1292
128 Ga0068852_100029813 3300005616 Bacteria 4484
129 Ga0068852_100155718 3300005616 Bacteria 2129
130 Ga0068852_100212344 3300005616 Bacteria 1836
131 Ga0068852_100270359 3300005616 Bacteria 1635
132 Ga0068852_100421421 3300005616 Bacteria 1317
133 Ga0068861_100082377 3300005719 Bacteria 2521
134 Ga0068861_100454470 3300005719 Bacteria 1148
135 Ga0068863_100088948 3300005841 Bacteria 2927
136 Ga0068863_100236108 3300005841 Bacteria 1764
137 Ga0068863_100905383 3300005841 Bacteria 882
138 Ga0068858_100062622 3300005842 Bacteria 3440
139 Ga0068858_100216885 3300005842 Bacteria 1811
140 Ga0068858_100390035 3300005842 Bacteria 1337
141 Ga0068858_100976170 3300005842 Bacteria 830
142 Ga0068860_100000338 3300005843 Bacteria 63598
143 Ga0068860_100081165 3300005843 Bacteria 3084
144 Ga0068862_100138674 3300005844 Bacteria 2157
145 Ga0068862_100145088 3300005844 Bacteria 2109
146 Ga0068862_100150469 3300005844 Bacteria 2071
147 Ga0081455_10006681 3300005937 Bacteria 12325
148 Ga0081455_10010124 3300005937 Bacteria 9611
149 Ga0081455_10039057 3300005937 Bacteria 4199
150 Ga0081455_10086338 3300005937 Bacteria 2556
151 Ga0081538_10096160 3300005981 Bacteria 1510
152 Ga0081540_1001719 3300005983 Bacteria 18532
153 Ga0081540_1007729 3300005983 Bacteria 7618
154 Ga0081540_1007924 3300005983 Bacteria 7497
155 Ga0081540_1016537 3300005983 Bacteria 4609
156 Ga0081540_1016811 3300005983 Bacteria 4560
157 Ga0081540_1025457 3300005983 Bacteria 3403
158 Ga0081539_10003400 3300005985 Bacteria 19636
159 Ga0081539_10145483 3300005985 Bacteria 1147
160 Ga0070717_10000881 3300006028 Bacteria 19843
161 Ga0070717_10012781 3300006028 Bacteria 6409
162 Ga0075365_10106251 3300006038 Bacteria 1926
163 Ga0075365_10106909 3300006038 Bacteria 1920
164 Ga0075365_10274789 3300006038 Bacteria 1185
165 Ga0075368_10013721 3300006042 Bacteria 2979
166 Ga0075368_10054498 3300006042 Bacteria 1593
167 Ga0075364_10079328 3300006051 Bacteria 2169
168 Ga0075364_10143630 3300006051 Bacteria 1606
169 Ga0070715_10000142 3300006163 Bacteria 16844
170 Ga0070715_10025119 3300006163 Bacteria 2356
171 Ga0070715_10083510 3300006163 Bacteria 1455
172 Ga0070716_100011221 3300006173 Bacteria 4511
173 Ga0070716_100288712 3300006173 Bacteria 1135
174 Ga0070712_100008524 3300006175 Bacteria 6450
175 Ga0070712_100057376 3300006175 Bacteria 2735
176 Ga0070712_100088144 3300006175 Bacteria 2267
177 Ga0075362_10020552 3300006177 Bacteria 2760
178 Ga0075362_10064514 3300006177 Bacteria 1662
179 Ga0075367_10072597 3300006178 Bacteria 2072
180 Ga0075367_10101615 3300006178 Bacteria 1758
181 Ga0075367_10125084 3300006178 Bacteria 1586
182 Ga0075367_10171980 3300006178 Bacteria 1349
183 Ga0075369_10065699 3300006186 Bacteria 1590
184 Ga0075369_10160506 3300006186 Bacteria 1030
185 Ga0075366_10039102 3300006195 Bacteria 2803
186 Ga0075366_10137241 3300006195 Bacteria 1477
187 Ga0075366_10175353 3300006195 Bacteria 1301
188 Ga0097621_100682248 3300006237 Bacteria 945
189 Ga0075370_10007642 3300006353 Bacteria 5516
190 Ga0075370_10045190 3300006353 Bacteria 2490
191 Ga0075370_10227837 3300006353 Bacteria 1102
192 Ga0068871_100234210 3300006358 Bacteria 1595
193 Ga0075428_100313699 3300006844 Bacteria 1685
194 Ga0075434_100091190 3300006871 Bacteria 3049
195 Ga0075434_100778047 3300006871 Bacteria 974
196 Ga0068865_100351977 3300006881 Bacteria 1193
197 Ga0075436_100469419 3300006914 Bacteria 918
198 Ga0099825_1040475 3300006941 Bacteria 1381
199 Ga0099824_1003918 3300006942 Bacteria 21572
200 Ga0099824_1014440 3300006942 Bacteria 7838
201 Ga0099822_1001088 3300006943 Bacteria 30109
202 Ga0075435_100072595 3300007076 Bacteria 2812
203 Ga0075435_100211288 3300007076 Bacteria 1646
204 Ga0099794_10012330 3300007265 Bacteria 3685
205 Ga0099795_10015844 3300007788 Bacteria 2371
206 Ga0099795_10114253 3300007788 Bacteria 1073
207 Ga0105244_10151055 3300009036 Bacteria 1113
208 Ga0105250_10081818 3300009092 Bacteria 1309
209 Ga0105240_10011631 3300009093 Bacteria 12237
210 Ga0105240_10107940 3300009093 Bacteria 3373
211 Ga0105240_10119154 3300009093 Bacteria 3180
212 Ga0105240_10235517 3300009093 Bacteria 2125
213 Ga0111539_10098137 3300009094 Bacteria 3441
214 Ga0105245_10347772 3300009098 Bacteria 1468
215 Ga0105245_10537913 3300009098 Bacteria 1189
216 Ga0105247_10386298 3300009101 Bacteria 994
217 Ga0114129_10184276 3300009147 Bacteria 2838
218 Ga0105243_10704614 3300009148 Bacteria 984
219 Ga0105241_10089499 3300009174 Bacteria 2425
220 Ga0105241_10106447 3300009174 Bacteria 2238
221 Ga0105241_10108204 3300009174 Bacteria 2222
222 Ga0105241_10212606 3300009174 Bacteria 1621
223 Ga0105241_10246418 3300009174 Bacteria 1513
224 Ga0105241_10410482 3300009174 Bacteria 1190
225 Ga0105241_10523286 3300009174 Bacteria 1061
226 Ga0105242_10766860 3300009176 Bacteria 951
227 Ga0105248_10033744 3300009177 Bacteria 5720
228 Ga0105248_10198655 3300009177 Bacteria 2259
229 Ga0105248_10525556 3300009177 Bacteria 1334
230 Ga0105237_10028867 3300009545 Bacteria 5645
231 Ga0105237_10085738 3300009545 Bacteria 3139
232 Ga0105237_10129523 3300009545 Bacteria 2518
233 Ga0105237_10503354 3300009545 Bacteria 1218
234 Ga0105238_10004512 3300009551 Bacteria 13800
235 Ga0105238_10325855 3300009551 Bacteria 1522
236 Ga0105238_10715344 3300009551 Bacteria 1014
237 Ga0105249_10574889 3300009553 Bacteria 1180
238 Ga0105249_10715616 3300009553 Bacteria 1062
239 Ga0105249_11269842 3300009553 Bacteria 808
240 Ga0105239_10069619 3300010375 Bacteria 3866
241 Ga0105239_10246611 3300010375 Bacteria 2005
242 Ga0105239_10272260 3300010375 Bacteria 1905
243 Ga0105239_10278093 3300010375 Bacteria 1884
244 Ga0105239_10283113 3300010375 Bacteria 1867
245 Ga0105239_10598302 3300010375 Bacteria 1258
246 Ga0105239_10774240 3300010375 Bacteria 1099
247 Ga0105246_10119566 3300011119 Bacteria 1950
248 Ga0105246_10168932 3300011119 Bacteria 1673
249 Ga0105246_10338814 3300011119 Bacteria 1228
250 Ga0157373_10032979 3300013100 Bacteria 3728
251 Ga0157370_10138556 3300013104 Bacteria 2267
252 Ga0157369_10189265 3300013105 Bacteria 2163
253 Ga0157369_10202616 3300013105 Bacteria 2082
254 Ga0157369_10415885 3300013105 Bacteria 1394
255 Ga0157378_10181370 3300013297 Bacteria 1981
256 Ga0157378_10242434 3300013297 Bacteria 1722
257 Ga0163162_10658394 3300013306 Bacteria 1171
258 Ga0163162_10802990 3300013306 Bacteria 1058
259 Ga0157372_10131460 3300013307 Bacteria 2880
260 Ga0157375_10470738 3300013308 Bacteria 1422
261 Ga0163163_10157670 3300014325 Bacteria 2314
262 Ga0163163_10157929 3300014325 Bacteria 2312
263 Ga0163163_10210261 3300014325 Bacteria 1994
264 Ga0157380_10828385 3300014326 Bacteria 945
265 Ga0157379_10125455 3300014968 Bacteria 2310
266 Ga0157376_10360365 3300014969 Bacteria 1394
267 Ga0157376_10446801 3300014969 Bacteria 1260
268 Ga0163161_10273386 3300017792 Bacteria 1323
269 Ga0163161_10559423 3300017792 Bacteria 938
270 Ga0214544_1000003 3300021320 Bacteria 643752
271 Ga0214542_1000003 3300021321 Bacteria 435700
272 Ga0214545_1000004 3300021324 Bacteria 453352
273 Ga0214543_1000007 3300021327 Bacteria 414744
274 Ga0213876_10001789 3300021384 Bacteria 13022
275 Ga0209563_100565 3300025230 Bacteria 12334
276 Ga0207425_1003823 3300025245 Bacteria 4692
277 Ga0209677_100794 3300025253 Bacteria 15885
278 Ga0209677_107068 3300025253 Bacteria 2478
279 Ga0209148_1008864 3300025254 Bacteria 1997
280 Ga0209233_1000798 3300025261 Bacteria 14123
281 Ga0209233_1008827 3300025261 Bacteria 3093
282 Ga0209455_1003650 3300025272 Bacteria 5341
283 Ga0209564_1011290 3300025295 Bacteria 4017
284 Ga0209564_1013080 3300025295 Bacteria 3554
285 Ga0209758_1000030 3300025297 Bacteria 509217
286 Ga0209758_1000277 3300025297 Bacteria 102106
287 Ga0209758_1004322 3300025297 Bacteria 11944
288 Ga0209758_1005254 3300025297 Bacteria 10133
289 Ga0209758_1008633 3300025297 Bacteria 6542
290 Ga0209256_1004360 3300025299 Bacteria 8959
291 Ga0207426_1000271 3300025302 Bacteria 108392
292 Ga0207426_1016608 3300025302 Bacteria 2637
293 Ga0209257_1003520 3300025304 Bacteria 13314
294 Ga0207697_10274856 3300025315 Bacteria 746
295 Ga0207656_10001723 3300025321 Bacteria 7270
296 Ga0207692_10004179 3300025898 Bacteria 5700
297 Ga0207692_10080277 3300025898 Bacteria 1743
298 Ga0207688_10063508 3300025901 Bacteria 2083
299 Ga0207680_10130339 3300025903 Bacteria 1657
300 Ga0207647_10112176 3300025904 Bacteria 1612
301 Ga0207699_10000443 3300025906 Bacteria 21171
302 Ga0207699_10116447 3300025906 Bacteria 1721
303 Ga0207645_10023630 3300025907 Bacteria 3991
304 Ga0207645_10064183 3300025907 Bacteria 2346
305 Ga0207684_10479518 3300025910 Bacteria 1067
306 Ga0207684_10669091 3300025910 Bacteria 884
307 Ga0207654_10020998 3300025911 Bacteria 3468
308 Ga0207654_10033507 3300025911 Bacteria 2848
309 Ga0207654_10365306 3300025911 Bacteria 997
310 Ga0207707_10002133 3300025912 Bacteria 17911
311 Ga0207707_10010412 3300025912 Bacteria 8069
312 Ga0207695_10000059 3300025913 Bacteria 363920
313 Ga0207695_10063408 3300025913 Bacteria 3811
314 Ga0207695_10303448 3300025913 Bacteria 1488
315 Ga0207695_10666390 3300025913 Bacteria 921
316 Ga0207671_10010861 3300025914 Bacteria 7469
317 Ga0207671_10184011 3300025914 Bacteria 1627
318 Ga0207671_10356181 3300025914 Bacteria 1161
319 Ga0207693_10025285 3300025915 Bacteria 4708
320 Ga0207693_10061331 3300025915 Bacteria 2945
321 Ga0207693_10217157 3300025915 Bacteria 1502
322 Ga0207663_10000159 3300025916 Bacteria 31170
323 Ga0207663_10008306 3300025916 Bacteria 5420
324 Ga0207663_10276585 3300025916 Bacteria 1246
325 Ga0207660_10062522 3300025917 Bacteria 2682
326 Ga0207660_10087813 3300025917 Bacteria 2298
327 Ga0207660_10087915 3300025917 Bacteria 2297
328 Ga0207660_10115066 3300025917 Bacteria 2030
329 Ga0207657_10177745 3300025919 Bacteria 1722
330 Ga0207657_10451988 3300025919 Bacteria 1008
331 Ga0207652_10007627 3300025921 Bacteria 8707
332 Ga0207652_10010602 3300025921 Bacteria 7418
333 Ga0207652_10368050 3300025921 Bacteria 1297
334 Ga0207646_10245834 3300025922 Bacteria 1616
335 Ga0207681_10241534 3300025923 Bacteria 1406
336 Ga0207694_10003079 3300025924 Bacteria 13349
337 Ga0207694_10221119 3300025924 Bacteria 1545
338 Ga0207650_10172442 3300025925 Bacteria 1720
339 Ga0207659_10159014 3300025926 Bacteria 1772
340 Ga0207687_10096342 3300025927 Bacteria 2168
