F490274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 391 | 1098 | 467 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10016860|Ga0075433_100168605 |
| Length | 534 |
| Sequence | VLWSRLDVLAYAQPASDHVILRGVPNMTALNARTEEATMAATTRSVRAQRAGGDIERDAPFASAWRRAHMSVDERVGRGRAARNEAPRSSHGHWEAAPDRPDPISLLEEQAKSRVAELVPIRYGRMLASPFTFYRGAAAIMAADLAGTPTSGVTVQLCGDAHLSNFGLFGTPERRLLFDINDFDETLPGPWEWDVKRLAASFEVMGREGGFSPADRRAVVMAGVRQYREKMGHAAKMGTLGAWYDQLDAQMLLKLVNEETRLRRLRRKEALTAGRRVAQARTRDSIRVFAKRARELNGELRIVADPPLIVPIEDLVIPGSEWENPTPLIKKLLSTYRRTLGRQGHPLEEFRYVHAARKVVGVGSVGTRCYLLLLMGRDRGDPLFLQVKEAQASVLEPFLGRSTYPHHGERIVVGQRLMQGATDIFLGWQRIRGLDGMTRDYYVRQFHDWKGGATVENLKMPGATFYARLCAATLARAHARWGDRIAIAAYLGKGDAFDRAIADFSVIYADQNERDYDSFRAAVNSGRLSAQTGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 3 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 4 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 5 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 6 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 7 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 8 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 9 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 10 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 11 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 12 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 13 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 14 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 15 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 223 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 227 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 228 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 240 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 267 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 350 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 386 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 387 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0.99 |
| Isolates | 1.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0.09 |
| Rhizoplane | 11.58 |
| Rhizosphere | 84.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000802 | 3300001979 | Bacteria | 13809 |
| 2 | JGI25151J46595_10000166 | 3300003187 | Bacteria | 85475 |
| 3 | JGI25407J50210_10006261 | 3300003373 | Bacteria | 2958 |
| 4 | Ga0058863_11944294 | 3300004799 | Bacteria | 1894 |
| 5 | Ga0058861_10082651 | 3300004800 | Bacteria | 2054 |
| 6 | Ga0070683_100000558 | 3300005329 | Bacteria | 26449 |
| 7 | Ga0070683_100002533 | 3300005329 | Bacteria | 14580 |
| 8 | Ga0070683_100028383 | 3300005329 | Bacteria | 5056 |
| 9 | Ga0070683_100039126 | 3300005329 | Bacteria | 4352 |
| 10 | Ga0070683_100149948 | 3300005329 | Bacteria | 2211 |
| 11 | Ga0068869_100021699 | 3300005334 | Bacteria | 4419 |
| 12 | Ga0070680_100059941 | 3300005336 | Bacteria | 3115 |
| 13 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 14 | Ga0070682_100020489 | 3300005337 | Unclassified | 3891 |
| 15 | Ga0070682_100062599 | 3300005337 | Bacteria | 2357 |
| 16 | Ga0070682_100134408 | 3300005337 | Bacteria | 1678 |
| 17 | Ga0070682_100143366 | 3300005337 | Bacteria | 1631 |
| 18 | Ga0068868_100132802 | 3300005338 | Bacteria | 2038 |
| 19 | Ga0068868_100180700 | 3300005338 | Bacteria | 1750 |
| 20 | Ga0070660_100011436 | 3300005339 | Bacteria | 6305 |
| 21 | Ga0070689_100033350 | 3300005340 | Bacteria | 3923 |
| 22 | Ga0070691_10000100 | 3300005341 | Bacteria | 25275 |
| 23 | Ga0070691_10012578 | 3300005341 | Bacteria | 3876 |
| 24 | Ga0070691_10014628 | 3300005341 | Bacteria | 3601 |
| 25 | Ga0070692_10011129 | 3300005345 | Bacteria | 4122 |
| 26 | Ga0070692_10018220 | 3300005345 | Bacteria | 3372 |
| 27 | Ga0070692_10107762 | 3300005345 | Bacteria | 1537 |
| 28 | Ga0070668_100015399 | 3300005347 | Bacteria | 5715 |
| 29 | Ga0070668_100027645 | 3300005347 | Bacteria | 4306 |
| 30 | Ga0070668_100037245 | 3300005347 | Bacteria | 3713 |
| 31 | Ga0070668_100065222 | 3300005347 | Bacteria | 2825 |
| 32 | Ga0070669_100014929 | 3300005353 | Bacteria | 5535 |
| 33 | Ga0070669_100104806 | 3300005353 | Bacteria | 2138 |
| 34 | Ga0070675_100001463 | 3300005354 | Bacteria | 17411 |
| 35 | Ga0070675_100013342 | 3300005354 | Bacteria | 6456 |
| 36 | Ga0070675_100086774 | 3300005354 | Bacteria | 2616 |
| 37 | Ga0070674_100139241 | 3300005356 | Bacteria | 1819 |
| 38 | Ga0070674_100150710 | 3300005356 | Bacteria | 1755 |
| 39 | Ga0070688_100038237 | 3300005365 | Bacteria | 2929 |
| 40 | Ga0070659_100000852 | 3300005366 | Bacteria | 22251 |
| 41 | Ga0070659_100012095 | 3300005366 | Bacteria | 6390 |
| 42 | Ga0070659_100012543 | 3300005366 | Bacteria | 6283 |
| 43 | Ga0070659_100065148 | 3300005366 | Bacteria | 2886 |
| 44 | Ga0070659_100132928 | 3300005366 | Bacteria | 2021 |
| 45 | Ga0070659_100183191 | 3300005366 | Unclassified | 1719 |
| 46 | Ga0070667_100000597 | 3300005367 | Bacteria | 35219 |
| 47 | Ga0070667_100183131 | 3300005367 | Bacteria | 1853 |
| 48 | Ga0070714_100001300 | 3300005435 | Bacteria | 18068 |
| 49 | Ga0070714_100003174 | 3300005435 | Bacteria | 12216 |
| 50 | Ga0070714_100004997 | 3300005435 | Bacteria | 10082 |
| 51 | Ga0070714_100006732 | 3300005435 | Bacteria | 8905 |
| 52 | Ga0070714_100019304 | 3300005435 | Bacteria | 5549 |
| 53 | Ga0070714_100019464 | 3300005435 | Bacteria | 5532 |
| 54 | Ga0070714_100042155 | 3300005435 | Bacteria | 3854 |
| 55 | Ga0070714_100046135 | 3300005435 | Bacteria | 3695 |
| 56 | Ga0070714_100133144 | 3300005435 | Bacteria | 2223 |
| 57 | Ga0070713_100001413 | 3300005436 | Bacteria | 15387 |
| 58 | Ga0070713_100005405 | 3300005436 | Bacteria | 8726 |
| 59 | Ga0070713_100032866 | 3300005436 | Bacteria | 4149 |
| 60 | Ga0070713_100044804 | 3300005436 | Bacteria | 3622 |
| 61 | Ga0070710_10000002 | 3300005437 | Bacteria | 290371 |
| 62 | Ga0070710_10000267 | 3300005437 | Bacteria | 24789 |
| 63 | Ga0070710_10022888 | 3300005437 | Bacteria | 3275 |
| 64 | Ga0070710_10028899 | 3300005437 | Bacteria | 2969 |
| 65 | Ga0070701_10010033 | 3300005438 | Bacteria | 4173 |
| 66 | Ga0070701_10073309 | 3300005438 | Bacteria | 1836 |
| 67 | Ga0070711_100000788 | 3300005439 | Bacteria | 16554 |
| 68 | Ga0070711_100003451 | 3300005439 | Bacteria | 9212 |
| 69 | Ga0070711_100011244 | 3300005439 | Bacteria | 5552 |
| 70 | Ga0070711_100025477 | 3300005439 | Bacteria | 3870 |
| 71 | Ga0070711_100031448 | 3300005439 | Bacteria | 3524 |
| 72 | Ga0070711_100049324 | 3300005439 | Bacteria | 2883 |
| 73 | Ga0070711_100050791 | 3300005439 | Bacteria | 2845 |
| 74 | Ga0070711_100054959 | 3300005439 | Bacteria | 2749 |
| 75 | Ga0070711_100077818 | 3300005439 | Bacteria | 2355 |
| 76 | Ga0070711_100107448 | 3300005439 | Bacteria | 2042 |
| 77 | Ga0070705_100009341 | 3300005440 | Bacteria | 4871 |
| 78 | Ga0070700_100005283 | 3300005441 | Bacteria | 6833 |
| 79 | Ga0070700_100010097 | 3300005441 | Bacteria | 5198 |
| 80 | Ga0070700_100018773 | 3300005441 | Bacteria | 3980 |
| 81 | Ga0070700_100052626 | 3300005441 | Bacteria | 2539 |
| 82 | Ga0070694_100004651 | 3300005444 | Bacteria | 8260 |
| 83 | Ga0070694_100076615 | 3300005444 | Bacteria | 2316 |
| 84 | Ga0070708_100184572 | 3300005445 | Bacteria | 1950 |
| 85 | Ga0070663_100002472 | 3300005455 | Bacteria | 10427 |
| 86 | Ga0070663_100036784 | 3300005455 | Bacteria | 3403 |
| 87 | Ga0070663_100132944 | 3300005455 | Bacteria | 1891 |
| 88 | Ga0070663_100134704 | 3300005455 | Bacteria | 1880 |
| 89 | Ga0070678_100040934 | 3300005456 | Bacteria | 3281 |
| 90 | Ga0070678_100183952 | 3300005456 | Bacteria | 1713 |
| 91 | Ga0070662_100013035 | 3300005457 | Bacteria | 5526 |
| 92 | Ga0070662_100047016 | 3300005457 | Bacteria | 3102 |
| 93 | Ga0070662_100049611 | 3300005457 | Bacteria | 3027 |
| 94 | Ga0070662_100063899 | 3300005457 | Bacteria | 2694 |
| 95 | Ga0070662_100137455 | 3300005457 | Bacteria | 1891 |
| 96 | Ga0070662_100154358 | 3300005457 | Bacteria | 1791 |
| 97 | Ga0070681_10014198 | 3300005458 | Bacteria | 7925 |
| 98 | Ga0068867_100002154 | 3300005459 | Bacteria | 13812 |
| 99 | Ga0068867_100008485 | 3300005459 | Bacteria | 7252 |
| 100 | Ga0070685_10007229 | 3300005466 | Bacteria | 5676 |
| 101 | Ga0070706_100025104 | 3300005467 | Bacteria | 5486 |
| 102 | Ga0070707_100138905 | 3300005468 | Bacteria | 2364 |
| 103 | Ga0070698_100031035 | 3300005471 | Bacteria | 5541 |
| 104 | Ga0070698_100037283 | 3300005471 | Bacteria | 5013 |
| 105 | Ga0070698_100259376 | 3300005471 | Bacteria | 1670 |
| 106 | Ga0070699_100000043 | 3300005518 | Bacteria | 127213 |
| 107 | Ga0070679_100041121 | 3300005530 | Bacteria | 4602 |
| 108 | Ga0070679_100122463 | 3300005530 | Bacteria | 2585 |
| 109 | Ga0070684_100006264 | 3300005535 | Bacteria | 9186 |
| 110 | Ga0070684_100010636 | 3300005535 | Bacteria | 7297 |
| 111 | Ga0070684_100011666 | 3300005535 | Bacteria | 7007 |
| 112 | Ga0070684_100062282 | 3300005535 | Bacteria | 3267 |
| 113 | Ga0070697_100021855 | 3300005536 | Bacteria | 5073 |
| 114 | Ga0068853_100007231 | 3300005539 | Bacteria | 8893 |
| 115 | Ga0068853_100063625 | 3300005539 | Bacteria | 3195 |
| 116 | Ga0068853_100074408 | 3300005539 | Bacteria | 2963 |
| 117 | Ga0068853_100093895 | 3300005539 | Bacteria | 2642 |
| 118 | Ga0070672_100013162 | 3300005543 | Bacteria | 5834 |
| 119 | Ga0070686_100029552 | 3300005544 | Bacteria | 3335 |
| 120 | Ga0070686_100076181 | 3300005544 | Bacteria | 2208 |
| 121 | Ga0070686_100111680 | 3300005544 | Bacteria | 1863 |
| 122 | Ga0070695_100139300 | 3300005545 | Bacteria | 1680 |
| 123 | Ga0070696_100088208 | 3300005546 | Bacteria | 2204 |
| 124 | Ga0070696_100107322 | 3300005546 | Bacteria | 2008 |
| 125 | Ga0070693_100009311 | 3300005547 | Bacteria | 4881 |
| 126 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 127 | Ga0070665_100006680 | 3300005548 | Bacteria | 11731 |
| 128 | Ga0070665_100018108 | 3300005548 | Bacteria | 7067 |
| 129 | Ga0070665_100131441 | 3300005548 | Bacteria | 2505 |
| 130 | Ga0070665_100144277 | 3300005548 | Bacteria | 2384 |
| 131 | Ga0068855_100016708 | 3300005563 | Bacteria | 8826 |
| 132 | Ga0068855_100045286 | 3300005563 | Bacteria | 5203 |
| 133 | Ga0070664_100013358 | 3300005564 | Bacteria | 6688 |
| 134 | Ga0070664_100017902 | 3300005564 | Bacteria | 5817 |
| 135 | Ga0070664_100154820 | 3300005564 | Bacteria | 2025 |
| 136 | Ga0070664_100163711 | 3300005564 | Bacteria | 1969 |
| 137 | Ga0068857_100017156 | 3300005577 | Bacteria | 6341 |
| 138 | Ga0068857_100115106 | 3300005577 | Bacteria | 2419 |
| 139 | Ga0068854_100004234 | 3300005578 | Bacteria | 9034 |
| 140 | Ga0068854_100024072 | 3300005578 | Bacteria | 4165 |
| 141 | Ga0068856_100003506 | 3300005614 | Bacteria | 15837 |
| 142 | Ga0068856_100009718 | 3300005614 | Bacteria | 9344 |
| 143 | Ga0068856_100014872 | 3300005614 | Bacteria | 7512 |
| 144 | Ga0068856_100066493 | 3300005614 | Bacteria | 3562 |
| 145 | Ga0068856_100109819 | 3300005614 | Bacteria | 2754 |
| 146 | Ga0070702_100003799 | 3300005615 | Bacteria | 6824 |
| 147 | Ga0070702_100005715 | 3300005615 | Bacteria | 5821 |
| 148 | Ga0070702_100123530 | 3300005615 | Bacteria | 1624 |
| 149 | Ga0068852_100008106 | 3300005616 | Bacteria | 7710 |
| 150 | Ga0068852_100080517 | 3300005616 | Bacteria | 2888 |
| 151 | Ga0068852_100091270 | 3300005616 | Bacteria | 2725 |
| 152 | Ga0068852_100119796 | 3300005616 | Bacteria | 2407 |
| 153 | Ga0068864_100000024 | 3300005618 | Bacteria | 252632 |
| 154 | Ga0068864_100047627 | 3300005618 | Bacteria | 3683 |
| 155 | Ga0068866_10016127 | 3300005718 | Bacteria | 3333 |
| 156 | Ga0068861_100014414 | 3300005719 | Bacteria | 5549 |
| 157 | Ga0068861_100055131 | 3300005719 | Unclassified | 3030 |
| 158 | Ga0068861_100176098 | 3300005719 | Bacteria | 1776 |
| 159 | Ga0068870_10062911 | 3300005840 | Bacteria | 2000 |
| 160 | Ga0068870_10079616 | 3300005840 | Bacteria | 1808 |
| 161 | Ga0068863_100016249 | 3300005841 | Bacteria | 7141 |
| 162 | Ga0068863_100055706 | 3300005841 | Bacteria | 3744 |
| 163 | Ga0068863_100079728 | 3300005841 | Unclassified | 3101 |
| 164 | Ga0068858_100031114 | 3300005842 | Bacteria | 4955 |
| 165 | Ga0068858_100081825 | 3300005842 | Bacteria | 3001 |
| 166 | Ga0068860_100078060 | 3300005843 | Bacteria | 3149 |
| 167 | Ga0068860_100128723 | 3300005843 | Bacteria | 2428 |
| 168 | Ga0068860_100234091 | 3300005843 | Bacteria | 1785 |
| 169 | Ga0068862_100000366 | 3300005844 | Bacteria | 49032 |
| 170 | Ga0068862_100062940 | 3300005844 | Bacteria | 3192 |
| 171 | Ga0068862_100087848 | 3300005844 | Bacteria | 2704 |
| 172 | Ga0068862_100132971 | 3300005844 | Bacteria | 2202 |
| 173 | Ga0068862_100200344 | 3300005844 | Bacteria | 1800 |
| 174 | Ga0081455_10013896 | 3300005937 | Bacteria | 7914 |
| 175 | Ga0081455_10016343 | 3300005937 | Bacteria | 7169 |
| 176 | Ga0081538_10000023 | 3300005981 | Bacteria | 131101 |
| 177 | Ga0081540_1000181 | 3300005983 | Bacteria | 65791 |
| 178 | Ga0081540_1000757 | 3300005983 | Bacteria | 29739 |
| 179 | Ga0081540_1007808 | 3300005983 | Bacteria | 7570 |
| 180 | Ga0081540_1037492 | 3300005983 | Bacteria | 2568 |
| 181 | Ga0081539_10001052 | 3300005985 | Bacteria | 50554 |
| 182 | Ga0070717_10000006 | 3300006028 | Bacteria | 353403 |
| 183 | Ga0070717_10002252 | 3300006028 | Bacteria | 13525 |
| 184 | Ga0070717_10003906 | 3300006028 | Bacteria | 10722 |
| 185 | Ga0070717_10008176 | 3300006028 | Bacteria | 7808 |
| 186 | Ga0070717_10026014 | 3300006028 | Bacteria | 4664 |
| 187 | Ga0070717_10053450 | 3300006028 | Bacteria | 3329 |
| 188 | Ga0075363_100021934 | 3300006048 | Bacteria | 3224 |
| 189 | Ga0075364_10017590 | 3300006051 | Bacteria | 4469 |
| 190 | Ga0070715_10001599 | 3300006163 | Bacteria | 6675 |
| 191 | Ga0070716_100001363 | 3300006173 | Bacteria | 10842 |
| 192 | Ga0070716_100003719 | 3300006173 | Bacteria | 7223 |
| 193 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 194 | Ga0070712_100003227 | 3300006175 | Bacteria | 10049 |
| 195 | Ga0070712_100019601 | 3300006175 | Bacteria | 4415 |
| 196 | Ga0070712_100024148 | 3300006175 | Bacteria | 4024 |
| 197 | Ga0070712_100027943 | 3300006175 | Bacteria | 3769 |
| 198 | Ga0070712_100069626 | 3300006175 | Bacteria | 2511 |
| 199 | Ga0070712_100158695 | 3300006175 | Bacteria | 1745 |
| 200 | Ga0097621_100011114 | 3300006237 | Bacteria | 6622 |
| 201 | Ga0097621_100140573 | 3300006237 | Bacteria | 2063 |
| 202 | Ga0068871_100032952 | 3300006358 | Bacteria | 4097 |
| 203 | Ga0068871_100034036 | 3300006358 | Bacteria | 4040 |
| 204 | Ga0068871_100040731 | 3300006358 | Bacteria | 3722 |
| 205 | Ga0068871_100041886 | 3300006358 | Bacteria | 3673 |
| 206 | Ga0068871_100075188 | 3300006358 | Unclassified | 2788 |
| 207 | Ga0075428_100022812 | 3300006844 | Bacteria | 6926 |
| 208 | Ga0075428_100028236 | 3300006844 | Bacteria | 6205 |
| 209 | Ga0075428_100079512 | 3300006844 | Bacteria | 3578 |
| 210 | Ga0075428_100081909 | 3300006844 | Bacteria | 3521 |
| 211 | Ga0075428_100134561 | 3300006844 | Bacteria | 2688 |
| 212 | Ga0075430_100011868 | 3300006846 | Bacteria | 7415 |
| 213 | Ga0075430_100041483 | 3300006846 | Bacteria | 3893 |
| 214 | Ga0075430_100041844 | 3300006846 | Bacteria | 3876 |
| 215 | Ga0075430_100113457 | 3300006846 | Bacteria | 2259 |
| 216 | Ga0075431_100000685 | 3300006847 | Bacteria | 29059 |
| 217 | Ga0075431_100065005 | 3300006847 | Bacteria | 3767 |
| 218 | Ga0075431_100082299 | 3300006847 | Bacteria | 3322 |
| 219 | Ga0075433_10004165 | 3300006852 | Bacteria | 11227 |
| 220 | Ga0075433_10016860 | 3300006852 | Bacteria | 6036 |
| 221 | Ga0075433_10031502 | 3300006852 | Bacteria | 4534 |
| 222 | Ga0075433_10042932 | 3300006852 | Bacteria | 3924 |
| 223 | Ga0075433_10063711 | 3300006852 | Bacteria | 3230 |
| 224 | Ga0075434_100004695 | 3300006871 | Bacteria | 12345 |
| 225 | Ga0075434_100030794 | 3300006871 | Bacteria | 5286 |
| 226 | Ga0075434_100077166 | 3300006871 | Bacteria | 3326 |
| 227 | Ga0075434_100144366 | 3300006871 | Bacteria | 2400 |
| 228 | Ga0075434_100225994 | 3300006871 | Unclassified | 1891 |
| 229 | Ga0075434_100228529 | 3300006871 | Bacteria | 1880 |
| 230 | Ga0075429_100116021 | 3300006880 | Bacteria | 2341 |
| 231 | Ga0068865_100003061 | 3300006881 | Bacteria | 10003 |
| 232 | Ga0068865_100005688 | 3300006881 | Bacteria | 7573 |
| 233 | Ga0068865_100094754 | 3300006881 | Bacteria | 2173 |
| 234 | Ga0075436_100006626 | 3300006914 | Bacteria | 7936 |
| 235 | Ga0075436_100009259 | 3300006914 | Bacteria | 6738 |
| 236 | Ga0099824_1000332 | 3300006942 | Bacteria | 51674 |
| 237 | Ga0075435_100010048 | 3300007076 | Bacteria | 6901 |
| 238 | Ga0075435_100010366 | 3300007076 | Bacteria | 6814 |
| 239 | Ga0075435_100014025 | 3300007076 | Bacteria | 5976 |
| 240 | Ga0075435_100082894 | 3300007076 | Bacteria | 2636 |
| 241 | Ga0075435_100122502 | 3300007076 | Bacteria | 2171 |
| 242 | Ga0105240_10032970 | 3300009093 | Bacteria | 6698 |
| 243 | Ga0105240_10094357 | 3300009093 | Bacteria | 3650 |
| 244 | Ga0105240_10192408 | 3300009093 | Bacteria | 2398 |
| 245 | Ga0111539_10002534 | 3300009094 | Bacteria | 24191 |
| 246 | Ga0111539_10002876 | 3300009094 | Bacteria | 22852 |
| 247 | Ga0111539_10030024 | 3300009094 | Bacteria | 6613 |
| 248 | Ga0111539_10108769 | 3300009094 | Bacteria | 3253 |
| 249 | Ga0111539_10164550 | 3300009094 | Bacteria | 2594 |
| 250 | Ga0111539_10343497 | 3300009094 | Unclassified | 1737 |
| 251 | Ga0105245_10010376 | 3300009098 | Bacteria | 8114 |
| 252 | Ga0105245_10013722 | 3300009098 | Bacteria | 7057 |
| 253 | Ga0105245_10047423 | 3300009098 | Bacteria | 3841 |
| 254 | Ga0105245_10069086 | 3300009098 | Bacteria | 3203 |
| 255 | Ga0105245_10073817 | 3300009098 | Bacteria | 3103 |
| 256 | Ga0105245_10108511 | 3300009098 | Bacteria | 2578 |
| 257 | Ga0105245_10236092 | 3300009098 | Bacteria | 1770 |
| 258 | Ga0105247_10000369 | 3300009101 | Bacteria | 38254 |
| 259 | Ga0114129_10036368 | 3300009147 | Bacteria | 6954 |
| 260 | Ga0114129_10079769 | 3300009147 | Bacteria | 4551 |
| 261 | Ga0105243_10003685 | 3300009148 | Bacteria | 12321 |
| 262 | Ga0105243_10005915 | 3300009148 | Bacteria | 9476 |
| 263 | Ga0105243_10017401 | 3300009148 | Bacteria | 5434 |
| 264 | Ga0105243_10041665 | 3300009148 | Bacteria | 3590 |
| 265 | Ga0105243_10048351 | 3300009148 | Bacteria | 3353 |
| 266 | Ga0105243_10071064 | 3300009148 | Bacteria | 2813 |
| 267 | Ga0105243_10085160 | 3300009148 | Bacteria | 2590 |
| 268 | Ga0105241_10068171 | 3300009174 | Bacteria | 2756 |
| 269 | Ga0105242_10001159 | 3300009176 | Bacteria | 20774 |
| 270 | Ga0105242_10008877 | 3300009176 | Bacteria | 7714 |
| 271 | Ga0105242_10016636 | 3300009176 | Bacteria | 5721 |
| 272 | Ga0105242_10018440 | 3300009176 | Bacteria | 5456 |
| 273 | Ga0105242_10060082 | 3300009176 | Bacteria | 3121 |
| 274 | Ga0105242_10091633 | 3300009176 | Bacteria | 2559 |
| 275 | Ga0105242_10176318 | 3300009176 | Bacteria | 1882 |
| 276 | Ga0105242_10194217 | 3300009176 | Bacteria | 1799 |
| 277 | Ga0105242_10238791 | 3300009176 | Bacteria | 1633 |
| 278 | Ga0105248_10009406 | 3300009177 | Bacteria | 10759 |
| 279 | Ga0105248_10066247 | 3300009177 | Bacteria | 4056 |