341 Ga0207700_10001897 3300025928 Bacteria 11872
342 Ga0207700_10078655 3300025928 Bacteria 2566
343 Ga0207700_10097767 3300025928 Bacteria 2334
344 Ga0207700_10633421 3300025928 Bacteria 953
345 Ga0207664_10048445 3300025929 Bacteria 3341
346 Ga0207664_10368882 3300025929 Bacteria 1273
347 Ga0207664_10437037 3300025929 Bacteria 1167
348 Ga0207644_10044865 3300025931 Bacteria 3143
349 Ga0207644_10401547 3300025931 Bacteria 1120
350 Ga0207690_10018691 3300025932 Bacteria 4253
351 Ga0207706_10082235 3300025933 Bacteria 2830
352 Ga0207706_10121400 3300025933 Bacteria 2298
353 Ga0207686_10062058 3300025934 Bacteria 2372
354 Ga0207709_10057873 3300025935 Bacteria 2406
355 Ga0207709_10362204 3300025935 Bacteria 1098
356 Ga0207704_10087993 3300025938 Bacteria 2030
357 Ga0207704_10118038 3300025938 Bacteria 1808
358 Ga0207665_10001544 3300025939 Bacteria 15491
359 Ga0207665_10698510 3300025939 Bacteria 797
360 Ga0207691_10308714 3300025940 Bacteria 1358
361 Ga0207691_10381056 3300025940 Bacteria 1204
362 Ga0207689_10030539 3300025942 Bacteria 4490
363 Ga0207679_10429628 3300025945 Bacteria 1167
364 Ga0207679_10445009 3300025945 Bacteria 1148
365 Ga0207679_10864169 3300025945 Bacteria 826
366 Ga0207679_10968016 3300025945 Bacteria 780
367 Ga0207667_10017617 3300025949 Bacteria 8034
368 Ga0207667_10069227 3300025949 Bacteria 3673
369 Ga0207667_10289439 3300025949 Bacteria 1674
370 Ga0207667_10543069 3300025949 Bacteria 1176
371 Ga0207651_10812878 3300025960 Bacteria 829
372 Ga0207712_10111476 3300025961 Bacteria 2053
373 Ga0207668_10110750 3300025972 Bacteria 2059
374 Ga0207668_10114119 3300025972 Bacteria 2033
375 Ga0207668_10179991 3300025972 Bacteria 1666
376 Ga0207640_10043499 3300025981 Bacteria 2871
377 Ga0207640_10565755 3300025981 Bacteria 957
378 Ga0207640_10600161 3300025981 Bacteria 932
379 Ga0207658_10536757 3300025986 Bacteria 1045
380 Ga0207677_10153115 3300026023 Bacteria 1782
381 Ga0207677_10292173 3300026023 Bacteria 1343
382 Ga0207703_10332981 3300026035 Bacteria 1393
383 Ga0207703_10366962 3300026035 Bacteria 1329
384 Ga0207639_10002960 3300026041 Bacteria 11420
385 Ga0207639_10562892 3300026041 Bacteria 1048
386 Ga0207639_11141086 3300026041 Bacteria 731
387 Ga0207678_10031971 3300026067 Bacteria 4588
388 Ga0207678_10118720 3300026067 Bacteria 2257
389 Ga0207678_10160170 3300026067 Bacteria 1922
390 Ga0207702_10000191 3300026078 Bacteria 72810
391 Ga0207702_10166453 3300026078 Bacteria 2017
392 Ga0207702_10189338 3300026078 Bacteria 1900
393 Ga0207641_10323159 3300026088 Bacteria 1464
394 Ga0207641_10436922 3300026088 Bacteria 1263
395 Ga0207648_10126331 3300026089 Bacteria 2250
396 Ga0207648_10334755 3300026089 Bacteria 1362
397 Ga0207648_10674781 3300026089 Bacteria 956
398 Ga0207648_10859337 3300026089 Bacteria 846
399 Ga0207676_11175369 3300026095 Bacteria 760
400 Ga0207674_10214579 3300026116 Bacteria 1873
401 Ga0207674_10387981 3300026116 Bacteria 1350
402 Ga0207675_100107645 3300026118 Bacteria 2629
403 Ga0207675_100154382 3300026118 Bacteria 2187
404 Ga0207683_10024682 3300026121 Bacteria 5180
405 Ga0207683_10095034 3300026121 Bacteria 2657
406 Ga0207683_10140247 3300026121 Bacteria 2178
407 Ga0207698_10020684 3300026142 Bacteria 4535
408 Ga0207698_10795870 3300026142 Bacteria 947
409 Ga0207698_11015620 3300026142 Bacteria 840
410 Ga0209389_1000193 3300027296 Bacteria 44705
411 Ga0209389_1000207 3300027296 Bacteria 42300
412 Ga0209589_1000024 3300027357 Bacteria 169886
413 Ga0209589_1000025 3300027357 Bacteria 165546
414 Ga0209489_100039 3300027361 Bacteria 165546
415 Ga0209489_101741 3300027361 Bacteria 44747
416 Ga0209489_101963 3300027361 Bacteria 42342
417 Ga0209700_100043 3300027363 Bacteria 167890
418 Ga0209700_100420 3300027363 Bacteria 77617
419 Ga0209179_1027877 3300027512 Bacteria 1142
420 Ga0209588_1005363 3300027671 Bacteria 3672
421 Ga0209813_10017710 3300027866 Bacteria 1959
422 Ga0268266_10093564 3300028379 Bacteria 2637
423 Ga0268266_10102702 3300028379 Bacteria 2522
424 Ga0268266_10182723 3300028379 Bacteria 1910
425 Ga0268266_10402505 3300028379 Bacteria 1294
426 Ga0268266_10498429 3300028379 Bacteria 1162
427 Ga0268265_10233756 3300028380 Bacteria 1617
428 Ga0268265_10340670 3300028380 Bacteria 1365
429 Ga0268264_10000051 3300028381 Bacteria 321565
430 Ga0265334_10061058 3300028573 Bacteria 1421
431 Ga0265323_10014930 3300028653 Bacteria 3062
432 Ga0265336_10001054 3300028666 Bacteria 13486
433 Ga0307517_10002349 3300028786 Bacteria 30516
434 Ga0307517_10164980 3300028786 Bacteria 1474
435 Ga0265338_10000231 3300028800 Bacteria 103805
436 Ga0307511_10068005 3300030521 Bacteria 2636
437 Ga0307512_10152234 3300030522 Bacteria 1380
438 Ga0265330_10019295 3300031235 Bacteria 3126
439 Ga0265330_10057988 3300031235 Bacteria 1688
440 Ga0265332_10018917 3300031238 Bacteria 3041
441 Ga0265325_10031254 3300031241 Bacteria 2851
442 Ga0265340_10007086 3300031247 Bacteria 6111
443 Ga0265340_10054320 3300031247 Bacteria 1932
444 Ga0265339_10019205 3300031249 Bacteria 4015
445 Ga0265339_10286563 3300031249 Bacteria 788
446 Ga0307509_10034268 3300031507 Bacteria 5578
447 Ga0307509_10050156 3300031507 Bacteria 4470
448 Ga0307408_100073647 3300031548 Bacteria 2532
449 Ga0307508_10000152 3300031616 Bacteria 82883
450 Ga0307508_10032270 3300031616 Bacteria 4731
451 Ga0307508_10090477 3300031616 Bacteria 2647
452 Ga0265314_10013479 3300031711 Bacteria 6599
453 Ga0265314_10093163 3300031711 Bacteria 1956
454 Ga0265314_10189273 3300031711 Bacteria 1226
455 Ga0265342_10009530 3300031712 Bacteria 6825
456 Ga0265342_10047587 3300031712 Bacteria 2573
457 Ga0307516_10010117 3300031730 Bacteria 10422
458 Ga0307516_10039301 3300031730 Bacteria 4717
459 Ga0307516_10186455 3300031730 Bacteria 1804
460 Ga0307516_10329537 3300031730 Bacteria 1196
461 Ga0307406_10364465 3300031901 Bacteria 1134
462 Ga0307409_100870847 3300031995 Bacteria 913
463 Ga0307415_100151732 3300032126 Bacteria 1784
464 Ga0307507_10035688 3300033179 Bacteria 5102
465 Ga0307510_10054282 3300033180 Bacteria 4200
466 Ga0307510_10070832 3300033180 Bacteria 3478
467 Ga0307510_10078249 3300033180 Bacteria 3236
468 Ga0307510_10153880 3300033180 Bacteria 1911
469 Ga0315911_1000023 3300033442 Bacteria 110348
470 Ga0373926_0105476 3300035083 Bacteria 1056
471 Ga0373934_0009884 3300035086 Bacteria 3581
472 Ga0373923_0004103 3300035111 Bacteria 4791
473 Ga0373923_0029194 3300035111 Bacteria 2210
474 Ga0373936_0001144 3300035113 Bacteria 9516
475 Ga0373936_0009733 3300035113 Bacteria 3626
476 Ga0373941_0023970 3300035115 Bacteria 1748
477 Ga0373953_0010020 3300035117 Bacteria 3285
478 Ga0373953_0051304 3300035117 Bacteria 1668
479 Ga0373954_0066410 3300035118 Bacteria 1708
480 Ga0373956_0003314 3300035119 Bacteria 6486
481 Ga0373957_0004032 3300035120 Bacteria 4423
482 Ga0373957_0038732 3300035120 Bacteria 1786
483 Ga0373943_0009607 3300035170 Bacteria 4336
484 Ga0373943_0074774 3300035170 Bacteria 1723
485 Ga0373946_0046411 3300035171 Bacteria 1800
486 Ga0373955_0002545 3300035172 Bacteria 7980
487 Ga0373924_0005363 3300035410 Bacteria 4535
488 Ga0373924_0016407 3300035410 Bacteria 2826
489 Ga0373931_0003381 3300035691 Bacteria 7158
490 Ga0373931_0091706 3300035691 Bacteria 1694
491 Ga0373935_0001102 3300035692 Bacteria 14741
492 Ga0373935_0206236 3300035692 Bacteria 1360
493 Ga0373935_0214787 3300035692 Bacteria 1334
494 Ga0373927_0003159 3300035695 Bacteria 11896
495 Ga0373927_0033149 3300035695 Bacteria 3363
496 Ga0373927_0042821 3300035695 Bacteria 2934
497 Ga0373927_0050595 3300035695 Bacteria 2687
498 Ga0373927_0105363 3300035695 Bacteria 1836
499 Ga0373927_0510350 3300035695 Bacteria 794
500 Ga0373933_0004241 3300035724 Bacteria 7898
501 Ga0373933_0077836 3300035724 Bacteria 2028
502 Ga0373933_0127932 3300035724 Bacteria 1595
503 Ga0373933_0315799 3300035724 Bacteria 1013
504 Ga0373947_0000480 3300035725 Bacteria 22933
505 Ga0373947_0055651 3300035725 Bacteria 2389
506 Ga0373937_0020950 3300036401 Bacteria 5864
507 Ga0373937_0020992 3300036401 Bacteria 5858
508 Ga0372808_001922 3300036459 Bacteria 2292
509 Ga0373925_0039387 3300037068 Bacteria 3497
510 Ga0373925_0094759 3300037068 Bacteria 2286
511 Ga0373925_0129665 3300037068 Bacteria 1965
512 Ga0395899_0066257 3300037312 Bacteria 2652
513 Ga0395900_0001144 3300037418 Bacteria 33438
514 Ga0395898_0047649 3300037466 Bacteria 4205
515 Ga0395898_0334455 3300037466 Bacteria 1444
516 Ga0395905_0001838 3300037471 Bacteria 24511
517 Ga0395905_0046769 3300037471 Bacteria 4057
518 Ga0395905_0086526 3300037471 Bacteria 2938
519 Ga0395905_0308829 3300037471 Bacteria 1470
520 Ga0436364_0363089 3300037853 Bacteria 1331
521 Ga0436364_0417484 3300037853 Bacteria 1167
522 Ga0395901_0168028 3300038443 Bacteria 2302
523 Ga0395901_0777838 3300038443 Bacteria 948
524 Ga0436365_0995966 3300039437 Bacteria 2156
525 Ga0436365_1476582 3300039437 Bacteria 2479
526 Ga0436360_1215019 3300039438 Bacteria 3920
527 Ga0436361_0838028 3300039447 Bacteria 1146
528 Ga0436363_0991272 3300039450 Bacteria 10945
529 Ga0439465_0175373 3300041413 Bacteria 774
530 Ga0451793_0560032 3300041452 Bacteria 1244
531 Ga0466969_0068293 3300044656 Bacteria 1713
532 Ga0466969_0115510 3300044656 Bacteria 1253
533 Ga0466972_0011985 3300044658 Bacteria 4356
534 Ga0466965_0045343 3300044683 Bacteria 2174
535 Ga0466965_0095547 3300044683 Bacteria 1516
536 Ga0466966_0000857 3300044684 Bacteria 19413
537 Ga0466966_0311368 3300044684 Bacteria 946
538 Ga0466961_0000065 3300044693 Bacteria 63259
539 Ga0466963_0157118 3300044694 Bacteria 1581
540 Ga0466964_0287591 3300044706 Bacteria 824
541 Ga0466968_0016525 3300044735 Bacteria 2939
542 Ga0466957_0161540 3300044842 Bacteria 1455
543 Ga0466960_0143522 3300044901 Bacteria 1270
544 Ga0466959_0041579 3300045049 Bacteria 3393
545 Ga0466958_0168914 3300045836 Bacteria 1385
546 Ga0466967_0007710 3300045976 Bacteria 7801
547 Ga0495617_080534 3300046452 Bacteria 1067
548 Ga0495592_0097532 3300046454 Bacteria 2099
549 Ga0495603_0001026 3300046455 Bacteria 16115
550 Ga0495603_0013790 3300046455 Bacteria 4890
551 Ga0495603_0046069 3300046455 Bacteria 2599
552 Ga0495603_0200741 3300046455 Bacteria 1152
553 Ga0495603_0201046 3300046455 Bacteria 1151
554 Ga0495629_0000074 3300046459 Bacteria 87355
555 Ga0495629_0000905 3300046459 Bacteria 23806