| 280 | Ga0105248_10127493 | 3300009177 | Bacteria | 2871 |
| 281 | Ga0105248_10296632 | 3300009177 | Bacteria | 1820 |
| 282 | Ga0105237_10028453 | 3300009545 | Bacteria | 5693 |
| 283 | Ga0105237_10226999 | 3300009545 | Bacteria | 1868 |
| 284 | Ga0105238_10019629 | 3300009551 | Bacteria | 6883 |
| 285 | Ga0105238_10152433 | 3300009551 | Bacteria | 2286 |
| 286 | Ga0105238_10262486 | 3300009551 | Unclassified | 1707 |
| 287 | Ga0105249_10000916 | 3300009553 | Bacteria | 26081 |
| 288 | Ga0105249_10002508 | 3300009553 | Bacteria | 15869 |
| 289 | Ga0105249_10009694 | 3300009553 | Bacteria | 8440 |
| 290 | Ga0105249_10107528 | 3300009553 | Bacteria | 2632 |
| 291 | Ga0105249_10150221 | 3300009553 | Bacteria | 2242 |
| 292 | Ga0105239_10009449 | 3300010375 | Bacteria | 10987 |
| 293 | Ga0105239_10033703 | 3300010375 | Bacteria | 5623 |
| 294 | Ga0105239_10103632 | 3300010375 | Bacteria | 3149 |
| 295 | Ga0105239_10112707 | 3300010375 | Bacteria | 3016 |
| 296 | Ga0105246_10018236 | 3300011119 | Bacteria | 4472 |
| 297 | Ga0105246_10033619 | 3300011119 | Bacteria | 3410 |
| 298 | Ga0157373_10000003 | 3300013100 | Bacteria | 454601 |
| 299 | Ga0157373_10075674 | 3300013100 | Bacteria | 2375 |
| 300 | Ga0157371_10049289 | 3300013102 | Bacteria | 2992 |
| 301 | Ga0157370_10033202 | 3300013104 | Bacteria | 5031 |
| 302 | Ga0157370_10151057 | 3300013104 | Bacteria | 2161 |
| 303 | Ga0157369_10009457 | 3300013105 | Bacteria | 11144 |
| 304 | Ga0157369_10033435 | 3300013105 | Bacteria | 5651 |
| 305 | Ga0157369_10069460 | 3300013105 | Bacteria | 3784 |
| 306 | Ga0157374_10322458 | 3300013296 | Bacteria | 1531 |
| 307 | Ga0157378_10217413 | 3300013297 | Bacteria | 1815 |
| 308 | Ga0157378_10271297 | 3300013297 | Bacteria | 1632 |
| 309 | Ga0163162_10014212 | 3300013306 | Bacteria | 7777 |
| 310 | Ga0163162_10014551 | 3300013306 | Bacteria | 7689 |
| 311 | Ga0163162_10025640 | 3300013306 | Bacteria | 5828 |
| 312 | Ga0163162_10026336 | 3300013306 | Bacteria | 5748 |
| 313 | Ga0163162_10030239 | 3300013306 | Bacteria | 5366 |
| 314 | Ga0163162_10205614 | 3300013306 | Bacteria | 2098 |
| 315 | Ga0163162_10236293 | 3300013306 | Bacteria | 1958 |
| 316 | Ga0163162_10339249 | 3300013306 | Bacteria | 1635 |
| 317 | Ga0157372_10008824 | 3300013307 | Bacteria | 10708 |
| 318 | Ga0157372_10309031 | 3300013307 | Bacteria | 1840 |
| 319 | Ga0157375_10003892 | 3300013308 | Bacteria | 12951 |
| 320 | Ga0157375_10004006 | 3300013308 | Bacteria | 12778 |
| 321 | Ga0157375_10016208 | 3300013308 | Bacteria | 6684 |
| 322 | Ga0157375_10086370 | 3300013308 | Bacteria | 3188 |
| 323 | Ga0157375_10103526 | 3300013308 | Bacteria | 2934 |
| 324 | Ga0157375_10247796 | 3300013308 | Bacteria | 1942 |
| 325 | Ga0157375_10427895 | 3300013308 | Bacteria | 1490 |
| 326 | Ga0163163_10007110 | 3300014325 | Bacteria | 9840 |
| 327 | Ga0163163_10043622 | 3300014325 | Bacteria | 4397 |
| 328 | Ga0157380_10018093 | 3300014326 | Bacteria | 5227 |
| 329 | Ga0157380_10032636 | 3300014326 | Unclassified | 4007 |
| 330 | Ga0157380_10039774 | 3300014326 | Bacteria | 3659 |
| 331 | Ga0157380_10080362 | 3300014326 | Bacteria | 2664 |
| 332 | Ga0157380_10136826 | 3300014326 | Bacteria | 2098 |
| 333 | Ga0157380_10177339 | 3300014326 | Bacteria | 1869 |
| 334 | Ga0157377_10001163 | 3300014745 | Bacteria | 11149 |
| 335 | Ga0157377_10005504 | 3300014745 | Bacteria | 5959 |
| 336 | Ga0157377_10126072 | 3300014745 | Bacteria | 1558 |
| 337 | Ga0157379_10018892 | 3300014968 | Bacteria | 6081 |
| 338 | Ga0157379_10140789 | 3300014968 | Bacteria | 2175 |
| 339 | Ga0157376_10004119 | 3300014969 | Bacteria | 10073 |
| 340 | Ga0182006_1041690 | 3300015261 | Bacteria | 1801 |
| 341 | Ga0163161_10017674 | 3300017792 | Bacteria | 4996 |
| 342 | Ga0163161_10047150 | 3300017792 | Unclassified | 3112 |
| 343 | Ga0163161_10055314 | 3300017792 | Bacteria | 2881 |
| 344 | Ga0163161_10078165 | 3300017792 | Bacteria | 2432 |
| 345 | Ga0197907_10292294 | 3300020069 | Bacteria | 1676 |
| 346 | Ga0206355_1195442 | 3300020076 | Bacteria | 2100 |
| 347 | Ga0206351_10206386 | 3300020077 | Bacteria | 1904 |
| 348 | Ga0206351_10855698 | 3300020077 | Bacteria | 2173 |
| 349 | Ga0206352_10111744 | 3300020078 | Bacteria | 1992 |
| 350 | Ga0206352_11357117 | 3300020078 | Bacteria | 2025 |
| 351 | Ga0206353_11863956 | 3300020082 | Bacteria | 1900 |
| 352 | Ga0154015_1332211 | 3300020610 | Bacteria | 2384 |
| 353 | Ga0213872_10023559 | 3300021361 | Bacteria | 2833 |
| 354 | Ga0224712_10004327 | 3300022467 | Bacteria | 3817 |
| 355 | Ga0209025_1000053 | 3300025294 | Bacteria | 317600 |
| 356 | Ga0209758_1001127 | 3300025297 | Bacteria | 34298 |
| 357 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 358 | Ga0207692_10004714 | 3300025898 | Bacteria | 5411 |
| 359 | Ga0207692_10006213 | 3300025898 | Bacteria | 4837 |
| 360 | Ga0207642_10021960 | 3300025899 | Bacteria | 2522 |
| 361 | Ga0207710_10000227 | 3300025900 | Bacteria | 48932 |
| 362 | Ga0207688_10006721 | 3300025901 | Bacteria | 6255 |
| 363 | Ga0207688_10069458 | 3300025901 | Bacteria | 1996 |
| 364 | Ga0207647_10008001 | 3300025904 | Bacteria | 7603 |
| 365 | Ga0207647_10051955 | 3300025904 | Bacteria | 2531 |
| 366 | Ga0207647_10055729 | 3300025904 | Bacteria | 2428 |
| 367 | Ga0207685_10010684 | 3300025905 | Bacteria | 2724 |
| 368 | Ga0207685_10031309 | 3300025905 | Unclassified | 1903 |
| 369 | Ga0207699_10003875 | 3300025906 | Bacteria | 7148 |
| 370 | Ga0207645_10039419 | 3300025907 | Bacteria | 3027 |
| 371 | Ga0207705_10013443 | 3300025909 | Bacteria | 5905 |
| 372 | Ga0207684_10208636 | 3300025910 | Bacteria | 1685 |
| 373 | Ga0207654_10091040 | 3300025911 | Bacteria | 1859 |
| 374 | Ga0207707_10017087 | 3300025912 | Bacteria | 6322 |
| 375 | Ga0207707_10017437 | 3300025912 | Bacteria | 6260 |
| 376 | Ga0207695_10003637 | 3300025913 | Bacteria | 21542 |
| 377 | Ga0207693_10000009 | 3300025915 | Bacteria | 168990 |
| 378 | Ga0207693_10001273 | 3300025915 | Bacteria | 22484 |
| 379 | Ga0207693_10002186 | 3300025915 | Bacteria | 17054 |
| 380 | Ga0207693_10002493 | 3300025915 | Bacteria | 16014 |
| 381 | Ga0207693_10003950 | 3300025915 | Bacteria | 12603 |
| 382 | Ga0207693_10015101 | 3300025915 | Bacteria | 6199 |
| 383 | Ga0207693_10083758 | 3300025915 | Bacteria | 2498 |
| 384 | Ga0207693_10131025 | 3300025915 | Bacteria | 1971 |
| 385 | Ga0207663_10005201 | 3300025916 | Bacteria | 6548 |
| 386 | Ga0207663_10005313 | 3300025916 | Bacteria | 6484 |
| 387 | Ga0207663_10016114 | 3300025916 | Bacteria | 4136 |
| 388 | Ga0207663_10023197 | 3300025916 | Bacteria | 3557 |
| 389 | Ga0207663_10066960 | 3300025916 | Bacteria | 2301 |
| 390 | Ga0207663_10080764 | 3300025916 | Bacteria | 2127 |
| 391 | Ga0207663_10128601 | 3300025916 | Bacteria | 1746 |
| 392 | Ga0207660_10085054 | 3300025917 | Bacteria | 2332 |
| 393 | Ga0207662_10056488 | 3300025918 | Bacteria | 2344 |
| 394 | Ga0207657_10005677 | 3300025919 | Bacteria | 13017 |
| 395 | Ga0207657_10012567 | 3300025919 | Bacteria | 8346 |
| 396 | Ga0207657_10093682 | 3300025919 | Bacteria | 2502 |
| 397 | Ga0207649_10116054 | 3300025920 | Bacteria | 1797 |
| 398 | Ga0207652_10051270 | 3300025921 | Bacteria | 3538 |
| 399 | Ga0207646_10082643 | 3300025922 | Bacteria | 2872 |
| 400 | Ga0207646_10104150 | 3300025922 | Bacteria | 2545 |
| 401 | Ga0207681_10045347 | 3300025923 | Bacteria | 2951 |
| 402 | Ga0207681_10086256 | 3300025923 | Bacteria | 2230 |
| 403 | Ga0207694_10076077 | 3300025924 | Unclassified | 2628 |
| 404 | Ga0207659_10003884 | 3300025926 | Bacteria | 9009 |
| 405 | Ga0207659_10040587 | 3300025926 | Bacteria | 3255 |
| 406 | Ga0207687_10027279 | 3300025927 | Bacteria | 3831 |
| 407 | Ga0207687_10037166 | 3300025927 | Bacteria | 3320 |
| 408 | Ga0207687_10053621 | 3300025927 | Bacteria | 2818 |
| 409 | Ga0207687_10176006 | 3300025927 | Bacteria | 1654 |
| 410 | Ga0207700_10005015 | 3300025928 | Bacteria | 7875 |
| 411 | Ga0207700_10012605 | 3300025928 | Bacteria | 5461 |
| 412 | Ga0207700_10112071 | 3300025928 | Bacteria | 2197 |
| 413 | Ga0207664_10003838 | 3300025929 | Bacteria | 10096 |
| 414 | Ga0207664_10005028 | 3300025929 | Bacteria | 8996 |
| 415 | Ga0207664_10007360 | 3300025929 | Bacteria | 7630 |
| 416 | Ga0207664_10008030 | 3300025929 | Bacteria | 7338 |
| 417 | Ga0207664_10012014 | 3300025929 | Bacteria | 6182 |
| 418 | Ga0207664_10022821 | 3300025929 | Bacteria | 4680 |
| 419 | Ga0207664_10051885 | 3300025929 | Bacteria | 3241 |
| 420 | Ga0207664_10053517 | 3300025929 | Bacteria | 3196 |
| 421 | Ga0207664_10070425 | 3300025929 | Bacteria | 2814 |
| 422 | Ga0207664_10097511 | 3300025929 | Bacteria | 2422 |
| 423 | Ga0207690_10029423 | 3300025932 | Bacteria | 3493 |
| 424 | Ga0207690_10039765 | 3300025932 | Bacteria | 3070 |
| 425 | Ga0207690_10071111 | 3300025932 | Bacteria | 2399 |
| 426 | Ga0207706_10002554 | 3300025933 | Bacteria | 17744 |
| 427 | Ga0207706_10003441 | 3300025933 | Bacteria | 15118 |
| 428 | Ga0207706_10005339 | 3300025933 | Bacteria | 11976 |
| 429 | Ga0207706_10015246 | 3300025933 | Bacteria | 6951 |
| 430 | Ga0207706_10018736 | 3300025933 | Bacteria | 6226 |
| 431 | Ga0207706_10040269 | 3300025933 | Bacteria | 4141 |
| 432 | Ga0207706_10099242 | 3300025933 | Bacteria | 2562 |
| 433 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 434 | Ga0207686_10001551 | 3300025934 | Bacteria | 12972 |
| 435 | Ga0207686_10053260 | 3300025934 | Bacteria | 2529 |
| 436 | Ga0207709_10001318 | 3300025935 | Bacteria | 17566 |
| 437 | Ga0207709_10035002 | 3300025935 | Bacteria | 2965 |
| 438 | Ga0207709_10068835 | 3300025935 | Bacteria | 2239 |
| 439 | Ga0207709_10117364 | 3300025935 | Bacteria | 1790 |
| 440 | Ga0207670_10021496 | 3300025936 | Bacteria | 3982 |
| 441 | Ga0207669_10020443 | 3300025937 | Bacteria | 3473 |
| 442 | Ga0207704_10006123 | 3300025938 | Bacteria | 5579 |
| 443 | Ga0207704_10016620 | 3300025938 | Bacteria | 3787 |
| 444 | Ga0207704_10102160 | 3300025938 | Bacteria | 1914 |
| 445 | Ga0207665_10001498 | 3300025939 | Bacteria | 15698 |
| 446 | Ga0207665_10004626 | 3300025939 | Bacteria | 9137 |
| 447 | Ga0207665_10039692 | 3300025939 | Bacteria | 3139 |
| 448 | Ga0207665_10043840 | 3300025939 | Bacteria | 2992 |
| 449 | Ga0207691_10003769 | 3300025940 | Bacteria | 14721 |
| 450 | Ga0207691_10178554 | 3300025940 | Bacteria | 1856 |
| 451 | Ga0207711_10018257 | 3300025941 | Bacteria | 5830 |
| 452 | Ga0207711_10162875 | 3300025941 | Bacteria | 2020 |
| 453 | Ga0207689_10028298 | 3300025942 | Bacteria | 4690 |
| 454 | Ga0207689_10036645 | 3300025942 | Bacteria | 4072 |
| 455 | Ga0207689_10071506 | 3300025942 | Bacteria | 2849 |
| 456 | Ga0207689_10150840 | 3300025942 | Bacteria | 1916 |
| 457 | Ga0207661_10000896 | 3300025944 | Bacteria | 19528 |
| 458 | Ga0207661_10005047 | 3300025944 | Bacteria | 9262 |
| 459 | Ga0207661_10017682 | 3300025944 | Bacteria | 5283 |
| 460 | Ga0207661_10023477 | 3300025944 | Bacteria | 4660 |
| 461 | Ga0207661_10060629 | 3300025944 | Bacteria | 3053 |
| 462 | Ga0207661_10181926 | 3300025944 | Bacteria | 1837 |
| 463 | Ga0207679_10033544 | 3300025945 | Bacteria | 3613 |
| 464 | Ga0207712_10018506 | 3300025961 | Bacteria | 4539 |
| 465 | Ga0207712_10064710 | 3300025961 | Bacteria | 2608 |
| 466 | Ga0207712_10111032 | 3300025961 | Bacteria | 2057 |
| 467 | Ga0207712_10120762 | 3300025961 | Bacteria | 1982 |
| 468 | Ga0207668_10007005 | 3300025972 | Bacteria | 6686 |
| 469 | Ga0207668_10137382 | 3300025972 | Bacteria | 1875 |
| 470 | Ga0207668_10142092 | 3300025972 | Bacteria | 1847 |
| 471 | Ga0207640_10109174 | 3300025981 | Unclassified | 1957 |
| 472 | Ga0207658_10000465 | 3300025986 | Bacteria | 37863 |
| 473 | Ga0207677_10044985 | 3300026023 | Bacteria | 2945 |
| 474 | Ga0207677_10087065 | 3300026023 | Unclassified | 2260 |
| 475 | Ga0207677_10140050 | 3300026023 | Bacteria | 1851 |
| 476 | Ga0207703_10121530 | 3300026035 | Bacteria | 2242 |
| 477 | Ga0207703_10246477 | 3300026035 | Bacteria | 1608 |
| 478 | Ga0207639_10005344 | 3300026041 | Bacteria | 8678 |
| 479 | Ga0207639_10075794 | 3300026041 | Bacteria | 2646 |
| 480 | Ga0207678_10003330 | 3300026067 | Bacteria | 14492 |
| 481 | Ga0207678_10013416 | 3300026067 | Bacteria | 7192 |
| 482 | Ga0207678_10016969 | 3300026067 | Bacteria | 6394 |
| 483 | Ga0207678_10098105 | 3300026067 | Bacteria | 2503 |
| 484 | Ga0207678_10145917 | 3300026067 | Bacteria | 2020 |
| 485 | Ga0207708_10002772 | 3300026075 | Bacteria | 12872 |
| 486 | Ga0207708_10013121 | 3300026075 | Bacteria | 6183 |
| 487 | Ga0207708_10017990 | 3300026075 | Bacteria | 5317 |
| 488 | Ga0207708_10020425 | 3300026075 | Bacteria | 4996 |
| 489 | Ga0207708_10058018 | 3300026075 | Bacteria | 2954 |
| 490 | Ga0207702_10028773 | 3300026078 | Bacteria | 4621 |
| 491 | Ga0207702_10044134 | 3300026078 | Bacteria | 3746 |
| 492 | Ga0207702_10050195 | 3300026078 | Bacteria | 3522 |
| 493 | Ga0207702_10063186 | 3300026078 | Bacteria | 3165 |
| 494 | Ga0207702_10085384 | 3300026078 | Bacteria | 2750 |
| 495 | Ga0207641_10011889 | 3300026088 | Bacteria | 7140 |
| 496 | Ga0207641_10042529 | 3300026088 | Bacteria | 3812 |
| 497 | Ga0207641_10084193 | 3300026088 | Unclassified | 2768 |
| 498 | Ga0207648_10003623 | 3300026089 | Bacteria | 16151 |
| 499 | Ga0207648_10003682 | 3300026089 | Bacteria | 16035 |
| 500 | Ga0207648_10005519 | 3300026089 | Bacteria | 12747 |
| 501 | Ga0207648_10074878 | 3300026089 | Bacteria | 2951 |
| 502 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 503 | Ga0207676_10056628 | 3300026095 | Bacteria | 3083 |
| 504 | Ga0207674_10001090 | 3300026116 | Bacteria | 35329 |
| 505 | Ga0207674_10025958 | 3300026116 | Bacteria | 6235 |
| 506 | Ga0207675_100036180 | 3300026118 | Bacteria | 4605 |
| 507 | Ga0207675_100088285 | 3300026118 | Bacteria | 2912 |
| 508 | Ga0207675_100213549 | 3300026118 | Bacteria | 1857 |
| 509 | Ga0207675_100234454 | 3300026118 | Bacteria | 1772 |
| 510 | Ga0207683_10000941 | 3300026121 | Bacteria | 26696 |
| 511 | Ga0207683_10020763 | 3300026121 | Bacteria | 5620 |
| 512 | Ga0207683_10102639 | 3300026121 | Bacteria | 2554 |
| 513 | Ga0207683_10125432 | 3300026121 | Bacteria | 2307 |
| 514 | Ga0207698_10008521 | 3300026142 | Bacteria | 6494 |
| 515 | Ga0207698_10059113 | 3300026142 | Bacteria | 2975 |
| 516 | Ga0207698_10099693 | 3300026142 | Bacteria | 2404 |
| 517 | Ga0207698_10122177 | 3300026142 | Bacteria | 2206 |
| 518 | Ga0207428_10001212 | 3300027907 | Bacteria | 27686 |
| 519 | Ga0207428_10014005 | 3300027907 | Bacteria | 6985 |
| 520 | Ga0207428_10080458 | 3300027907 | Unclassified | 2545 |
| 521 | Ga0268266_10161541 | 3300028379 | Bacteria | 2027 |
| 522 | Ga0268266_10167727 | 3300028379 | Bacteria | 1991 |
| 523 | Ga0268265_10001048 | 3300028380 | Bacteria | 24851 |
| 524 | Ga0268264_10110101 | 3300028381 | Bacteria | 2411 |
| 525 | Ga0268264_10175727 | 3300028381 | Bacteria | 1941 |
| 526 | Ga0268264_10212271 | 3300028381 | Bacteria | 1777 |
| 527 | Ga0268264_10220509 | 3300028381 | Bacteria | 1746 |
| 528 | Ga0265337_1000060 | 3300028556 | Bacteria | 49697 |
| 529 | Ga0265326_10000056 | 3300028558 | Bacteria | 64840 |
| 530 | Ga0265319_1000037 | 3300028563 | Bacteria | 115642 |
| 531 | Ga0265322_10000017 | 3300028654 | Bacteria | 114833 |
| 532 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 533 | Ga0265338_10175064 | 3300028800 | Bacteria | 1641 |
| 534 | Ga0265324_10000196 | 3300029957 | Bacteria | 46096 |
| 535 | Ga0307511_10020634 | 3300030521 | Bacteria | 6233 |
| 536 | Ga0265332_10022481 | 3300031238 | Bacteria | 2783 |
| 537 | Ga0265328_10000258 | 3300031239 | Bacteria | 24453 |
| 538 | Ga0265320_10000068 | 3300031240 | Bacteria | 91884 |
| 539 | Ga0265329_10001686 | 3300031242 | Bacteria | 10577 |
| 540 | Ga0265331_10000606 | 3300031250 | Bacteria | 31608 |
| 541 | Ga0265331_10004016 | 3300031250 | Bacteria | 9283 |
| 542 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 543 | Ga0265327_10000317 | 3300031251 | Bacteria | 92215 |
| 544 | Ga0265327_10063849 | 3300031251 | Bacteria | 1868 |
| 545 | Ga0265316_10034806 | 3300031344 | Bacteria | 4089 |
| 546 | Ga0307513_10006242 | 3300031456 | Bacteria | 15613 |
| 547 | Ga0307513_10201135 | 3300031456 | Bacteria | 1833 |
| 548 | Ga0307408_100020500 | 3300031548 | Bacteria | 4465 |
| 549 | Ga0265313_10006987 | 3300031595 | Bacteria | 7829 |
| 550 | Ga0307508_10150367 | 3300031616 | Bacteria | 1932 |
| 551 | Ga0316575_10001075 | 3300031665 | Bacteria | 8519 |
| 552 | Ga0316575_10002167 | 3300031665 | Bacteria | 6550 |
| 553 | Ga0316579_10005583 | 3300031691 | Bacteria | 5088 |
| 554 | Ga0265314_10000973 | 3300031711 | Bacteria | 33669 |
| 555 | Ga0265314_10064755 | 3300031711 | Bacteria | 2473 |
| 556 | Ga0265342_10094047 | 3300031712 | Bacteria | 1715 |
| 557 | Ga0316576_10001067 | 3300031727 | Bacteria | 14245 |
| 558 | Ga0316576_10012627 | 3300031727 | Bacteria | 5587 |
| 559 | Ga0316576_10028532 | 3300031727 | Bacteria | 3934 |
| 560 | Ga0316576_10108327 | 3300031727 | Bacteria | 2081 |
| 561 | Ga0316578_10014810 | 3300031728 | Bacteria | 4178 |
| 562 | Ga0316577_10011476 | 3300031733 | Bacteria | 4800 |
| 563 | Ga0316577_10033831 | 3300031733 | Bacteria | 2856 |
| 564 | Ga0307413_10000272 | 3300031824 | Bacteria | 15774 |
| 565 | Ga0307410_10002547 | 3300031852 | Bacteria | 8826 |
| 566 | Ga0307406_10014287 | 3300031901 | Bacteria | 4565 |
| 567 | Ga0307407_10001800 | 3300031903 | Bacteria | 8022 |
| 568 | Ga0307412_10017513 | 3300031911 | Bacteria | 4289 |
| 569 | Ga0307409_100011608 | 3300031995 | Bacteria | 5565 |
| 570 | Ga0307416_100139478 | 3300032002 | Bacteria | 2201 |
| 571 | Ga0307414_10003567 | 3300032004 | Bacteria | 8329 |
| 572 | Ga0307411_10000003 | 3300032005 | Bacteria | 477556 |
| 573 | Ga0307411_10047461 | 3300032005 | Bacteria | 2776 |
| 574 | Ga0307415_100009645 | 3300032126 | Bacteria | 5427 |
| 575 | Ga0316585_10003725 | 3300032137 | Bacteria | 4205 |
| 576 | Ga0316585_10005770 | 3300032137 | Bacteria | 3505 |
| 577 | Ga0316580_10001868 | 3300032139 | Bacteria | 5650 |
| 578 | Ga0373926_0000085 | 3300035083 | Bacteria | 17960 |
| 579 | Ga0373934_0004651 | 3300035086 | Bacteria | 5075 |
| 580 | Ga0373940_0038524 | 3300035088 | Bacteria | 1305 |
| 581 | Ga0373944_0000201 | 3300035089 | Bacteria | 12777 |
| 582 | Ga0373951_0012974 | 3300035091 | Bacteria | 1874 |
| 583 | Ga0373923_0000654 | 3300035111 | Bacteria | 8765 |
| 584 | Ga0373932_0022750 | 3300035112 | Bacteria | 1668 |
| 585 | Ga0373936_0001199 | 3300035113 | Bacteria | 9336 |
| 586 | Ga0373936_0019069 | 3300035113 | Bacteria | 2656 |
| 587 | Ga0373941_0011532 | 3300035115 | Bacteria | 2286 |
| 588 | Ga0373945_0000115 | 3300035116 | Bacteria | 19575 |
| 589 | Ga0373945_0000374 | 3300035116 | Bacteria | 12870 |
| 590 | Ga0373953_0000290 | 3300035117 | Bacteria | 13750 |
| 591 | Ga0373953_0001319 | 3300035117 | Bacteria | 7116 |
| 592 | Ga0373954_0000277 | 3300035118 | Bacteria | 18681 |
| 593 | Ga0373954_0006958 | 3300035118 | Bacteria | 4938 |
| 594 | Ga0373956_0000733 | 3300035119 | Bacteria | 13479 |
| 595 | Ga0373956_0012653 | 3300035119 | Bacteria | 3501 |
| 596 | Ga0373957_0000032 | 3300035120 | Bacteria | 36214 |
| 597 | Ga0373957_0009644 | 3300035120 | Bacteria | 3164 |
| 598 | Ga0373943_0000129 | 3300035170 | Bacteria | 28679 |
| 599 | Ga0373943_0003042 | 3300035170 | Bacteria | 7618 |
| 600 | Ga0373943_0023348 | 3300035170 | Bacteria | 2875 |
| 601 | Ga0373943_0076020 | 3300035170 | Bacteria | 1712 |
| 602 | Ga0373946_0000428 | 3300035171 | Bacteria | 13745 |
| 603 | Ga0373946_0000709 | 3300035171 | Bacteria | 11299 |
| 604 | Ga0373955_0000092 | 3300035172 | Bacteria | 36115 |
| 605 | Ga0373955_0026927 | 3300035172 | Bacteria | 2967 |
| 606 | Ga0373955_0030615 | 3300035172 | Bacteria | 2811 |
| 607 | Ga0316574_0000052 | 3300035398 | Bacteria | 29685 |
| 608 | Ga0316574_0036378 | 3300035398 | Bacteria | 3013 |
| 609 | Ga0316574_0074281 | 3300035398 | Bacteria | 2151 |
| 610 | Ga0373924_0000555 | 3300035410 | Bacteria | 11493 |
| 611 | Ga0373924_0009457 | 3300035410 | Bacteria | 3571 |
| 612 | Ga0373931_0018769 | 3300035691 | Bacteria | 3443 |
| 613 | Ga0373935_0000628 | 3300035692 | Bacteria | 18518 |
| 614 | Ga0373935_0003273 | 3300035692 | Bacteria | 9366 |
| 615 | Ga0373935_0168636 | 3300035692 | Bacteria | 1496 |
| 616 | Ga0373927_0002848 | 3300035695 | Bacteria | 12621 |
| 617 | Ga0373927_0004146 | 3300035695 | Bacteria | 10196 |
| 618 | Ga0373927_0074168 | 3300035695 | Bacteria | 2203 |
| 619 | Ga0373933_0000121 | 3300035724 | Bacteria | 50773 |
| 620 | Ga0373947_0000901 | 3300035725 | Bacteria | 17992 |
| 621 | Ga0373947_0003331 | 3300035725 | Bacteria | 9516 |
| 622 | Ga0373947_0038902 | 3300035725 | Bacteria | 2829 |
| 623 | Ga0373947_0057317 | 3300035725 | Bacteria | 2357 |
| 624 | Ga0373947_0058616 | 3300035725 | Bacteria | 2333 |
| 625 | Ga0373947_0120244 | 3300035725 | Bacteria | 1668 |
| 626 | Ga0373947_0142491 | 3300035725 | Bacteria | 1538 |
| 627 | Ga0373937_0000169 | 3300036401 | Bacteria | 63595 |
| 628 | Ga0373937_0018127 | 3300036401 | Bacteria | 6280 |
| 629 | Ga0373937_0018778 | 3300036401 | Bacteria | 6179 |
| 630 | Ga0373937_0021306 | 3300036401 | Bacteria | 5817 |
| 631 | Ga0373937_0048404 | 3300036401 | Bacteria | 3892 |
| 632 | Ga0373937_0057773 | 3300036401 | Bacteria | 3564 |
| 633 | Ga0373937_0116738 | 3300036401 | Bacteria | 2485 |
| 634 | Ga0316582_0000166 | 3300036647 | Bacteria | 20311 |
| 635 | Ga0316584_0005054 | 3300036712 | Bacteria | 8789 |
| 636 | Ga0316584_0007826 | 3300036712 | Bacteria | 7331 |
| 637 | Ga0316584_0026524 | 3300036712 | Bacteria | 4259 |
| 638 | Ga0316584_0029469 | 3300036712 | Bacteria | 4051 |
| 639 | Ga0316584_0051911 | 3300036712 | Bacteria | 3067 |
| 640 | Ga0316584_0091485 | 3300036712 | Bacteria | 2278 |
| 641 | Ga0316584_0139184 | 3300036712 | Bacteria | 1811 |
| 642 | Ga0373925_0002434 | 3300037068 | Bacteria | 14935 |
| 643 | Ga0373925_0003472 | 3300037068 | Bacteria | 12194 |
| 644 | Ga0373925_0034931 | 3300037068 | Bacteria | 3707 |
| 645 | Ga0373925_0037510 | 3300037068 | Bacteria | 3578 |
| 646 | Ga0373925_0140157 | 3300037068 | Bacteria | 1892 |
| 647 | Ga0395900_0111834 | 3300037418 | Bacteria | 2805 |
| 648 | Ga0395900_0233340 | 3300037418 | Bacteria | 1849 |
| 649 | Ga0395898_0028626 | 3300037466 | Bacteria | 5583 |
| 650 | Ga0395898_0190730 | 3300037466 | Bacteria | 1958 |
| 651 | Ga0316581_0001663 | 3300037588 | Bacteria | 5103 |
| 652 | Ga0395901_0018262 | 3300038443 | Bacteria | 7161 |
| 653 | Ga0395901_0161922 | 3300038443 | Bacteria | 2350 |
| 654 | Ga0395901_0193477 | 3300038443 | Bacteria | 2133 |
| 655 | Ga0242420_000347 | 3300038996 | Bacteria | 5142 |
| 656 | Ga0436360_0633769 | 3300039438 | Bacteria | 11634 |
| 657 | Ga0436361_0002000 | 3300039447 | Bacteria | 1855 |
| 658 | Ga0436361_0035073 | 3300039447 | Bacteria | 7878 |
| 659 | Ga0436361_0336407 | 3300039447 | Bacteria | 16691 |
| 660 | Ga0436361_0510461 | 3300039447 | Bacteria | 4197 |
| 661 | Ga0436361_0735490 | 3300039447 | Bacteria | 23457 |
| 662 | Ga0436363_0472667 | 3300039450 | Bacteria | 1777 |
| 663 | Ga0436362_0003157 | 3300039453 | Bacteria | 13284 |
| 664 | Ga0439447_000024 | 3300041407 | Bacteria | 53601 |
| 665 | Ga0451853_1257484 | 3300041512 | Bacteria | 3450 |
| 666 | Ga0466963_0000281 | 3300044694 | Bacteria | 22762 |
| 667 | Ga0466963_0004575 | 3300044694 | Bacteria | 8052 |
| 668 | Ga0466958_0007766 | 3300045836 | Bacteria | 5919 |
| 669 | Ga0466967_0003703 | 3300045976 | Bacteria | 10067 |
| 670 | Ga0466967_0015423 | 3300045976 | Bacteria | 5989 |
| 671 | Ga0466967_0052298 | 3300045976 | Bacteria | 3584 |
| 672 | Ga0466967_0077622 | 3300045976 | Bacteria | 2990 |
| 673 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 674 | Ga0495592_0000220 | 3300046454 | Bacteria | 49173 |
| 675 | Ga0495592_0003048 | 3300046454 | Bacteria | 11941 |
| 676 | Ga0495603_0023570 | 3300046455 | Bacteria | 3722 |
| 677 | Ga0495603_0033679 | 3300046455 | Bacteria | 3082 |
| 678 | Ga0495629_0009244 | 3300046459 | Bacteria | 7212 |
| 679 | Ga0495629_0041398 | 3300046459 | Bacteria | 3242 |
| 680 | Ga0495629_0088760 | 3300046459 | Bacteria | 2157 |
| 681 | Ga0495629_0177689 | 3300046459 | Bacteria | 1476 |
| 682 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 683 | Ga0495641_0000742 | 3300046461 | Bacteria | 27572 |
| 684 | Ga0495641_0004675 | 3300046461 | Bacteria | 9554 |
| 685 | Ga0495641_0018240 | 3300046461 | Bacteria | 3626 |
| 686 | Ga0495641_0038696 | 3300046461 | Bacteria | 2227 |
| 687 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 688 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 689 | Ga0495651_0002437 | 3300046462 | Bacteria | 14361 |
| 690 | Ga0495651_0009283 | 3300046462 | Bacteria | 7548 |
| 691 | Ga0495651_0012581 | 3300046462 | Bacteria | 6530 |
| 692 | Ga0495651_0066441 | 3300046462 | Bacteria | 2752 |
| 693 | Ga0495651_0126539 | 3300046462 | Bacteria | 1871 |
| 694 | Ga0495653_0000416 | 3300046463 | Bacteria | 34136 |
| 695 | Ga0495653_0000669 | 3300046463 | Bacteria | 26191 |
| 696 | Ga0495653_0013842 | 3300046463 | Bacteria | 6574 |
| 697 | Ga0495653_0039619 | 3300046463 | Bacteria | 3690 |
| 698 | Ga0495653_0089525 | 3300046463 | Bacteria | 2254 |
| 699 | Ga0495582_0007328 | 3300046473 | Bacteria | 6112 |
| 700 | Ga0495582_0019734 | 3300046473 | Bacteria | 3686 |
| 701 | Ga0495582_0025352 | 3300046473 | Bacteria | 3248 |
| 702 | Ga0495662_0001224 | 3300046476 | Bacteria | 12633 |
| 703 | Ga0495662_0035185 | 3300046476 | Bacteria | 2417 |
| 704 | Ga0495664_0001885 | 3300046477 | Bacteria | 11153 |
| 705 | Ga0495664_0006030 | 3300046477 | Bacteria | 6681 |
| 706 | Ga0495664_0018691 | 3300046477 | Bacteria | 3976 |
| 707 | Ga0495664_0095018 | 3300046477 | Bacteria | 1794 |
| 708 | Ga0495584_0050343 | 3300046491 | Bacteria | 2098 |
| 709 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 710 | Ga0495594_0037340 | 3300046499 | Bacteria | 2650 |
| 711 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 712 | Ga0495608_0000584 | 3300046511 | Bacteria | 25040 |
| 713 | Ga0495608_0005192 | 3300046511 | Bacteria | 9304 |
| 714 | Ga0495608_0018319 | 3300046511 | Bacteria | 4832 |
| 715 | Ga0495608_0027634 | 3300046511 | Bacteria | 3859 |
| 716 | Ga0495608_0050745 | 3300046511 | Bacteria | 2752 |
| 717 | Ga0495608_0093071 | 3300046511 | Bacteria | 1947 |
| 718 | Ga0495618_0002174 | 3300046514 | Bacteria | 12819 |
| 719 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 720 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 721 | Ga0495628_0000106 | 3300046516 | Bacteria | 67965 |
| 722 | Ga0495628_0000548 | 3300046516 | Bacteria | 34470 |
| 723 | Ga0495628_0008134 | 3300046516 | Bacteria | 9024 |
| 724 | Ga0495628_0026747 | 3300046516 | Bacteria | 4699 |
| 725 | Ga0495628_0076419 | 3300046516 | Bacteria | 2606 |
| 726 | Ga0495628_0077467 | 3300046516 | Bacteria | 2586 |
| 727 | Ga0495628_0089313 | 3300046516 | Bacteria | 2387 |
| 728 | Ga0495628_0095682 | 3300046516 | Bacteria | 2294 |
| 729 | Ga0495628_0143245 | 3300046516 | Bacteria | 1823 |
| 730 | Ga0495630_0007970 | 3300046517 | Bacteria | 7602 |
| 731 | Ga0495630_0027711 | 3300046517 | Bacteria | 4207 |
| 732 | Ga0495630_0218180 | 3300046517 | Bacteria | 1456 |
| 733 | Ga0495666_0001713 | 3300046526 | Bacteria | 10830 |
| 734 | Ga0495652_0000119 | 3300046529 | Bacteria | 85582 |
| 735 | Ga0495652_0002645 | 3300046529 | Bacteria | 18255 |
| 736 | Ga0495652_0006599 | 3300046529 | Bacteria | 10780 |
| 737 | Ga0495652_0012958 | 3300046529 | Bacteria | 7515 |
| 738 | Ga0495652_0024428 | 3300046529 | Bacteria | 5349 |
| 739 | Ga0495652_0036500 | 3300046529 | Bacteria | 4273 |
| 740 | Ga0495652_0057114 | 3300046529 | Bacteria | 3311 |
| 741 | Ga0495652_0079778 | 3300046529 | Bacteria | 2705 |
| 742 | Ga0495665_0001874 | 3300046531 | Bacteria | 11363 |
| 743 | Ga0495665_0025665 | 3300046531 | Bacteria | 3165 |
| 744 | Ga0495640_0002238 | 3300046533 | Bacteria | 15493 |
| 745 | Ga0495640_0012252 | 3300046533 | Bacteria | 6561 |
| 746 | Ga0495640_0069624 | 3300046533 | Bacteria | 2366 |
| 747 | Ga0495586_0011461 | 3300046535 | Bacteria | 4713 |
| 748 | Ga0495586_0028610 | 3300046535 | Bacteria | 2982 |
| 749 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 750 | Ga0495587_0000119 | 3300046536 | Bacteria | 60244 |
| 751 | Ga0495587_0000208 | 3300046536 | Bacteria | 43565 |
| 752 | Ga0495587_0021986 | 3300046536 | Bacteria | 3931 |
| 753 | Ga0495587_0076226 | 3300046536 | Bacteria | 1947 |
| 754 | Ga0495645_0000073 | 3300046543 | Bacteria | 70164 |
| 755 | Ga0495645_0004517 | 3300046543 | Bacteria | 9499 |
| 756 | Ga0495645_0009728 | 3300046543 | Bacteria | 6724 |
| 757 | Ga0495645_0014243 | 3300046543 | Bacteria | 5639 |
| 758 | Ga0495645_0025818 | 3300046543 | Bacteria | 4265 |
| 759 | Ga0495645_0027180 | 3300046543 | Bacteria | 4155 |
| 760 | Ga0495645_0050054 | 3300046543 | Bacteria | 3042 |
| 761 | Ga0495645_0087386 | 3300046543 | Bacteria | 2230 |
| 762 | Ga0495645_0150754 | 3300046543 | Bacteria | 1615 |
| 763 | Ga0495622_0000033 | 3300046557 | Bacteria | 124162 |
| 764 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 765 | Ga0495667_0000253 | 3300046559 | Bacteria | 34719 |
| 766 | Ga0495667_0000786 | 3300046559 | Bacteria | 20379 |
| 767 | Ga0495667_0004224 | 3300046559 | Bacteria | 9683 |
| 768 | Ga0495667_0004526 | 3300046559 | Bacteria | 9380 |
| 769 | Ga0495667_0024978 | 3300046559 | Bacteria | 4026 |
| 770 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 771 | Ga0495634_0001902 | 3300046642 | Bacteria | 17893 |
| 772 | Ga0495634_0003663 | 3300046642 | Bacteria | 12250 |
| 773 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 774 | Ga0495635_0006237 | 3300046663 | Bacteria | 8305 |
| 775 | Ga0495635_0007795 | 3300046663 | Bacteria | 7476 |
| 776 | Ga0495635_0104834 | 3300046663 | Bacteria | 1932 |
| 777 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 778 | Ga0495657_0027438 | 3300046675 | Bacteria | 4018 |
| 779 | Ga0495657_0032893 | 3300046675 | Bacteria | 3615 |
| 780 | Ga0495657_0109621 | 3300046675 | Bacteria | 1750 |
| 781 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 782 | Ga0495599_0000173 | 3300046678 | Bacteria | 42460 |
| 783 | Ga0495599_0003417 | 3300046678 | Bacteria | 9292 |
| 784 | Ga0495599_0023499 | 3300046678 | Bacteria | 3855 |
| 785 | Ga0495599_0031788 | 3300046678 | Bacteria | 3313 |
| 786 | Ga0495599_0054268 | 3300046678 | Bacteria | 2511 |
| 787 | Ga0495623_0000101 | 3300046679 | Bacteria | 52470 |
| 788 | Ga0495623_0035821 | 3300046679 | Bacteria | 3181 |
| 789 | Ga0495623_0047400 | 3300046679 | Bacteria | 2727 |
| 790 | Ga0495623_0054890 | 3300046679 | Bacteria | 2513 |
| 791 | Ga0495623_0074173 | 3300046679 | Bacteria | 2114 |
| 792 | Ga0495623_0097522 | 3300046679 | Bacteria | 1795 |
| 793 | Ga0495646_0005486 | 3300046680 | Bacteria | 8017 |
| 794 | Ga0495646_0009050 | 3300046680 | Bacteria | 6313 |
| 795 | Ga0495646_0010006 | 3300046680 | Bacteria | 6029 |
| 796 | Ga0495646_0014587 | 3300046680 | Bacteria | 4993 |
| 797 | Ga0495646_0026385 | 3300046680 | Bacteria | 3649 |
| 798 | Ga0495646_0028953 | 3300046680 | Bacteria | 3466 |
| 799 | Ga0495647_0013226 | 3300046681 | Bacteria | 2857 |
| 800 | Ga0495647_0044345 | 3300046681 | Bacteria | 1705 |
| 801 | Ga0495658_0001583 | 3300046683 | Bacteria | 11873 |
| 802 | Ga0495658_0002011 | 3300046683 | Bacteria | 10362 |
| 803 | Ga0495613_0007629 | 3300046689 | Bacteria | 8046 |
| 804 | Ga0495613_0107403 | 3300046689 | Bacteria | 2013 |
| 805 | Ga0495613_0201242 | 3300046689 | Bacteria | 1404 |
| 806 | Ga0495624_0002113 | 3300046690 | Bacteria | 15159 |
| 807 | Ga0495624_0018620 | 3300046690 | Bacteria | 4643 |
| 808 | Ga0495624_0032751 | 3300046690 | Bacteria | 3368 |
| 809 | Ga0495600_0003523 | 3300046809 | Bacteria | 9203 |
| 810 | Ga0495600_0005898 | 3300046809 | Bacteria | 7411 |
| 811 | Ga0495600_0012266 | 3300046809 | Bacteria | 5355 |
| 812 | Ga0495600_0057945 | 3300046809 | Bacteria | 2530 |
| 813 | Ga0495581_0000642 | 3300047315 | Bacteria | 18306 |
| 814 | Ga0495581_0001959 | 3300047315 | Bacteria | 11531 |
| 815 | Ga0495581_0010170 | 3300047315 | Bacteria | 5442 |
| 816 | Ga0495604_0000120 | 3300047317 | Bacteria | 66462 |
| 817 | Ga0495604_0000121 | 3300047317 | Bacteria | 65991 |
| 818 | Ga0495604_0006362 | 3300047317 | Bacteria | 9364 |
| 819 | Ga0495604_0011115 | 3300047317 | Bacteria | 7146 |
| 820 | Ga0495674_0005612 | 3300047319 | Bacteria | 12032 |
| 821 | Ga0495674_0011270 | 3300047319 | Bacteria | 8440 |
| 822 | Ga0495674_0019676 | 3300047319 | Bacteria | 6263 |
| 823 | Ga0495674_0059367 | 3300047319 | Bacteria | 3340 |
| 824 | Ga0495674_0123969 | 3300047319 | Unclassified | 2181 |
| 825 | Ga0495676_0000928 | 3300047321 | Bacteria | 24577 |
| 826 | Ga0495676_0003693 | 3300047321 | Bacteria | 13893 |
| 827 | Ga0495676_0004043 | 3300047321 | Bacteria | 13354 |
| 828 | Ga0495676_0006190 | 3300047321 | Bacteria | 11004 |
| 829 | Ga0495676_0066007 | 3300047321 | Bacteria | 2806 |
| 830 | Ga0495676_0147446 | 3300047321 | Bacteria | 1679 |
| 831 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 832 | Ga0495680_0001641 | 3300047322 | Bacteria | 23765 |
| 833 | Ga0495680_0001765 | 3300047322 | Bacteria | 22914 |
| 834 | Ga0495680_0002289 | 3300047322 | Bacteria | 19707 |
| 835 | Ga0495680_0005698 | 3300047322 | Bacteria | 11659 |
| 836 | Ga0495680_0009533 | 3300047322 | Bacteria | 8725 |
| 837 | Ga0495680_0018763 | 3300047322 | Bacteria | 5862 |
| 838 | Ga0495680_0020072 | 3300047322 | Bacteria | 5630 |
| 839 | Ga0495680_0037660 | 3300047322 | Bacteria | 3873 |
| 840 | Ga0495680_0084308 | 3300047322 | Bacteria | 2395 |
| 841 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 842 | Ga0495675_0000176 | 3300047444 | Bacteria | 46587 |
| 843 | Ga0495675_0071560 | 3300047444 | Bacteria | 2188 |
| 844 | Ga0495675_0077140 | 3300047444 | Bacteria | 2099 |
| 845 | Ga0495684_0000562 | 3300047471 | Bacteria | 30116 |
| 846 | Ga0495684_0001716 | 3300047471 | Bacteria | 17633 |
| 847 | Ga0495684_0001870 | 3300047471 | Bacteria | 16849 |
| 848 | Ga0495684_0008951 | 3300047471 | Bacteria | 7732 |
| 849 | Ga0495684_0010104 | 3300047471 | Bacteria | 7299 |
| 850 | Ga0495684_0010681 | 3300047471 | Bacteria | 7099 |
| 851 | Ga0495684_0052690 | 3300047471 | Bacteria | 3105 |
| 852 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 853 | Ga0495686_0104501 | 3300047472 | Bacteria | 1705 |
| 854 | Ga0495593_0004833 | 3300047673 | Bacteria | 7990 |
| 855 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 856 | Ga0495602_0001081 | 3300048088 | Bacteria | 26704 |
| 857 | Ga0495602_0004291 | 3300048088 | Bacteria | 14846 |
| 858 | Ga0495602_0004572 | 3300048088 | Bacteria | 14436 |
| 859 | Ga0495602_0034960 | 3300048088 | Bacteria | 4692 |
| 860 | Ga0495602_0038087 | 3300048088 | Bacteria | 4452 |
| 861 | Ga0495602_0050130 | 3300048088 | Bacteria | 3733 |
| 862 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 863 | Ga0496100_0003734 | 3300048903 | Bacteria | 7970 |
| 864 | Ga0496100_0005515 | 3300048903 | Bacteria | 6827 |
| 865 | Ga0496100_0006389 | 3300048903 | Bacteria | 6425 |
| 866 | Ga0496100_0011308 | 3300048903 | Bacteria | 5079 |
| 867 | Ga0496100_0023604 | 3300048903 | Bacteria | 3739 |
| 868 | Ga0496100_0050281 | 3300048903 | Bacteria | 2700 |
| 869 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 870 | Ga0496101_0025969 | 3300048904 | Bacteria | 4068 |
| 871 | Ga0496101_0057627 | 3300048904 | Bacteria | 2810 |
| 872 | Ga0496101_0089632 | 3300048904 | Bacteria | 2286 |
| 873 | Ga0496101_0284127 | 3300048904 | Bacteria | 1294 |
| 874 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 875 | Ga0496102_0024895 | 3300048905 | Bacteria | 5323 |
| 876 | Ga0496102_0029102 | 3300048905 | Bacteria | 4939 |
| 877 | Ga0496102_0031693 | 3300048905 | Bacteria | 4744 |
| 878 | Ga0496102_0037880 | 3300048905 | Bacteria | 4349 |
| 879 | Ga0496102_0066504 | 3300048905 | Bacteria | 3303 |
| 880 | Ga0496102_0128068 | 3300048905 | Bacteria | 2374 |
| 881 | Ga0496102_0167077 | 3300048905 | Bacteria | 2071 |
| 882 | Ga0496102_0285040 | 3300048905 | Bacteria | 1557 |
| 883 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 884 | Ga0496103_0007179 | 3300048906 | Bacteria | 6643 |
| 885 | Ga0496103_0053282 | 3300048906 | Bacteria | 2507 |
| 886 | Ga0496103_0064679 | 3300048906 | Bacteria | 2280 |
| 887 | Ga0496103_0074041 | 3300048906 | Bacteria | 2134 |
| 888 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 889 | Ga0496104_0000551 | 3300048907 | Bacteria | 31933 |
| 890 | Ga0496104_0008695 | 3300048907 | Bacteria | 9030 |
| 891 | Ga0496104_0018535 | 3300048907 | Bacteria | 6351 |
| 892 | Ga0496104_0029165 | 3300048907 | Bacteria | 5117 |
| 893 | Ga0496104_0153399 | 3300048907 | Bacteria | 2211 |
| 894 | Ga0496104_0154114 | 3300048907 | Bacteria | 2205 |
| 895 | Ga0496104_0181132 | 3300048907 | Bacteria | 2017 |
| 896 | Ga0496104_0219752 | 3300048907 | Bacteria | 1812 |
| 897 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 898 | Ga0496105_0007317 | 3300048908 | Bacteria | 8527 |
| 899 | Ga0496105_0007781 | 3300048908 | Bacteria | 8318 |
| 900 | Ga0496105_0011873 | 3300048908 | Bacteria | 6898 |
| 901 | Ga0496105_0013858 | 3300048908 | Bacteria | 6404 |
| 902 | Ga0496105_0037207 | 3300048908 | Bacteria | 4008 |
| 903 | Ga0496105_0106059 | 3300048908 | Bacteria | 2320 |
| 904 | Ga0496105_0123184 | 3300048908 | Bacteria | 2137 |
| 905 | Ga0496105_0132247 | 3300048908 | Bacteria | 2057 |
| 906 | Ga0496106_0000033 | 3300048909 | Bacteria | 131412 |
| 907 | Ga0496106_0001620 | 3300048909 | Bacteria | 16924 |
| 908 | Ga0496106_0002498 | 3300048909 | Bacteria | 13685 |
| 909 | Ga0496106_0005382 | 3300048909 | Bacteria | 9471 |
| 910 | Ga0496106_0011536 | 3300048909 | Bacteria | 6534 |
| 911 | Ga0496106_0032180 | 3300048909 | Bacteria | 3910 |
| 912 | Ga0496106_0087764 | 3300048909 | Bacteria | 2397 |
| 913 | Ga0496106_0215607 | 3300048909 | Bacteria | 1530 |
| 914 | Ga0496106_0231732 | 3300048909 | Bacteria | 1474 |
| 915 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 916 | Ga0496107_0001120 | 3300048910 | Bacteria | 16167 |