556 Ga0495629_0002614 3300046459 Bacteria 13806
557 Ga0495629_0057240 3300046459 Bacteria 2726
558 Ga0495629_0109713 3300046459 Bacteria 1924
559 Ga0495638_0006758 3300046460 Bacteria 8304
560 Ga0495638_0119062 3300046460 Bacteria 1562
561 Ga0495638_0140693 3300046460 Bacteria 1409
562 Ga0495638_0280157 3300046460 Bacteria 906
563 Ga0495641_0005311 3300046461 Bacteria 8747
564 Ga0495641_0279045 3300046461 Bacteria 752
565 Ga0495651_0061319 3300046462 Bacteria 2879
566 Ga0495651_0120911 3300046462 Bacteria 1924
567 Ga0495651_0200110 3300046462 Bacteria 1398
568 Ga0495651_0304696 3300046462 Bacteria 1067
569 Ga0495653_0006522 3300046463 Bacteria 9575
570 Ga0495653_0010020 3300046463 Bacteria 7753
571 Ga0495653_0047464 3300046463 Bacteria 3321
572 Ga0495653_0114341 3300046463 Bacteria 1934
573 Ga0495653_0436461 3300046463 Bacteria 826
574 Ga0495580_0006217 3300046472 Bacteria 9757
575 Ga0495580_0067938 3300046472 Bacteria 2493
576 Ga0495580_0179183 3300046472 Bacteria 1463
577 Ga0495582_0000059 3300046473 Bacteria 55798
578 Ga0495582_0059797 3300046473 Bacteria 2102
579 Ga0495582_0169114 3300046473 Bacteria 1244
580 Ga0495639_0023249 3300046475 Bacteria 2723
581 Ga0495662_0000353 3300046476 Bacteria 20170
582 Ga0495664_0034197 3300046477 Bacteria 2989
583 Ga0495664_0037868 3300046477 Bacteria 2847
584 Ga0495664_0141977 3300046477 Bacteria 1456
585 Ga0495584_0274368 3300046491 Bacteria 857
586 Ga0495594_0000739 3300046499 Bacteria 16775
587 Ga0495607_0226349 3300046501 Bacteria 912
588 Ga0495583_0169620 3300046506 Bacteria 897
589 Ga0495606_0017354 3300046507 Bacteria 5444
590 Ga0495606_0025094 3300046507 Bacteria 4277
591 Ga0495608_0011764 3300046511 Bacteria 6086
592 Ga0495608_0011932 3300046511 Bacteria 6042
593 Ga0495608_0125196 3300046511 Bacteria 1646
594 Ga0495608_0138708 3300046511 Bacteria 1553
595 Ga0495610_0147295 3300046512 Bacteria 1008
596 Ga0495616_0120553 3300046513 Bacteria 1211
597 Ga0495616_0205229 3300046513 Bacteria 864
598 Ga0495618_0141527 3300046514 Bacteria 1538
599 Ga0495618_0142416 3300046514 Bacteria 1533
600 Ga0495618_0150758 3300046514 Bacteria 1485
601 Ga0495618_0185740 3300046514 Bacteria 1320
602 Ga0495618_0271076 3300046514 Bacteria 1061
603 Ga0495620_0069204 3300046515 Bacteria 1448
604 Ga0495628_0021621 3300046516 Bacteria 5290
605 Ga0495628_0049172 3300046516 Bacteria 3339
606 Ga0495628_0327571 3300046516 Bacteria 1129
607 Ga0495631_0255910 3300046518 Bacteria 746
608 Ga0495632_0186415 3300046519 Bacteria 949
609 Ga0495637_0096630 3300046520 Bacteria 1159
610 Ga0495643_0010684 3300046522 Bacteria 5640
611 Ga0495644_0057463 3300046523 Bacteria 1462
612 Ga0495648_0001072 3300046524 Bacteria 27793
613 Ga0495648_0072355 3300046524 Bacteria 1995
614 Ga0495648_0115674 3300046524 Bacteria 1450
615 Ga0495648_0163111 3300046524 Bacteria 1150
616 Ga0495648_0191501 3300046524 Bacteria 1031
617 Ga0495666_0036199 3300046526 Bacteria 2404
618 Ga0495652_0009450 3300046529 Bacteria 8859
619 Ga0495652_0015406 3300046529 Bacteria 6847
620 Ga0495652_0029538 3300046529 Bacteria 4816
621 Ga0495652_0050712 3300046529 Bacteria 3547
622 Ga0495652_0149844 3300046529 Bacteria 1824
623 Ga0495652_0370470 3300046529 Bacteria 1021
624 Ga0495652_0428609 3300046529 Bacteria 930
625 Ga0495665_0007726 3300046531 Bacteria 5819
626 Ga0495665_0078110 3300046531 Bacteria 1741
627 Ga0495640_0003997 3300046533 Bacteria 11803
628 Ga0495640_0005556 3300046533 Bacteria 10025
629 Ga0495640_0018677 3300046533 Bacteria 5133
630 Ga0495640_0423728 3300046533 Bacteria 815
631 Ga0495586_0106725 3300046535 Bacteria 1557
632 Ga0495587_0010964 3300046536 Bacteria 5748
633 Ga0495587_0035730 3300046536 Bacteria 2992
634 Ga0495598_0004861 3300046537 Bacteria 2939
635 Ga0495597_0046921 3300046542 Bacteria 1913
636 Ga0495645_0025866 3300046543 Bacteria 4261
637 Ga0495645_0056454 3300046543 Bacteria 2851
638 Ga0495645_0137848 3300046543 Bacteria 1705
639 Ga0495645_0183083 3300046543 Bacteria 1433
640 Ga0495645_0462257 3300046543 Bacteria 799
641 Ga0495645_0519075 3300046543 Bacteria 742
642 Ga0495622_0008469 3300046557 Bacteria 4761
643 Ga0495622_0010239 3300046557 Bacteria 4334
644 Ga0495633_0073695 3300046558 Bacteria 1591
645 Ga0495667_0011440 3300046559 Bacteria 6004
646 Ga0495667_0013790 3300046559 Bacteria 5459
647 Ga0495667_0176464 3300046559 Bacteria 1372
648 Ga0495656_0018155 3300046615 Bacteria 2696
649 Ga0495668_0085926 3300046616 Bacteria 1725
650 Ga0495634_0001138 3300046642 Bacteria 24566
651 Ga0495634_0119611 3300046642 Bacteria 1687
652 Ga0495634_0182402 3300046642 Bacteria 1313
653 Ga0495611_0221977 3300046648 Bacteria 879
654 Ga0495625_0189269 3300046660 Bacteria 1364
655 Ga0495625_0471368 3300046660 Bacteria 772
656 Ga0495635_0000177 3300046663 Bacteria 40081
657 Ga0495635_0001821 3300046663 Bacteria 14407
658 Ga0495635_0006294 3300046663 Bacteria 8269
659 Ga0495635_0090798 3300046663 Bacteria 2089
660 Ga0495635_0408421 3300046663 Bacteria 901
661 Ga0495659_0009925 3300046664 Bacteria 3045
662 Ga0495588_0000651 3300046674 Bacteria 16098
663 Ga0495588_0017658 3300046674 Bacteria 3469
664 Ga0495588_0116156 3300046674 Bacteria 1410
665 Ga0495588_0192970 3300046674 Bacteria 1076
666 Ga0495657_0004358 3300046675 Bacteria 11297
667 Ga0495657_0026309 3300046675 Bacteria 4120
668 Ga0495657_0160150 3300046675 Bacteria 1393
669 Ga0495657_0181727 3300046675 Bacteria 1290
670 Ga0495599_0001858 3300046678 Bacteria 12234
671 Ga0495599_0010912 3300046678 Bacteria 5570
672 Ga0495599_0157201 3300046678 Bacteria 1406
673 Ga0495599_0224561 3300046678 Bacteria 1148
674 Ga0495623_0009276 3300046679 Bacteria 6387
675 Ga0495646_0035715 3300046680 Bacteria 3082
676 Ga0495646_0095015 3300046680 Bacteria 1716
677 Ga0495646_0133119 3300046680 Bacteria 1398
678 Ga0495646_0174413 3300046680 Bacteria 1183
679 Ga0495647_0002727 3300046681 Bacteria 5604
680 Ga0495647_0067947 3300046681 Bacteria 1421
681 Ga0495647_0086081 3300046681 Bacteria 1281
682 Ga0495658_0001202 3300046683 Bacteria 13609
683 Ga0495658_0015763 3300046683 Bacteria 3881
684 Ga0495658_0136138 3300046683 Bacteria 1499
685 Ga0495669_0060051 3300046684 Bacteria 1718
686 Ga0495613_0004460 3300046689 Bacteria 10490
687 Ga0495613_0020604 3300046689 Bacteria 4915
688 Ga0495613_0083933 3300046689 Bacteria 2313
689 Ga0495613_0257261 3300046689 Bacteria 1217
690 Ga0495613_0258492 3300046689 Bacteria 1214
691 Ga0495624_0003858 3300046690 Bacteria 11065
692 Ga0495624_0028691 3300046690 Bacteria 3634
693 Ga0495624_0165802 3300046690 Bacteria 1349
694 Ga0495670_0037188 3300046691 Bacteria 2426
695 Ga0495649_0109588 3300046694 Bacteria 1464
696 Ga0495649_0175401 3300046694 Bacteria 1120
697 Ga0495589_0205769 3300046794 Bacteria 928
698 Ga0495600_0003824 3300046809 Bacteria 8916
699 Ga0495600_0020355 3300046809 Bacteria 4244
700 Ga0495600_0035751 3300046809 Bacteria 3228
701 Ga0495600_0120632 3300046809 Bacteria 1705
702 Ga0495581_0000037 3300047315 Bacteria 47930
703 Ga0495581_0018828 3300047315 Bacteria 4008
704 Ga0495581_0192512 3300047315 Bacteria 1193
705 Ga0495581_0199305 3300047315 Bacteria 1171
706 Ga0495581_0224342 3300047315 Bacteria 1099
707 Ga0495604_0001856 3300047317 Bacteria 17220
708 Ga0495604_0022916 3300047317 Bacteria 4983
709 Ga0495604_0026598 3300047317 Bacteria 4605
710 Ga0495604_0070858 3300047317 Bacteria 2638
711 Ga0495604_0122740 3300047317 Bacteria 1878
712 Ga0495604_0229190 3300047317 Bacteria 1275
713 Ga0495636_0258528 3300047318 Bacteria 807
714 Ga0495674_0000499 3300047319 Bacteria 35905
715 Ga0495674_0027269 3300047319 Bacteria 5221
716 Ga0495674_0030306 3300047319 Bacteria 4920
717 Ga0495674_0043960 3300047319 Bacteria 3972
718 Ga0495674_0276791 3300047319 Bacteria 1376
719 Ga0495674_0391874 3300047319 Bacteria 1122
720 Ga0495674_0509043 3300047319 Bacteria 962
721 Ga0495674_0558003 3300047319 Bacteria 911
722 Ga0495674_0722034 3300047319 Bacteria 780
723 Ga0495672_0067260 3300047320 Bacteria 2041
724 Ga0495672_0160699 3300047320 Bacteria 1156
725 Ga0495676_0006149 3300047321 Bacteria 11051
726 Ga0495676_0036000 3300047321 Bacteria 4137
727 Ga0495676_0349632 3300047321 Bacteria 988
728 Ga0495680_0002074 3300047322 Bacteria 20875
729 Ga0495675_0027706 3300047444 Bacteria 3611
730 Ga0495675_0154367 3300047444 Bacteria 1416
731 Ga0495675_0304162 3300047444 Bacteria 946
732 Ga0495677_0091859 3300047445 Bacteria 1144
733 Ga0495673_0110256 3300047469 Bacteria 1101
734 Ga0495673_0148485 3300047469 Bacteria 908
735 Ga0495673_0176629 3300047469 Bacteria 811
736 Ga0495684_0131796 3300047471 Bacteria 1877
737 Ga0495684_0268800 3300047471 Bacteria 1234
738 Ga0495686_0157413 3300047472 Bacteria 1330
739 Ga0495593_0000788 3300047673 Bacteria 18351
740 Ga0495593_0005823 3300047673 Bacteria 7267
741 Ga0495593_0082798 3300047673 Bacteria 1658
742 Ga0495593_0267487 3300047673 Bacteria 855
743 Ga0495602_0018537 3300048088 Bacteria 6947
744 Ga0495602_0042386 3300048088 Bacteria 4147
745 Ga0495602_0044045 3300048088 Bacteria 4051
746 Ga0495602_0236781 3300048088 Bacteria 1368
747 Ga0495602_0247479 3300048088 Bacteria 1330
748 Ga0495614_0014379 3300048089 Bacteria 3464
749 Ga0495626_0065119 3300048091 Bacteria 1650
750 Ga0495626_0104791 3300048091 Bacteria 1230
751 Ga0496100_0058273 3300048903 Bacteria 2534
752 Ga0496100_0071204 3300048903 Bacteria 2321
753 Ga0496100_0239888 3300048903 Bacteria 1337
754 Ga0496101_0079676 3300048904 Bacteria 2418
755 Ga0496101_0102982 3300048904 Bacteria 2139
756 Ga0496101_0237673 3300048904 Bacteria 1417
757 Ga0496102_0088796 3300048905 Bacteria 2858
758 Ga0496102_0154650 3300048905 Bacteria 2156
759 Ga0496102_0187318 3300048905 Bacteria 1950
760 Ga0496102_0448636 3300048905 Bacteria 1210
761 Ga0496103_0024113 3300048906 Bacteria 3669
762 Ga0496104_0022050 3300048907 Bacteria 5853
763 Ga0496104_0034983 3300048907 Bacteria 4688
764 Ga0496104_0043610 3300048907 Bacteria 4212
765 Ga0496104_0049102 3300048907 Bacteria 3979
766 Ga0496104_0097805 3300048907 Bacteria 2809
767 Ga0496104_0888250 3300048907 Bacteria 796
768 Ga0496105_0006148 3300048908 Bacteria 9202
769 Ga0496105_0034179 3300048908 Bacteria 4180
770 Ga0496105_0326209 3300048908 Bacteria 1229
771 Ga0496105_0357026 3300048908 Bacteria 1166
772 Ga0496105_0434136 3300048908 Bacteria 1038
773 Ga0496106_0001884 3300048909 Bacteria 15715