| 917 | Ga0496107_0009391 | 3300048910 | Bacteria | 6783 |
| 918 | Ga0496107_0010207 | 3300048910 | Bacteria | 6516 |
| 919 | Ga0496107_0074309 | 3300048910 | Bacteria | 2473 |
| 920 | Ga0496107_0108244 | 3300048910 | Bacteria | 2041 |
| 921 | Ga0496107_0195020 | 3300048910 | Bacteria | 1505 |
| 922 | Ga0496108_0000187 | 3300048911 | Bacteria | 57568 |
| 923 | Ga0496108_0006174 | 3300048911 | Bacteria | 9692 |
| 924 | Ga0496108_0012519 | 3300048911 | Bacteria | 6908 |
| 925 | Ga0496108_0015305 | 3300048911 | Bacteria | 6258 |
| 926 | Ga0496108_0029554 | 3300048911 | Bacteria | 4540 |
| 927 | Ga0496108_0045410 | 3300048911 | Bacteria | 3670 |
| 928 | Ga0496108_0045656 | 3300048911 | Bacteria | 3659 |
| 929 | Ga0496108_0050063 | 3300048911 | Bacteria | 3496 |
| 930 | Ga0496108_0065269 | 3300048911 | Bacteria | 3068 |
| 931 | Ga0496108_0097162 | 3300048911 | Bacteria | 2510 |
| 932 | Ga0496108_0107050 | 3300048911 | Bacteria | 2387 |
| 933 | Ga0496109_0000636 | 3300048912 | Bacteria | 29254 |
| 934 | Ga0496109_0011911 | 3300048912 | Bacteria | 7488 |
| 935 | Ga0496109_0015902 | 3300048912 | Bacteria | 6571 |
| 936 | Ga0496109_0057804 | 3300048912 | Bacteria | 3542 |
| 937 | Ga0496109_0060773 | 3300048912 | Bacteria | 3453 |
| 938 | Ga0496109_0066426 | 3300048912 | Bacteria | 3302 |
| 939 | Ga0496109_0085910 | 3300048912 | Bacteria | 2905 |
| 940 | Ga0496109_0128724 | 3300048912 | Bacteria | 2362 |
| 941 | Ga0496110_0009948 | 3300048913 | Bacteria | 7711 |
| 942 | Ga0496110_0010762 | 3300048913 | Bacteria | 7455 |
| 943 | Ga0496110_0013223 | 3300048913 | Bacteria | 6815 |
| 944 | Ga0496110_0014802 | 3300048913 | Bacteria | 6481 |
| 945 | Ga0496110_0026382 | 3300048913 | Bacteria | 4971 |
| 946 | Ga0496110_0035902 | 3300048913 | Bacteria | 4304 |
| 947 | Ga0496110_0048112 | 3300048913 | Bacteria | 3737 |
| 948 | Ga0496110_0068392 | 3300048913 | Bacteria | 3143 |
| 949 | Ga0496110_0182004 | 3300048913 | Bacteria | 1908 |
| 950 | Ga0496110_0187494 | 3300048913 | Bacteria | 1878 |
| 951 | Ga0496110_0231352 | 3300048913 | Bacteria | 1681 |
| 952 | Ga0496111_0004675 | 3300048914 | Bacteria | 8678 |
| 953 | Ga0496111_0014526 | 3300048914 | Bacteria | 5383 |
| 954 | Ga0496111_0014676 | 3300048914 | Bacteria | 5358 |
| 955 | Ga0496111_0041217 | 3300048914 | Bacteria | 3313 |
| 956 | Ga0496111_0047847 | 3300048914 | Bacteria | 3080 |
| 957 | Ga0496111_0057454 | 3300048914 | Bacteria | 2817 |
| 958 | Ga0496111_0101851 | 3300048914 | Bacteria | 2110 |
| 959 | Ga0496111_0160691 | 3300048914 | Bacteria | 1668 |
| 960 | Ga0496111_0192486 | 3300048914 | Bacteria | 1516 |
| 961 | Ga0496112_0001147 | 3300048915 | Bacteria | 19779 |
| 962 | Ga0496112_0009893 | 3300048915 | Bacteria | 8621 |
| 963 | Ga0496112_0026382 | 3300048915 | Bacteria | 5589 |
| 964 | Ga0496112_0062499 | 3300048915 | Bacteria | 3673 |
| 965 | Ga0496112_0068233 | 3300048915 | Bacteria | 3511 |
| 966 | Ga0496112_0078518 | 3300048915 | Bacteria | 3264 |
| 967 | Ga0496112_0098819 | 3300048915 | Bacteria | 2888 |
| 968 | Ga0496112_0108236 | 3300048915 | Bacteria | 2750 |
| 969 | Ga0496112_0157518 | 3300048915 | Bacteria | 2238 |
| 970 | Ga0496113_0002968 | 3300048916 | Bacteria | 10034 |
| 971 | Ga0496113_0010955 | 3300048916 | Bacteria | 6022 |
| 972 | Ga0496113_0094109 | 3300048916 | Bacteria | 2314 |
| 973 | Ga0496113_0096997 | 3300048916 | Bacteria | 2280 |
| 974 | Ga0496113_0162980 | 3300048916 | Bacteria | 1763 |
| 975 | Ga0496113_0175229 | 3300048916 | Bacteria | 1699 |
| 976 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 977 | Ga0496114_0001583 | 3300048917 | Bacteria | 17261 |
| 978 | Ga0496114_0003903 | 3300048917 | Bacteria | 11499 |
| 979 | Ga0496114_0006313 | 3300048917 | Bacteria | 9328 |
| 980 | Ga0496114_0008959 | 3300048917 | Bacteria | 7934 |
| 981 | Ga0496114_0013045 | 3300048917 | Bacteria | 6659 |
| 982 | Ga0496114_0046563 | 3300048917 | Unclassified | 3604 |
| 983 | Ga0496114_0132957 | 3300048917 | Bacteria | 2150 |
| 984 | Ga0496115_0001724 | 3300048918 | Bacteria | 15676 |
| 985 | Ga0496115_0016518 | 3300048918 | Bacteria | 5622 |
| 986 | Ga0496115_0022266 | 3300048918 | Bacteria | 4908 |
| 987 | Ga0496115_0032311 | 3300048918 | Bacteria | 4128 |
| 988 | Ga0496115_0037757 | 3300048918 | Bacteria | 3829 |
| 989 | Ga0496115_0134780 | 3300048918 | Bacteria | 2036 |
| 990 | Ga0496115_0215009 | 3300048918 | Bacteria | 1587 |
| 991 | Ga0496116_0000138 | 3300048919 | Bacteria | 151606 |
| 992 | Ga0496117_0002715 | 3300048920 | Bacteria | 21760 |
| 993 | Ga0496118_0000424 | 3300048921 | Bacteria | 70137 |
| 994 | Ga0496119_0005703 | 3300048922 | Bacteria | 11807 |
| 995 | Ga0496119_0007790 | 3300048922 | Bacteria | 9553 |
| 996 | Ga0496119_0014904 | 3300048922 | Bacteria | 6043 |
| 997 | Ga0496119_0021422 | 3300048922 | Bacteria | 4674 |
| 998 | Ga0496119_0059615 | 3300048922 | Bacteria | 2291 |
| 999 | Ga0496120_0002506 | 3300048923 | Bacteria | 18404 |
| 1000 | Ga0496121_0008090 | 3300048924 | Bacteria | 12514 |
| 1001 | Ga0496121_0111864 | 3300048924 | Bacteria | 2081 |
| 1002 | Ga0496121_0161553 | 3300048924 | Bacteria | 1637 |
| 1003 | Ga0496125_0022767 | 3300048928 | Bacteria | 5808 |
| 1004 | Ga0501032_0004690 | 3300049569 | Bacteria | 10261 |
| 1005 | Ga0501033_0099214 | 3300049570 | Bacteria | 2126 |
| 1006 | Ga0501034_0009420 | 3300049571 | Bacteria | 10222 |
| 1007 | Ga0501034_0128786 | 3300049571 | Bacteria | 2515 |
| 1008 | Ga0501036_0046408 | 3300049572 | Bacteria | 3679 |
| 1009 | Ga0501038_0016446 | 3300049574 | Bacteria | 6704 |
| 1010 | Ga0501039_0030969 | 3300049575 | Bacteria | 4124 |
| 1011 | Ga0501039_0190209 | 3300049575 | Bacteria | 1614 |
| 1012 | Ga0501042_0007340 | 3300049578 | Bacteria | 7215 |
| 1013 | Ga0501042_0194806 | 3300049578 | Bacteria | 1461 |
| 1014 | Ga0501046_0045753 | 3300049580 | Bacteria | 3475 |
| 1015 | Ga0501047_0053952 | 3300049581 | Bacteria | 3889 |
| 1016 | Ga0501047_0182365 | 3300049581 | Bacteria | 1965 |
| 1017 | Ga0501069_0000387 | 3300049585 | Bacteria | 19897 |
| 1018 | Ga0501070_0006896 | 3300049586 | Bacteria | 9665 |
| 1019 | Ga0501070_0017234 | 3300049586 | Bacteria | 6065 |
| 1020 | Ga0501249_003280 | 3300049679 | Bacteria | 3255 |
| 1021 | Ga0501079_0071732 | 3300049741 | Bacteria | 2676 |
| 1022 | nmdc:mga06z11_55717_c1 | 3300050494 | Bacteria | 2042 |
| 1023 | nmdc:mga05p37_10540_c1 | 3300050507 | Bacteria | 10961 |
| 1024 | nmdc:mga05p37_27122_c1 | 3300050507 | Bacteria | 6972 |
| 1025 | nmdc:mga05p37_29021_c1 | 3300050507 | Bacteria | 6751 |
| 1026 | nmdc:mga05p37_38141_c1 | 3300050507 | Bacteria | 5893 |
| 1027 | nmdc:mga09592_111263_c1 | 3300050508 | Bacteria | 2350 |
| 1028 | nmdc:mga09592_31516_c1 | 3300050508 | Bacteria | 4418 |
| 1029 | nmdc:mga0qj67_100862_c1 | 3300050509 | Bacteria | 2327 |
| 1030 | nmdc:mga0qj67_105601_c1 | 3300050509 | Bacteria | 2272 |
| 1031 | nmdc:mga0qj67_126806_c1 | 3300050509 | Bacteria | 2065 |
| 1032 | nmdc:mga0qj67_18732_c1 | 3300050509 | Bacteria | 5278 |
| 1033 | nmdc:mga0qj67_21097_c1 | 3300050509 | Bacteria | 4995 |
| 1034 | nmdc:mga0qj67_241184_c1 | 3300050509 | Bacteria | 1467 |
| 1035 | nmdc:mga0qj67_70731_c1 | 3300050509 | Bacteria | 2784 |
| 1036 | nmdc:mga06r32_11724_c1 | 3300050510 | Bacteria | 7890 |
| 1037 | nmdc:mga06r32_217756_c1 | 3300050510 | Bacteria | 1897 |
| 1038 | nmdc:mga06r32_26545_c1 | 3300050510 | Bacteria | 5401 |
| 1039 | nmdc:mga08y16_1438_c1 | 3300050511 | Bacteria | 23849 |
| 1040 | nmdc:mga08y16_27181_c1 | 3300050511 | Bacteria | 6029 |
| 1041 | nmdc:mga08y16_51543_c1 | 3300050511 | Bacteria | 4305 |
| 1042 | nmdc:mga08y16_62383_c1 | 3300050511 | Bacteria | 3893 |
| 1043 | nmdc:mga0n895_103767_c1 | 3300050512 | Bacteria | 2855 |
| 1044 | nmdc:mga0n895_147475_c1 | 3300050512 | Bacteria | 2383 |
| 1045 | nmdc:mga0n895_191761_c1 | 3300050512 | Bacteria | 2075 |
| 1046 | nmdc:mga0n895_38576_c1 | 3300050512 | Bacteria | 4630 |
| 1047 | nmdc:mga0n895_4006_c1 | 3300050512 | Bacteria | 11980 |
| 1048 | nmdc:mga0n895_51772_c1 | 3300050512 | Bacteria | 4029 |
| 1049 | nmdc:mga0n895_52902_c1 | 3300050512 | Bacteria | 3988 |
| 1050 | nmdc:mga0n895_6500_c1 | 3300050512 | Bacteria | 9938 |
| 1051 | nmdc:mga0rr50_10917_c1 | 3300050513 | Bacteria | 5792 |
| 1052 | nmdc:mga0rr50_13008_c1 | 3300050513 | Bacteria | 5401 |
| 1053 | nmdc:mga0rr50_24764_c1 | 3300050513 | Bacteria | 4162 |
| 1054 | nmdc:mga0rr50_26236_c1 | 3300050513 | Bacteria | 4062 |
| 1055 | nmdc:mga0rr50_5422_c1 | 3300050513 | Bacteria | 7606 |
| 1056 | nmdc:mga0rr50_60781_c1 | 3300050513 | Bacteria | 2844 |
| 1057 | nmdc:mga0rr50_69963_c1 | 3300050513 | Bacteria | 2673 |
| 1058 | nmdc:mga08x19_38054_c1 | 3300050514 | Bacteria | 3055 |
| 1059 | nmdc:mga0a205_18213_c1 | 3300050515 | Bacteria | 6598 |
| 1060 | nmdc:mga0a205_185303_c1 | 3300050515 | Bacteria | 1974 |
| 1061 | nmdc:mga0a205_21593_c1 | 3300050515 | Bacteria | 6089 |
| 1062 | nmdc:mga0a205_25548_c1 | 3300050515 | Bacteria | 5627 |
| 1063 | nmdc:mga0a205_271288_c1 | 3300050515 | Bacteria | 1573 |
| 1064 | nmdc:mga0a205_3610_c1 | 3300050515 | Bacteria | 13853 |
| 1065 | nmdc:mga0a205_62187_c1 | 3300050515 | Bacteria | 3607 |
| 1066 | nmdc:mga0a205_679_c1 | 3300050515 | Bacteria | 27196 |
| 1067 | nmdc:mga0a205_69143_c1 | 3300050515 | Bacteria | 3411 |
| 1068 | nmdc:mga0sz30_56499_c2 | 3300050516 | Bacteria | 1381 |
| 1069 | Ga0495601_0000110 | 3300053077 | Bacteria | 44959 |
| 1070 | Ga0495601_0000124 | 3300053077 | Bacteria | 43205 |
| 1071 | Ga0495601_0003438 | 3300053077 | Bacteria | 9074 |
| 1072 | Ga0495601_0013142 | 3300053077 | Bacteria | 4977 |
| 1073 | Ga0495601_0020740 | 3300053077 | Bacteria | 4017 |
| 1074 | Ga0495601_0048222 | 3300053077 | Bacteria | 2683 |
| 1075 | Ga0495612_0003172 | 3300053078 | Bacteria | 6811 |
| 1076 | Ga0495612_0010699 | 3300053078 | Bacteria | 3707 |
| 1077 | Ga0495612_0010857 | 3300053078 | Bacteria | 3680 |
| 1078 | Ga0495612_0023356 | 3300053078 | Bacteria | 2481 |
| 1079 | Ga0495655_0000008 | 3300053083 | Bacteria | 153535 |
| 1080 | Ga0495595_0001178 | 3300053084 | Bacteria | 10157 |
| 1081 | Ga0495595_0016809 | 3300053084 | Bacteria | 3136 |
| 1082 | Ga0495595_0038686 | 3300053084 | Bacteria | 2174 |
| 1083 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 1084 | Ga0495619_0001863 | 3300053085 | Bacteria | 14045 |
| 1085 | Ga0495619_0009701 | 3300053085 | Bacteria | 6070 |
| 1086 | Ga0495619_0021921 | 3300053085 | Bacteria | 4084 |
| 1087 | Ga0495619_0025437 | 3300053085 | Bacteria | 3802 |
| 1088 | Ga0495619_0042642 | 3300053085 | Bacteria | 2972 |
| 1089 | Ga0495619_0107445 | 3300053085 | Bacteria | 1904 |
| 1090 | Ga0500566_0002923 | 3300053094 | Bacteria | 10195 |
| 1091 | Ga0500556_0001512 | 3300053104 | Bacteria | 9592 |
| 1092 | Ga0500572_001267 | 3300053111 | Bacteria | 7103 |
| 1093 | Ga0500614_000117 | 3300053123 | Bacteria | 19001 |
| 1094 | Ga0500628_000023 | 3300053129 | Bacteria | 77818 |
| 1095 | Ga0500658_0000015 | 3300053134 | Bacteria | 151134 |
| 1096 | Ga0500559_0010654 | 3300053136 | Bacteria | 3941 |
| 1097 | Ga0500616_0011561 | 3300053153 | Bacteria | 5203 |
| 1098 | Ga0501082_0056838 | 3300060353 | Bacteria | 3371 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100139241 | Ga0070674_1001392413 | 355 |
| 2 | 3300049578 | Ga0501042_0194806 | Ga0501042_0194806_281_1438 | 366 |
| 3 | 3300035088 | Ga0373940_0038524 | Ga0373940_0038524_32_1189 | 368 |
| 4 | 3300048911 | Ga0496108_0107050 | Ga0496108_0107050_29_1186 | 368 |
| 5 | 3300048913 | Ga0496110_0182004 | Ga0496110_0182004_742_1893 | 373 |
| 6 | 3300048919 | Ga0496116_0000138 | Ga0496116_0000138_34635_35915 | 373 |
| 7 | 3300048922 | Ga0496119_0021422 | Ga0496119_0021422_3148_4428 | 373 |
| 8 | 3300046543 | Ga0495645_0150754 | Ga0495645_0150754_453_1586 | 374 |
| 9 | 3300048905 | Ga0496102_0167077 | Ga0496102_0167077_749_2032 | 381 |
| 10 | 3300048921 | Ga0496118_0000424 | Ga0496118_0000424_3126_4409 | 381 |
| 11 | 3300006844 | Ga0075428_100081909 | Ga0075428_1000819093 | 384 |
| 12 | 3300006163 | Ga0070715_10001599 | Ga0070715_100015995 | 389 |
| 13 | 3300025905 | Ga0207685_10010684 | Ga0207685_100106843 | 389 |
| 14 | 3300048903 | Ga0496100_0023604 | Ga0496100_0023604_44_1426 | 389 |
| 15 | 3300048905 | Ga0496102_0024895 | Ga0496102_0024895_3172_4554 | 389 |
| 16 | 3300048906 | Ga0496103_0064679 | Ga0496103_0064679_734_2116 | 389 |
| 17 | 3300050508 | nmdc:mga09592_31516_c1 | nmdc:mga09592_31516_c1_223_1434 | 397 |
| 18 | 3300050509 | nmdc:mga0qj67_70731_c1 | nmdc:mga0qj67_70731_c1_578_1789 | 397 |
| 19 | 3300035691 | Ga0373931_0018769 | Ga0373931_0018769_1669_3048 | 398 |
| 20 | 3300005718 | Ga0068866_10016127 | Ga0068866_100161273 | 399 |
| 21 | 3300009176 | Ga0105242_10194217 | Ga0105242_101942172 | 399 |
| 22 | 3300048905 | Ga0496102_0066504 | Ga0496102_0066504_541_1920 | 399 |
| 23 | 3300048910 | Ga0496107_0074309 | Ga0496107_0074309_885_2282 | 399 |
| 24 | 3300050494 | nmdc:mga06z11_55717_c1 | nmdc:mga06z11_55717_c1_455_1852 | 399 |
| 25 | 3300050513 | nmdc:mga0rr50_24764_c1 | nmdc:mga0rr50_24764_c1_2041_3438 | 399 |
| 26 | 3300005347 | Ga0070668_100015399 | Ga0070668_1000153992 | 400 |
| 27 | 3300009553 | Ga0105249_10000916 | Ga0105249_100009163 | 400 |
| 28 | 3300013297 | Ga0157378_10217413 | Ga0157378_102174132 | 400 |
| 29 | 3300013306 | Ga0163162_10339249 | Ga0163162_103392491 | 400 |
| 30 | 3300025942 | Ga0207689_10150840 | Ga0207689_101508402 | 400 |
| 31 | 3300041512 | Ga0451853_1257484 | Ga0451853_1257484_598_1812 | 400 |
| 32 | 3300046459 | Ga0495629_0177689 | Ga0495629_0177689_186_1400 | 400 |
| 33 | 3300046462 | Ga0495651_0009283 | Ga0495651_0009283_3968_5182 | 400 |
| 34 | 3300046511 | Ga0495608_0018319 | Ga0495608_0018319_960_2174 | 400 |
| 35 | 3300046516 | Ga0495628_0076419 | Ga0495628_0076419_296_1510 | 400 |
| 36 | 3300046517 | Ga0495630_0218180 | Ga0495630_0218180_125_1339 | 400 |
| 37 | 3300046529 | Ga0495652_0006599 | Ga0495652_0006599_1998_3212 | 400 |
| 38 | 3300046533 | Ga0495640_0069624 | Ga0495640_0069624_868_2082 | 400 |
| 39 | 3300046536 | Ga0495587_0021986 | Ga0495587_0021986_371_1585 | 400 |
| 40 | 3300046559 | Ga0495667_0004526 | Ga0495667_0004526_5405_6619 | 400 |
| 41 | 3300046663 | Ga0495635_0104834 | Ga0495635_0104834_288_1502 | 400 |
| 42 | 3300046675 | Ga0495657_0109621 | Ga0495657_0109621_132_1346 | 400 |
| 43 | 3300046678 | Ga0495599_0031788 | Ga0495599_0031788_1714_2928 | 400 |
| 44 | 3300046680 | Ga0495646_0028953 | Ga0495646_0028953_2052_3266 | 400 |
| 45 | 3300046809 | Ga0495600_0012266 | Ga0495600_0012266_389_1603 | 400 |
| 46 | 3300047317 | Ga0495604_0006362 | Ga0495604_0006362_2369_3583 | 400 |
| 47 | 3300047319 | Ga0495674_0011270 | Ga0495674_0011270_1773_2987 | 400 |
| 48 | 3300047322 | Ga0495680_0002289 | Ga0495680_0002289_17938_19152 | 400 |
| 49 | 3300047471 | Ga0495684_0010681 | Ga0495684_0010681_68_1282 | 400 |
| 50 | 3300048088 | Ga0495602_0050130 | Ga0495602_0050130_674_1888 | 400 |
| 51 | 3300048928 | Ga0496125_0022767 | Ga0496125_0022767_49_1383 | 400 |
| 52 | 3300050509 | nmdc:mga0qj67_241184_c1 | nmdc:mga0qj67_241184_c1_18_1223 | 400 |
| 53 | 3300053077 | Ga0495601_0048222 | Ga0495601_0048222_145_1359 | 400 |
| 54 | 3300053084 | Ga0495595_0016809 | Ga0495595_0016809_275_1489 | 400 |
| 55 | 3300053085 | Ga0495619_0042642 | Ga0495619_0042642_1701_2915 | 400 |
| 56 | 3300005338 | Ga0068868_100132802 | Ga0068868_1001328022 | 401 |
| 57 | 3300025912 | Ga0207707_10017087 | Ga0207707_100170874 | 401 |
| 58 | 3300035695 | Ga0373927_0002848 | Ga0373927_0002848_11353_12579 | 401 |
| 59 | 3300005356 | Ga0070674_100150710 | Ga0070674_1001507101 | 402 |
| 60 | 3300046689 | Ga0495613_0201242 | Ga0495613_0201242_27_1238 | 402 |
| 61 | 3300048904 | Ga0496101_0284127 | Ga0496101_0284127_22_1233 | 402 |
| 62 | 3300048910 | Ga0496107_0195020 | Ga0496107_0195020_24_1238 | 403 |
| 63 | 3300005337 | Ga0070682_100143366 | Ga0070682_1001433662 | 404 |
| 64 | 3300005366 | Ga0070659_100065148 | Ga0070659_1000651482 | 404 |
| 65 | 3300005438 | Ga0070701_10073309 | Ga0070701_100733091 | 404 |
| 66 | 3300005439 | Ga0070711_100003451 | Ga0070711_1000034516 | 404 |
| 67 | 3300005455 | Ga0070663_100132944 | Ga0070663_1001329441 | 404 |
| 68 | 3300005456 | Ga0070678_100040934 | Ga0070678_1000409343 | 404 |
| 69 | 3300005457 | Ga0070662_100049611 | Ga0070662_1000496112 | 404 |
| 70 | 3300005539 | Ga0068853_100074408 | Ga0068853_1000744081 | 404 |
| 71 | 3300005545 | Ga0070695_100139300 | Ga0070695_1001393001 | 404 |
| 72 | 3300005578 | Ga0068854_100024072 | Ga0068854_1000240723 | 404 |
| 73 | 3300006173 | Ga0070716_100003719 | Ga0070716_1000037194 | 404 |
| 74 | 3300006175 | Ga0070712_100024148 | Ga0070712_1000241482 | 404 |
| 75 | 3300006358 | Ga0068871_100032952 | Ga0068871_1000329523 | 404 |
| 76 | 3300013306 | Ga0163162_10236293 | Ga0163162_102362933 | 404 |
| 77 | 3300025915 | Ga0207693_10002493 | Ga0207693_1000249312 | 404 |
| 78 | 3300025916 | Ga0207663_10005313 | Ga0207663_100053133 | 404 |
| 79 | 3300025932 | Ga0207690_10071111 | Ga0207690_100711112 | 404 |
| 80 | 3300025939 | Ga0207665_10043840 | Ga0207665_100438402 | 404 |
| 81 | 3300026067 | Ga0207678_10098105 | Ga0207678_100981052 | 404 |
| 82 | 3300026121 | Ga0207683_10102639 | Ga0207683_101026392 | 404 |
| 83 | 3300028381 | Ga0268264_10110101 | Ga0268264_101101013 | 404 |
| 84 | 3300048903 | Ga0496100_0050281 | Ga0496100_0050281_22_1401 | 404 |
| 85 | 3300048909 | Ga0496106_0011536 | Ga0496106_0011536_4210_5589 | 404 |
| 86 | 3300048910 | Ga0496107_0010207 | Ga0496107_0010207_2613_3992 | 404 |
| 87 | 3300048920 | Ga0496117_0002715 | Ga0496117_0002715_20136_21518 | 407 |
| 88 | 3300014326 | Ga0157380_10136826 | Ga0157380_101368262 | 409 |
| 89 | 3300048922 | Ga0496119_0005703 | Ga0496119_0005703_6632_7942 | 410 |
| 90 | 3300048923 | Ga0496120_0002506 | Ga0496120_0002506_9028_10338 | 410 |
| 91 | 3300013308 | Ga0157375_10427895 | Ga0157375_104278952 | 411 |
| 92 | 3300048922 | Ga0496119_0059615 | Ga0496119_0059615_696_2078 | 411 |
| 93 | 3300048924 | Ga0496121_0111864 | Ga0496121_0111864_57_1439 | 411 |
| 94 | 3300037418 | Ga0395900_0233340 | Ga0395900_0233340_23_1318 | 412 |
| 95 | 3300048914 | Ga0496111_0014526 | Ga0496111_0014526_1925_3307 | 414 |
| 96 | 3300048917 | Ga0496114_0008959 | Ga0496114_0008959_4259_5641 | 414 |
| 97 | 3300025940 | Ga0207691_10178554 | Ga0207691_101785542 | 415 |
| 98 | 3300006844 | Ga0075428_100079512 | Ga0075428_1000795122 | 416 |
| 99 | 3300006847 | Ga0075431_100082299 | Ga0075431_1000822995 | 416 |
| 100 | 3300047472 | Ga0495686_0000020 | Ga0495686_0000020_260234_261511 | 416 |
| 101 | 3300048909 | Ga0496106_0032180 | Ga0496106_0032180_2470_3792 | 416 |
| 102 | 3300048914 | Ga0496111_0192486 | Ga0496111_0192486_168_1490 | 416 |
| 103 | 3300048915 | Ga0496112_0068233 | Ga0496112_0068233_369_1691 | 416 |
| 104 | 3300050507 | nmdc:mga05p37_27122_c1 | nmdc:mga05p37_27122_c1_5100_6398 | 416 |
| 105 | 3300050510 | nmdc:mga06r32_217756_c1 | nmdc:mga06r32_217756_c1_23_1321 | 416 |
| 106 | 3300050515 | nmdc:mga0a205_271288_c1 | nmdc:mga0a205_271288_c1_154_1452 | 416 |