774 Ga0496106_0001995 3300048909 Bacteria 15358
775 Ga0496106_0036279 3300048909 Bacteria 3688
776 Ga0496106_0326240 3300048909 Bacteria 1232
777 Ga0496106_0619527 3300048909 Bacteria 866
778 Ga0496107_0041285 3300048910 Bacteria 3312
779 Ga0496108_0000438 3300048911 Bacteria 33500
780 Ga0496108_0036057 3300048911 Bacteria 4113
781 Ga0496108_0196538 3300048911 Bacteria 1749
782 Ga0496108_0459384 3300048911 Bacteria 1112
783 Ga0496109_0000284 3300048912 Bacteria 48342
784 Ga0496109_0073751 3300048912 Bacteria 3136
785 Ga0496109_0085155 3300048912 Bacteria 2917
786 Ga0496109_0139679 3300048912 Bacteria 2265
787 Ga0496109_0187381 3300048912 Bacteria 1944
788 Ga0496110_0012769 3300048913 Bacteria 6917
789 Ga0496110_0052828 3300048913 Bacteria 3571
790 Ga0496110_0087441 3300048913 Bacteria 2783
791 Ga0496110_0271012 3300048913 Bacteria 1545
792 Ga0496110_0285616 3300048913 Bacteria 1503
793 Ga0496111_0015727 3300048914 Bacteria 5202
794 Ga0496111_0099475 3300048914 Bacteria 2136
795 Ga0496111_0128224 3300048914 Bacteria 1876
796 Ga0496111_0172517 3300048914 Bacteria 1607
797 Ga0496111_0182728 3300048914 Bacteria 1559
798 Ga0496112_0000585 3300048915 Bacteria 24994
799 Ga0496112_0003685 3300048915 Bacteria 12775
800 Ga0496112_0009940 3300048915 Bacteria 8606
801 Ga0496112_0050901 3300048915 Bacteria 4062
802 Ga0496112_0414428 3300048915 Bacteria 1286
803 Ga0496113_0009649 3300048916 Bacteria 6339
804 Ga0496113_0058926 3300048916 Bacteria 2891
805 Ga0496113_0156397 3300048916 Bacteria 1801
806 Ga0496113_0466026 3300048916 Bacteria 1015
807 Ga0496114_0090633 3300048917 Bacteria 2596
808 Ga0496114_0367529 3300048917 Bacteria 1273
809 Ga0496115_0043945 3300048918 Bacteria 3563
810 Ga0496115_0163683 3300048918 Bacteria 1839
811 Ga0496115_0300079 3300048918 Bacteria 1316
812 Ga0496115_0360716 3300048918 Bacteria 1184
813 Ga0496115_0368588 3300048918 Bacteria 1169
814 Ga0496115_0455807 3300048918 Bacteria 1032
815 Ga0496115_0678272 3300048918 Bacteria 812
816 Ga0496117_0119627 3300048920 Bacteria 1621
817 Ga0496117_0193458 3300048920 Bacteria 1156
818 Ga0496118_0001280 3300048921 Bacteria 38482
819 Ga0496119_0026620 3300048922 Bacteria 4004
820 Ga0496119_0125648 3300048922 Bacteria 1404
821 Ga0496119_0146044 3300048922 Bacteria 1272
822 Ga0496120_0112819 3300048923 Bacteria 1417
823 Ga0496120_0161348 3300048923 Bacteria 1117
824 Ga0496121_0000571 3300048924 Bacteria 69504
825 Ga0496121_0005094 3300048924 Bacteria 17131
826 Ga0496121_0162219 3300048924 Bacteria 1633
827 Ga0496121_0197790 3300048924 Bacteria 1435
828 Ga0496121_0207345 3300048924 Bacteria 1391
829 Ga0496121_0259223 3300048924 Bacteria 1201
830 Ga0496121_0344142 3300048924 Bacteria 995
831 Ga0496122_0041025 3300048925 Bacteria 3669
832 Ga0496123_0076834 3300048926 Bacteria 2054
833 Ga0496124_0000267 3300048927 Bacteria 101138
834 Ga0496124_0141241 3300048927 Bacteria 1900
835 Ga0496124_0231225 3300048927 Bacteria 1382
836 Ga0496124_0319932 3300048927 Bacteria 1111
837 Ga0496125_0023578 3300048928 Bacteria 5677
838 Ga0496125_0166823 3300048928 Bacteria 1486
839 Ga0496125_0208549 3300048928 Bacteria 1271
840 Ga0496125_0232111 3300048928 Bacteria 1179
841 Ga0496125_0305547 3300048928 Bacteria 972
842 Ga0496125_0335280 3300048928 Bacteria 910
843 Ga0496126_0011100 3300048929 Bacteria 9358
844 Ga0496126_0035506 3300048929 Bacteria 4672
845 Ga0496126_0053366 3300048929 Bacteria 3668
846 Ga0496126_0146145 3300048929 Bacteria 2030
847 Ga0496126_0338802 3300048929 Bacteria 1232
848 Ga0496126_0339323 3300048929 Bacteria 1231
849 Ga0496126_0390729 3300048929 Bacteria 1130
850 Ga0496126_0469114 3300048929 Bacteria 1010
851 Ga0496126_0497687 3300048929 Bacteria 974
852 Ga0495678_127136 3300049459 Bacteria 849
853 Ga0495682_0052951 3300049460 Bacteria 1474
854 Ga0495682_0088552 3300049460 Bacteria 1112
855 Ga0501031_0225085 3300049568 Bacteria 1221
856 Ga0501033_0271169 3300049570 Bacteria 1199
857 Ga0501038_0118653 3300049574 Bacteria 2184
858 Ga0501046_0388133 3300049580 Bacteria 1010
859 Ga0501067_0130057 3300049583 Bacteria 1401
860 Ga0501069_0105724 3300049585 Bacteria 1600
861 Ga0501235_039941 3300049669 Bacteria 1072
862 Ga0501035_0609955 3300049822 Bacteria 888
863 Ga0501044_0180305 3300049823 Bacteria 2079
864 Ga0501045_0381210 3300049824 Bacteria 1050
865 nmdc:mga03683_101784_c1 3300050489 Bacteria 1263
866 nmdc:mga03683_62848_c1 3300050489 Bacteria 1573
867 nmdc:mga03n38_63173_c1 3300050490 Bacteria 1691
868 nmdc:mga03n38_97892_c1 3300050490 Bacteria 1410
869 nmdc:mga00v17_92914_c1 3300050491 Bacteria 1897
870 nmdc:mga00v17_94525_c1 3300050491 Bacteria 1881
871 nmdc:mga0yw44_107334_c1 3300050492 Bacteria 1786
872 nmdc:mga0yw44_234840_c1 3300050492 Bacteria 1218
873 nmdc:mga0k408_56485_c1 3300050493 Bacteria 2278
874 nmdc:mga0k408_83657_c1 3300050493 Bacteria 1871
875 nmdc:mga0k408_9879_c1 3300050493 Bacteria 5151
876 nmdc:mga06z11_26288_c1 3300050494 Bacteria 2769
877 nmdc:mga04h51_40682_c1 3300050495 Bacteria 1516
878 nmdc:mga07m45_126835_c1 3300050496 Bacteria 1476
879 nmdc:mga07m45_138202_c1 3300050496 Bacteria 1411
880 nmdc:mga07m45_250872_c1 3300050496 Bacteria 1030
881 nmdc:mga05p37_435584_c1 3300050507 Bacteria 1522
882 nmdc:mga08y16_464550_c1 3300050511 Bacteria 1289
883 nmdc:mga0n895_275036_c1 3300050512 Bacteria 1708
884 nmdc:mga0n895_373552_c1 3300050512 Bacteria 1443
885 nmdc:mga0rr50_35332_c1 3300050513 Bacteria 3588
886 nmdc:mga0rr50_63344_c1 3300050513 Bacteria 2792
887 nmdc:mga08x19_125175_c1 3300050514 Bacteria 1725
888 nmdc:mga0sz30_8422_c1 3300050516 Bacteria 3895
889 nmdc:mga0sz30_99170_c1 3300050516 Bacteria 1272
890 Ga0495601_0103258 3300053077 Bacteria 1842
891 Ga0495601_0114538 3300053077 Bacteria 1748
892 Ga0495601_0121752 3300053077 Bacteria 1695
893 Ga0495601_0205867 3300053077 Bacteria 1285
894 Ga0495612_0046486 3300053078 Bacteria 1778
895 Ga0500610_0127560 3300053079 Bacteria 1297
896 Ga0500635_0127500 3300053080 Bacteria 957
897 Ga0495655_0015732 3300053083 Bacteria 1614
898 Ga0495595_0145446 3300053084 Bacteria 1164
899 Ga0495619_0001862 3300053085 Bacteria 14045
900 Ga0495619_0290710 3300053085 Bacteria 1132
901 Ga0495619_0298266 3300053085 Bacteria 1116
902 Ga0500643_000028 3300053087 Bacteria 245672
903 Ga0500647_0026988 3300053091 Bacteria 2712
904 Ga0500583_0022151 3300053092 Bacteria 2657
905 Ga0500651_0083146 3300053093 Bacteria 1981
906 Ga0500566_0040880 3300053094 Bacteria 2679
907 Ga0500641_0077438 3300053096 Bacteria 1407
908 Ga0500650_0058770 3300053098 Bacteria 1794
909 Ga0500555_002004 3300053103 Bacteria 6008
910 Ga0500556_0051487 3300053104 Bacteria 1492
911 Ga0500557_000150 3300053105 Bacteria 16181
912 Ga0500562_002759 3300053108 Bacteria 4367
913 Ga0500594_0035124 3300053118 Bacteria 1343
914 Ga0500594_0036116 3300053118 Bacteria 1328
915 Ga0500595_000141 3300053119 Bacteria 46988
916 Ga0500595_002912 3300053119 Bacteria 8189
917 Ga0500595_021236 3300053119 Bacteria 2321
918 Ga0500595_065032 3300053119 Bacteria 1092
919 Ga0500608_074760 3300053122 Bacteria 1607
920 Ga0500614_083245 3300053123 Bacteria 899
921 Ga0500642_0000319 3300053130 Bacteria 16783
922 Ga0500642_0014943 3300053130 Bacteria 2903
923 Ga0500652_140272 3300053131 Bacteria 1006
924 Ga0500655_027656 3300053133 Bacteria 1083
925 Ga0500655_028772 3300053133 Bacteria 1064
926 Ga0500559_0126507 3300053136 Bacteria 1191
927 Ga0500568_0012960 3300053139 Bacteria 3816
928 Ga0500573_0084912 3300053140 Bacteria 1795
929 Ga0500577_0007864 3300053142 Bacteria 3009
930 Ga0500590_076030 3300053148 Bacteria 1660
931 Ga0500590_167811 3300053148 Bacteria 969
932 Ga0500603_000092 3300053150 Bacteria 21528
933 Ga0500622_0028909 3300053156 Bacteria 2917
934 Ga0500638_003710 3300053162 Bacteria 5727
935 Ga0500636_0156489 3300053177 Bacteria 1247
936 Ga0500636_0183479 3300053177 Bacteria 1121
937 Ga0500636_0196750 3300053177 Bacteria 1069
938 Ga0500637_0000293 3300053178 Bacteria 18802
939 Ga0500637_0005216 3300053178 Bacteria 6268
940 Ga0500576_079677 3300053725 Bacteria 1387
941 Ga0500625_005839 3300053729 Bacteria 5186
942 Ga0500645_022324 3300053730 Bacteria 1948
943 Ga0500645_042085 3300053730 Bacteria 1348
944 Ga0500596_007900 3300053735 Bacteria 1718
945 Ga0500599_000638 3300053736 Bacteria 3740
946 Ga0500601_003226 3300053737 Bacteria 1767
947 Ga0500661_005735 3300055283 Bacteria 2313
948 2507504452 2507262055 Bacteria 8048963
949 2508694708 2508501042 Bacteria 8719808
950 2509146374 2508501128 Bacteria 8613869
951 2511396395 2511231028 Bacteria 8046582
952 2513624251 2513237092 Bacteria 8341956
953 2513638740 2513237094 Bacteria 8789602
954 2513649212 2513237095 Bacteria 8976980
955 2513656256 2513237096 Bacteria 8722461
956 2513673392 2513237098 Bacteria 9902361
957 2513694618 2513237101 Bacteria 7952346
958 2513706389 2513237102 Bacteria 7703324
959 2513716687 2513237104 Bacteria 10034502
960 2513858821 2513237137 Bacteria 9558895
961 2513874168 2513237139 Bacteria 8737671
962 2513917565 2513237145 Bacteria 8979722
963 2514010071 2513237161 Bacteria 8871253
964 2515624372 2515154112 Bacteria 8294334
965 2517103071 2517093001 Bacteria 9002274
966 2517887772 2517572143 Bacteria 9484767
967 2524438905 2524023205 Bacteria 8918781
968 2524535441 2524023228 Bacteria 10118060
969 2617350290 2617270735 Bacteria 9163226
970 2617374377 2617270741 Bacteria 8201522
971 2723842429 2721755755 Bacteria 8322773
972 2728751820 2728368998 Bacteria 8720350
973 2745081959 2744054633 Bacteria 8678936
974 2793070512 2791355197 Bacteria 8420563
975 2793078729
976 2805920886 2802429603 Bacteria 8777136
977 2818240599 2816332527 Bacteria 8933356
978 2824604705 2824600985 Bacteria 8488197
979 2824615376 2824609381 Bacteria 8672835
980 2824618833 2824617872 Bacteria 8814715
981 2824628939 2824626560 Bacteria 8813858
982 2824639232 2824635225 Bacteria 8785348
983 2824650136 2824644064 Bacteria 8743947
984 2824657999 2824653114 Bacteria 8493680
985 2824675079 2824671348 Bacteria 8369588
986 2824687058 2824679649 Bacteria 8248951
987 2824695101 2824687955 Bacteria 8360029
988 2824699355 2824696289 Bacteria 8335049
989 2824712863 2824704595 Bacteria 9667483
990 2824717517 2824714736 Bacteria 8717648
991 2824726791 2824723954 Bacteria 8758240
992 2824739136 2824732956 Bacteria 7810675
993 2824751009 2824746037 Bacteria 7911610
994 2824759662 2824753945 Bacteria 9787441
995 2824769957 2824763712 Bacteria 9792355
996 2824780294 2824773399 Bacteria 8360218
997 2838126020 2838122688 Bacteria 8803140
998 2841942586 2841941048 Bacteria 8688029
999 2841953064 2841949485 Bacteria 8680857
1000 2841963917 2841957949 Bacteria 8652217
1001 2841970911 2841966195 Bacteria 8673214
1002 2841977829 2841974524 Bacteria 8931498
1003 2841984607 2841983080 Bacteria 8395090
1004 2842041669 2842038055 Bacteria 8002051
1005 2842049711 2842045827 Bacteria 8006841
1006 2844321441 2844315083 Bacteria 8138177
1007 2847931958 2847930680 Bacteria 9342022
1008 2847943204 2847939898 Bacteria 8606328
1009 2849076936 2849076700 Bacteria 7039503
1010 2857514795 2857509624 Bacteria 7472071
1011 2874595599 2874590934 Bacteria 8299676
1012 2874606883 2874604998 Bacteria 7834745
1013 2874620397 2874612657 Bacteria 8252029
1014 2874621889 2874620515 Bacteria 8290088
1015 2874629626 2874628541 Bacteria 8630250
1016 2874651767 2874645413 Bacteria 8214782
1017 2876769240 2876761206 Bacteria 10111113
1018 2876775794 2876771140 Bacteria 8287509
1019 2876812947 2876808645 Bacteria 8824342
1020 2876821663 2876818435 Bacteria 8274608
1021 2879079885 2879074833 Bacteria 8279565
1022 2879091132 2879083081 Bacteria 8587928
1023 2879112334 2879110137 Bacteria 8907982
1024 2879133969 2879127579 Bacteria 8294491
1025 2879148454 2879142872 Bacteria 8267021
1026 2881364611 2881364244 Bacteria 7710352
1027 2885374376 2885366525 Bacteria 8326213
1028 2885379412 2885374607 Bacteria 8927485
1029 2885390342 2885383462 Bacteria 9473874
1030 2888387278 2888378607 Bacteria 9652610
1031 2888391423 2888388044 Bacteria 7304136
1032 2888426960 2888419890 Bacteria 7857137
1033 2889034348 2889033259 Bacteria 9099371
1034 2903727980 2903727486 Bacteria 8281579
1035 2903755515 2903748898 Bacteria 9972761
1036 2903775866 2903768456 Bacteria 9749579
1037 2904669518 2904666416 Bacteria 8226587
1038 2904691914 2904690495 Bacteria 9412302
1039 2904709965
1040 2904713667 2904711408 Bacteria 9771557
1041 2906602536 2906602504 Bacteria 8295279
1042 2906612797
1043 2906629175 2906626472 Bacteria 8826946
1044 2906636718 2906635258 Bacteria 8601019
1045 2906663164 2906660503 Bacteria 8595048
1046 2908745978 2908739725 Bacteria 8628932
1047 2908764019 2908756301 Bacteria 8864324
1048 2908776858 2908775508 Bacteria 8092255
1049 2922364869 2922361189 Bacteria 7436256
1050 2922391671 2922386360 Bacteria 7017218
1051 2922398877 2922393267 Bacteria 8285685
1052 2922433258
1053 2932800679 2932794094 Bacteria 7915132
1054 2932808410 2932801729 Bacteria 7987968
1055 2935613145 2935608549 Bacteria 8203142
1056 2935630545 2935630451 Bacteria 8169952
1057 2935654100 2935648319 Bacteria 8801166
1058 2935662798 2935656913 Bacteria 8965014
1059 2935774834 2935769743 Bacteria 7878163
1060 2935779980 2935777560 Bacteria 8077691
1061 2935792966 2935785616 Bacteria 7962367
1062 2935798582 2935793552 Bacteria 8012592
1063 2935825003 2935819856 Bacteria 8261050
1064 2935852222 2935847175 Bacteria 8228321
1065 2935883517 2935883170 Bacteria 7964738
1066 2935910656 2935908558 Bacteria 8568796
1067 2935921836 2935916978 Bacteria 9113783
1068 2935930025 2935926038 Bacteria 8601059
1069 2935937693 2935934488 Bacteria 8602579
1070 2935949797 2935942939 Bacteria 8599779
1071 2935956893 2935951376 Bacteria 8602333
1072 2935965352 2935959822 Bacteria 7869783
1073 2935970850 2935967501 Bacteria 8603075
1074 2935980169 2935975950 Bacteria 8347125
1075 2935984337 2935984226 Bacteria 8302647
1076 2936017005 2936011229 Bacteria 8801034
1077 2936025587 2936019824 Bacteria 8804134
1078 2936034429 2936028420 Bacteria 8965941
1079 2936052537 2936046547 Bacteria 8903709
1080 2936055417 2936055302 Bacteria 8785755
1081 2941507197 2941507105 Bacteria 8166816
1082 2941520333 2941515067 Bacteria 8166720
1083 2941523668 2941523033 Bacteria 8169134
1084 2941532019 2941531003 Bacteria 7653939
1085 3005482858 3005474847 Bacteria 9259049
1086 3005490850 3005483717 Bacteria 7877331
1087 3005506557 3005506211 Bacteria 6943378
1088 3005717540 3005710791 Bacteria 7622528
1089 3005724484 3005718088 Bacteria 8283608
1090 8006926745 8006926726 Bacteria 6749210
1091 8006935172 8006933436 Bacteria 10410654
1092 8006965308 8006964411 Bacteria 8966052
1093 8006975141 8006973647 Bacteria 10679141
1094 8006992147 8006984368 Bacteria 9651211
1095 8006995458 8006994254 Bacteria 8309700
1096 8016525230 8016522445 Bacteria 8156687
1097 8016543095 8016539877 Bacteria 8155419
1098 8016550193 8016548790 Bacteria 8155074
1099 8016558600 8016557553 Bacteria 8154380
1100 8016568504 8016566248 Bacteria 8158151
1101 8016581154 8016575299 Bacteria 8154085
1102 8016587554 8016583857 Bacteria 10421953
1103 8016607450 8016603502 Bacteria 8731218
1104 8016630343 8016622563 Bacteria 7999408
1105 8016636797 8016630954 Bacteria 9217207
1106 8019538478 8019530166 Bacteria 8155624
1107 8019541341 8019538911 Bacteria 7872763
1108 8019549286 8019547302 Bacteria 7996444
1109 8019563534 8019555841 Bacteria 9642137
1110 8019573608 8019565922 Bacteria 9639779
1111 8019623764 8019619141 Bacteria 9218857
1112 8019638275 8019629233 Bacteria 8687553
1113 8019641365 8019638758 Bacteria 9062356
1114 8019666191 8019659431 Bacteria 8577854
1115 8019675701 8019668869 Bacteria 8791617
1116 8019680400 8019678201 Bacteria 8863603
1117 8056679031 8056673599 Bacteria 7871253
1118 8056681713 8056681323 Bacteria 8472857
1119 8056692879 8056689827 Bacteria 6712655
1120 Ga0070714_100010904
1121 LJQas_1005275
1122 JGI24739J22299_10066317
1123 JGI24742J22300_10019112
1124 JGI25406J46586_10002664
1125 JGI25165J46597_1004162
1126 JGI25153J46596_10003773
1127 JGI25153J46596_10012875
1128 JGI25153J46596_10012878
1129 JGI25153J46596_10040141
1130 JGI25160J50197_1002453
1131 JGI25160J50197_1007063
1132 JGI25160J50197_1029015
1133 JGI25404J52841_10023877
1134 Ga0055526_1025587
1135 Ga0055526_1036448
1136 Ga0055531_10022052
1137 Ga0065165_1000370
1138 Ga0065165_1020076
1139 Ga0065165_1033428
1140 Ga0070658_10388586
1141 Ga0070676_10326877
1142 Ga0070683_100047208
1143 Ga0070683_100361940
1144 Ga0070690_100029664
1145 Ga0068869_100048883
1146 Ga0070680_100022477
1147 Ga0070680_100085474
1148 Ga0070680_100106831
1149 Ga0070680_100388993
1150 Ga0070682_100060860
1151 Ga0068868_100419393
1152 Ga0070660_100076421
1153 Ga0070660_100162547
1154 Ga0070689_100162505
1155 Ga0070689_100497687
1156 Ga0070668_100055997
1157 Ga0070668_100564809
1158 Ga0070669_100177265
1159 Ga0070669_100451495
1160 Ga0070675_100525976
1161 Ga0070671_100054653
1162 Ga0070671_100083780
1163 Ga0070671_100284059
1164 Ga0070674_100047262
1165 Ga0070674_100629873
1166 Ga0070659_100576381
1167 Ga0070667_100407242
1168 Ga0070667_100494704
1169 Ga0070709_10009497
1170 Ga0070709_10035366
1171 Ga0070714_100065958
1172 Ga0070714_100071509
1173 Ga0070714_100335605
1174 Ga0070713_100073819
1175 Ga0070713_100153901
1176 Ga0070710_10002662
1177 Ga0070710_10005145
1178 Ga0070710_10566174
1179 Ga0070711_100007717
1180 Ga0070711_100065325
1181 Ga0070711_100131461
1182 Ga0070711_100399242
1183 Ga0070711_100556928
1184 Ga0070694_100472321
1185 Ga0070663_100032843
1186 Ga0070663_100045790
1187 Ga0070663_100221250
1188 Ga0070663_100232099
1189 Ga0070678_100077627
1190 Ga0070678_100110089
1191 Ga0070678_100818795
1192 Ga0070662_100102813
1193 Ga0070662_100280423
1194 Ga0070662_100612432
1195 Ga0070681_10006981
1196 Ga0070681_10133159
1197 Ga0070681_10416394
1198 Ga0068867_100032215
1199 Ga0068867_100620064
1200 Ga0068867_100903324
1201 Ga0070685_10155086
1202 Ga0070685_10359585
1203 Ga0070707_100030468
1204 Ga0070679_100015866
1205 Ga0070679_100021860
1206 Ga0070679_100101450
1207 Ga0070679_100569265
1208 Ga0070684_100012882
1209 Ga0070684_100024614
1210 Ga0070684_100214974
1211 Ga0070697_100111993
1212 Ga0070697_100496426
1213 Ga0068853_100006064
1214 Ga0068853_100157206
1215 Ga0068853_100171361
1216 Ga0068853_100334629
1217 Ga0068853_100930454
1218 Ga0070696_100232461
1219 Ga0070665_100122399
1220 Ga0070665_100133169
1221 Ga0070665_100145702
1222 Ga0070665_100414544
1223 Ga0070704_100266789
1224 Ga0068855_100036277
1225 Ga0068855_100051465
1226 Ga0068855_100067274
1227 Ga0068855_100196626
1228 Ga0068855_100305096
1229 Ga0068855_100668708
1230 Ga0070664_100097548
1231 Ga0070664_100381999
1232 Ga0070664_100495603
1233 Ga0070664_100754298
1234 Ga0068857_100248718
1235 Ga0068857_100422028
1236 Ga0068854_100050162
1237 Ga0068854_100120969
1238 Ga0068854_100204649
1239 Ga0068854_100649458
1240 Ga0068856_100000226
1241 Ga0068856_100083698
1242 Ga0068856_100127315
1243 Ga0068856_100910966
1244 Ga0068856_101030508
1245 Ga0070702_100039695
1246 Ga0070702_100210953
1247 Ga0068852_100029813
1248 Ga0068852_100155718
1249 Ga0068852_100212344
1250 Ga0068852_100270359
1251 Ga0068852_100421421
1252 Ga0068861_100082377
1253 Ga0068861_100454470
1254 Ga0068863_100088948
1255 Ga0068863_100236108
1256 Ga0068863_100905383
1257 Ga0068858_100062622
1258 Ga0068858_100216885
1259 Ga0068858_100390035
1260 Ga0068858_100976170
1261 Ga0068860_100000338
1262 Ga0068860_100081165
1263 Ga0068862_100138674
1264 Ga0068862_100145088
1265 Ga0068862_100150469
1266 Ga0081455_10006681
1267 Ga0081455_10010124
1268 Ga0081455_10039057
1269 Ga0081455_10086338
1270 Ga0081538_10096160
1271 Ga0081540_1001719
1272 Ga0081540_1007729
1273 Ga0081540_1007924
1274 Ga0081540_1016537
1275 Ga0081540_1016811
1276 Ga0081540_1025457
1277 Ga0081539_10003400
1278 Ga0081539_10145483
1279 Ga0070717_10000881
1280 Ga0070717_10012781
1281 Ga0075365_10106251
1282 Ga0075365_10106909
1283 Ga0075365_10274789
1284 Ga0075368_10013721
1285 Ga0075368_10054498
1286 Ga0075364_10079328
1287 Ga0075364_10143630
1288 Ga0070715_10000142
1289 Ga0070715_10025119
1290 Ga0070715_10083510
1291 Ga0070716_100011221
1292 Ga0070716_100288712
1293 Ga0070712_100008524
1294 Ga0070712_100057376
1295 Ga0070712_100088144
1296 Ga0075362_10020552
1297 Ga0075362_10064514
1298 Ga0075367_10072597
1299 Ga0075367_10101615
1300 Ga0075367_10125084
1301 Ga0075367_10171980
1302 Ga0075369_10065699
1303 Ga0075369_10160506
1304 Ga0075366_10039102
1305 Ga0075366_10137241
1306 Ga0075366_10175353
1307 Ga0097621_100682248
1308 Ga0075370_10007642
1309 Ga0075370_10045190
1310 Ga0075370_10227837
1311 Ga0068871_100234210
1312 Ga0075428_100313699