| 107 | 3300050516 | nmdc:mga0sz30_56499_c2 | nmdc:mga0sz30_56499_c2_59_1330 | 416 |
| 108 | 3300014326 | Ga0157380_10032636 | Ga0157380_100326365 | 417 |
| 109 | 3300048913 | Ga0496110_0048112 | Ga0496110_0048112_377_1759 | 417 |
| 110 | 3300006847 | Ga0075431_100065005 | Ga0075431_1000650052 | 418 |
| 111 | 3300009098 | Ga0105245_10108511 | Ga0105245_101085112 | 418 |
| 112 | 3300009148 | Ga0105243_10071064 | Ga0105243_100710641 | 418 |
| 113 | 3300009176 | Ga0105242_10091633 | Ga0105242_100916332 | 418 |
| 114 | 3300013296 | Ga0157374_10322458 | Ga0157374_103224581 | 418 |
| 115 | 3300014326 | Ga0157380_10177339 | Ga0157380_101773392 | 418 |
| 116 | 3300025941 | Ga0207711_10162875 | Ga0207711_101628752 | 418 |
| 117 | 3300048905 | Ga0496102_0031693 | Ga0496102_0031693_2782_4095 | 418 |
| 118 | 3300048907 | Ga0496104_0219752 | Ga0496104_0219752_215_1546 | 418 |
| 119 | 3300048911 | Ga0496108_0097162 | Ga0496108_0097162_495_1877 | 418 |
| 120 | 3300048913 | Ga0496110_0231352 | Ga0496110_0231352_18_1400 | 418 |
| 121 | 3300053085 | Ga0495619_0107445 | Ga0495619_0107445_21_1352 | 418 |
| 122 | 3300035692 | Ga0373935_0168636 | Ga0373935_0168636_131_1414 | 419 |
| 123 | 3300035725 | Ga0373947_0142491 | Ga0373947_0142491_124_1407 | 419 |
| 124 | 3300037068 | Ga0373925_0140157 | Ga0373925_0140157_44_1498 | 419 |
| 125 | 3300046517 | Ga0495630_0027711 | Ga0495630_0027711_19_1302 | 419 |
| 126 | 3300047321 | Ga0495676_0147446 | Ga0495676_0147446_290_1573 | 419 |
| 127 | 3300004799 | Ga0058863_11944294 | Ga0058863_119442942 | 420 |
| 128 | 3300004800 | Ga0058861_10082651 | Ga0058861_100826511 | 420 |
| 129 | 3300005440 | Ga0070705_100009341 | Ga0070705_1000093412 | 420 |
| 130 | 3300005458 | Ga0070681_10014198 | Ga0070681_100141982 | 420 |
| 131 | 3300005615 | Ga0070702_100005715 | Ga0070702_1000057152 | 420 |
| 132 | 3300006852 | Ga0075433_10004165 | Ga0075433_100041658 | 420 |
| 133 | 3300009176 | Ga0105242_10060082 | Ga0105242_100600823 | 420 |
| 134 | 3300009553 | Ga0105249_10150221 | Ga0105249_101502212 | 420 |
| 135 | 3300014326 | Ga0157380_10080362 | Ga0157380_100803622 | 420 |
| 136 | 3300025912 | Ga0207707_10017437 | Ga0207707_100174377 | 420 |
| 137 | 3300025921 | Ga0207652_10051270 | Ga0207652_100512702 | 420 |
| 138 | 3300025934 | Ga0207686_10053260 | Ga0207686_100532602 | 420 |
| 139 | 3300010375 | Ga0105239_10112707 | Ga0105239_101127072 | 421 |
| 140 | 3300050515 | nmdc:mga0a205_185303_c1 | nmdc:mga0a205_185303_c1_20_1366 | 421 |
| 141 | 3300050515 | nmdc:mga0a205_3610_c1 | nmdc:mga0a205_3610_c1_7239_8645 | 422 |
| 142 | 3300005337 | Ga0070682_100000013 | Ga0070682_10000001365 | 423 |
| 143 | 3300005439 | Ga0070711_100049324 | Ga0070711_1000493242 | 423 |
| 144 | 3300005614 | Ga0068856_100066493 | Ga0068856_1000664936 | 423 |
| 145 | 3300025916 | Ga0207663_10023197 | Ga0207663_100231972 | 423 |
| 146 | 3300048903 | Ga0496100_0005515 | Ga0496100_0005515_1377_2834 | 423 |
| 147 | 3300048904 | Ga0496101_0057627 | Ga0496101_0057627_351_1808 | 423 |
| 148 | 3300048907 | Ga0496104_0000551 | Ga0496104_0000551_2291_3748 | 423 |
| 149 | 3300048908 | Ga0496105_0007317 | Ga0496105_0007317_608_2065 | 423 |
| 150 | 3300048909 | Ga0496106_0001620 | Ga0496106_0001620_867_2324 | 423 |
| 151 | 3300048910 | Ga0496107_0001120 | Ga0496107_0001120_1808_3265 | 423 |
| 152 | 3300048911 | Ga0496108_0006174 | Ga0496108_0006174_5517_6974 | 423 |
| 153 | 3300048912 | Ga0496109_0060773 | Ga0496109_0060773_271_1728 | 423 |
| 154 | 3300048913 | Ga0496110_0009948 | Ga0496110_0009948_4944_6401 | 423 |
| 155 | 3300048915 | Ga0496112_0062499 | Ga0496112_0062499_1797_3254 | 423 |
| 156 | 3300048917 | Ga0496114_0001583 | Ga0496114_0001583_8631_10088 | 423 |
| 157 | 3300048918 | Ga0496115_0016518 | Ga0496115_0016518_2258_3715 | 423 |
| 158 | 3300005614 | Ga0068856_100009718 | Ga0068856_1000097184 | 424 |
| 159 | 3300009176 | Ga0105242_10008877 | Ga0105242_100088771 | 424 |
| 160 | 3300013297 | Ga0157378_10271297 | Ga0157378_102712971 | 424 |
| 161 | 3300026078 | Ga0207702_10028773 | Ga0207702_100287735 | 424 |
| 162 | 3300046477 | Ga0495664_0095018 | Ga0495664_0095018_375_1670 | 424 |
| 163 | 3300048915 | Ga0496112_0157518 | Ga0496112_0157518_712_1989 | 424 |
| 164 | 3300048916 | Ga0496113_0094109 | Ga0496113_0094109_957_2234 | 424 |
| 165 | 3300053077 | Ga0495601_0020740 | Ga0495601_0020740_2262_3557 | 424 |
| 166 | iso_pu_bacteria | 2757320536 | 2758225509 | 424 |
| 167 | 3300005530 | Ga0070679_100122463 | Ga0070679_1001224632 | 425 |
| 168 | 3300020076 | Ga0206355_1195442 | Ga0206355_11954422 | 425 |
| 169 | 3300020077 | Ga0206351_10855698 | Ga0206351_108556982 | 425 |
| 170 | 3300020078 | Ga0206352_10111744 | Ga0206352_101117443 | 425 |
| 171 | 3300020082 | Ga0206353_11863956 | Ga0206353_118639562 | 425 |
| 172 | 3300020610 | Ga0154015_1332211 | Ga0154015_13322112 | 425 |
| 173 | 3300046690 | Ga0495624_0032751 | Ga0495624_0032751_112_1401 | 425 |
| 174 | 3300035725 | Ga0373947_0057317 | Ga0373947_0057317_663_2057 | 426 |
| 175 | 3300046455 | Ga0495603_0033679 | Ga0495603_0033679_1391_2785 | 426 |
| 176 | 3300025941 | Ga0207711_10018257 | Ga0207711_100182573 | 427 |
| 177 | 3300036712 | Ga0316584_0005054 | Ga0316584_0005054_5019_6350 | 427 |
| 178 | 3300037588 | Ga0316581_0001663 | Ga0316581_0001663_1271_2602 | 427 |
| 179 | 3300048903 | Ga0496100_0003734 | Ga0496100_0003734_815_2107 | 427 |
| 180 | 3300048904 | Ga0496101_0025969 | Ga0496101_0025969_662_1954 | 427 |
| 181 | 3300048907 | Ga0496104_0153399 | Ga0496104_0153399_836_2134 | 427 |
| 182 | 3300048910 | Ga0496107_0009391 | Ga0496107_0009391_4805_6097 | 427 |
| 183 | 3300048915 | Ga0496112_0078518 | Ga0496112_0078518_233_1531 | 427 |
| 184 | 3300048916 | Ga0496113_0010955 | Ga0496113_0010955_3904_5202 | 427 |
| 185 | 3300048918 | Ga0496115_0215009 | Ga0496115_0215009_84_1376 | 427 |
| 186 | 3300050509 | nmdc:mga0qj67_126806_c1 | nmdc:mga0qj67_126806_c1_404_1762 | 427 |
| 187 | 3300005436 | Ga0070713_100001413 | Ga0070713_1000014135 | 428 |
| 188 | 3300006175 | Ga0070712_100069626 | Ga0070712_1000696262 | 428 |
| 189 | 3300025915 | Ga0207693_10083758 | Ga0207693_100837584 | 428 |
| 190 | 3300025928 | Ga0207700_10112071 | Ga0207700_101120712 | 428 |
| 191 | 3300037466 | Ga0395898_0190730 | Ga0395898_0190730_142_1542 | 428 |
| 192 | 3300038443 | Ga0395901_0018262 | Ga0395901_0018262_3430_4830 | 428 |
| 193 | 3300046515 | Ga0495620_0000144 | Ga0495620_0000144_9405_10811 | 428 |
| 194 | 3300048914 | Ga0496111_0101851 | Ga0496111_0101851_452_1885 | 428 |
| 195 | iso_pu_bacteria | 2870628048 | 2870628812 | 428 |
| 196 | 3300005937 | Ga0081455_10013896 | Ga0081455_100138962 | 429 |
| 197 | 3300048906 | Ga0496103_0007179 | Ga0496103_0007179_4856_6187 | 429 |
| 198 | 3300050509 | nmdc:mga0qj67_18732_c1 | nmdc:mga0qj67_18732_c1_551_1981 | 429 |
| 199 | 3300009177 | Ga0105248_10009406 | Ga0105248_100094065 | 430 |
| 200 | 3300013306 | Ga0163162_10030239 | Ga0163162_100302392 | 430 |
| 201 | 3300014325 | Ga0163163_10007110 | Ga0163163_100071105 | 430 |
| 202 | 3300021361 | Ga0213872_10023559 | Ga0213872_100235592 | 430 |
| 203 | 3300032002 | Ga0307416_100139478 | Ga0307416_1001394782 | 430 |
| 204 | 3300039447 | Ga0436361_0336407 | Ga0436361_0336407_12604_13920 | 430 |
| 205 | 3300039453 | Ga0436362_0003157 | Ga0436362_0003157_9985_11301 | 430 |
| 206 | 3300048915 | Ga0496112_0009893 | Ga0496112_0009893_6177_7556 | 430 |
| 207 | 3300025933 | Ga0207706_10040269 | Ga0207706_100402691 | 431 |
| 208 | 3300039447 | Ga0436361_0510461 | Ga0436361_0510461_1018_2388 | 431 |
| 209 | 3300053085 | Ga0495619_0025437 | Ga0495619_0025437_87_1439 | 431 |
| 210 | 3300035119 | Ga0373956_0012653 | Ga0373956_0012653_1261_2583 | 432 |
| 211 | 3300037466 | Ga0395898_0028626 | Ga0395898_0028626_1490_2908 | 432 |
| 212 | 3300046675 | Ga0495657_0027438 | Ga0495657_0027438_1338_2660 | 432 |
| 213 | 3300047317 | Ga0495604_0011115 | Ga0495604_0011115_5399_6721 | 432 |
| 214 | 3300047322 | Ga0495680_0009533 | Ga0495680_0009533_6131_7453 | 432 |
| 215 | iso_pu_bacteria | 2523231044 | 2523385192 | 432 |
| 216 | 3300005435 | Ga0070714_100006732 | Ga0070714_1000067321 | 433 |
| 217 | 3300005439 | Ga0070711_100077818 | Ga0070711_1000778182 | 433 |
| 218 | 3300006028 | Ga0070717_10002252 | Ga0070717_100022529 | 433 |
| 219 | 3300006028 | Ga0070717_10053450 | Ga0070717_100534503 | 433 |
| 220 | 3300009098 | Ga0105245_10013722 | Ga0105245_100137223 | 433 |
| 221 | 3300009177 | Ga0105248_10296632 | Ga0105248_102966322 | 433 |
| 222 | 3300013308 | Ga0157375_10247796 | Ga0157375_102477962 | 433 |
| 223 | 3300014325 | Ga0163163_10043622 | Ga0163163_100436223 | 433 |
| 224 | 3300025929 | Ga0207664_10070425 | Ga0207664_100704252 | 433 |
| 225 | 3300026118 | Ga0207675_100213549 | Ga0207675_1002135492 | 433 |
| 226 | 3300030521 | Ga0307511_10020634 | Ga0307511_100206345 | 433 |
| 227 | 3300005983 | Ga0081540_1000757 | Ga0081540_100075715 | 434 |
| 228 | 3300031727 | Ga0316576_10108327 | Ga0316576_101083272 | 434 |
| 229 | 3300031733 | Ga0316577_10033831 | Ga0316577_100338314 | 434 |
| 230 | 3300035398 | Ga0316574_0036378 | Ga0316574_0036378_453_1820 | 434 |
| 231 | 3300036401 | Ga0373937_0018127 | Ga0373937_0018127_1327_2775 | 434 |
| 232 | 3300036712 | Ga0316584_0026524 | Ga0316584_0026524_1684_3051 | 434 |
| 233 | 3300039447 | Ga0436361_0035073 | Ga0436361_0035073_3303_4658 | 434 |
| 234 | 3300039447 | Ga0436361_0735490 | Ga0436361_0735490_3078_4433 | 434 |
| 235 | 3300046454 | Ga0495592_0000220 | Ga0495592_0000220_8677_10125 | 434 |
| 236 | 3300046462 | Ga0495651_0000034 | Ga0495651_0000034_95670_97118 | 434 |
| 237 | 3300046463 | Ga0495653_0000669 | Ga0495653_0000669_15081_16529 | 434 |
| 238 | 3300046511 | Ga0495608_0000584 | Ga0495608_0000584_10239_11687 | 434 |
| 239 | 3300046516 | Ga0495628_0000040 | Ga0495628_0000040_83042_84490 | 434 |
| 240 | 3300046529 | Ga0495652_0002645 | Ga0495652_0002645_4705_6153 | 434 |
| 241 | 3300046536 | Ga0495587_0000055 | Ga0495587_0000055_56422_57870 | 434 |
| 242 | 3300046543 | Ga0495645_0000073 | Ga0495645_0000073_44972_46420 | 434 |
| 243 | 3300046678 | Ga0495599_0000173 | Ga0495599_0000173_1964_3412 | 434 |
| 244 | 3300046679 | Ga0495623_0000101 | Ga0495623_0000101_30244_31692 | 434 |
| 245 | 3300046680 | Ga0495646_0010006 | Ga0495646_0010006_98_1546 | 434 |
| 246 | 3300047317 | Ga0495604_0000120 | Ga0495604_0000120_59204_60652 | 434 |
| 247 | 3300047322 | Ga0495680_0018763 | Ga0495680_0018763_378_1826 | 434 |
| 248 | 3300047444 | Ga0495675_0000029 | Ga0495675_0000029_54978_56426 | 434 |
| 249 | 3300048088 | Ga0495602_0001081 | Ga0495602_0001081_15082_16530 | 434 |
| 250 | 3300048917 | Ga0496114_0006313 | Ga0496114_0006313_4777_6180 | 434 |
| 251 | 3300050515 | nmdc:mga0a205_62187_c1 | nmdc:mga0a205_62187_c1_851_2248 | 434 |
| 252 | 3300053077 | Ga0495601_0000110 | Ga0495601_0000110_15902_17350 | 434 |
| 253 | 3300053078 | Ga0495612_0023356 | Ga0495612_0023356_53_1501 | 434 |
| 254 | 3300053084 | Ga0495595_0038686 | Ga0495595_0038686_271_1719 | 434 |
| 255 | iso_pu_bacteria | 2738541308 | 2738886880 | 434 |
| 256 | 3300005471 | Ga0070698_100259376 | Ga0070698_1002593761 | 435 |
| 257 | 3300006871 | Ga0075434_100030794 | Ga0075434_1000307942 | 435 |
| 258 | 3300036712 | Ga0316584_0029469 | Ga0316584_0029469_2712_4034 | 435 |
| 259 | 3300039438 | Ga0436360_0633769 | Ga0436360_0633769_10157_11488 | 435 |
| 260 | 3300049741 | Ga0501079_0071732 | Ga0501079_0071732_274_1716 | 435 |
| 261 | 3300050512 | nmdc:mga0n895_51772_c1 | nmdc:mga0n895_51772_c1_2478_3875 | 435 |
| 262 | 3300060353 | Ga0501082_0056838 | Ga0501082_0056838_285_1727 | 435 |
| 263 | 3300005983 | Ga0081540_1037492 | Ga0081540_10374922 | 436 |
| 264 | 3300009148 | Ga0105243_10085160 | Ga0105243_100851603 | 436 |
| 265 | 3300031251 | Ga0265327_10000018 | Ga0265327_10000018145 | 436 |
| 266 | 3300046477 | Ga0495664_0018691 | Ga0495664_0018691_401_1723 | 436 |
| 267 | 3300046675 | Ga0495657_0032893 | Ga0495657_0032893_130_1452 | 436 |
| 268 | 3300046679 | Ga0495623_0035821 | Ga0495623_0035821_13_1335 | 436 |
| 269 | 3300049575 | Ga0501039_0190209 | Ga0501039_0190209_83_1450 | 436 |
| 270 | 3300053078 | Ga0495612_0010857 | Ga0495612_0010857_90_1412 | 436 |
| 271 | 3300005345 | Ga0070692_10011129 | Ga0070692_100111291 | 437 |
| 272 | 3300005347 | Ga0070668_100037245 | Ga0070668_1000372453 | 437 |
| 273 | 3300005366 | Ga0070659_100183191 | Ga0070659_1001831911 | 437 |
| 274 | 3300005435 | Ga0070714_100001300 | Ga0070714_10000130018 | 437 |
| 275 | 3300005436 | Ga0070713_100044804 | Ga0070713_1000448042 | 437 |
| 276 | 3300005444 | Ga0070694_100004651 | Ga0070694_1000046514 | 437 |
| 277 | 3300005457 | Ga0070662_100137455 | Ga0070662_1001374552 | 437 |
| 278 | 3300005548 | Ga0070665_100144277 | Ga0070665_1001442772 | 437 |
| 279 | 3300005563 | Ga0068855_100045286 | Ga0068855_1000452862 | 437 |
| 280 | 3300005719 | Ga0068861_100014414 | Ga0068861_1000144142 | 437 |
| 281 | 3300005840 | Ga0068870_10062911 | Ga0068870_100629112 | 437 |
| 282 | 3300005842 | Ga0068858_100031114 | Ga0068858_1000311145 | 437 |
| 283 | 3300005844 | Ga0068862_100062940 | Ga0068862_1000629403 | 437 |
| 284 | 3300006028 | Ga0070717_10026014 | Ga0070717_100260143 | 437 |
| 285 | 3300006048 | Ga0075363_100021934 | Ga0075363_1000219342 | 437 |
| 286 | 3300006358 | Ga0068871_100075188 | Ga0068871_1000751884 | 437 |
| 287 | 3300006852 | Ga0075433_10031502 | Ga0075433_100315021 | 437 |
| 288 | 3300006871 | Ga0075434_100225994 | Ga0075434_1002259941 | 437 |
| 289 | 3300006914 | Ga0075436_100006626 | Ga0075436_1000066267 | 437 |
| 290 | 3300007076 | Ga0075435_100014025 | Ga0075435_1000140256 | 437 |
| 291 | 3300009093 | Ga0105240_10094357 | Ga0105240_100943573 | 437 |
| 292 | 3300009094 | Ga0111539_10002534 | Ga0111539_100025349 | 437 |
| 293 | 3300009148 | Ga0105243_10041665 | Ga0105243_100416651 | 437 |
| 294 | 3300009551 | Ga0105238_10262486 | Ga0105238_102624861 | 437 |
| 295 | 3300013100 | Ga0157373_10075674 | Ga0157373_100756742 | 437 |
| 296 | 3300013104 | Ga0157370_10151057 | Ga0157370_101510571 | 437 |
| 297 | 3300014326 | Ga0157380_10039774 | Ga0157380_100397744 | 437 |
| 298 | 3300014745 | Ga0157377_10126072 | Ga0157377_101260721 | 437 |
| 299 | 3300025904 | Ga0207647_10008001 | Ga0207647_100080015 | 437 |
| 300 | 3300025905 | Ga0207685_10031309 | Ga0207685_100313092 | 437 |
| 301 | 3300025915 | Ga0207693_10002186 | Ga0207693_100021868 | 437 |
| 302 | 3300025929 | Ga0207664_10053517 | Ga0207664_100535172 | 437 |
| 303 | 3300025933 | Ga0207706_10015246 | Ga0207706_100152465 | 437 |
| 304 | 3300025939 | Ga0207665_10004626 | Ga0207665_100046262 | 437 |
| 305 | 3300025942 | Ga0207689_10036645 | Ga0207689_100366454 | 437 |
| 306 | 3300025972 | Ga0207668_10007005 | Ga0207668_100070055 | 437 |
| 307 | 3300026023 | Ga0207677_10087065 | Ga0207677_100870651 | 437 |
| 308 | 3300026067 | Ga0207678_10016969 | Ga0207678_100169694 | 437 |
| 309 | 3300026075 | Ga0207708_10058018 | Ga0207708_100580183 | 437 |
| 310 | 3300026078 | Ga0207702_10044134 | Ga0207702_100441344 | 437 |
| 311 | 3300026095 | Ga0207676_10056628 | Ga0207676_100566284 | 437 |
| 312 | 3300026121 | Ga0207683_10020763 | Ga0207683_100207634 | 437 |
| 313 | 3300027907 | Ga0207428_10080458 | Ga0207428_100804582 | 437 |
| 314 | 3300035091 | Ga0373951_0012974 | Ga0373951_0012974_364_1761 | 437 |
| 315 | 3300035112 | Ga0373932_0022750 | Ga0373932_0022750_82_1479 | 437 |
| 316 | 3300035115 | Ga0373941_0011532 | Ga0373941_0011532_659_2056 | 437 |
| 317 | 3300038443 | Ga0395901_0193477 | Ga0395901_0193477_244_1656 | 437 |
| 318 | 3300048904 | Ga0496101_0089632 | Ga0496101_0089632_387_1784 | 437 |
| 319 | 3300048905 | Ga0496102_0128068 | Ga0496102_0128068_604_2001 | 437 |
| 320 | 3300048907 | Ga0496104_0018535 | Ga0496104_0018535_1423_2820 | 437 |
| 321 | 3300048908 | Ga0496105_0132247 | Ga0496105_0132247_494_1819 | 437 |
| 322 | 3300048909 | Ga0496106_0231732 | Ga0496106_0231732_37_1434 | 437 |
| 323 | 3300048910 | Ga0496107_0108244 | Ga0496107_0108244_400_1797 | 437 |
| 324 | 3300048912 | Ga0496109_0015902 | Ga0496109_0015902_2436_3833 | 437 |
| 325 | 3300048913 | Ga0496110_0026382 | Ga0496110_0026382_1895_3292 | 437 |
| 326 | 3300048914 | Ga0496111_0041217 | Ga0496111_0041217_1193_2590 | 437 |
| 327 | 3300048915 | Ga0496112_0108236 | Ga0496112_0108236_335_1690 | 437 |
| 328 | 3300048916 | Ga0496113_0175229 | Ga0496113_0175229_73_1470 | 437 |
| 329 | 3300048917 | Ga0496114_0046563 | Ga0496114_0046563_1175_2572 | 437 |
| 330 | 3300048918 | Ga0496115_0134780 | Ga0496115_0134780_110_1507 | 437 |
| 331 | 3300050509 | nmdc:mga0qj67_105601_c1 | nmdc:mga0qj67_105601_c1_493_1872 | 437 |
| 332 | 3300050511 | nmdc:mga08y16_1438_c1 | nmdc:mga08y16_1438_c1_4704_6200 | 437 |
| 333 | 3300050512 | nmdc:mga0n895_103767_c1 | nmdc:mga0n895_103767_c1_1399_2796 | 437 |
| 334 | 3300050512 | nmdc:mga0n895_6500_c1 | nmdc:mga0n895_6500_c1_6282_7778 | 437 |
| 335 | 3300050513 | nmdc:mga0rr50_13008_c1 | nmdc:mga0rr50_13008_c1_115_1512 | 437 |
| 336 | 3300050514 | nmdc:mga08x19_38054_c1 | nmdc:mga08x19_38054_c1_468_1964 | 437 |
| 337 | 3300050515 | nmdc:mga0a205_25548_c1 | nmdc:mga0a205_25548_c1_2798_4195 | 437 |
| 338 | 3300050515 | nmdc:mga0a205_679_c1 | nmdc:mga0a205_679_c1_19275_20771 | 437 |
| 339 | 3300003187 | JGI25151J46595_10000166 | JGI25151J46595_1000016668 | 438 |
| 340 | 3300017792 | Ga0163161_10078165 | Ga0163161_100781652 | 438 |
| 341 | 3300031665 | Ga0316575_10002167 | Ga0316575_100021675 | 438 |
| 342 | 3300031733 | Ga0316577_10011476 | Ga0316577_100114762 | 438 |
| 343 | 3300032137 | Ga0316585_10005770 | Ga0316585_100057705 | 438 |
| 344 | 3300035398 | Ga0316574_0000052 | Ga0316574_0000052_11211_12680 | 438 |
| 345 | 3300035398 | Ga0316574_0074281 | Ga0316574_0074281_581_1939 | 438 |
| 346 | 3300036647 | Ga0316582_0000166 | Ga0316582_0000166_1682_3151 | 438 |
| 347 | 3300036712 | Ga0316584_0007826 | Ga0316584_0007826_2317_3786 | 438 |
| 348 | 3300005338 | Ga0068868_100180700 | Ga0068868_1001807001 | 439 |
| 349 | 3300005366 | Ga0070659_100132928 | Ga0070659_1001329281 | 439 |
| 350 | 3300005539 | Ga0068853_100093895 | Ga0068853_1000938953 | 439 |
| 351 | 3300005841 | Ga0068863_100079728 | Ga0068863_1000797282 | 439 |
| 352 | 3300005843 | Ga0068860_100128723 | Ga0068860_1001287232 | 439 |
| 353 | 3300006844 | Ga0075428_100028236 | Ga0075428_1000282362 | 439 |
| 354 | 3300006852 | Ga0075433_10063711 | Ga0075433_100637112 | 439 |
| 355 | 3300006871 | Ga0075434_100077166 | Ga0075434_1000771662 | 439 |
| 356 | 3300007076 | Ga0075435_100082894 | Ga0075435_1000828942 | 439 |
| 357 | 3300009148 | Ga0105243_10048351 | Ga0105243_100483515 | 439 |
| 358 | 3300009553 | Ga0105249_10107528 | Ga0105249_101075281 | 439 |
| 359 | 3300013306 | Ga0163162_10026336 | Ga0163162_100263364 | 439 |
| 360 | 3300017792 | Ga0163161_10017674 | Ga0163161_100176743 | 439 |
| 361 | 3300025933 | Ga0207706_10099242 | Ga0207706_100992421 | 439 |
| 362 | 3300025938 | Ga0207704_10016620 | Ga0207704_100166202 | 439 |
| 363 | 3300025961 | Ga0207712_10111032 | Ga0207712_101110322 | 439 |