1313 Ga0075434_100091190
1314 Ga0075434_100778047
1315 Ga0068865_100351977
1316 Ga0075436_100469419
1317 Ga0099825_1040475
1318 Ga0099824_1003918
1319 Ga0099824_1014440
1320 Ga0099822_1001088
1321 Ga0075435_100072595
1322 Ga0075435_100211288
1323 Ga0099794_10012330
1324 Ga0099795_10015844
1325 Ga0099795_10114253
1326 Ga0105244_10151055
1327 Ga0105250_10081818
1328 Ga0105240_10011631
1329 Ga0105240_10107940
1330 Ga0105240_10119154
1331 Ga0105240_10235517
1332 Ga0111539_10098137
1333 Ga0105245_10347772
1334 Ga0105245_10537913
1335 Ga0105247_10386298
1336 Ga0114129_10184276
1337 Ga0105243_10704614
1338 Ga0105241_10089499
1339 Ga0105241_10106447
1340 Ga0105241_10108204
1341 Ga0105241_10212606
1342 Ga0105241_10246418
1343 Ga0105241_10410482
1344 Ga0105241_10523286
1345 Ga0105242_10766860
1346 Ga0105248_10033744
1347 Ga0105248_10198655
1348 Ga0105248_10525556
1349 Ga0105237_10028867
1350 Ga0105237_10085738
1351 Ga0105237_10129523
1352 Ga0105237_10503354
1353 Ga0105238_10004512
1354 Ga0105238_10325855
1355 Ga0105238_10715344
1356 Ga0105249_10574889
1357 Ga0105249_10715616
1358 Ga0105249_11269842
1359 Ga0105239_10069619
1360 Ga0105239_10246611
1361 Ga0105239_10272260
1362 Ga0105239_10278093
1363 Ga0105239_10283113
1364 Ga0105239_10598302
1365 Ga0105239_10774240
1366 Ga0105246_10119566
1367 Ga0105246_10168932
1368 Ga0105246_10338814
1369 Ga0157373_10032979
1370 Ga0157370_10138556
1371 Ga0157369_10189265
1372 Ga0157369_10202616
1373 Ga0157369_10415885
1374 Ga0157378_10181370
1375 Ga0157378_10242434
1376 Ga0163162_10658394
1377 Ga0163162_10802990
1378 Ga0157372_10131460
1379 Ga0157375_10470738
1380 Ga0163163_10157670
1381 Ga0163163_10157929
1382 Ga0163163_10210261
1383 Ga0157380_10828385
1384 Ga0157379_10125455
1385 Ga0157376_10360365
1386 Ga0157376_10446801
1387 Ga0163161_10273386
1388 Ga0163161_10559423
1389 Ga0214544_1000003
1390 Ga0214542_1000003
1391 Ga0214545_1000004
1392 Ga0214543_1000007
1393 Ga0213876_10001789
1394 Ga0209563_100565
1395 Ga0207425_1003823
1396 Ga0209677_100794
1397 Ga0209677_107068
1398 Ga0209148_1008864
1399 Ga0209233_1000798
1400 Ga0209233_1008827
1401 Ga0209455_1003650
1402 Ga0209564_1011290
1403 Ga0209564_1013080
1404 Ga0209758_1000030
1405 Ga0209758_1000277
1406 Ga0209758_1004322
1407 Ga0209758_1005254
1408 Ga0209758_1008633
1409 Ga0209256_1004360
1410 Ga0207426_1000271
1411 Ga0207426_1016608
1412 Ga0209257_1003520
1413 Ga0207697_10274856
1414 Ga0207656_10001723
1415 Ga0207692_10004179
1416 Ga0207692_10080277
1417 Ga0207688_10063508
1418 Ga0207680_10130339
1419 Ga0207647_10112176
1420 Ga0207699_10000443
1421 Ga0207699_10116447
1422 Ga0207645_10023630
1423 Ga0207645_10064183
1424 Ga0207684_10479518
1425 Ga0207684_10669091
1426 Ga0207654_10020998
1427 Ga0207654_10033507
1428 Ga0207654_10365306
1429 Ga0207707_10002133
1430 Ga0207707_10010412
1431 Ga0207695_10000059
1432 Ga0207695_10063408
1433 Ga0207695_10303448
1434 Ga0207695_10666390
1435 Ga0207671_10010861
1436 Ga0207671_10184011
1437 Ga0207671_10356181
1438 Ga0207693_10025285
1439 Ga0207693_10061331
1440 Ga0207693_10217157
1441 Ga0207663_10000159
1442 Ga0207663_10008306
1443 Ga0207663_10276585
1444 Ga0207660_10062522
1445 Ga0207660_10087813
1446 Ga0207660_10087915
1447 Ga0207660_10115066
1448 Ga0207657_10177745
1449 Ga0207657_10451988
1450 Ga0207652_10007627
1451 Ga0207652_10010602
1452 Ga0207652_10368050
1453 Ga0207646_10245834
1454 Ga0207681_10241534
1455 Ga0207694_10003079
1456 Ga0207694_10221119
1457 Ga0207650_10172442
1458 Ga0207659_10159014
1459 Ga0207687_10096342
1460 Ga0207700_10001897
1461 Ga0207700_10078655
1462 Ga0207700_10097767
1463 Ga0207700_10633421
1464 Ga0207664_10048445
1465 Ga0207664_10368882
1466 Ga0207664_10437037
1467 Ga0207644_10044865
1468 Ga0207644_10401547
1469 Ga0207690_10018691
1470 Ga0207706_10082235
1471 Ga0207706_10121400
1472 Ga0207686_10062058
1473 Ga0207709_10057873
1474 Ga0207709_10362204
1475 Ga0207704_10087993
1476 Ga0207704_10118038
1477 Ga0207665_10001544
1478 Ga0207665_10698510
1479 Ga0207691_10308714
1480 Ga0207691_10381056
1481 Ga0207689_10030539
1482 Ga0207679_10429628
1483 Ga0207679_10445009
1484 Ga0207679_10864169
1485 Ga0207679_10968016
1486 Ga0207667_10017617
1487 Ga0207667_10069227
1488 Ga0207667_10289439
1489 Ga0207667_10543069
1490 Ga0207651_10812878
1491 Ga0207712_10111476
1492 Ga0207668_10110750
1493 Ga0207668_10114119
1494 Ga0207668_10179991
1495 Ga0207640_10043499
1496 Ga0207640_10565755
1497 Ga0207640_10600161
1498 Ga0207658_10536757
1499 Ga0207677_10153115
1500 Ga0207677_10292173
1501 Ga0207703_10332981
1502 Ga0207703_10366962
1503 Ga0207639_10002960
1504 Ga0207639_10562892
1505 Ga0207639_11141086
1506 Ga0207678_10031971
1507 Ga0207678_10118720
1508 Ga0207678_10160170
1509 Ga0207702_10000191
1510 Ga0207702_10166453
1511 Ga0207702_10189338
1512 Ga0207641_10323159
1513 Ga0207641_10436922
1514 Ga0207648_10126331
1515 Ga0207648_10334755
1516 Ga0207648_10674781
1517 Ga0207648_10859337
1518 Ga0207676_11175369
1519 Ga0207674_10214579
1520 Ga0207674_10387981
1521 Ga0207675_100107645
1522 Ga0207675_100154382
1523 Ga0207683_10024682
1524 Ga0207683_10095034
1525 Ga0207683_10140247
1526 Ga0207698_10020684
1527 Ga0207698_10795870
1528 Ga0207698_11015620
1529 Ga0209389_1000193
1530 Ga0209389_1000207
1531 Ga0209589_1000024
1532 Ga0209589_1000025
1533 Ga0209489_100039
1534 Ga0209489_101741
1535 Ga0209489_101963
1536 Ga0209700_100043
1537 Ga0209700_100420
1538 Ga0209179_1027877
1539 Ga0209588_1005363
1540 Ga0209813_10017710
1541 Ga0268266_10093564
1542 Ga0268266_10102702
1543 Ga0268266_10182723
1544 Ga0268266_10402505
1545 Ga0268266_10498429
1546 Ga0268265_10233756
1547 Ga0268265_10340670
1548 Ga0268264_10000051
1549 Ga0265334_10061058
1550 Ga0265323_10014930
1551 Ga0265336_10001054
1552 Ga0307517_10002349
1553 Ga0307517_10164980
1554 Ga0265338_10000231
1555 Ga0307511_10068005
1556 Ga0307512_10152234
1557 Ga0265330_10019295
1558 Ga0265330_10057988
1559 Ga0265332_10018917
1560 Ga0265325_10031254
1561 Ga0265340_10007086
1562 Ga0265340_10054320
1563 Ga0265339_10019205
1564 Ga0265339_10286563
1565 Ga0307509_10034268
1566 Ga0307509_10050156
1567 Ga0307408_100073647
1568 Ga0307508_10000152
1569 Ga0307508_10032270
1570 Ga0307508_10090477
1571 Ga0265314_10013479
1572 Ga0265314_10093163
1573 Ga0265314_10189273
1574 Ga0265342_10009530
1575 Ga0265342_10047587
1576 Ga0307516_10010117
1577 Ga0307516_10039301
1578 Ga0307516_10186455
1579 Ga0307516_10329537
1580 Ga0307406_10364465
1581 Ga0307409_100870847
1582 Ga0307415_100151732
1583 Ga0307507_10035688
1584 Ga0307510_10054282
1585 Ga0307510_10070832
1586 Ga0307510_10078249
1587 Ga0307510_10153880
1588 Ga0315911_1000023
1589 Ga0373926_0105476
1590 Ga0373934_0009884
1591 Ga0373923_0004103
1592 Ga0373923_0029194
1593 Ga0373936_0001144
1594 Ga0373936_0009733
1595 Ga0373941_0023970
1596 Ga0373953_0010020
1597 Ga0373953_0051304
1598 Ga0373954_0066410
1599 Ga0373956_0003314
1600 Ga0373957_0004032
1601 Ga0373957_0038732
1602 Ga0373943_0009607
1603 Ga0373943_0074774
1604 Ga0373946_0046411
1605 Ga0373955_0002545
1606 Ga0373924_0005363
1607 Ga0373924_0016407
1608 Ga0373931_0003381
1609 Ga0373931_0091706
1610 Ga0373935_0001102
1611 Ga0373935_0206236
1612 Ga0373935_0214787
1613 Ga0373927_0003159
1614 Ga0373927_0033149
1615 Ga0373927_0042821
1616 Ga0373927_0050595
1617 Ga0373927_0105363
1618 Ga0373927_0510350
1619 Ga0373933_0004241
1620 Ga0373933_0077836
1621 Ga0373933_0127932
1622 Ga0373933_0315799
1623 Ga0373947_0000480
1624 Ga0373947_0055651
1625 Ga0373937_0020950
1626 Ga0373937_0020992
1627 Ga0372808_001922
1628 Ga0373925_0039387
1629 Ga0373925_0094759
1630 Ga0373925_0129665
1631 Ga0395899_0066257
1632 Ga0395900_0001144
1633 Ga0395898_0047649
1634 Ga0395898_0334455
1635 Ga0395905_0001838
1636 Ga0395905_0046769
1637 Ga0395905_0086526
1638 Ga0395905_0308829
1639 Ga0436364_0363089
1640 Ga0436364_0417484
1641 Ga0395901_0168028
1642 Ga0395901_0777838
1643 Ga0436365_0995966
1644 Ga0436365_1476582
1645 Ga0436360_1215019
1646 Ga0436361_0838028
1647 Ga0436363_0991272
1648 Ga0439465_0175373
1649 Ga0451793_0560032
1650 Ga0466969_0068293
1651 Ga0466969_0115510
1652 Ga0466972_0011985
1653 Ga0466965_0045343
1654 Ga0466965_0095547
1655 Ga0466966_0000857
1656 Ga0466966_0311368
1657 Ga0466961_0000065
1658 Ga0466963_0157118
1659 Ga0466964_0287591
1660 Ga0466968_0016525
1661 Ga0466957_0161540
1662 Ga0466960_0143522
1663 Ga0466959_0041579
1664 Ga0466958_0168914
1665 Ga0466967_0007710
1666 Ga0495617_080534
1667 Ga0495592_0097532
1668 Ga0495603_0001026
1669 Ga0495603_0013790
1670 Ga0495603_0046069
1671 Ga0495603_0200741
1672 Ga0495603_0201046
1673 Ga0495629_0000074
1674 Ga0495629_0000905
1675 Ga0495629_0002614
1676 Ga0495629_0057240
1677 Ga0495629_0109713
1678 Ga0495638_0006758
1679 Ga0495638_0119062
1680 Ga0495638_0140693
1681 Ga0495638_0280157
1682 Ga0495641_0005311
1683 Ga0495641_0279045
1684 Ga0495651_0061319
1685 Ga0495651_0120911
1686 Ga0495651_0200110
1687 Ga0495651_0304696
1688 Ga0495653_0006522
1689 Ga0495653_0010020
1690 Ga0495653_0047464
1691 Ga0495653_0114341
1692 Ga0495653_0436461
1693 Ga0495580_0006217
1694 Ga0495580_0067938
1695 Ga0495580_0179183
1696 Ga0495582_0000059
1697 Ga0495582_0059797
1698 Ga0495582_0169114
1699 Ga0495639_0023249
1700 Ga0495662_0000353
1701 Ga0495664_0034197
1702 Ga0495664_0037868
1703 Ga0495664_0141977
1704 Ga0495584_0274368
1705 Ga0495594_0000739
1706 Ga0495607_0226349
1707 Ga0495583_0169620
1708 Ga0495606_0017354
1709 Ga0495606_0025094
1710 Ga0495608_0011764
1711 Ga0495608_0011932
1712 Ga0495608_0125196
1713 Ga0495608_0138708
1714 Ga0495610_0147295
1715 Ga0495616_0120553
1716 Ga0495616_0205229
1717 Ga0495618_0141527
1718 Ga0495618_0142416
1719 Ga0495618_0150758
1720 Ga0495618_0185740
1721 Ga0495618_0271076
1722 Ga0495620_0069204
1723 Ga0495628_0021621
1724 Ga0495628_0049172
1725 Ga0495628_0327571
1726 Ga0495631_0255910
1727 Ga0495632_0186415
1728 Ga0495637_0096630
1729 Ga0495643_0010684
1730 Ga0495644_0057463
1731 Ga0495648_0001072
1732 Ga0495648_0072355
1733 Ga0495648_0115674
1734 Ga0495648_0163111
1735 Ga0495648_0191501
1736 Ga0495666_0036199
1737 Ga0495652_0009450
1738 Ga0495652_0015406
1739 Ga0495652_0029538
1740 Ga0495652_0050712
1741 Ga0495652_0149844
1742 Ga0495652_0370470
1743 Ga0495652_0428609
1744 Ga0495665_0007726
1745 Ga0495665_0078110
1746 Ga0495640_0003997
1747 Ga0495640_0005556
1748 Ga0495640_0018677
1749 Ga0495640_0423728
1750 Ga0495586_0106725
1751 Ga0495587_0010964
1752 Ga0495587_0035730
1753 Ga0495598_0004861
1754 Ga0495597_0046921
1755 Ga0495645_0025866
1756 Ga0495645_0056454
1757 Ga0495645_0137848
1758 Ga0495645_0183083
1759 Ga0495645_0462257
1760 Ga0495645_0519075
1761 Ga0495622_0008469
1762 Ga0495622_0010239
1763 Ga0495633_0073695
1764 Ga0495667_0011440
1765 Ga0495667_0013790
1766 Ga0495667_0176464
1767 Ga0495656_0018155
1768 Ga0495668_0085926
1769 Ga0495634_0001138
1770 Ga0495634_0119611
1771 Ga0495634_0182402
1772 Ga0495611_0221977
1773 Ga0495625_0189269
1774 Ga0495625_0471368
1775 Ga0495635_0000177
1776 Ga0495635_0001821
1777 Ga0495635_0006294
1778 Ga0495635_0090798
1779 Ga0495635_0408421
1780 Ga0495659_0009925
1781 Ga0495588_0000651
1782 Ga0495588_0017658
1783 Ga0495588_0116156
1784 Ga0495588_0192970
1785 Ga0495657_0004358
1786 Ga0495657_0026309
1787 Ga0495657_0160150
1788 Ga0495657_0181727
1789 Ga0495599_0001858
1790 Ga0495599_0010912
1791 Ga0495599_0157201
1792 Ga0495599_0224561
1793 Ga0495623_0009276
1794 Ga0495646_0035715
1795 Ga0495646_0095015
1796 Ga0495646_0133119
1797 Ga0495646_0174413
1798 Ga0495647_0002727
1799 Ga0495647_0067947
1800 Ga0495647_0086081
1801 Ga0495658_0001202
1802 Ga0495658_0015763
1803 Ga0495658_0136138
1804 Ga0495669_0060051
1805 Ga0495613_0004460
1806 Ga0495613_0020604
1807 Ga0495613_0083933
1808 Ga0495613_0257261
1809 Ga0495613_0258492
1810 Ga0495624_0003858
1811 Ga0495624_0028691
1812 Ga0495624_0165802
1813 Ga0495670_0037188
1814 Ga0495649_0109588
1815 Ga0495649_0175401
1816 Ga0495589_0205769
1817 Ga0495600_0003824
1818 Ga0495600_0020355
1819 Ga0495600_0035751
1820 Ga0495600_0120632
1821 Ga0495581_0000037
1822 Ga0495581_0018828
1823 Ga0495581_0192512
1824 Ga0495581_0199305
1825 Ga0495581_0224342
1826 Ga0495604_0001856
1827 Ga0495604_0022916
1828 Ga0495604_0026598
1829 Ga0495604_0070858
1830 Ga0495604_0122740
1831 Ga0495604_0229190
1832 Ga0495636_0258528
1833 Ga0495674_0000499
1834 Ga0495674_0027269
1835 Ga0495674_0030306
1836 Ga0495674_0043960
1837 Ga0495674_0276791
1838 Ga0495674_0391874
1839 Ga0495674_0509043
1840 Ga0495674_0558003
1841 Ga0495674_0722034
1842 Ga0495672_0067260
1843 Ga0495672_0160699
1844 Ga0495676_0006149
1845 Ga0495676_0036000
1846 Ga0495676_0349632
1847 Ga0495680_0002074
1848 Ga0495675_0027706
1849 Ga0495675_0154367
1850 Ga0495675_0304162
1851 Ga0495677_0091859
1852 Ga0495673_0110256
1853 Ga0495673_0148485
1854 Ga0495673_0176629
1855 Ga0495684_0131796
1856 Ga0495684_0268800
1857 Ga0495686_0157413
1858 Ga0495593_0000788
1859 Ga0495593_0005823
1860 Ga0495593_0082798
1861 Ga0495593_0267487
1862 Ga0495602_0018537
1863 Ga0495602_0042386
1864 Ga0495602_0044045
1865 Ga0495602_0236781
1866 Ga0495602_0247479
1867 Ga0495614_0014379
1868 Ga0495626_0065119
1869 Ga0495626_0104791
1870 Ga0496100_0058273
1871 Ga0496100_0071204
1872 Ga0496100_0239888
1873 Ga0496101_0079676
1874 Ga0496101_0102982
1875 Ga0496101_0237673
1876 Ga0496102_0088796
1877 Ga0496102_0154650
1878 Ga0496102_0187318
1879 Ga0496102_0448636
1880 Ga0496103_0024113
1881 Ga0496104_0022050
1882 Ga0496104_0034983
1883 Ga0496104_0043610
1884 Ga0496104_0049102
1885 Ga0496104_0097805
1886 Ga0496104_0888250
1887 Ga0496105_0006148
1888 Ga0496105_0034179
1889 Ga0496105_0326209
1890 Ga0496105_0357026
1891 Ga0496105_0434136
1892 Ga0496106_0001884
1893 Ga0496106_0001995
1894 Ga0496106_0036279
1895 Ga0496106_0326240
1896 Ga0496106_0619527
1897 Ga0496107_0041285
1898 Ga0496108_0000438
1899 Ga0496108_0036057
1900 Ga0496108_0196538
1901 Ga0496108_0459384
1902 Ga0496109_0000284
1903 Ga0496109_0073751
1904 Ga0496109_0085155
1905 Ga0496109_0139679
1906 Ga0496109_0187381
1907 Ga0496110_0012769
1908 Ga0496110_0052828
1909 Ga0496110_0087441
1910 Ga0496110_0271012
1911 Ga0496110_0285616
1912 Ga0496111_0015727
1913 Ga0496111_0099475
1914 Ga0496111_0128224
1915 Ga0496111_0172517
1916 Ga0496111_0182728
1917 Ga0496112_0000585
1918 Ga0496112_0003685
1919 Ga0496112_0009940
1920 Ga0496112_0050901
1921 Ga0496112_0414428
1922 Ga0496113_0009649
1923 Ga0496113_0058926
1924 Ga0496113_0156397
1925 Ga0496113_0466026
1926 Ga0496114_0090633
1927 Ga0496114_0367529
1928 Ga0496115_0043945
1929 Ga0496115_0163683
1930 Ga0496115_0300079
1931 Ga0496115_0360716
1932 Ga0496115_0368588
1933 Ga0496115_0455807
1934 Ga0496115_0678272
1935 Ga0496117_0119627
1936 Ga0496117_0193458
1937 Ga0496118_0001280
1938 Ga0496119_0026620
1939 Ga0496119_0125648
1940 Ga0496119_0146044
1941 Ga0496120_0112819
1942 Ga0496120_0161348
1943 Ga0496121_0000571
1944 Ga0496121_0005094
1945 Ga0496121_0162219
1946 Ga0496121_0197790
1947 Ga0496121_0207345
1948 Ga0496121_0259223
1949 Ga0496121_0344142
1950 Ga0496122_0041025
1951 Ga0496123_0076834
1952 Ga0496124_0000267
1953 Ga0496124_0141241
1954 Ga0496124_0231225
1955 Ga0496124_0319932
1956 Ga0496125_0023578
1957 Ga0496125_0166823
1958 Ga0496125_0208549
1959 Ga0496125_0232111
1960 Ga0496125_0305547
1961 Ga0496125_0335280
1962 Ga0496126_0011100
1963 Ga0496126_0035506
1964 Ga0496126_0053366
1965 Ga0496126_0146145
1966 Ga0496126_0338802
1967 Ga0496126_0339323
1968 Ga0496126_0390729
1969 Ga0496126_0469114
1970 Ga0496126_0497687
1971 Ga0495678_127136
1972 Ga0495682_0052951
1973 Ga0495682_0088552
1974 Ga0501031_0225085
1975 Ga0501033_0271169
1976 Ga0501038_0118653
1977 Ga0501046_0388133
1978 Ga0501067_0130057
1979 Ga0501069_0105724
1980 Ga0501235_039941
1981 Ga0501035_0609955
1982 Ga0501044_0180305
1983 Ga0501045_0381210
1984 nmdc:mga03683_101784_c1
1985 nmdc:mga03683_62848_c1
1986 nmdc:mga03n38_63173_c1
1987 nmdc:mga03n38_97892_c1
1988 nmdc:mga00v17_92914_c1
1989 nmdc:mga00v17_94525_c1
1990 nmdc:mga0yw44_107334_c1
1991 nmdc:mga0yw44_234840_c1
1992 nmdc:mga0k408_56485_c1
1993 nmdc:mga0k408_83657_c1
1994 nmdc:mga0k408_9879_c1
1995 nmdc:mga06z11_26288_c1
1996 nmdc:mga04h51_40682_c1
1997 nmdc:mga07m45_126835_c1
1998 nmdc:mga07m45_138202_c1
1999 nmdc:mga07m45_250872_c1
2000 nmdc:mga05p37_435584_c1
2001 nmdc:mga08y16_464550_c1
2002 nmdc:mga0n895_275036_c1
2003 nmdc:mga0n895_373552_c1
2004 nmdc:mga0rr50_35332_c1
2005 nmdc:mga0rr50_63344_c1
2006 nmdc:mga08x19_125175_c1
2007 nmdc:mga0sz30_8422_c1
2008 nmdc:mga0sz30_99170_c1
2009 Ga0495601_0103258
2010 Ga0495601_0114538
2011 Ga0495601_0121752
2012 Ga0495601_0205867
2013 Ga0495612_0046486
2014 Ga0500610_0127560
2015 Ga0500635_0127500
2016 Ga0495655_0015732
2017 Ga0495595_0145446
2018 Ga0495619_0001862
2019 Ga0495619_0290710
2020 Ga0495619_0298266
2021 Ga0500643_000028
2022 Ga0500647_0026988
2023 Ga0500583_0022151
2024 Ga0500651_0083146
2025 Ga0500566_0040880
2026 Ga0500641_0077438
2027 Ga0500650_0058770
2028 Ga0500555_002004
2029 Ga0500556_0051487
2030 Ga0500557_000150
2031 Ga0500562_002759
2032 Ga0500594_0035124
2033 Ga0500594_0036116
2034 Ga0500595_000141
2035 Ga0500595_002912
2036 Ga0500595_021236
2037 Ga0500595_065032
2038 Ga0500608_074760
2039 Ga0500614_083245
2040 Ga0500642_0000319
2041 Ga0500642_0014943
2042 Ga0500652_140272
2043 Ga0500655_027656
2044 Ga0500655_028772
2045 Ga0500559_0126507
2046 Ga0500568_0012960
2047 Ga0500573_0084912
2048 Ga0500577_0007864
2049 Ga0500590_076030
2050 Ga0500590_167811
2051 Ga0500603_000092
2052 Ga0500622_0028909
2053 Ga0500638_003710
2054 Ga0500636_0156489
2055 Ga0500636_0183479
2056 Ga0500636_0196750
2057 Ga0500637_0000293
2058 Ga0500637_0005216
2059 Ga0500576_079677
2060 Ga0500625_005839
2061 Ga0500645_022324
2062 Ga0500645_042085
2063 Ga0500596_007900
2064 Ga0500599_000638
2065 Ga0500601_003226
2066 Ga0500661_005735
2067 2507504452
2068 2508694708
2069 2509146374
2070 2511396395
2071 2513624251
2072 2513638740
2073 2513649212
2074 2513656256
2075 2513673392
2076 2513694618
2077 2513706389
2078 2513716687
2079 2513858821
2080 2513874168
2081 2513917565
2082 2514010071
2083 2515624372
2084 2517103071
2085 2517887772
2086 2524438905
2087 2524535441
2088 2617350290
2089 2617374377
2090 2723842429
2091 2728751820
2092 2745081959
2093 2793070512
2094 2793078729
2095 2805920886
2096 2818240599
2097 2824604705
2098 2824615376
2099 2824618833
2100 2824628939
2101 2824639232
2102 2824650136
2103 2824657999
2104 2824675079
2105 2824687058
2106 2824695101
2107 2824699355
2108 2824712863
2109 2824717517
2110 2824726791
2111 2824739136
2112 2824751009
2113 2824759662
2114 2824769957
2115 2824780294
2116 2838126020
2117 2841942586
2118 2841953064
2119 2841963917
2120 2841970911
2121 2841977829
2122 2841984607
2123 2842041669
2124 2842049711
2125 2844321441
2126 2847931958
2127 2847943204
2128 2849076936
2129 2857514795
2130 2874595599
2131 2874606883
2132 2874620397
2133 2874621889
2134 2874629626
2135 2874651767
2136 2876769240
2137 2876775794
2138 2876812947
2139 2876821663
2140 2879079885
2141 2879091132
2142 2879112334
2143 2879133969
2144 2879148454
2145 2881364611
2146 2885374376
2147 2885379412
2148 2885390342
2149 2888387278
2150 2888391423
2151 2888426960
2152 2889034348
2153 2903727980
2154 2903755515
2155 2903775866
2156 2904669518
2157 2904691914
2158 2904709965
2159 2904713667
2160 2906602536
2161 2906612797
2162 2906629175
2163 2906636718
2164 2906663164
2165 2908745978
2166 2908764019
2167 2908776858
2168 2922364869
2169 2922391671
2170 2922398877
2171 2922433258
2172 2932800679
2173 2932808410
2174 2935613145
2175 2935630545
2176 2935654100
2177 2935662798
2178 2935774834
2179 2935779980
2180 2935792966
2181 2935798582
2182 2935825003
2183 2935852222
2184 2935883517
2185 2935910656
2186 2935921836
2187 2935930025
2188 2935937693
2189 2935949797
2190 2935956893
2191 2935965352
2192 2935970850
2193 2935980169
2194 2935984337
2195 2936017005
2196 2936025587
2197 2936034429
2198 2936052537
2199 2936055417
2200 2941507197
2201 2941520333
2202 2941523668
2203 2941532019
2204 3005482858
2205 3005490850
2206 3005506557
2207 3005717540
2208 3005724484
2209 8006926745
2210 8006935172
2211 8006965308
2212 8006975141
2213 8006992147
2214 8006995458
2215 8016525230
2216 8016543095
2217 8016550193
2218 8016558600
2219 8016568504
2220 8016581154
2221 8016587554
2222 8016607450
2223 8016630343
2224 8016636797
2225 8019538478
2226 8019541341
2227 8019549286
2228 8019563534
2229 8019573608
2230 8019623764
2231 8019638275
2232 8019641365
2233 8019666191
2234 8019675701
2235 8019680400
2236 8056679031
2237 8056681713
2238 8056692879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