| 364 | 3300025981 | Ga0207640_10109174 | Ga0207640_101091742 | 439 |
| 365 | 3300026041 | Ga0207639_10075794 | Ga0207639_100757942 | 439 |
| 366 | 3300026088 | Ga0207641_10084193 | Ga0207641_100841932 | 439 |
| 367 | 3300027907 | Ga0207428_10014005 | Ga0207428_100140052 | 439 |
| 368 | 3300048912 | Ga0496109_0057804 | Ga0496109_0057804_76_1479 | 439 |
| 369 | 3300048916 | Ga0496113_0162980 | Ga0496113_0162980_53_1456 | 439 |
| 370 | 3300050507 | nmdc:mga05p37_38141_c1 | nmdc:mga05p37_38141_c1_4298_5809 | 439 |
| 371 | 3300050510 | nmdc:mga06r32_26545_c1 | nmdc:mga06r32_26545_c1_1189_2688 | 439 |
| 372 | 3300050511 | nmdc:mga08y16_62383_c1 | nmdc:mga08y16_62383_c1_1621_3120 | 439 |
| 373 | 3300050512 | nmdc:mga0n895_52902_c1 | nmdc:mga0n895_52902_c1_218_1717 | 439 |
| 374 | 3300050513 | nmdc:mga0rr50_69963_c1 | nmdc:mga0rr50_69963_c1_639_2138 | 439 |
| 375 | 3300050515 | nmdc:mga0a205_21593_c1 | nmdc:mga0a205_21593_c1_622_2121 | 439 |
| 376 | 3300039447 | Ga0436361_0002000 | Ga0436361_0002000_127_1536 | 440 |
| 377 | 3300039450 | Ga0436363_0472667 | Ga0436363_0472667_288_1697 | 440 |
| 378 | 3300045976 | Ga0466967_0052298 | Ga0466967_0052298_948_2333 | 440 |
| 379 | iso_pu_bacteria | 2919034639 | 2919036786 | 440 |
| 380 | 3300005548 | Ga0070665_100131441 | Ga0070665_1001314412 | 441 |
| 381 | 3300028379 | Ga0268266_10167727 | Ga0268266_101677272 | 441 |
| 382 | 3300006175 | Ga0070712_100000003 | Ga0070712_100000003221 | 442 |
| 383 | 3300025915 | Ga0207693_10000009 | Ga0207693_10000009128 | 442 |
| 384 | 3300026023 | Ga0207677_10140050 | Ga0207677_101400502 | 442 |
| 385 | 3300045976 | Ga0466967_0015423 | Ga0466967_0015423_1357_2721 | 442 |
| 386 | 3300048915 | Ga0496112_0001147 | Ga0496112_0001147_9712_11046 | 442 |
| 387 | 3300049581 | Ga0501047_0053952 | Ga0501047_0053952_1571_2947 | 442 |
| 388 | 3300049586 | Ga0501070_0017234 | Ga0501070_0017234_300_1682 | 442 |
| 389 | iso_pu_bacteria | 2684623219 | 2687238119 | 442 |
| 390 | 3300009094 | Ga0111539_10343497 | Ga0111539_103434971 | 443 |
| 391 | 3300031456 | Ga0307513_10006242 | Ga0307513_100062424 | 443 |
| 392 | 3300048905 | Ga0496102_0285040 | Ga0496102_0285040_11_1456 | 443 |
| 393 | 3300050511 | nmdc:mga08y16_51543_c1 | nmdc:mga08y16_51543_c1_1891_3306 | 443 |
| 394 | 3300053136 | Ga0500559_0010654 | Ga0500559_0010654_407_1804 | 443 |
| 395 | iso_pu_bacteria | 2739367857 | 2740000265 | 443 |
| 396 | iso_pu_bacteria | 2739367858 | 2740005081 | 443 |
| 397 | 3300005347 | Ga0070668_100065222 | Ga0070668_1000652222 | 444 |
| 398 | 3300005353 | Ga0070669_100104806 | Ga0070669_1001048061 | 444 |
| 399 | 3300005841 | Ga0068863_100055706 | Ga0068863_1000557063 | 444 |
| 400 | 3300005843 | Ga0068860_100234091 | Ga0068860_1002340912 | 444 |
| 401 | 3300005844 | Ga0068862_100087848 | Ga0068862_1000878482 | 444 |
| 402 | 3300005937 | Ga0081455_10016343 | Ga0081455_100163432 | 444 |
| 403 | 3300006844 | Ga0075428_100134561 | Ga0075428_1001345611 | 444 |
| 404 | 3300006852 | Ga0075433_10042932 | Ga0075433_100429321 | 444 |
| 405 | 3300006871 | Ga0075434_100144366 | Ga0075434_1001443663 | 444 |
| 406 | 3300006914 | Ga0075436_100009259 | Ga0075436_1000092596 | 444 |
| 407 | 3300006942 | Ga0099824_1000332 | Ga0099824_100033226 | 444 |
| 408 | 3300007076 | Ga0075435_100010366 | Ga0075435_1000103669 | 444 |
| 409 | 3300009094 | Ga0111539_10108769 | Ga0111539_101087692 | 444 |
| 410 | 3300009147 | Ga0114129_10036368 | Ga0114129_100363685 | 444 |
| 411 | 3300009176 | Ga0105242_10238791 | Ga0105242_102387911 | 444 |
| 412 | 3300013100 | Ga0157373_10000003 | Ga0157373_1000000323 | 444 |
| 413 | 3300015261 | Ga0182006_1041690 | Ga0182006_10416901 | 444 |
| 414 | 3300025294 | Ga0209025_1000053 | Ga0209025_1000053133 | 444 |
| 415 | 3300025297 | Ga0209758_1001127 | Ga0209758_100112712 | 444 |
| 416 | 3300025923 | Ga0207681_10086256 | Ga0207681_100862561 | 444 |
| 417 | 3300025972 | Ga0207668_10142092 | Ga0207668_101420922 | 444 |
| 418 | 3300026088 | Ga0207641_10042529 | Ga0207641_100425293 | 444 |
| 419 | 3300028381 | Ga0268264_10175727 | Ga0268264_101757271 | 444 |
| 420 | 3300028381 | Ga0268264_10212271 | Ga0268264_102122711 | 444 |
| 421 | 3300031595 | Ga0265313_10006987 | Ga0265313_100069875 | 444 |
| 422 | 3300031711 | Ga0265314_10064755 | Ga0265314_100647552 | 444 |
| 423 | 3300031824 | Ga0307413_10000272 | Ga0307413_1000027212 | 444 |
| 424 | 3300032005 | Ga0307411_10000003 | Ga0307411_10000003184 | 444 |
| 425 | 3300036401 | Ga0373937_0048404 | Ga0373937_0048404_415_1827 | 444 |
| 426 | 3300041407 | Ga0439447_000024 | Ga0439447_000024_8629_10029 | 444 |
| 427 | 3300046511 | Ga0495608_0050745 | Ga0495608_0050745_171_1583 | 444 |
| 428 | 3300046516 | Ga0495628_0026747 | Ga0495628_0026747_2943_4355 | 444 |
| 429 | 3300046559 | Ga0495667_0024978 | Ga0495667_0024978_395_1807 | 444 |
| 430 | 3300047319 | Ga0495674_0123969 | Ga0495674_0123969_31_1443 | 444 |
| 431 | 3300047322 | Ga0495680_0084308 | Ga0495680_0084308_57_1469 | 444 |
| 432 | 3300047444 | Ga0495675_0071560 | Ga0495675_0071560_399_1811 | 444 |
| 433 | 3300048088 | Ga0495602_0004291 | Ga0495602_0004291_9778_11190 | 444 |
| 434 | 3300048924 | Ga0496121_0008090 | Ga0496121_0008090_8793_10193 | 444 |
| 435 | 3300049679 | Ga0501249_003280 | Ga0501249_003280_685_2085 | 444 |
| 436 | 3300050507 | nmdc:mga05p37_29021_c1 | nmdc:mga05p37_29021_c1_1890_3380 | 444 |
| 437 | 3300050512 | nmdc:mga0n895_147475_c1 | nmdc:mga0n895_147475_c1_763_2253 | 444 |
| 438 | 3300050513 | nmdc:mga0rr50_5422_c1 | nmdc:mga0rr50_5422_c1_5203_6693 | 444 |
| 439 | 3300050515 | nmdc:mga0a205_69143_c1 | nmdc:mga0a205_69143_c1_451_1941 | 444 |
| 440 | 3300053077 | Ga0495601_0003438 | Ga0495601_0003438_5052_6464 | 444 |
| 441 | 3300053111 | Ga0500572_001267 | Ga0500572_001267_1308_2702 | 444 |
| 442 | 3300053134 | Ga0500658_0000015 | Ga0500658_0000015_8215_9615 | 444 |
| 443 | iso_pu_bacteria | 2857618242 | 2857621489 | 444 |
| 444 | iso_pu_bacteria | 2919191525 | 2919192496 | 444 |
| 445 | iso_pu_bacteria | 8054307821 | 8054309405 | 444 |
| 446 | 3300005439 | Ga0070711_100107448 | Ga0070711_1001074482 | 445 |
| 447 | 3300005618 | Ga0068864_100047627 | Ga0068864_1000476272 | 445 |
| 448 | 3300035695 | Ga0373927_0074168 | Ga0373927_0074168_119_1576 | 445 |
| 449 | 3300049571 | Ga0501034_0128786 | Ga0501034_0128786_21_1412 | 445 |
| 450 | 3300031548 | Ga0307408_100020500 | Ga0307408_1000205004 | 446 |
| 451 | 3300031616 | Ga0307508_10150367 | Ga0307508_101503671 | 446 |
| 452 | 3300031852 | Ga0307410_10002547 | Ga0307410_100025472 | 446 |
| 453 | 3300031901 | Ga0307406_10014287 | Ga0307406_100142874 | 446 |
| 454 | 3300031903 | Ga0307407_10001800 | Ga0307407_100018008 | 446 |
| 455 | 3300031911 | Ga0307412_10017513 | Ga0307412_100175134 | 446 |
| 456 | 3300031995 | Ga0307409_100011608 | Ga0307409_1000116085 | 446 |
| 457 | 3300032004 | Ga0307414_10003567 | Ga0307414_100035675 | 446 |
| 458 | 3300032005 | Ga0307411_10047461 | Ga0307411_100474612 | 446 |
| 459 | 3300046559 | Ga0495667_0000019 | Ga0495667_0000019_46869_48251 | 446 |
| 460 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_6990_8366 | 446 |
| 461 | 3300047321 | Ga0495676_0006190 | Ga0495676_0006190_3241_4641 | 446 |
| 462 | 3300047322 | Ga0495680_0001765 | Ga0495680_0001765_3607_4989 | 446 |
| 463 | 3300005618 | Ga0068864_100000024 | Ga0068864_100000024211 | 447 |
| 464 | 3300026095 | Ga0207676_10000048 | Ga0207676_1000004842 | 447 |
| 465 | 3300031727 | Ga0316576_10028532 | Ga0316576_100285324 | 447 |
| 466 | 3300035170 | Ga0373943_0076020 | Ga0373943_0076020_157_1584 | 447 |
| 467 | 3300035725 | Ga0373947_0038902 | Ga0373947_0038902_673_2100 | 447 |
| 468 | 3300036712 | Ga0316584_0091485 | Ga0316584_0091485_680_2119 | 447 |
| 469 | 3300005329 | Ga0070683_100149948 | Ga0070683_1001499481 | 448 |
| 470 | 3300005435 | Ga0070714_100042155 | Ga0070714_1000421553 | 448 |
| 471 | 3300006846 | Ga0075430_100041844 | Ga0075430_1000418443 | 448 |
| 472 | 3300025929 | Ga0207664_10051885 | Ga0207664_100518852 | 448 |
| 473 | 3300031665 | Ga0316575_10001075 | Ga0316575_100010754 | 448 |
| 474 | 3300031691 | Ga0316579_10005583 | Ga0316579_100055831 | 448 |
| 475 | 3300031727 | Ga0316576_10012627 | Ga0316576_100126274 | 448 |
| 476 | 3300031728 | Ga0316578_10014810 | Ga0316578_100148103 | 448 |
| 477 | 3300032137 | Ga0316585_10003725 | Ga0316585_100037253 | 448 |
| 478 | 3300032139 | Ga0316580_10001868 | Ga0316580_100018683 | 448 |
| 479 | 3300048911 | Ga0496108_0045656 | Ga0496108_0045656_191_1618 | 448 |
| 480 | 3300048914 | Ga0496111_0160691 | Ga0496111_0160691_162_1589 | 448 |
| 481 | 3300003373 | JGI25407J50210_10006261 | JGI25407J50210_100062613 | 449 |
| 482 | 3300005471 | Ga0070698_100031035 | Ga0070698_1000310354 | 449 |
| 483 | 3300005981 | Ga0081538_10000023 | Ga0081538_100000239 | 449 |
| 484 | 3300009098 | Ga0105245_10236092 | Ga0105245_102360921 | 449 |
| 485 | 3300026089 | Ga0207648_10005519 | Ga0207648_1000551920 | 449 |
| 486 | 3300038443 | Ga0395901_0161922 | Ga0395901_0161922_684_2078 | 449 |
| 487 | 3300044694 | Ga0466963_0004575 | Ga0466963_0004575_3994_5379 | 449 |
| 488 | 3300048914 | Ga0496111_0057454 | Ga0496111_0057454_1093_2478 | 449 |
| 489 | iso_pu_bacteria | 2818991458 | 2819667620 | 449 |
| 490 | 3300005337 | Ga0070682_100020489 | Ga0070682_1000204894 | 450 |
| 491 | 3300005719 | Ga0068861_100055131 | Ga0068861_1000551315 | 450 |
| 492 | 3300005983 | Ga0081540_1007808 | Ga0081540_10078087 | 450 |
| 493 | 3300013306 | Ga0163162_10014212 | Ga0163162_100142123 | 450 |
| 494 | 3300017792 | Ga0163161_10047150 | Ga0163161_100471505 | 450 |
| 495 | 3300025899 | Ga0207642_10021960 | Ga0207642_100219602 | 450 |
| 496 | 3300025924 | Ga0207694_10076077 | Ga0207694_100760772 | 450 |
| 497 | 3300025961 | Ga0207712_10018506 | Ga0207712_100185063 | 450 |
| 498 | 3300026067 | Ga0207678_10145917 | Ga0207678_101459172 | 450 |
| 499 | 3300037418 | Ga0395900_0111834 | Ga0395900_0111834_79_1506 | 450 |
| 500 | 3300048903 | Ga0496100_0006389 | Ga0496100_0006389_2400_3851 | 450 |
| 501 | 3300048905 | Ga0496102_0029102 | Ga0496102_0029102_2329_3780 | 450 |
| 502 | 3300048906 | Ga0496103_0074041 | Ga0496103_0074041_114_1565 | 450 |
| 503 | 3300048917 | Ga0496114_0013045 | Ga0496114_0013045_4432_5883 | 450 |
| 504 | 3300048918 | Ga0496115_0022266 | Ga0496115_0022266_1573_3024 | 450 |
| 505 | iso_pu_bacteria | 2939657138 | 2939658176 | 450 |
| 506 | 3300005842 | Ga0068858_100081825 | Ga0068858_1000818254 | 451 |
| 507 | 3300014968 | Ga0157379_10140789 | Ga0157379_101407893 | 451 |
| 508 | 3300035725 | Ga0373947_0120244 | Ga0373947_0120244_70_1557 | 451 |
| 509 | 3300038996 | Ga0242420_000347 | Ga0242420_000347_1996_3375 | 451 |
| 510 | 3300048907 | Ga0496104_0029165 | Ga0496104_0029165_98_1585 | 451 |
| 511 | 3300048907 | Ga0496104_0181132 | Ga0496104_0181132_192_1589 | 451 |
| 512 | 3300048908 | Ga0496105_0123184 | Ga0496105_0123184_618_2015 | 451 |
| 513 | 3300048911 | Ga0496108_0050063 | Ga0496108_0050063_485_1972 | 451 |
| 514 | 3300048912 | Ga0496109_0128724 | Ga0496109_0128724_475_1962 | 451 |
| 515 | 3300048922 | Ga0496119_0007790 | Ga0496119_0007790_7964_9361 | 451 |
| 516 | 3300048924 | Ga0496121_0161553 | Ga0496121_0161553_181_1578 | 451 |
| 517 | iso_pu_bacteria | 2818991462 | 2819690921 | 451 |
| 518 | iso_pu_bacteria | 2818991469 | 2819727738 | 451 |
| 519 | 3300005367 | Ga0070667_100000597 | Ga0070667_10000059728 | 452 |
| 520 | 3300005439 | Ga0070711_100054959 | Ga0070711_1000549592 | 452 |
| 521 | 3300005468 | Ga0070707_100138905 | Ga0070707_1001389053 | 452 |
| 522 | 3300005530 | Ga0070679_100041121 | Ga0070679_1000411212 | 452 |
| 523 | 3300005546 | Ga0070696_100107322 | Ga0070696_1001073222 | 452 |
| 524 | 3300005548 | Ga0070665_100018108 | Ga0070665_1000181086 | 452 |
| 525 | 3300005563 | Ga0068855_100016708 | Ga0068855_1000167086 | 452 |
| 526 | 3300005844 | Ga0068862_100000366 | Ga0068862_10000036633 | 452 |
| 527 | 3300006028 | Ga0070717_10003906 | Ga0070717_100039064 | 452 |
| 528 | 3300006175 | Ga0070712_100158695 | Ga0070712_1001586951 | 452 |
| 529 | 3300009093 | Ga0105240_10032970 | Ga0105240_100329705 | 452 |
| 530 | 3300009098 | Ga0105245_10069086 | Ga0105245_100690861 | 452 |
| 531 | 3300009551 | Ga0105238_10152433 | Ga0105238_101524332 | 452 |
| 532 | 3300010375 | Ga0105239_10103632 | Ga0105239_101036322 | 452 |
| 533 | 3300013105 | Ga0157369_10033435 | Ga0157369_100334352 | 452 |
| 534 | 3300013307 | Ga0157372_10309031 | Ga0157372_103090312 | 452 |
| 535 | 3300025913 | Ga0207695_10003637 | Ga0207695_1000363718 | 452 |
| 536 | 3300025917 | Ga0207660_10085054 | Ga0207660_100850542 | 452 |
| 537 | 3300025944 | Ga0207661_10023477 | Ga0207661_100234775 | 452 |
| 538 | 3300025986 | Ga0207658_10000465 | Ga0207658_1000046527 | 452 |
| 539 | 3300026035 | Ga0207703_10121530 | Ga0207703_101215303 | 452 |
| 540 | 3300026078 | Ga0207702_10063186 | Ga0207702_100631863 | 452 |
| 541 | 3300028379 | Ga0268266_10161541 | Ga0268266_101615413 | 452 |
| 542 | 3300028380 | Ga0268265_10001048 | Ga0268265_100010485 | 452 |
| 543 | 3300045976 | Ga0466967_0077622 | Ga0466967_0077622_1411_2820 | 452 |
| 544 | 3300048907 | Ga0496104_0154114 | Ga0496104_0154114_429_1850 | 452 |
| 545 | 3300048908 | Ga0496105_0007781 | Ga0496105_0007781_1344_2765 | 452 |
| 546 | 3300048908 | Ga0496105_0011873 | Ga0496105_0011873_5181_6638 | 452 |
| 547 | 3300048911 | Ga0496108_0029554 | Ga0496108_0029554_1563_2972 | 452 |
| 548 | 3300048912 | Ga0496109_0066426 | Ga0496109_0066426_1543_2982 | 452 |
| 549 | 3300048914 | Ga0496111_0014676 | Ga0496111_0014676_2556_3995 | 452 |
| 550 | 3300053085 | Ga0495619_0021921 | Ga0495619_0021921_1752_3158 | 452 |
| 551 | 3300053104 | Ga0500556_0001512 | Ga0500556_0001512_1735_3162 | 452 |
| 552 | 3300053153 | Ga0500616_0011561 | Ga0500616_0011561_1706_3133 | 452 |
| 553 | iso_pu_bacteria | 2811994882 | 2812372081 | 452 |
| 554 | 3300005844 | Ga0068862_100200344 | Ga0068862_1002003442 | 453 |
| 555 | 3300048906 | Ga0496103_0053282 | Ga0496103_0053282_846_2327 | 453 |
| 556 | 3300005435 | Ga0070714_100046135 | Ga0070714_1000461352 | 454 |
| 557 | 3300005436 | Ga0070713_100005405 | Ga0070713_1000054052 | 454 |
| 558 | 3300005459 | Ga0068867_100008485 | Ga0068867_1000084852 | 454 |
| 559 | 3300005518 | Ga0070699_100000043 | Ga0070699_100000043111 | 454 |
| 560 | 3300005535 | Ga0070684_100010636 | Ga0070684_1000106366 | 454 |
| 561 | 3300005535 | Ga0070684_100062282 | Ga0070684_1000622823 | 454 |
| 562 | 3300005546 | Ga0070696_100088208 | Ga0070696_1000882082 | 454 |
| 563 | 3300005577 | Ga0068857_100017156 | Ga0068857_1000171562 | 454 |
| 564 | 3300005614 | Ga0068856_100003506 | Ga0068856_10000350616 | 454 |
| 565 | 3300005615 | Ga0070702_100123530 | Ga0070702_1001235301 | 454 |
| 566 | 3300006880 | Ga0075429_100116021 | Ga0075429_1001160212 | 454 |
| 567 | 3300009094 | Ga0111539_10030024 | Ga0111539_100300242 | 454 |
| 568 | 3300009147 | Ga0114129_10079769 | Ga0114129_100797694 | 454 |
| 569 | 3300009148 | Ga0105243_10003685 | Ga0105243_100036859 | 454 |
| 570 | 3300009174 | Ga0105241_10068171 | Ga0105241_100681711 | 454 |
| 571 | 3300009176 | Ga0105242_10018440 | Ga0105242_100184404 | 454 |
| 572 | 3300009177 | Ga0105248_10066247 | Ga0105248_100662472 | 454 |
| 573 | 3300009545 | Ga0105237_10028453 | Ga0105237_100284532 | 454 |
| 574 | 3300009551 | Ga0105238_10019629 | Ga0105238_100196294 | 454 |
| 575 | 3300009553 | Ga0105249_10002508 | Ga0105249_1000250812 | 454 |
| 576 | 3300011119 | Ga0105246_10033619 | Ga0105246_100336192 | 454 |
| 577 | 3300013105 | Ga0157369_10009457 | Ga0157369_100094576 | 454 |
| 578 | 3300013105 | Ga0157369_10069460 | Ga0157369_100694604 | 454 |
| 579 | 3300013306 | Ga0163162_10014551 | Ga0163162_100145515 | 454 |
| 580 | 3300013308 | Ga0157375_10103526 | Ga0157375_101035261 | 454 |
| 581 | 3300014326 | Ga0157380_10018093 | Ga0157380_100180935 | 454 |
| 582 | 3300017792 | Ga0163161_10055314 | Ga0163161_100553143 | 454 |
| 583 | 3300020069 | Ga0197907_10292294 | Ga0197907_102922941 | 454 |
| 584 | 3300020077 | Ga0206351_10206386 | Ga0206351_102063861 | 454 |
| 585 | 3300020078 | Ga0206352_11357117 | Ga0206352_113571171 | 454 |
| 586 | 3300025929 | Ga0207664_10022821 | Ga0207664_100228215 | 454 |
| 587 | 3300025944 | Ga0207661_10060629 | Ga0207661_100606291 | 454 |
| 588 | 3300026078 | Ga0207702_10050195 | Ga0207702_100501952 | 454 |
| 589 | 3300026089 | Ga0207648_10003682 | Ga0207648_1000368212 | 454 |
| 590 | 3300026116 | Ga0207674_10001090 | Ga0207674_1000109027 | 454 |
| 591 | 3300035170 | Ga0373943_0023348 | Ga0373943_0023348_398_1855 | 454 |
| 592 | 3300035725 | Ga0373947_0058616 | Ga0373947_0058616_445_1902 | 454 |
| 593 | 3300036712 | Ga0316584_0051911 | Ga0316584_0051911_267_1676 | 454 |
| 594 | 3300037068 | Ga0373925_0037510 | Ga0373925_0037510_1151_2548 | 454 |
| 595 | 3300046459 | Ga0495629_0088760 | Ga0495629_0088760_631_2055 | 454 |
| 596 | 3300046461 | Ga0495641_0000742 | Ga0495641_0000742_21016_22440 | 454 |
| 597 | 3300046461 | Ga0495641_0018240 | Ga0495641_0018240_1647_3038 | 454 |
| 598 | 3300046473 | Ga0495582_0025352 | Ga0495582_0025352_41_1498 | 454 |
| 599 | 3300046476 | Ga0495662_0035185 | Ga0495662_0035185_850_2274 | 454 |
| 600 | 3300046516 | Ga0495628_0077467 | Ga0495628_0077467_28_1485 | 454 |
| 601 | 3300046543 | Ga0495645_0025818 | Ga0495645_0025818_618_2015 | 454 |
| 602 | 3300046680 | Ga0495646_0026385 | Ga0495646_0026385_1392_2789 | 454 |
| 603 | 3300046681 | Ga0495647_0044345 | Ga0495647_0044345_253_1644 | 454 |
| 604 | 3300046683 | Ga0495658_0002011 | Ga0495658_0002011_2851_4275 | 454 |
| 605 | 3300046809 | Ga0495600_0057945 | Ga0495600_0057945_353_1750 | 454 |
| 606 | 3300047315 | Ga0495581_0000642 | Ga0495581_0000642_6415_7806 | 454 |
| 607 | 3300047315 | Ga0495581_0010170 | Ga0495581_0010170_3577_4980 | 454 |
| 608 | 3300047319 | Ga0495674_0005612 | Ga0495674_0005612_3077_4468 | 454 |
| 609 | 3300047321 | Ga0495676_0066007 | Ga0495676_0066007_1132_2523 | 454 |
| 610 | 3300047472 | Ga0495686_0104501 | Ga0495686_0104501_101_1516 | 454 |
| 611 | 3300048903 | Ga0496100_0011308 | Ga0496100_0011308_2657_4060 | 454 |
| 612 | 3300048905 | Ga0496102_0037880 | Ga0496102_0037880_2532_3935 | 454 |
| 613 | 3300048908 | Ga0496105_0037207 | Ga0496105_0037207_1759_3156 | 454 |
| 614 | 3300048908 | Ga0496105_0106059 | Ga0496105_0106059_718_2121 | 454 |
| 615 | 3300048909 | Ga0496106_0002498 | Ga0496106_0002498_11705_13108 | 454 |
| 616 | 3300048909 | Ga0496106_0215607 | Ga0496106_0215607_88_1485 | 454 |
| 617 | 3300048911 | Ga0496108_0065269 | Ga0496108_0065269_1474_2871 | 454 |
| 618 | 3300048912 | Ga0496109_0011911 | Ga0496109_0011911_710_2107 | 454 |
| 619 | 3300048912 | Ga0496109_0085910 | Ga0496109_0085910_219_1622 | 454 |
| 620 | 3300048913 | Ga0496110_0010762 | Ga0496110_0010762_648_2045 | 454 |
| 621 | 3300048913 | Ga0496110_0187494 | Ga0496110_0187494_298_1701 | 454 |
| 622 | 3300048915 | Ga0496112_0098819 | Ga0496112_0098819_1465_2862 | 454 |
| 623 | 3300048917 | Ga0496114_0003903 | Ga0496114_0003903_422_1813 | 454 |
| 624 | 3300048917 | Ga0496114_0132957 | Ga0496114_0132957_434_1837 | 454 |