112

230

0.95

PF13905

Thioredoxin_8

Thioredoxin-like

134

231

0.94

PF08534

Redoxin

Redoxin

109

249

0.91

PF00085

Thioredoxin

Thioredoxin

126

186

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jfu-assembly1.cif.gz_A crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum 0.9977 45 219
4txo-assembly2.cif.gz_A crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.997 45 217
1jfu-assembly1.cif.gz_A crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum 0.9864 45 219
4txo-assembly2.cif.gz_A crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.9691 45 217
5um7-assembly2.cif.gz_B crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.9014 78 206
ID Description Score Start End Superfamily
4txvC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9966 45 218 3.40.30.10
4txvC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9688 45 218 3.40.30.10
3hdcA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8829 82 216 3.40.30.10
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8828 78 219 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8748 78 214 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2D8XJM0-F1-model_v4 Redoxin 0.9649 68 220 GO:0015036
GO:0017004
GO:0030313
AF-A0A142BPN4-F1-model_v4 Thioredoxin protein 0.9601 70 218 GO:0015036
GO:0016020
GO:0017004
GO:0030313
AF-A0A1M7ZFJ6-F1-model_v4 Thiol-disulfide isomerase or thioredoxin 0.9587 44 218 GO:0015036
GO:0016020
GO:0016209
GO:0016853
AF-A0A560CZV6-F1-model_v4 Thiol-disulfide isomerase/thioredoxin 0.9566 38 225 GO:0015036
GO:0016020
GO:0016853
GO:0030313
AF-A0A2T2Q386-F1-model_v4 Thiol:disulfide interchange protein 0.9543 39 225 GO:0015036
GO:0016020
GO:0030313

Map