| 625 | 3300048918 | Ga0496115_0001724 | Ga0496115_0001724_412_1803 | 454 |
| 626 | 3300048918 | Ga0496115_0037757 | Ga0496115_0037757_1190_2587 | 454 |
| 627 | 3300049569 | Ga0501032_0004690 | Ga0501032_0004690_1792_3264 | 454 |
| 628 | 3300049570 | Ga0501033_0099214 | Ga0501033_0099214_415_1887 | 454 |
| 629 | 3300049571 | Ga0501034_0009420 | Ga0501034_0009420_7018_8490 | 454 |
| 630 | 3300049572 | Ga0501036_0046408 | Ga0501036_0046408_1964_3436 | 454 |
| 631 | 3300049574 | Ga0501038_0016446 | Ga0501038_0016446_1701_3173 | 454 |
| 632 | 3300049575 | Ga0501039_0030969 | Ga0501039_0030969_129_1601 | 454 |
| 633 | 3300049580 | Ga0501046_0045753 | Ga0501046_0045753_1952_3424 | 454 |
| 634 | 3300049581 | Ga0501047_0182365 | Ga0501047_0182365_454_1926 | 454 |
| 635 | 3300050507 | nmdc:mga05p37_10540_c1 | nmdc:mga05p37_10540_c1_2508_3905 | 454 |
| 636 | 3300050508 | nmdc:mga09592_111263_c1 | nmdc:mga09592_111263_c1_457_1854 | 454 |
| 637 | 3300050509 | nmdc:mga0qj67_100862_c1 | nmdc:mga0qj67_100862_c1_779_2176 | 454 |
| 638 | 3300050510 | nmdc:mga06r32_11724_c1 | nmdc:mga06r32_11724_c1_5725_7122 | 454 |
| 639 | 3300050511 | nmdc:mga08y16_27181_c1 | nmdc:mga08y16_27181_c1_2316_3713 | 454 |
| 640 | 3300050512 | nmdc:mga0n895_191761_c1 | nmdc:mga0n895_191761_c1_56_1477 | 454 |
| 641 | 3300050512 | nmdc:mga0n895_38576_c1 | nmdc:mga0n895_38576_c1_805_2202 | 454 |
| 642 | 3300050512 | nmdc:mga0n895_4006_c1 | nmdc:mga0n895_4006_c1_3216_4673 | 454 |
| 643 | 3300050513 | nmdc:mga0rr50_10917_c1 | nmdc:mga0rr50_10917_c1_511_1968 | 454 |
| 644 | 3300050513 | nmdc:mga0rr50_26236_c1 | nmdc:mga0rr50_26236_c1_1538_2959 | 454 |
| 645 | 3300050513 | nmdc:mga0rr50_60781_c1 | nmdc:mga0rr50_60781_c1_323_1720 | 454 |
| 646 | 3300050515 | nmdc:mga0a205_18213_c1 | nmdc:mga0a205_18213_c1_812_2209 | 454 |
| 647 | 3300005341 | Ga0070691_10012578 | Ga0070691_100125784 | 455 |
| 648 | 3300005435 | Ga0070714_100133144 | Ga0070714_1001331441 | 455 |
| 649 | 3300005439 | Ga0070711_100025477 | Ga0070711_1000254772 | 455 |
| 650 | 3300005439 | Ga0070711_100050791 | Ga0070711_1000507912 | 455 |
| 651 | 3300005441 | Ga0070700_100018773 | Ga0070700_1000187733 | 455 |
| 652 | 3300005457 | Ga0070662_100047016 | Ga0070662_1000470162 | 455 |
| 653 | 3300005539 | Ga0068853_100063625 | Ga0068853_1000636252 | 455 |
| 654 | 3300005544 | Ga0070686_100076181 | Ga0070686_1000761812 | 455 |
| 655 | 3300005719 | Ga0068861_100176098 | Ga0068861_1001760982 | 455 |
| 656 | 3300006175 | Ga0070712_100027943 | Ga0070712_1000279433 | 455 |
| 657 | 3300006846 | Ga0075430_100041483 | Ga0075430_1000414832 | 455 |
| 658 | 3300009177 | Ga0105248_10127493 | Ga0105248_101274933 | 455 |
| 659 | 3300009545 | Ga0105237_10226999 | Ga0105237_102269992 | 455 |
| 660 | 3300013308 | Ga0157375_10086370 | Ga0157375_100863703 | 455 |
| 661 | 3300022467 | Ga0224712_10004327 | Ga0224712_100043273 | 455 |
| 662 | 3300025915 | Ga0207693_10131025 | Ga0207693_101310251 | 455 |
| 663 | 3300025916 | Ga0207663_10128601 | Ga0207663_101286011 | 455 |
| 664 | 3300025918 | Ga0207662_10056488 | Ga0207662_100564882 | 455 |
| 665 | 3300025933 | Ga0207706_10018736 | Ga0207706_100187365 | 455 |
| 666 | 3300026035 | Ga0207703_10246477 | Ga0207703_102464771 | 455 |
| 667 | 3300026075 | Ga0207708_10020425 | Ga0207708_100204253 | 455 |
| 668 | 3300026118 | Ga0207675_100088285 | Ga0207675_1000882852 | 455 |
| 669 | 3300031727 | Ga0316576_10001067 | Ga0316576_1000106710 | 455 |
| 670 | 3300036712 | Ga0316584_0139184 | Ga0316584_0139184_191_1591 | 455 |
| 671 | 3300046678 | Ga0495599_0023499 | Ga0495599_0023499_396_1856 | 455 |
| 672 | 3300046678 | Ga0495599_0054268 | Ga0495599_0054268_169_1575 | 455 |
| 673 | 3300047471 | Ga0495684_0001716 | Ga0495684_0001716_2308_3819 | 455 |
| 674 | 3300049585 | Ga0501069_0000387 | Ga0501069_0000387_10458_11873 | 455 |
| 675 | 3300049586 | Ga0501070_0006896 | Ga0501070_0006896_7659_9074 | 455 |
| 676 | 3300050509 | nmdc:mga0qj67_21097_c1 | nmdc:mga0qj67_21097_c1_2304_3725 | 455 |
| 677 | 3300005329 | Ga0070683_100000558 | Ga0070683_10000055814 | 456 |
| 678 | 3300005439 | Ga0070711_100031448 | Ga0070711_1000314482 | 456 |
| 679 | 3300005535 | Ga0070684_100011666 | Ga0070684_1000116663 | 456 |
| 680 | 3300005548 | Ga0070665_100000106 | Ga0070665_100000106102 | 456 |
| 681 | 3300005564 | Ga0070664_100163711 | Ga0070664_1001637112 | 456 |
| 682 | 3300025904 | Ga0207647_10055729 | Ga0207647_100557291 | 456 |
| 683 | 3300025916 | Ga0207663_10005201 | Ga0207663_100052017 | 456 |
| 684 | 3300025944 | Ga0207661_10000896 | Ga0207661_100008968 | 456 |
| 685 | 3300028556 | Ga0265337_1000060 | Ga0265337_100006012 | 456 |
| 686 | 3300028558 | Ga0265326_10000056 | Ga0265326_1000005625 | 456 |
| 687 | 3300028654 | Ga0265322_10000017 | Ga0265322_1000001771 | 456 |
| 688 | 3300029957 | Ga0265324_10000196 | Ga0265324_100001964 | 456 |
| 689 | 3300031238 | Ga0265332_10022481 | Ga0265332_100224812 | 456 |
| 690 | 3300031239 | Ga0265328_10000258 | Ga0265328_100002581 | 456 |
| 691 | 3300031240 | Ga0265320_10000068 | Ga0265320_1000006853 | 456 |
| 692 | 3300031242 | Ga0265329_10001686 | Ga0265329_100016867 | 456 |
| 693 | 3300031250 | Ga0265331_10000606 | Ga0265331_1000060611 | 456 |
| 694 | 3300031251 | Ga0265327_10000317 | Ga0265327_1000031753 | 456 |
| 695 | 3300031344 | Ga0265316_10034806 | Ga0265316_100348062 | 456 |
| 696 | 3300031456 | Ga0307513_10201135 | Ga0307513_102011352 | 456 |
| 697 | 3300031711 | Ga0265314_10000973 | Ga0265314_100009739 | 456 |
| 698 | 3300035089 | Ga0373944_0000201 | Ga0373944_0000201_6325_7818 | 456 |
| 699 | 3300035113 | Ga0373936_0001199 | Ga0373936_0001199_7420_8913 | 456 |
| 700 | 3300035116 | Ga0373945_0000115 | Ga0373945_0000115_6738_8231 | 456 |
| 701 | 3300035170 | Ga0373943_0000129 | Ga0373943_0000129_23244_24737 | 456 |
| 702 | 3300035171 | Ga0373946_0000428 | Ga0373946_0000428_3702_5195 | 456 |
| 703 | 3300035692 | Ga0373935_0000628 | Ga0373935_0000628_8322_9815 | 456 |
| 704 | 3300035725 | Ga0373947_0000901 | Ga0373947_0000901_9861_11354 | 456 |
| 705 | 3300037068 | Ga0373925_0003472 | Ga0373925_0003472_1597_3090 | 456 |
| 706 | 3300046461 | Ga0495641_0000044 | Ga0495641_0000044_66279_67682 | 456 |
| 707 | 3300046461 | Ga0495641_0038696 | Ga0495641_0038696_596_2089 | 456 |
| 708 | 3300046463 | Ga0495653_0013842 | Ga0495653_0013842_3866_5359 | 456 |
| 709 | 3300046477 | Ga0495664_0001885 | Ga0495664_0001885_5220_6713 | 456 |
| 710 | 3300046511 | Ga0495608_0093071 | Ga0495608_0093071_336_1739 | 456 |
| 711 | 3300046531 | Ga0495665_0025665 | Ga0495665_0025665_481_1974 | 456 |
| 712 | 3300046543 | Ga0495645_0087386 | Ga0495645_0087386_346_1746 | 456 |
| 713 | 3300046559 | Ga0495667_0000786 | Ga0495667_0000786_16839_18332 | 456 |
| 714 | 3300046663 | Ga0495635_0007795 | Ga0495635_0007795_3943_5436 | 456 |
| 715 | 3300046690 | Ga0495624_0018620 | Ga0495624_0018620_1213_2706 | 456 |
| 716 | 3300047321 | Ga0495676_0000928 | Ga0495676_0000928_14541_15914 | 456 |
| 717 | 3300047321 | Ga0495676_0004043 | Ga0495676_0004043_7899_9392 | 456 |
| 718 | 3300047322 | Ga0495680_0001641 | Ga0495680_0001641_15225_16625 | 456 |
| 719 | 3300047322 | Ga0495680_0005698 | Ga0495680_0005698_1672_3165 | 456 |
| 720 | 3300047471 | Ga0495684_0001870 | Ga0495684_0001870_9042_10535 | 456 |
| 721 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_119576_120949 | 456 |
| 722 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_119576_120949 | 456 |
| 723 | 3300048909 | Ga0496106_0000033 | Ga0496106_0000033_69565_70938 | 456 |
| 724 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_119793_121166 | 456 |
| 725 | 3300048913 | Ga0496110_0013223 | Ga0496110_0013223_3931_5331 | 456 |
| 726 | 3300048916 | Ga0496113_0096997 | Ga0496113_0096997_488_1891 | 456 |
| 727 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_270290_271663 | 456 |
| 728 | 3300048918 | Ga0496115_0032311 | Ga0496115_0032311_2154_3527 | 456 |
| 729 | 3300053077 | Ga0495601_0000124 | Ga0495601_0000124_28298_29701 | 456 |
| 730 | 3300053123 | Ga0500614_000117 | Ga0500614_000117_12545_13948 | 456 |
| 731 | 3300005329 | Ga0070683_100028383 | Ga0070683_1000283833 | 457 |
| 732 | 3300005337 | Ga0070682_100134408 | Ga0070682_1001344081 | 457 |
| 733 | 3300005341 | Ga0070691_10000100 | Ga0070691_1000010015 | 457 |
| 734 | 3300005347 | Ga0070668_100027645 | Ga0070668_1000276453 | 457 |
| 735 | 3300005354 | Ga0070675_100086774 | Ga0070675_1000867742 | 457 |
| 736 | 3300005366 | Ga0070659_100012095 | Ga0070659_1000120952 | 457 |
| 737 | 3300005435 | Ga0070714_100003174 | Ga0070714_1000031744 | 457 |
| 738 | 3300005435 | Ga0070714_100004997 | Ga0070714_1000049977 | 457 |
| 739 | 3300005435 | Ga0070714_100019304 | Ga0070714_1000193046 | 457 |
| 740 | 3300005435 | Ga0070714_100019464 | Ga0070714_1000194642 | 457 |
| 741 | 3300005436 | Ga0070713_100032866 | Ga0070713_1000328662 | 457 |
| 742 | 3300005437 | Ga0070710_10000267 | Ga0070710_1000026713 | 457 |
| 743 | 3300005437 | Ga0070710_10022888 | Ga0070710_100228885 | 457 |
| 744 | 3300005437 | Ga0070710_10028899 | Ga0070710_100288992 | 457 |
| 745 | 3300005438 | Ga0070701_10010033 | Ga0070701_100100332 | 457 |
| 746 | 3300005439 | Ga0070711_100000788 | Ga0070711_1000007888 | 457 |
| 747 | 3300005439 | Ga0070711_100011244 | Ga0070711_1000112441 | 457 |
| 748 | 3300005441 | Ga0070700_100010097 | Ga0070700_1000100972 | 457 |
| 749 | 3300005441 | Ga0070700_100052626 | Ga0070700_1000526262 | 457 |
| 750 | 3300005444 | Ga0070694_100076615 | Ga0070694_1000766152 | 457 |
| 751 | 3300005445 | Ga0070708_100184572 | Ga0070708_1001845721 | 457 |
| 752 | 3300005455 | Ga0070663_100036784 | Ga0070663_1000367842 | 457 |
| 753 | 3300005457 | Ga0070662_100154358 | Ga0070662_1001543581 | 457 |
| 754 | 3300005459 | Ga0068867_100002154 | Ga0068867_1000021542 | 457 |
| 755 | 3300005466 | Ga0070685_10007229 | Ga0070685_100072292 | 457 |
| 756 | 3300005467 | Ga0070706_100025104 | Ga0070706_1000251042 | 457 |
| 757 | 3300005471 | Ga0070698_100037283 | Ga0070698_1000372832 | 457 |
| 758 | 3300005536 | Ga0070697_100021855 | Ga0070697_1000218554 | 457 |
| 759 | 3300005544 | Ga0070686_100029552 | Ga0070686_1000295522 | 457 |
| 760 | 3300005548 | Ga0070665_100006680 | Ga0070665_1000066809 | 457 |
| 761 | 3300005577 | Ga0068857_100115106 | Ga0068857_1001151062 | 457 |
| 762 | 3300005614 | Ga0068856_100014872 | Ga0068856_1000148725 | 457 |
| 763 | 3300005614 | Ga0068856_100109819 | Ga0068856_1001098193 | 457 |
| 764 | 3300005616 | Ga0068852_100008106 | Ga0068852_1000081063 | 457 |
| 765 | 3300005841 | Ga0068863_100016249 | Ga0068863_1000162492 | 457 |
| 766 | 3300005843 | Ga0068860_100078060 | Ga0068860_1000780602 | 457 |
| 767 | 3300005983 | Ga0081540_1000181 | Ga0081540_100018122 | 457 |
| 768 | 3300005985 | Ga0081539_10001052 | Ga0081539_1000105249 | 457 |
| 769 | 3300006028 | Ga0070717_10000006 | Ga0070717_1000000698 | 457 |
| 770 | 3300006028 | Ga0070717_10008176 | Ga0070717_100081766 | 457 |
| 771 | 3300006173 | Ga0070716_100001363 | Ga0070716_1000013635 | 457 |
| 772 | 3300006175 | Ga0070712_100003227 | Ga0070712_1000032275 | 457 |
| 773 | 3300006175 | Ga0070712_100019601 | Ga0070712_1000196014 | 457 |
| 774 | 3300006237 | Ga0097621_100011114 | Ga0097621_1000111148 | 457 |
| 775 | 3300006237 | Ga0097621_100140573 | Ga0097621_1001405731 | 457 |
| 776 | 3300006358 | Ga0068871_100034036 | Ga0068871_1000340362 | 457 |
| 777 | 3300006358 | Ga0068871_100040731 | Ga0068871_1000407314 | 457 |
| 778 | 3300006358 | Ga0068871_100041886 | Ga0068871_1000418863 | 457 |
| 779 | 3300006844 | Ga0075428_100022812 | Ga0075428_1000228127 | 457 |
| 780 | 3300006846 | Ga0075430_100011868 | Ga0075430_10001186810 | 457 |
| 781 | 3300006846 | Ga0075430_100113457 | Ga0075430_1001134571 | 457 |
| 782 | 3300006847 | Ga0075431_100000685 | Ga0075431_1000006853 | 457 |
| 783 | 3300006852 | Ga0075433_10016860 | Ga0075433_100168605 | 457 |
| 784 | 3300006871 | Ga0075434_100004695 | Ga0075434_10000469511 | 457 |
| 785 | 3300006871 | Ga0075434_100228529 | Ga0075434_1002285291 | 457 |
| 786 | 3300006881 | Ga0068865_100003061 | Ga0068865_10000306111 | 457 |
| 787 | 3300006881 | Ga0068865_100094754 | Ga0068865_1000947541 | 457 |
| 788 | 3300007076 | Ga0075435_100010048 | Ga0075435_1000100487 | 457 |
| 789 | 3300007076 | Ga0075435_100122502 | Ga0075435_1001225021 | 457 |
| 790 | 3300009093 | Ga0105240_10192408 | Ga0105240_101924082 | 457 |
| 791 | 3300009098 | Ga0105245_10073817 | Ga0105245_100738173 | 457 |
| 792 | 3300009176 | Ga0105242_10001159 | Ga0105242_1000115918 | 457 |
| 793 | 3300009176 | Ga0105242_10016636 | Ga0105242_100166363 | 457 |
| 794 | 3300009553 | Ga0105249_10009694 | Ga0105249_100096947 | 457 |
| 795 | 3300010375 | Ga0105239_10033703 | Ga0105239_100337034 | 457 |
| 796 | 3300013102 | Ga0157371_10049289 | Ga0157371_100492892 | 457 |
| 797 | 3300013104 | Ga0157370_10033202 | Ga0157370_100332022 | 457 |
| 798 | 3300013306 | Ga0163162_10025640 | Ga0163162_100256402 | 457 |
| 799 | 3300013306 | Ga0163162_10205614 | Ga0163162_102056141 | 457 |
| 800 | 3300013307 | Ga0157372_10008824 | Ga0157372_100088243 | 457 |
| 801 | 3300013308 | Ga0157375_10004006 | Ga0157375_100040064 | 457 |
| 802 | 3300014968 | Ga0157379_10018892 | Ga0157379_100188924 | 457 |
| 803 | 3300014969 | Ga0157376_10004119 | Ga0157376_100041194 | 457 |
| 804 | 3300025898 | Ga0207692_10004714 | Ga0207692_100047143 | 457 |
| 805 | 3300025898 | Ga0207692_10006213 | Ga0207692_100062134 | 457 |
| 806 | 3300025901 | Ga0207688_10069458 | Ga0207688_100694581 | 457 |
| 807 | 3300025904 | Ga0207647_10051955 | Ga0207647_100519552 | 457 |
| 808 | 3300025906 | Ga0207699_10003875 | Ga0207699_100038755 | 457 |
| 809 | 3300025910 | Ga0207684_10208636 | Ga0207684_102086361 | 457 |
| 810 | 3300025915 | Ga0207693_10001273 | Ga0207693_1000127310 | 457 |
| 811 | 3300025915 | Ga0207693_10003950 | Ga0207693_100039508 | 457 |
| 812 | 3300025915 | Ga0207693_10015101 | Ga0207693_100151012 | 457 |
| 813 | 3300025916 | Ga0207663_10016114 | Ga0207663_100161144 | 457 |
| 814 | 3300025916 | Ga0207663_10066960 | Ga0207663_100669602 | 457 |
| 815 | 3300025916 | Ga0207663_10080764 | Ga0207663_100807642 | 457 |
| 816 | 3300025919 | Ga0207657_10012567 | Ga0207657_100125673 | 457 |
| 817 | 3300025922 | Ga0207646_10082643 | Ga0207646_100826432 | 457 |
| 818 | 3300025922 | Ga0207646_10104150 | Ga0207646_101041502 | 457 |
| 819 | 3300025927 | Ga0207687_10176006 | Ga0207687_101760062 | 457 |
| 820 | 3300025928 | Ga0207700_10005015 | Ga0207700_100050155 | 457 |
| 821 | 3300025928 | Ga0207700_10012605 | Ga0207700_100126053 | 457 |
| 822 | 3300025929 | Ga0207664_10003838 | Ga0207664_100038384 | 457 |
| 823 | 3300025929 | Ga0207664_10005028 | Ga0207664_100050284 | 457 |
| 824 | 3300025929 | Ga0207664_10007360 | Ga0207664_100073606 | 457 |
| 825 | 3300025929 | Ga0207664_10008030 | Ga0207664_100080307 | 457 |
| 826 | 3300025929 | Ga0207664_10012014 | Ga0207664_100120143 | 457 |
| 827 | 3300025929 | Ga0207664_10097511 | Ga0207664_100975112 | 457 |
| 828 | 3300025933 | Ga0207706_10005339 | Ga0207706_100053392 | 457 |
| 829 | 3300025934 | Ga0207686_10000035 | Ga0207686_1000003520 | 457 |
| 830 | 3300025934 | Ga0207686_10001551 | Ga0207686_100015517 | 457 |
| 831 | 3300025935 | Ga0207709_10001318 | Ga0207709_100013184 | 457 |
| 832 | 3300025935 | Ga0207709_10068835 | Ga0207709_100688351 | 457 |
| 833 | 3300025935 | Ga0207709_10117364 | Ga0207709_101173642 | 457 |
| 834 | 3300025938 | Ga0207704_10006123 | Ga0207704_100061233 | 457 |
| 835 | 3300025938 | Ga0207704_10102160 | Ga0207704_101021601 | 457 |
| 836 | 3300025939 | Ga0207665_10001498 | Ga0207665_1000149811 | 457 |
| 837 | 3300025939 | Ga0207665_10039692 | Ga0207665_100396922 | 457 |
| 838 | 3300025961 | Ga0207712_10064710 | Ga0207712_100647101 | 457 |
| 839 | 3300026075 | Ga0207708_10002772 | Ga0207708_100027723 | 457 |
| 840 | 3300026075 | Ga0207708_10017990 | Ga0207708_100179904 | 457 |
| 841 | 3300026078 | Ga0207702_10085384 | Ga0207702_100853842 | 457 |
| 842 | 3300026088 | Ga0207641_10011889 | Ga0207641_100118896 | 457 |
| 843 | 3300026089 | Ga0207648_10003623 | Ga0207648_1000362313 | 457 |
| 844 | 3300026118 | Ga0207675_100234454 | Ga0207675_1002344542 | 457 |
| 845 | 3300026121 | Ga0207683_10000941 | Ga0207683_1000094121 | 457 |
| 846 | 3300026142 | Ga0207698_10008521 | Ga0207698_100085214 | 457 |
| 847 | 3300026142 | Ga0207698_10099693 | Ga0207698_100996931 | 457 |
| 848 | 3300027907 | Ga0207428_10001212 | Ga0207428_100012127 | 457 |
| 849 | 3300035083 | Ga0373926_0000085 | Ga0373926_0000085_7661_9139 | 457 |
| 850 | 3300035086 | Ga0373934_0004651 | Ga0373934_0004651_1784_3295 | 457 |
| 851 | 3300035111 | Ga0373923_0000654 | Ga0373923_0000654_6915_8393 | 457 |
| 852 | 3300035113 | Ga0373936_0019069 | Ga0373936_0019069_1006_2511 | 457 |
| 853 | 3300035116 | Ga0373945_0000374 | Ga0373945_0000374_3278_4756 | 457 |
| 854 | 3300035117 | Ga0373953_0000290 | Ga0373953_0000290_7615_9168 | 457 |
| 855 | 3300035117 | Ga0373953_0001319 | Ga0373953_0001319_2531_4009 | 457 |
| 856 | 3300035118 | Ga0373954_0000277 | Ga0373954_0000277_10388_11941 | 457 |
| 857 | 3300035118 | Ga0373954_0006958 | Ga0373954_0006958_334_1812 | 457 |
| 858 | 3300035119 | Ga0373956_0000733 | Ga0373956_0000733_11252_12805 | 457 |
| 859 | 3300035120 | Ga0373957_0000032 | Ga0373957_0000032_24400_25953 | 457 |
| 860 | 3300035120 | Ga0373957_0009644 | Ga0373957_0009644_1615_3093 | 457 |
| 861 | 3300035170 | Ga0373943_0003042 | Ga0373943_0003042_767_2245 | 457 |
| 862 | 3300035171 | Ga0373946_0000709 | Ga0373946_0000709_603_2081 | 457 |
| 863 | 3300035172 | Ga0373955_0000092 | Ga0373955_0000092_2894_4447 | 457 |
| 864 | 3300035172 | Ga0373955_0026927 | Ga0373955_0026927_1396_2901 | 457 |
| 865 | 3300035172 | Ga0373955_0030615 | Ga0373955_0030615_373_1851 | 457 |
| 866 | 3300035410 | Ga0373924_0000555 | Ga0373924_0000555_3741_5219 | 457 |
| 867 | 3300035410 | Ga0373924_0009457 | Ga0373924_0009457_194_1699 | 457 |
| 868 | 3300035692 | Ga0373935_0003273 | Ga0373935_0003273_7516_8994 | 457 |
| 869 | 3300035695 | Ga0373927_0004146 | Ga0373927_0004146_8347_9825 | 457 |
| 870 | 3300035724 | Ga0373933_0000121 | Ga0373933_0000121_32531_34084 | 457 |
| 871 | 3300035725 | Ga0373947_0003331 | Ga0373947_0003331_7719_9197 | 457 |
| 872 | 3300036401 | Ga0373937_0000169 | Ga0373937_0000169_2894_4447 | 457 |
| 873 | 3300036401 | Ga0373937_0018778 | Ga0373937_0018778_1866_3371 | 457 |
| 874 | 3300036401 | Ga0373937_0021306 | Ga0373937_0021306_2676_4187 | 457 |
| 875 | 3300036401 | Ga0373937_0057773 | Ga0373937_0057773_607_2085 | 457 |
| 876 | 3300036401 | Ga0373937_0116738 | Ga0373937_0116738_373_1851 | 457 |
| 877 | 3300037068 | Ga0373925_0002434 | Ga0373925_0002434_7531_9009 | 457 |
| 878 | 3300037068 | Ga0373925_0034931 | Ga0373925_0034931_1299_2789 | 457 |
| 879 | 3300044694 | Ga0466963_0000281 | Ga0466963_0000281_10819_12276 | 457 |
| 880 | 3300045836 | Ga0466958_0007766 | Ga0466958_0007766_3211_4668 | 457 |
| 881 | 3300045976 | Ga0466967_0003703 | Ga0466967_0003703_4755_6212 | 457 |
| 882 | 3300046454 | Ga0495592_0000070 | Ga0495592_0000070_59149_60702 | 457 |
| 883 | 3300046454 | Ga0495592_0003048 | Ga0495592_0003048_4349_5854 | 457 |
| 884 | 3300046455 | Ga0495603_0023570 | Ga0495603_0023570_442_1920 | 457 |
| 885 | 3300046459 | Ga0495629_0009244 | Ga0495629_0009244_294_1670 | 457 |
| 886 | 3300046459 | Ga0495629_0041398 | Ga0495629_0041398_1317_2693 | 457 |
| 887 | 3300046461 | Ga0495641_0004675 | Ga0495641_0004675_7704_9182 | 457 |
| 888 | 3300046462 | Ga0495651_0000042 | Ga0495651_0000042_32554_34107 | 457 |
| 889 | 3300046462 | Ga0495651_0002437 | Ga0495651_0002437_6138_7643 | 457 |
| 890 | 3300046462 | Ga0495651_0012581 | Ga0495651_0012581_1670_3148 | 457 |
| 891 | 3300046462 | Ga0495651_0066441 | Ga0495651_0066441_458_1954 | 457 |
| 892 | 3300046462 | Ga0495651_0126539 | Ga0495651_0126539_169_1548 | 457 |
| 893 | 3300046463 | Ga0495653_0000416 | Ga0495653_0000416_18026_19579 | 457 |
| 894 | 3300046463 | Ga0495653_0089525 | Ga0495653_0089525_302_1780 | 457 |
| 895 | 3300046473 | Ga0495582_0007328 | Ga0495582_0007328_84_1562 | 457 |
| 896 | 3300046476 | Ga0495662_0001224 | Ga0495662_0001224_4048_5526 | 457 |
| 897 | 3300046477 | Ga0495664_0006030 | Ga0495664_0006030_984_2462 | 457 |
| 898 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_156847_158226 | 457 |
| 899 | 3300046499 | Ga0495594_0037340 | Ga0495594_0037340_536_2014 | 457 |
| 900 | 3300046511 | Ga0495608_0000054 | Ga0495608_0000054_32554_34107 | 457 |
| 901 | 3300046511 | Ga0495608_0027634 | Ga0495608_0027634_2009_3487 | 457 |
| 902 | 3300046514 | Ga0495618_0002174 | Ga0495618_0002174_4529_6007 | 457 |
| 903 | 3300046516 | Ga0495628_0000106 | Ga0495628_0000106_29800_31353 | 457 |
| 904 | 3300046516 | Ga0495628_0000548 | Ga0495628_0000548_11650_13026 | 457 |
| 905 | 3300046516 | Ga0495628_0008134 | Ga0495628_0008134_2988_4493 | 457 |
| 906 | 3300046516 | Ga0495628_0089313 | Ga0495628_0089313_658_2037 | 457 |
| 907 | 3300046516 | Ga0495628_0095682 | Ga0495628_0095682_373_1851 | 457 |
| 908 | 3300046517 | Ga0495630_0007970 | Ga0495630_0007970_4551_6029 | 457 |
| 909 | 3300046526 | Ga0495666_0001713 | Ga0495666_0001713_7265_8743 | 457 |
| 910 | 3300046529 | Ga0495652_0000119 | Ga0495652_0000119_59134_60687 | 457 |
| 911 | 3300046529 | Ga0495652_0012958 | Ga0495652_0012958_1414_2919 | 457 |
| 912 | 3300046529 | Ga0495652_0024428 | Ga0495652_0024428_2704_4215 | 457 |
| 913 | 3300046529 | Ga0495652_0036500 | Ga0495652_0036500_461_1948 | 457 |
| 914 | 3300046529 | Ga0495652_0057114 | Ga0495652_0057114_1380_2858 | 457 |
| 915 | 3300046529 | Ga0495652_0079778 | Ga0495652_0079778_856_2235 | 457 |
| 916 | 3300046531 | Ga0495665_0001874 | Ga0495665_0001874_7076_8554 | 457 |
| 917 | 3300046533 | Ga0495640_0002238 | Ga0495640_0002238_6940_8418 | 457 |
| 918 | 3300046533 | Ga0495640_0012252 | Ga0495640_0012252_3995_5500 | 457 |
| 919 | 3300046535 | Ga0495586_0011461 | Ga0495586_0011461_1595_3073 | 457 |
| 920 | 3300046535 | Ga0495586_0028610 | Ga0495586_0028610_389_1894 | 457 |
| 921 | 3300046536 | Ga0495587_0000119 | Ga0495587_0000119_32554_34107 | 457 |
| 922 | 3300046536 | Ga0495587_0000208 | Ga0495587_0000208_31278_32783 | 457 |
| 923 | 3300046536 | Ga0495587_0076226 | Ga0495587_0076226_379_1755 | 457 |
| 924 | 3300046543 | Ga0495645_0004517 | Ga0495645_0004517_4697_6076 | 457 |
| 925 | 3300046543 | Ga0495645_0009728 | Ga0495645_0009728_444_1922 | 457 |
| 926 | 3300046543 | Ga0495645_0014243 | Ga0495645_0014243_3754_5151 | 457 |
| 927 | 3300046543 | Ga0495645_0027180 | Ga0495645_0027180_1745_3124 | 457 |
| 928 | 3300046543 | Ga0495645_0050054 | Ga0495645_0050054_392_1879 | 457 |
| 929 | 3300046557 | Ga0495622_0000033 | Ga0495622_0000033_69070_70449 | 457 |
| 930 | 3300046559 | Ga0495667_0000253 | Ga0495667_0000253_32554_34107 | 457 |
| 931 | 3300046559 | Ga0495667_0004224 | Ga0495667_0004224_6623_8101 | 457 |
| 932 | 3300046642 | Ga0495634_0001902 | Ga0495634_0001902_7591_9069 | 457 |
| 933 | 3300046642 | Ga0495634_0003663 | Ga0495634_0003663_10552_12057 | 457 |
| 934 | 3300046663 | Ga0495635_0006237 | Ga0495635_0006237_6384_7862 | 457 |
| 935 | 3300046675 | Ga0495657_0000067 | Ga0495657_0000067_32554_34107 | 457 |
| 936 | 3300046678 | Ga0495599_0000042 | Ga0495599_0000042_60806_62359 | 457 |
| 937 | 3300046678 | Ga0495599_0003417 | Ga0495599_0003417_5100_6578 | 457 |
| 938 | 3300046679 | Ga0495623_0047400 | Ga0495623_0047400_424_1935 | 457 |
| 939 | 3300046679 | Ga0495623_0054890 | Ga0495623_0054890_851_2404 | 457 |
| 940 | 3300046679 | Ga0495623_0074173 | Ga0495623_0074173_480_1958 | 457 |
| 941 | 3300046679 | Ga0495623_0097522 | Ga0495623_0097522_53_1531 | 457 |
| 942 | 3300046680 | Ga0495646_0005486 | Ga0495646_0005486_6289_7794 | 457 |
| 943 | 3300046680 | Ga0495646_0009050 | Ga0495646_0009050_444_1922 | 457 |
| 944 | 3300046680 | Ga0495646_0014587 | Ga0495646_0014587_1623_3176 | 457 |
| 945 | 3300046681 | Ga0495647_0013226 | Ga0495647_0013226_97_1575 | 457 |
| 946 | 3300046683 | Ga0495658_0001583 | Ga0495658_0001583_2597_4075 | 457 |
| 947 | 3300046689 | Ga0495613_0007629 | Ga0495613_0007629_961_2439 | 457 |
| 948 | 3300046689 | Ga0495613_0107403 | Ga0495613_0107403_237_1742 | 457 |
| 949 | 3300046690 | Ga0495624_0002113 | Ga0495624_0002113_10225_11703 | 457 |
| 950 | 3300046809 | Ga0495600_0003523 | Ga0495600_0003523_885_2438 | 457 |
| 951 | 3300046809 | Ga0495600_0005898 | Ga0495600_0005898_302_1780 | 457 |
| 952 | 3300047315 | Ga0495581_0001959 | Ga0495581_0001959_1357_2835 | 457 |
| 953 | 3300047317 | Ga0495604_0000121 | Ga0495604_0000121_59149_60702 | 457 |
| 954 | 3300047319 | Ga0495674_0019676 | Ga0495674_0019676_1632_3122 | 457 |
| 955 | 3300047319 | Ga0495674_0059367 | Ga0495674_0059367_879_2357 | 457 |
| 956 | 3300047321 | Ga0495676_0003693 | Ga0495676_0003693_8738_10216 | 457 |
| 957 | 3300047322 | Ga0495680_0000054 | Ga0495680_0000054_32543_34096 | 457 |
| 958 | 3300047322 | Ga0495680_0020072 | Ga0495680_0020072_3678_5156 | 457 |
| 959 | 3300047322 | Ga0495680_0037660 | Ga0495680_0037660_2469_3845 | 457 |
| 960 | 3300047444 | Ga0495675_0000176 | Ga0495675_0000176_25696_27249 | 457 |
| 961 | 3300047444 | Ga0495675_0077140 | Ga0495675_0077140_294_1772 | 457 |
| 962 | 3300047471 | Ga0495684_0000562 | Ga0495684_0000562_23564_25069 | 457 |
| 963 | 3300047471 | Ga0495684_0008951 | Ga0495684_0008951_5616_7094 | 457 |
| 964 | 3300047471 | Ga0495684_0052690 | Ga0495684_0052690_968_2479 | 457 |
| 965 | 3300047673 | Ga0495593_0004833 | Ga0495593_0004833_5986_7464 | 457 |
| 966 | 3300048088 | Ga0495602_0000083 | Ga0495602_0000083_32554_34107 | 457 |
| 967 | 3300048088 | Ga0495602_0004572 | Ga0495602_0004572_3530_4906 | 457 |
| 968 | 3300048088 | Ga0495602_0034960 | Ga0495602_0034960_984_2462 | 457 |
| 969 | 3300048088 | Ga0495602_0038087 | Ga0495602_0038087_2703_4214 | 457 |
| 970 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_53645_55021 | 457 |
| 971 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_540886_542262 | 457 |
| 972 | 3300048907 | Ga0496104_0008695 | Ga0496104_0008695_2381_3886 | 457 |
| 973 | 3300048908 | Ga0496105_0013858 | Ga0496105_0013858_3585_5090 | 457 |
| 974 | 3300048911 | Ga0496108_0012519 | Ga0496108_0012519_1211_2716 | 457 |
| 975 | 3300048911 | Ga0496108_0045410 | Ga0496108_0045410_80_1459 | 457 |
| 976 | 3300048913 | Ga0496110_0035902 | Ga0496110_0035902_1418_2797 | 457 |
| 977 | 3300048913 | Ga0496110_0068392 | Ga0496110_0068392_864_2369 | 457 |
| 978 | 3300048914 | Ga0496111_0004675 | Ga0496111_0004675_5803_7182 | 457 |
| 979 | 3300048914 | Ga0496111_0047847 | Ga0496111_0047847_963_2468 | 457 |
| 980 | 3300048915 | Ga0496112_0026382 | Ga0496112_0026382_119_1624 | 457 |
| 981 | 3300049578 | Ga0501042_0007340 | Ga0501042_0007340_1966_3342 | 457 |
| 982 | 3300053077 | Ga0495601_0013142 | Ga0495601_0013142_373_1851 | 457 |
| 983 | 3300053078 | Ga0495612_0003172 | Ga0495612_0003172_4235_5713 | 457 |
| 984 | 3300053078 | Ga0495612_0010699 | Ga0495612_0010699_2096_3472 | 457 |
| 985 | 3300053083 | Ga0495655_0000008 | Ga0495655_0000008_85522_86898 | 457 |
| 986 | 3300053084 | Ga0495595_0001178 | Ga0495595_0001178_8161_9714 | 457 |
| 987 | 3300053085 | Ga0495619_0001863 | Ga0495619_0001863_9060_10538 | 457 |
| 988 | 3300053085 | Ga0495619_0009701 | Ga0495619_0009701_2301_3806 | 457 |
| 989 | 3300053094 | Ga0500566_0002923 | Ga0500566_0002923_5180_6556 | 457 |
| 990 | 3300053129 | Ga0500628_000023 | Ga0500628_000023_40436_41812 | 457 |
| 991 | 3300001979 | JGI24740J21852_10000802 | JGI24740J21852_100008023 | 458 |
| 992 | 3300005329 | Ga0070683_100002533 | Ga0070683_1000025335 | 458 |
| 993 | 3300005329 | Ga0070683_100039126 | Ga0070683_1000391261 | 458 |
| 994 | 3300005334 | Ga0068869_100021699 | Ga0068869_1000216993 | 458 |
| 995 | 3300005336 | Ga0070680_100059941 | Ga0070680_1000599411 | 458 |
| 996 | 3300005337 | Ga0070682_100062599 | Ga0070682_1000625992 | 458 |
| 997 | 3300005339 | Ga0070660_100011436 | Ga0070660_1000114369 | 458 |
| 998 | 3300005340 | Ga0070689_100033350 | Ga0070689_1000333502 | 458 |
| 999 | 3300005341 | Ga0070691_10014628 | Ga0070691_100146282 | 458 |
| 1000 | 3300005345 | Ga0070692_10018220 | Ga0070692_100182201 | 458 |
| 1001 | 3300005345 | Ga0070692_10107762 | Ga0070692_101077621 | 458 |
| 1002 | 3300005353 | Ga0070669_100014929 | Ga0070669_1000149293 | 458 |
| 1003 | 3300005354 | Ga0070675_100001463 | Ga0070675_1000014639 | 458 |
| 1004 | 3300005354 | Ga0070675_100013342 | Ga0070675_1000133429 | 458 |
| 1005 | 3300005365 | Ga0070688_100038237 | Ga0070688_1000382373 | 458 |
| 1006 | 3300005366 | Ga0070659_100000852 | Ga0070659_1000008528 | 458 |
| 1007 | 3300005366 | Ga0070659_100012543 | Ga0070659_1000125437 | 458 |
| 1008 | 3300005367 | Ga0070667_100183131 | Ga0070667_1001831311 | 458 |
| 1009 | 3300005437 | Ga0070710_10000002 | Ga0070710_10000002158 | 458 |
| 1010 | 3300005441 | Ga0070700_100005283 | Ga0070700_1000052839 | 458 |
| 1011 | 3300005455 | Ga0070663_100002472 | Ga0070663_10000247215 | 458 |
| 1012 | 3300005455 | Ga0070663_100134704 | Ga0070663_1001347041 | 458 |
| 1013 | 3300005456 | Ga0070678_100183952 | Ga0070678_1001839521 | 458 |
| 1014 | 3300005457 | Ga0070662_100013035 | Ga0070662_1000130353 | 458 |
| 1015 | 3300005457 | Ga0070662_100063899 | Ga0070662_1000638994 | 458 |
| 1016 | 3300005535 | Ga0070684_100006264 | Ga0070684_1000062648 | 458 |
| 1017 | 3300005539 | Ga0068853_100007231 | Ga0068853_1000072313 | 458 |
| 1018 | 3300005543 | Ga0070672_100013162 | Ga0070672_1000131622 | 458 |
| 1019 | 3300005544 | Ga0070686_100111680 | Ga0070686_1001116801 | 458 |
| 1020 | 3300005547 | Ga0070693_100009311 | Ga0070693_1000093112 | 458 |
| 1021 | 3300005564 | Ga0070664_100013358 | Ga0070664_1000133588 | 458 |
| 1022 | 3300005564 | Ga0070664_100017902 | Ga0070664_1000179027 | 458 |
| 1023 | 3300005564 | Ga0070664_100154820 | Ga0070664_1001548201 | 458 |
| 1024 | 3300005578 | Ga0068854_100004234 | Ga0068854_10000423410 | 458 |
| 1025 | 3300005615 | Ga0070702_100003799 | Ga0070702_1000037995 | 458 |
| 1026 | 3300005616 | Ga0068852_100080517 | Ga0068852_1000805173 | 458 |
| 1027 | 3300005616 | Ga0068852_100091270 | Ga0068852_1000912702 | 458 |
| 1028 | 3300005616 | Ga0068852_100119796 | Ga0068852_1001197962 | 458 |
| 1029 | 3300005840 | Ga0068870_10079616 | Ga0068870_100796162 | 458 |
| 1030 | 3300005844 | Ga0068862_100132971 | Ga0068862_1001329712 | 458 |
| 1031 | 3300006051 | Ga0075364_10017590 | Ga0075364_100175903 | 458 |
| 1032 | 3300006881 | Ga0068865_100005688 | Ga0068865_10000568811 | 458 |
| 1033 | 3300009094 | Ga0111539_10002876 | Ga0111539_100028766 | 458 |
| 1034 | 3300009094 | Ga0111539_10164550 | Ga0111539_101645502 | 458 |
| 1035 | 3300009098 | Ga0105245_10010376 | Ga0105245_100103767 | 458 |
| 1036 | 3300009098 | Ga0105245_10047423 | Ga0105245_100474233 | 458 |
| 1037 | 3300009101 | Ga0105247_10000369 | Ga0105247_1000036930 | 458 |
| 1038 | 3300009148 | Ga0105243_10005915 | Ga0105243_100059156 | 458 |
| 1039 | 3300009148 | Ga0105243_10017401 | Ga0105243_100174013 | 458 |
| 1040 | 3300009176 | Ga0105242_10176318 | Ga0105242_101763182 | 458 |
| 1041 | 3300010375 | Ga0105239_10009449 | Ga0105239_100094498 | 458 |
| 1042 | 3300011119 | Ga0105246_10018236 | Ga0105246_100182361 | 458 |
| 1043 | 3300013308 | Ga0157375_10003892 | Ga0157375_100038926 | 458 |
| 1044 | 3300013308 | Ga0157375_10016208 | Ga0157375_100162086 | 458 |
| 1045 | 3300014745 | Ga0157377_10001163 | Ga0157377_100011638 | 458 |
| 1046 | 3300014745 | Ga0157377_10005504 | Ga0157377_100055045 | 458 |
| 1047 | 3300025898 | Ga0207692_10000005 | Ga0207692_1000000559 | 458 |
| 1048 | 3300025900 | Ga0207710_10000227 | Ga0207710_1000022712 | 458 |
| 1049 | 3300025901 | Ga0207688_10006721 | Ga0207688_100067212 | 458 |
| 1050 | 3300025907 | Ga0207645_10039419 | Ga0207645_100394192 | 458 |
| 1051 | 3300025909 | Ga0207705_10013443 | Ga0207705_100134437 | 458 |
| 1052 | 3300025911 | Ga0207654_10091040 | Ga0207654_100910401 | 458 |
| 1053 | 3300025919 | Ga0207657_10005677 | Ga0207657_1000567715 | 458 |
| 1054 | 3300025919 | Ga0207657_10093682 | Ga0207657_100936822 | 458 |
| 1055 | 3300025920 | Ga0207649_10116054 | Ga0207649_101160541 | 458 |
| 1056 | 3300025923 | Ga0207681_10045347 | Ga0207681_100453473 | 458 |
| 1057 | 3300025926 | Ga0207659_10003884 | Ga0207659_100038841 | 458 |
| 1058 | 3300025926 | Ga0207659_10040587 | Ga0207659_100405872 | 458 |
| 1059 | 3300025927 | Ga0207687_10027279 | Ga0207687_100272792 | 458 |
| 1060 | 3300025927 | Ga0207687_10037166 | Ga0207687_100371661 | 458 |
| 1061 | 3300025927 | Ga0207687_10053621 | Ga0207687_100536213 | 458 |
| 1062 | 3300025932 | Ga0207690_10029423 | Ga0207690_100294232 | 458 |
| 1063 | 3300025932 | Ga0207690_10039765 | Ga0207690_100397652 | 458 |
| 1064 | 3300025933 | Ga0207706_10002554 | Ga0207706_100025541 | 458 |
| 1065 | 3300025933 | Ga0207706_10003441 | Ga0207706_1000344115 | 458 |
| 1066 | 3300025935 | Ga0207709_10035002 | Ga0207709_100350021 | 458 |
| 1067 | 3300025936 | Ga0207670_10021496 | Ga0207670_100214962 | 458 |
| 1068 | 3300025937 | Ga0207669_10020443 | Ga0207669_100204435 | 458 |
| 1069 | 3300025940 | Ga0207691_10003769 | Ga0207691_1000376917 | 458 |
| 1070 | 3300025942 | Ga0207689_10028298 | Ga0207689_100282983 | 458 |
| 1071 | 3300025942 | Ga0207689_10071506 | Ga0207689_100715062 | 458 |
| 1072 | 3300025944 | Ga0207661_10005047 | Ga0207661_100050478 | 458 |
| 1073 | 3300025944 | Ga0207661_10017682 | Ga0207661_100176825 | 458 |
| 1074 | 3300025944 | Ga0207661_10181926 | Ga0207661_101819263 | 458 |
| 1075 | 3300025945 | Ga0207679_10033544 | Ga0207679_100335442 | 458 |
| 1076 | 3300025961 | Ga0207712_10120762 | Ga0207712_101207622 | 458 |
| 1077 | 3300025972 | Ga0207668_10137382 | Ga0207668_101373822 | 458 |
| 1078 | 3300026023 | Ga0207677_10044985 | Ga0207677_100449852 | 458 |
| 1079 | 3300026041 | Ga0207639_10005344 | Ga0207639_1000534411 | 458 |
| 1080 | 3300026067 | Ga0207678_10003330 | Ga0207678_100033302 | 458 |
| 1081 | 3300026067 | Ga0207678_10013416 | Ga0207678_100134169 | 458 |
| 1082 | 3300026075 | Ga0207708_10013121 | Ga0207708_100131213 | 458 |
| 1083 | 3300026089 | Ga0207648_10074878 | Ga0207648_100748781 | 458 |
| 1084 | 3300026116 | Ga0207674_10025958 | Ga0207674_100259584 | 458 |
| 1085 | 3300026118 | Ga0207675_100036180 | Ga0207675_1000361802 | 458 |
| 1086 | 3300026121 | Ga0207683_10125432 | Ga0207683_101254322 | 458 |
| 1087 | 3300026142 | Ga0207698_10059113 | Ga0207698_100591132 | 458 |
| 1088 | 3300026142 | Ga0207698_10122177 | Ga0207698_101221772 | 458 |
| 1089 | 3300028381 | Ga0268264_10220509 | Ga0268264_102205092 | 458 |
| 1090 | 3300028563 | Ga0265319_1000037 | Ga0265319_100003767 | 458 |
| 1091 | 3300028800 | Ga0265338_10000051 | Ga0265338_10000051168 | 458 |
| 1092 | 3300028800 | Ga0265338_10175064 | Ga0265338_101750641 | 458 |
| 1093 | 3300031250 | Ga0265331_10004016 | Ga0265331_100040165 | 458 |
| 1094 | 3300031251 | Ga0265327_10063849 | Ga0265327_100638491 | 458 |
| 1095 | 3300031712 | Ga0265342_10094047 | Ga0265342_100940471 | 458 |
| 1096 | 3300032126 | Ga0307415_100009645 | Ga0307415_1000096453 | 458 |
| 1097 | 3300046463 | Ga0495653_0039619 | Ga0495653_0039619_1683_3098 | 458 |
| 1098 | 3300046473 | Ga0495582_0019734 | Ga0495582_0019734_1234_2718 | 458 |
| 1099 | 3300046491 | Ga0495584_0050343 | Ga0495584_0050343_320_1762 | 458 |
| 1100 | 3300046511 | Ga0495608_0005192 | Ga0495608_0005192_4601_6013 | 458 |
| 1101 | 3300046516 | Ga0495628_0143245 | Ga0495628_0143245_99_1511 | 458 |
| 1102 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_90428_91840 | 458 |
| 1103 | 3300047471 | Ga0495684_0010104 | Ga0495684_0010104_1103_2533 | 458 |
| 1104 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_72377_73753 | 458 |
| 1105 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_72377_73753 | 458 |
| 1106 | 3300048909 | Ga0496106_0005382 | Ga0496106_0005382_7734_9155 | 458 |
| 1107 | 3300048909 | Ga0496106_0087764 | Ga0496106_0087764_210_1658 | 458 |
| 1108 | 3300048911 | Ga0496108_0000187 | Ga0496108_0000187_47547_48959 | 458 |
| 1109 | 3300048911 | Ga0496108_0015305 | Ga0496108_0015305_3963_5384 | 458 |
| 1110 | 3300048912 | Ga0496109_0000636 | Ga0496109_0000636_17535_18947 | 458 |
| 1111 | 3300048913 | Ga0496110_0014802 | Ga0496110_0014802_1510_2931 | 458 |
| 1112 | 3300048916 | Ga0496113_0002968 | Ga0496113_0002968_8349_9770 | 458 |
| 1113 | 3300048922 | Ga0496119_0014904 | Ga0496119_0014904_1047_2423 | 458 |
| 1114 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_32220_33632 | 458 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dm8-assembly1.cif.gz_A-2 | crystal structure of putative isomerase from rhodopseudomonas palustris | 0.5083 | 269 | 314 |
| 3i4b-assembly1.cif.gz_A | crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor | 0.4662 | 277 | 370 |
| 3rcd-assembly1.cif.gz_A | her2 kinase domain complexed with tak-285 | 0.4403 | 277 | 371 |
| 5jeb-assembly1.cif.gz_A | crystal structure of egfr tyrosine kinase domain with novel inhibitor of active state of her2 | 0.4272 | 273 | 371 |
| 4cyi-assembly2.cif.gz_C | chaetomium thermophilum pan3 | 0.4212 | 291 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VIG3_1_153_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5294 | 274 | 316 | 3.30.200.20 |
| 3dm8A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.5083 | 269 | 314 | 3.10.450.50 |
| af_Q2FWK3_394_500_3.30.160.270 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain | 0.4762 | 275 | 326 | 3.30.160.270 |
| 3attA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4634 | 279 | 370 | 3.30.200.20 |
| af_Q12222_39_128_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.446 | 275 | 370 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8YCJ8-F1-model_v4 | DUF2252 domain-containing protein | 0.9812 | 1 | 458 |
GO:0016020
|
| AF-A0A359A5M1-F1-model_v4 | deleted | 0.9811 | 1 | 458 |
|
| AF-A0A401WF67-F1-model_v4 | DUF2252 domain-containing protein | 0.979 | 1 | 458 |
|
| AF-A0A359A5M1-F1-model_v4 | deleted | 0.979 | 1 | 458 |
|
| AF-A0A6B2XTZ6-F1-model_v4 | DUF2252 domain-containing protein | 0.9788 | 26 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar