F490274

General Info

Members Datasets Scaffolds Average Seq Length
1114 391 1098 467

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10016860|Ga0075433_100168605
Length 534
Sequence VLWSRLDVLAYAQPASDHVILRGVPNMTALNARTEEATMAATTRSVRAQRAGGDIERDAPFASAWRRAHMSVDERVGRGRAARNEAPRSSHGHWEAAPDRPDPISLLEEQAKSRVAELVPIRYGRMLASPFTFYRGAAAIMAADLAGTPTSGVTVQLCGDAHLSNFGLFGTPERRLLFDINDFDETLPGPWEWDVKRLAASFEVMGREGGFSPADRRAVVMAGVRQYREKMGHAAKMGTLGAWYDQLDAQMLLKLVNEETRLRRLRRKEALTAGRRVAQARTRDSIRVFAKRARELNGELRIVADPPLIVPIEDLVIPGSEWENPTPLIKKLLSTYRRTLGRQGHPLEEFRYVHAARKVVGVGSVGTRCYLLLLMGRDRGDPLFLQVKEAQASVLEPFLGRSTYPHHGERIVVGQRLMQGATDIFLGWQRIRGLDGMTRDYYVRQFHDWKGGATVENLKMPGATFYARLCAATLARAHARWGDRIAIAAYLGKGDAFDRAIADFSVIYADQNERDYDSFRAAVNSGRLSAQTGI

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
4 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
5 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
6 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
7 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
8 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
9 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
10 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
11 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
12 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
13 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
14 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
15 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
205 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
206 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
207 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
223 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
227 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
240 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
248 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
267 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
384 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
385 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
386 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
387 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
388 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.99
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0.09
Rhizoplane 11.58
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000802 3300001979 Bacteria 13809
2 JGI25151J46595_10000166 3300003187 Bacteria 85475
3 JGI25407J50210_10006261 3300003373 Bacteria 2958
4 Ga0058863_11944294 3300004799 Bacteria 1894
5 Ga0058861_10082651 3300004800 Bacteria 2054
6 Ga0070683_100000558 3300005329 Bacteria 26449
7 Ga0070683_100002533 3300005329 Bacteria 14580
8 Ga0070683_100028383 3300005329 Bacteria 5056
9 Ga0070683_100039126 3300005329 Bacteria 4352
10 Ga0070683_100149948 3300005329 Bacteria 2211
11 Ga0068869_100021699 3300005334 Bacteria 4419
12 Ga0070680_100059941 3300005336 Bacteria 3115
13 Ga0070682_100000013 3300005337 Bacteria 254641
14 Ga0070682_100020489 3300005337 Unclassified 3891
15 Ga0070682_100062599 3300005337 Bacteria 2357
16 Ga0070682_100134408 3300005337 Bacteria 1678
17 Ga0070682_100143366 3300005337 Bacteria 1631
18 Ga0068868_100132802 3300005338 Bacteria 2038
19 Ga0068868_100180700 3300005338 Bacteria 1750
20 Ga0070660_100011436 3300005339 Bacteria 6305
21 Ga0070689_100033350 3300005340 Bacteria 3923
22 Ga0070691_10000100 3300005341 Bacteria 25275
23 Ga0070691_10012578 3300005341 Bacteria 3876
24 Ga0070691_10014628 3300005341 Bacteria 3601
25 Ga0070692_10011129 3300005345 Bacteria 4122
26 Ga0070692_10018220 3300005345 Bacteria 3372
27 Ga0070692_10107762 3300005345 Bacteria 1537
28 Ga0070668_100015399 3300005347 Bacteria 5715
29 Ga0070668_100027645 3300005347 Bacteria 4306
30 Ga0070668_100037245 3300005347 Bacteria 3713
31 Ga0070668_100065222 3300005347 Bacteria 2825
32 Ga0070669_100014929 3300005353 Bacteria 5535
33 Ga0070669_100104806 3300005353 Bacteria 2138
34 Ga0070675_100001463 3300005354 Bacteria 17411
35 Ga0070675_100013342 3300005354 Bacteria 6456
36 Ga0070675_100086774 3300005354 Bacteria 2616
37 Ga0070674_100139241 3300005356 Bacteria 1819
38 Ga0070674_100150710 3300005356 Bacteria 1755
39 Ga0070688_100038237 3300005365 Bacteria 2929
40 Ga0070659_100000852 3300005366 Bacteria 22251
41 Ga0070659_100012095 3300005366 Bacteria 6390
42 Ga0070659_100012543 3300005366 Bacteria 6283
43 Ga0070659_100065148 3300005366 Bacteria 2886
44 Ga0070659_100132928 3300005366 Bacteria 2021
45 Ga0070659_100183191 3300005366 Unclassified 1719
46 Ga0070667_100000597 3300005367 Bacteria 35219
47 Ga0070667_100183131 3300005367 Bacteria 1853
48 Ga0070714_100001300 3300005435 Bacteria 18068
49 Ga0070714_100003174 3300005435 Bacteria 12216
50 Ga0070714_100004997 3300005435 Bacteria 10082
51 Ga0070714_100006732 3300005435 Bacteria 8905
52 Ga0070714_100019304 3300005435 Bacteria 5549
53 Ga0070714_100019464 3300005435 Bacteria 5532
54 Ga0070714_100042155 3300005435 Bacteria 3854
55 Ga0070714_100046135 3300005435 Bacteria 3695
56 Ga0070714_100133144 3300005435 Bacteria 2223
57 Ga0070713_100001413 3300005436 Bacteria 15387
58 Ga0070713_100005405 3300005436 Bacteria 8726
59 Ga0070713_100032866 3300005436 Bacteria 4149
60 Ga0070713_100044804 3300005436 Bacteria 3622
61 Ga0070710_10000002 3300005437 Bacteria 290371
62 Ga0070710_10000267 3300005437 Bacteria 24789
63 Ga0070710_10022888 3300005437 Bacteria 3275
64 Ga0070710_10028899 3300005437 Bacteria 2969
65 Ga0070701_10010033 3300005438 Bacteria 4173
66 Ga0070701_10073309 3300005438 Bacteria 1836
67 Ga0070711_100000788 3300005439 Bacteria 16554
68 Ga0070711_100003451 3300005439 Bacteria 9212
69 Ga0070711_100011244 3300005439 Bacteria 5552
70 Ga0070711_100025477 3300005439 Bacteria 3870
71 Ga0070711_100031448 3300005439 Bacteria 3524
72 Ga0070711_100049324 3300005439 Bacteria 2883
73 Ga0070711_100050791 3300005439 Bacteria 2845
74 Ga0070711_100054959 3300005439 Bacteria 2749
75 Ga0070711_100077818 3300005439 Bacteria 2355
76 Ga0070711_100107448 3300005439 Bacteria 2042
77 Ga0070705_100009341 3300005440 Bacteria 4871
78 Ga0070700_100005283 3300005441 Bacteria 6833
79 Ga0070700_100010097 3300005441 Bacteria 5198
80 Ga0070700_100018773 3300005441 Bacteria 3980
81 Ga0070700_100052626 3300005441 Bacteria 2539
82 Ga0070694_100004651 3300005444 Bacteria 8260
83 Ga0070694_100076615 3300005444 Bacteria 2316
84 Ga0070708_100184572 3300005445 Bacteria 1950
85 Ga0070663_100002472 3300005455 Bacteria 10427
86 Ga0070663_100036784 3300005455 Bacteria 3403
87 Ga0070663_100132944 3300005455 Bacteria 1891
88 Ga0070663_100134704 3300005455 Bacteria 1880
89 Ga0070678_100040934 3300005456 Bacteria 3281
90 Ga0070678_100183952 3300005456 Bacteria 1713
91 Ga0070662_100013035 3300005457 Bacteria 5526
92 Ga0070662_100047016 3300005457 Bacteria 3102
93 Ga0070662_100049611 3300005457 Bacteria 3027
94 Ga0070662_100063899 3300005457 Bacteria 2694
95 Ga0070662_100137455 3300005457 Bacteria 1891
96 Ga0070662_100154358 3300005457 Bacteria 1791
97 Ga0070681_10014198 3300005458 Bacteria 7925
98 Ga0068867_100002154 3300005459 Bacteria 13812
99 Ga0068867_100008485 3300005459 Bacteria 7252
100 Ga0070685_10007229 3300005466 Bacteria 5676
101 Ga0070706_100025104 3300005467 Bacteria 5486
102 Ga0070707_100138905 3300005468 Bacteria 2364
103 Ga0070698_100031035 3300005471 Bacteria 5541
104 Ga0070698_100037283 3300005471 Bacteria 5013
105 Ga0070698_100259376 3300005471 Bacteria 1670
106 Ga0070699_100000043 3300005518 Bacteria 127213
107 Ga0070679_100041121 3300005530 Bacteria 4602
108 Ga0070679_100122463 3300005530 Bacteria 2585
109 Ga0070684_100006264 3300005535 Bacteria 9186
110 Ga0070684_100010636 3300005535 Bacteria 7297
111 Ga0070684_100011666 3300005535 Bacteria 7007
112 Ga0070684_100062282 3300005535 Bacteria 3267
113 Ga0070697_100021855 3300005536 Bacteria 5073
114 Ga0068853_100007231 3300005539 Bacteria 8893
115 Ga0068853_100063625 3300005539 Bacteria 3195
116 Ga0068853_100074408 3300005539 Bacteria 2963
117 Ga0068853_100093895 3300005539 Bacteria 2642
118 Ga0070672_100013162 3300005543 Bacteria 5834
119 Ga0070686_100029552 3300005544 Bacteria 3335
120 Ga0070686_100076181 3300005544 Bacteria 2208
121 Ga0070686_100111680 3300005544 Bacteria 1863
122 Ga0070695_100139300 3300005545 Bacteria 1680
123 Ga0070696_100088208 3300005546 Bacteria 2204
124 Ga0070696_100107322 3300005546 Bacteria 2008
125 Ga0070693_100009311 3300005547 Bacteria 4881
126 Ga0070665_100000106 3300005548 Bacteria 157315
127 Ga0070665_100006680 3300005548 Bacteria 11731
128 Ga0070665_100018108 3300005548 Bacteria 7067
129 Ga0070665_100131441 3300005548 Bacteria 2505
130 Ga0070665_100144277 3300005548 Bacteria 2384
131 Ga0068855_100016708 3300005563 Bacteria 8826
132 Ga0068855_100045286 3300005563 Bacteria 5203
133 Ga0070664_100013358 3300005564 Bacteria 6688
134 Ga0070664_100017902 3300005564 Bacteria 5817
135 Ga0070664_100154820 3300005564 Bacteria 2025
136 Ga0070664_100163711 3300005564 Bacteria 1969
137 Ga0068857_100017156 3300005577 Bacteria 6341
138 Ga0068857_100115106 3300005577 Bacteria 2419
139 Ga0068854_100004234 3300005578 Bacteria 9034
140 Ga0068854_100024072 3300005578 Bacteria 4165
141 Ga0068856_100003506 3300005614 Bacteria 15837
142 Ga0068856_100009718 3300005614 Bacteria 9344
143 Ga0068856_100014872 3300005614 Bacteria 7512
144 Ga0068856_100066493 3300005614 Bacteria 3562
145 Ga0068856_100109819 3300005614 Bacteria 2754
146 Ga0070702_100003799 3300005615 Bacteria 6824
147 Ga0070702_100005715 3300005615 Bacteria 5821
148 Ga0070702_100123530 3300005615 Bacteria 1624
149 Ga0068852_100008106 3300005616 Bacteria 7710
150 Ga0068852_100080517 3300005616 Bacteria 2888
151 Ga0068852_100091270 3300005616 Bacteria 2725
152 Ga0068852_100119796 3300005616 Bacteria 2407
153 Ga0068864_100000024 3300005618 Bacteria 252632
154 Ga0068864_100047627 3300005618 Bacteria 3683
155 Ga0068866_10016127 3300005718 Bacteria 3333
156 Ga0068861_100014414 3300005719 Bacteria 5549
157 Ga0068861_100055131 3300005719 Unclassified 3030
158 Ga0068861_100176098 3300005719 Bacteria 1776
159 Ga0068870_10062911 3300005840 Bacteria 2000
160 Ga0068870_10079616 3300005840 Bacteria 1808
161 Ga0068863_100016249 3300005841 Bacteria 7141
162 Ga0068863_100055706 3300005841 Bacteria 3744
163 Ga0068863_100079728 3300005841 Unclassified 3101
164 Ga0068858_100031114 3300005842 Bacteria 4955
165 Ga0068858_100081825 3300005842 Bacteria 3001
166 Ga0068860_100078060 3300005843 Bacteria 3149
167 Ga0068860_100128723 3300005843 Bacteria 2428
168 Ga0068860_100234091 3300005843 Bacteria 1785
169 Ga0068862_100000366 3300005844 Bacteria 49032
170 Ga0068862_100062940 3300005844 Bacteria 3192
171 Ga0068862_100087848 3300005844 Bacteria 2704
172 Ga0068862_100132971 3300005844 Bacteria 2202
173 Ga0068862_100200344 3300005844 Bacteria 1800
174 Ga0081455_10013896 3300005937 Bacteria 7914
175 Ga0081455_10016343 3300005937 Bacteria 7169
176 Ga0081538_10000023 3300005981 Bacteria 131101
177 Ga0081540_1000181 3300005983 Bacteria 65791
178 Ga0081540_1000757 3300005983 Bacteria 29739
179 Ga0081540_1007808 3300005983 Bacteria 7570
180 Ga0081540_1037492 3300005983 Bacteria 2568
181 Ga0081539_10001052 3300005985 Bacteria 50554
182 Ga0070717_10000006 3300006028 Bacteria 353403
183 Ga0070717_10002252 3300006028 Bacteria 13525
184 Ga0070717_10003906 3300006028 Bacteria 10722
185 Ga0070717_10008176 3300006028 Bacteria 7808
186 Ga0070717_10026014 3300006028 Bacteria 4664
187 Ga0070717_10053450 3300006028 Bacteria 3329
188 Ga0075363_100021934 3300006048 Bacteria 3224
189 Ga0075364_10017590 3300006051 Bacteria 4469
190 Ga0070715_10001599 3300006163 Bacteria 6675
191 Ga0070716_100001363 3300006173 Bacteria 10842
192 Ga0070716_100003719 3300006173 Bacteria 7223
193 Ga0070712_100000003 3300006175 Bacteria 253696
194 Ga0070712_100003227 3300006175 Bacteria 10049
195 Ga0070712_100019601 3300006175 Bacteria 4415
196 Ga0070712_100024148 3300006175 Bacteria 4024
197 Ga0070712_100027943 3300006175 Bacteria 3769
198 Ga0070712_100069626 3300006175 Bacteria 2511
199 Ga0070712_100158695 3300006175 Bacteria 1745
200 Ga0097621_100011114 3300006237 Bacteria 6622
201 Ga0097621_100140573 3300006237 Bacteria 2063
202 Ga0068871_100032952 3300006358 Bacteria 4097
203 Ga0068871_100034036 3300006358 Bacteria 4040
204 Ga0068871_100040731 3300006358 Bacteria 3722
205 Ga0068871_100041886 3300006358 Bacteria 3673
206 Ga0068871_100075188 3300006358 Unclassified 2788
207 Ga0075428_100022812 3300006844 Bacteria 6926
208 Ga0075428_100028236 3300006844 Bacteria 6205
209 Ga0075428_100079512 3300006844 Bacteria 3578
210 Ga0075428_100081909 3300006844 Bacteria 3521
211 Ga0075428_100134561 3300006844 Bacteria 2688
212 Ga0075430_100011868 3300006846 Bacteria 7415
213 Ga0075430_100041483 3300006846 Bacteria 3893
214 Ga0075430_100041844 3300006846 Bacteria 3876
215 Ga0075430_100113457 3300006846 Bacteria 2259
216 Ga0075431_100000685 3300006847 Bacteria 29059
217 Ga0075431_100065005 3300006847 Bacteria 3767
218 Ga0075431_100082299 3300006847 Bacteria 3322
219 Ga0075433_10004165 3300006852 Bacteria 11227
220 Ga0075433_10016860 3300006852 Bacteria 6036
221 Ga0075433_10031502 3300006852 Bacteria 4534
222 Ga0075433_10042932 3300006852 Bacteria 3924
223 Ga0075433_10063711 3300006852 Bacteria 3230
224 Ga0075434_100004695 3300006871 Bacteria 12345
225 Ga0075434_100030794 3300006871 Bacteria 5286
226 Ga0075434_100077166 3300006871 Bacteria 3326
227 Ga0075434_100144366 3300006871 Bacteria 2400
228 Ga0075434_100225994 3300006871 Unclassified 1891
229 Ga0075434_100228529 3300006871 Bacteria 1880
230 Ga0075429_100116021 3300006880 Bacteria 2341
231 Ga0068865_100003061 3300006881 Bacteria 10003
232 Ga0068865_100005688 3300006881 Bacteria 7573
233 Ga0068865_100094754 3300006881 Bacteria 2173
234 Ga0075436_100006626 3300006914 Bacteria 7936
235 Ga0075436_100009259 3300006914 Bacteria 6738
236 Ga0099824_1000332 3300006942 Bacteria 51674
237 Ga0075435_100010048 3300007076 Bacteria 6901
238 Ga0075435_100010366 3300007076 Bacteria 6814
239 Ga0075435_100014025 3300007076 Bacteria 5976
240 Ga0075435_100082894 3300007076 Bacteria 2636
241 Ga0075435_100122502 3300007076 Bacteria 2171
242 Ga0105240_10032970 3300009093 Bacteria 6698
243 Ga0105240_10094357 3300009093 Bacteria 3650
244 Ga0105240_10192408 3300009093 Bacteria 2398
245 Ga0111539_10002534 3300009094 Bacteria 24191
246 Ga0111539_10002876 3300009094 Bacteria 22852
247 Ga0111539_10030024 3300009094 Bacteria 6613
248 Ga0111539_10108769 3300009094 Bacteria 3253
249 Ga0111539_10164550 3300009094 Bacteria 2594
250 Ga0111539_10343497 3300009094 Unclassified 1737
251 Ga0105245_10010376 3300009098 Bacteria 8114
252 Ga0105245_10013722 3300009098 Bacteria 7057
253 Ga0105245_10047423 3300009098 Bacteria 3841
254 Ga0105245_10069086 3300009098 Bacteria 3203
255 Ga0105245_10073817 3300009098 Bacteria 3103
256 Ga0105245_10108511 3300009098 Bacteria 2578
257 Ga0105245_10236092 3300009098 Bacteria 1770
258 Ga0105247_10000369 3300009101 Bacteria 38254
259 Ga0114129_10036368 3300009147 Bacteria 6954
260 Ga0114129_10079769 3300009147 Bacteria 4551
261 Ga0105243_10003685 3300009148 Bacteria 12321
262 Ga0105243_10005915 3300009148 Bacteria 9476
263 Ga0105243_10017401 3300009148 Bacteria 5434
264 Ga0105243_10041665 3300009148 Bacteria 3590
265 Ga0105243_10048351 3300009148 Bacteria 3353
266 Ga0105243_10071064 3300009148 Bacteria 2813
267 Ga0105243_10085160 3300009148 Bacteria 2590
268 Ga0105241_10068171 3300009174 Bacteria 2756
269 Ga0105242_10001159 3300009176 Bacteria 20774
270 Ga0105242_10008877 3300009176 Bacteria 7714
271 Ga0105242_10016636 3300009176 Bacteria 5721
272 Ga0105242_10018440 3300009176 Bacteria 5456
273 Ga0105242_10060082 3300009176 Bacteria 3121
274 Ga0105242_10091633 3300009176 Bacteria 2559
275 Ga0105242_10176318 3300009176 Bacteria 1882
276 Ga0105242_10194217 3300009176 Bacteria 1799
277 Ga0105242_10238791 3300009176 Bacteria 1633
278 Ga0105248_10009406 3300009177 Bacteria 10759
279 Ga0105248_10066247 3300009177 Bacteria 4056
280 Ga0105248_10127493 3300009177 Bacteria 2871
281 Ga0105248_10296632 3300009177 Bacteria 1820
282 Ga0105237_10028453 3300009545 Bacteria 5693
283 Ga0105237_10226999 3300009545 Bacteria 1868
284 Ga0105238_10019629 3300009551 Bacteria 6883
285 Ga0105238_10152433 3300009551 Bacteria 2286
286 Ga0105238_10262486 3300009551 Unclassified 1707
287 Ga0105249_10000916 3300009553 Bacteria 26081
288 Ga0105249_10002508 3300009553 Bacteria 15869
289 Ga0105249_10009694 3300009553 Bacteria 8440
290 Ga0105249_10107528 3300009553 Bacteria 2632
291 Ga0105249_10150221 3300009553 Bacteria 2242
292 Ga0105239_10009449 3300010375 Bacteria 10987
293 Ga0105239_10033703 3300010375 Bacteria 5623
294 Ga0105239_10103632 3300010375 Bacteria 3149
295 Ga0105239_10112707 3300010375 Bacteria 3016
296 Ga0105246_10018236 3300011119 Bacteria 4472
297 Ga0105246_10033619 3300011119 Bacteria 3410
298 Ga0157373_10000003 3300013100 Bacteria 454601
299 Ga0157373_10075674 3300013100 Bacteria 2375
300 Ga0157371_10049289 3300013102 Bacteria 2992
301 Ga0157370_10033202 3300013104 Bacteria 5031
302 Ga0157370_10151057 3300013104 Bacteria 2161
303 Ga0157369_10009457 3300013105 Bacteria 11144
304 Ga0157369_10033435 3300013105 Bacteria 5651
305 Ga0157369_10069460 3300013105 Bacteria 3784
306 Ga0157374_10322458 3300013296 Bacteria 1531
307 Ga0157378_10217413 3300013297 Bacteria 1815
308 Ga0157378_10271297 3300013297 Bacteria 1632
309 Ga0163162_10014212 3300013306 Bacteria 7777
310 Ga0163162_10014551 3300013306 Bacteria 7689
311 Ga0163162_10025640 3300013306 Bacteria 5828
312 Ga0163162_10026336 3300013306 Bacteria 5748
313 Ga0163162_10030239 3300013306 Bacteria 5366
314 Ga0163162_10205614 3300013306 Bacteria 2098
315 Ga0163162_10236293 3300013306 Bacteria 1958
316 Ga0163162_10339249 3300013306 Bacteria 1635
317 Ga0157372_10008824 3300013307 Bacteria 10708
318 Ga0157372_10309031 3300013307 Bacteria 1840
319 Ga0157375_10003892 3300013308 Bacteria 12951
320 Ga0157375_10004006 3300013308 Bacteria 12778
321 Ga0157375_10016208 3300013308 Bacteria 6684
322 Ga0157375_10086370 3300013308 Bacteria 3188
323 Ga0157375_10103526 3300013308 Bacteria 2934
324 Ga0157375_10247796 3300013308 Bacteria 1942
325 Ga0157375_10427895 3300013308 Bacteria 1490
326 Ga0163163_10007110 3300014325 Bacteria 9840
327 Ga0163163_10043622 3300014325 Bacteria 4397
328 Ga0157380_10018093 3300014326 Bacteria 5227
329 Ga0157380_10032636 3300014326 Unclassified 4007
330 Ga0157380_10039774 3300014326 Bacteria 3659
331 Ga0157380_10080362 3300014326 Bacteria 2664
332 Ga0157380_10136826 3300014326 Bacteria 2098
333 Ga0157380_10177339 3300014326 Bacteria 1869
334 Ga0157377_10001163 3300014745 Bacteria 11149
335 Ga0157377_10005504 3300014745 Bacteria 5959
336 Ga0157377_10126072 3300014745 Bacteria 1558
337 Ga0157379_10018892 3300014968 Bacteria 6081
338 Ga0157379_10140789 3300014968 Bacteria 2175
339 Ga0157376_10004119 3300014969 Bacteria 10073
340 Ga0182006_1041690 3300015261 Bacteria 1801
341 Ga0163161_10017674 3300017792 Bacteria 4996
342 Ga0163161_10047150 3300017792 Unclassified 3112
343 Ga0163161_10055314 3300017792 Bacteria 2881
344 Ga0163161_10078165 3300017792 Bacteria 2432
345 Ga0197907_10292294 3300020069 Bacteria 1676
346 Ga0206355_1195442 3300020076 Bacteria 2100
347 Ga0206351_10206386 3300020077 Bacteria 1904
348 Ga0206351_10855698 3300020077 Bacteria 2173
349 Ga0206352_10111744 3300020078 Bacteria 1992
350 Ga0206352_11357117 3300020078 Bacteria 2025
351 Ga0206353_11863956 3300020082 Bacteria 1900
352 Ga0154015_1332211 3300020610 Bacteria 2384
353 Ga0213872_10023559 3300021361 Bacteria 2833
354 Ga0224712_10004327 3300022467 Bacteria 3817
355 Ga0209025_1000053 3300025294 Bacteria 317600
356 Ga0209758_1001127 3300025297 Bacteria 34298
357 Ga0207692_10000005 3300025898 Bacteria 370169
358 Ga0207692_10004714 3300025898 Bacteria 5411
359 Ga0207692_10006213 3300025898 Bacteria 4837
360 Ga0207642_10021960 3300025899 Bacteria 2522
361 Ga0207710_10000227 3300025900 Bacteria 48932
362 Ga0207688_10006721 3300025901 Bacteria 6255
363 Ga0207688_10069458 3300025901 Bacteria 1996
364 Ga0207647_10008001 3300025904 Bacteria 7603
365 Ga0207647_10051955 3300025904 Bacteria 2531
366 Ga0207647_10055729 3300025904 Bacteria 2428
367 Ga0207685_10010684 3300025905 Bacteria 2724
368 Ga0207685_10031309 3300025905 Unclassified 1903
369 Ga0207699_10003875 3300025906 Bacteria 7148
370 Ga0207645_10039419 3300025907 Bacteria 3027
371 Ga0207705_10013443 3300025909 Bacteria 5905
372 Ga0207684_10208636 3300025910 Bacteria 1685
373 Ga0207654_10091040 3300025911 Bacteria 1859
374 Ga0207707_10017087 3300025912 Bacteria 6322
375 Ga0207707_10017437 3300025912 Bacteria 6260
376 Ga0207695_10003637 3300025913 Bacteria 21542
377 Ga0207693_10000009 3300025915 Bacteria 168990
378 Ga0207693_10001273 3300025915 Bacteria 22484
379 Ga0207693_10002186 3300025915 Bacteria 17054
380 Ga0207693_10002493 3300025915 Bacteria 16014
381 Ga0207693_10003950 3300025915 Bacteria 12603
382 Ga0207693_10015101 3300025915 Bacteria 6199
383 Ga0207693_10083758 3300025915 Bacteria 2498
384 Ga0207693_10131025 3300025915 Bacteria 1971
385 Ga0207663_10005201 3300025916 Bacteria 6548
386 Ga0207663_10005313 3300025916 Bacteria 6484
387 Ga0207663_10016114 3300025916 Bacteria 4136
388 Ga0207663_10023197 3300025916 Bacteria 3557
389 Ga0207663_10066960 3300025916 Bacteria 2301
390 Ga0207663_10080764 3300025916 Bacteria 2127
391 Ga0207663_10128601 3300025916 Bacteria 1746
392 Ga0207660_10085054 3300025917 Bacteria 2332
393 Ga0207662_10056488 3300025918 Bacteria 2344
394 Ga0207657_10005677 3300025919 Bacteria 13017
395 Ga0207657_10012567 3300025919 Bacteria 8346
396 Ga0207657_10093682 3300025919 Bacteria 2502
397 Ga0207649_10116054 3300025920 Bacteria 1797
398 Ga0207652_10051270 3300025921 Bacteria 3538
399 Ga0207646_10082643 3300025922 Bacteria 2872
400 Ga0207646_10104150 3300025922 Bacteria 2545
401 Ga0207681_10045347 3300025923 Bacteria 2951
402 Ga0207681_10086256 3300025923 Bacteria 2230
403 Ga0207694_10076077 3300025924 Unclassified 2628
404 Ga0207659_10003884 3300025926 Bacteria 9009
405 Ga0207659_10040587 3300025926 Bacteria 3255
406 Ga0207687_10027279 3300025927 Bacteria 3831
407 Ga0207687_10037166 3300025927 Bacteria 3320
408 Ga0207687_10053621 3300025927 Bacteria 2818
409 Ga0207687_10176006 3300025927 Bacteria 1654
410 Ga0207700_10005015 3300025928 Bacteria 7875
411 Ga0207700_10012605 3300025928 Bacteria 5461
412 Ga0207700_10112071 3300025928 Bacteria 2197
413 Ga0207664_10003838 3300025929 Bacteria 10096
414 Ga0207664_10005028 3300025929 Bacteria 8996
415 Ga0207664_10007360 3300025929 Bacteria 7630
416 Ga0207664_10008030 3300025929 Bacteria 7338
417 Ga0207664_10012014 3300025929 Bacteria 6182
418 Ga0207664_10022821 3300025929 Bacteria 4680
419 Ga0207664_10051885 3300025929 Bacteria 3241
420 Ga0207664_10053517 3300025929 Bacteria 3196
421 Ga0207664_10070425 3300025929 Bacteria 2814
422 Ga0207664_10097511 3300025929 Bacteria 2422
423 Ga0207690_10029423 3300025932 Bacteria 3493
424 Ga0207690_10039765 3300025932 Bacteria 3070
425 Ga0207690_10071111 3300025932 Bacteria 2399
426 Ga0207706_10002554 3300025933 Bacteria 17744
427 Ga0207706_10003441 3300025933 Bacteria 15118
428 Ga0207706_10005339 3300025933 Bacteria 11976
429 Ga0207706_10015246 3300025933 Bacteria 6951
430 Ga0207706_10018736 3300025933 Bacteria 6226
431 Ga0207706_10040269 3300025933 Bacteria 4141
432 Ga0207706_10099242 3300025933 Bacteria 2562
433 Ga0207686_10000035 3300025934 Bacteria 130483
434 Ga0207686_10001551 3300025934 Bacteria 12972
435 Ga0207686_10053260 3300025934 Bacteria 2529
436 Ga0207709_10001318 3300025935 Bacteria 17566
437 Ga0207709_10035002 3300025935 Bacteria 2965
438 Ga0207709_10068835 3300025935 Bacteria 2239
439 Ga0207709_10117364 3300025935 Bacteria 1790
440 Ga0207670_10021496 3300025936 Bacteria 3982
441 Ga0207669_10020443 3300025937 Bacteria 3473
442 Ga0207704_10006123 3300025938 Bacteria 5579
443 Ga0207704_10016620 3300025938 Bacteria 3787
444 Ga0207704_10102160 3300025938 Bacteria 1914
445 Ga0207665_10001498 3300025939 Bacteria 15698
446 Ga0207665_10004626 3300025939 Bacteria 9137
447 Ga0207665_10039692 3300025939 Bacteria 3139
448 Ga0207665_10043840 3300025939 Bacteria 2992
449 Ga0207691_10003769 3300025940 Bacteria 14721
450 Ga0207691_10178554 3300025940 Bacteria 1856
451 Ga0207711_10018257 3300025941 Bacteria 5830
452 Ga0207711_10162875 3300025941 Bacteria 2020
453 Ga0207689_10028298 3300025942 Bacteria 4690
454 Ga0207689_10036645 3300025942 Bacteria 4072
455 Ga0207689_10071506 3300025942 Bacteria 2849
456 Ga0207689_10150840 3300025942 Bacteria 1916
457 Ga0207661_10000896 3300025944 Bacteria 19528
458 Ga0207661_10005047 3300025944 Bacteria 9262
459 Ga0207661_10017682 3300025944 Bacteria 5283
460 Ga0207661_10023477 3300025944 Bacteria 4660
461 Ga0207661_10060629 3300025944 Bacteria 3053
462 Ga0207661_10181926 3300025944 Bacteria 1837
463 Ga0207679_10033544 3300025945 Bacteria 3613
464 Ga0207712_10018506 3300025961 Bacteria 4539
465 Ga0207712_10064710 3300025961 Bacteria 2608
466 Ga0207712_10111032 3300025961 Bacteria 2057
467 Ga0207712_10120762 3300025961 Bacteria 1982
468 Ga0207668_10007005 3300025972 Bacteria 6686
469 Ga0207668_10137382 3300025972 Bacteria 1875
470 Ga0207668_10142092 3300025972 Bacteria 1847
471 Ga0207640_10109174 3300025981 Unclassified 1957
472 Ga0207658_10000465 3300025986 Bacteria 37863
473 Ga0207677_10044985 3300026023 Bacteria 2945
474 Ga0207677_10087065 3300026023 Unclassified 2260
475 Ga0207677_10140050 3300026023 Bacteria 1851
476 Ga0207703_10121530 3300026035 Bacteria 2242
477 Ga0207703_10246477 3300026035 Bacteria 1608
478 Ga0207639_10005344 3300026041 Bacteria 8678
479 Ga0207639_10075794 3300026041 Bacteria 2646
480 Ga0207678_10003330 3300026067 Bacteria 14492
481 Ga0207678_10013416 3300026067 Bacteria 7192
482 Ga0207678_10016969 3300026067 Bacteria 6394
483 Ga0207678_10098105 3300026067 Bacteria 2503
484 Ga0207678_10145917 3300026067 Bacteria 2020
485 Ga0207708_10002772 3300026075 Bacteria 12872
486 Ga0207708_10013121 3300026075 Bacteria 6183
487 Ga0207708_10017990 3300026075 Bacteria 5317
488 Ga0207708_10020425 3300026075 Bacteria 4996
489 Ga0207708_10058018 3300026075 Bacteria 2954
490 Ga0207702_10028773 3300026078 Bacteria 4621
491 Ga0207702_10044134 3300026078 Bacteria 3746
492 Ga0207702_10050195 3300026078 Bacteria 3522
493 Ga0207702_10063186 3300026078 Bacteria 3165
494 Ga0207702_10085384 3300026078 Bacteria 2750
495 Ga0207641_10011889 3300026088 Bacteria 7140
496 Ga0207641_10042529 3300026088 Bacteria 3812
497 Ga0207641_10084193 3300026088 Unclassified 2768
498 Ga0207648_10003623 3300026089 Bacteria 16151
499 Ga0207648_10003682 3300026089 Bacteria 16035
500 Ga0207648_10005519 3300026089 Bacteria 12747
501 Ga0207648_10074878 3300026089 Bacteria 2951
502 Ga0207676_10000048 3300026095 Bacteria 147853
503 Ga0207676_10056628 3300026095 Bacteria 3083
504 Ga0207674_10001090 3300026116 Bacteria 35329
505 Ga0207674_10025958 3300026116 Bacteria 6235
506 Ga0207675_100036180 3300026118 Bacteria 4605
507 Ga0207675_100088285 3300026118 Bacteria 2912
508 Ga0207675_100213549 3300026118 Bacteria 1857
509 Ga0207675_100234454 3300026118 Bacteria 1772
510 Ga0207683_10000941 3300026121 Bacteria 26696
511 Ga0207683_10020763 3300026121 Bacteria 5620
512 Ga0207683_10102639 3300026121 Bacteria 2554
513 Ga0207683_10125432 3300026121 Bacteria 2307
514 Ga0207698_10008521 3300026142 Bacteria 6494
515 Ga0207698_10059113 3300026142 Bacteria 2975
516 Ga0207698_10099693 3300026142 Bacteria 2404
517 Ga0207698_10122177 3300026142 Bacteria 2206
518 Ga0207428_10001212 3300027907 Bacteria 27686
519 Ga0207428_10014005 3300027907 Bacteria 6985
520 Ga0207428_10080458 3300027907 Unclassified 2545
521 Ga0268266_10161541 3300028379 Bacteria 2027
522 Ga0268266_10167727 3300028379 Bacteria 1991
523 Ga0268265_10001048 3300028380 Bacteria 24851
524 Ga0268264_10110101 3300028381 Bacteria 2411
525 Ga0268264_10175727 3300028381 Bacteria 1941
526 Ga0268264_10212271 3300028381 Bacteria 1777
527 Ga0268264_10220509 3300028381 Bacteria 1746
528 Ga0265337_1000060 3300028556 Bacteria 49697
529 Ga0265326_10000056 3300028558 Bacteria 64840
530 Ga0265319_1000037 3300028563 Bacteria 115642
531 Ga0265322_10000017 3300028654 Bacteria 114833
532 Ga0265338_10000051 3300028800 Bacteria 211202
533 Ga0265338_10175064 3300028800 Bacteria 1641
534 Ga0265324_10000196 3300029957 Bacteria 46096
535 Ga0307511_10020634 3300030521 Bacteria 6233
536 Ga0265332_10022481 3300031238 Bacteria 2783
537 Ga0265328_10000258 3300031239 Bacteria 24453
538 Ga0265320_10000068 3300031240 Bacteria 91884
539 Ga0265329_10001686 3300031242 Bacteria 10577
540 Ga0265331_10000606 3300031250 Bacteria 31608
541 Ga0265331_10004016 3300031250 Bacteria 9283
542 Ga0265327_10000018 3300031251 Bacteria 439197
543 Ga0265327_10000317 3300031251 Bacteria 92215
544 Ga0265327_10063849 3300031251 Bacteria 1868
545 Ga0265316_10034806 3300031344 Bacteria 4089
546 Ga0307513_10006242 3300031456 Bacteria 15613
547 Ga0307513_10201135 3300031456 Bacteria 1833
548 Ga0307408_100020500 3300031548 Bacteria 4465
549 Ga0265313_10006987 3300031595 Bacteria 7829
550 Ga0307508_10150367 3300031616 Bacteria 1932
551 Ga0316575_10001075 3300031665 Bacteria 8519
552 Ga0316575_10002167 3300031665 Bacteria 6550
553 Ga0316579_10005583 3300031691 Bacteria 5088
554 Ga0265314_10000973 3300031711 Bacteria 33669
555 Ga0265314_10064755 3300031711 Bacteria 2473
556 Ga0265342_10094047 3300031712 Bacteria 1715
557 Ga0316576_10001067 3300031727 Bacteria 14245
558 Ga0316576_10012627 3300031727 Bacteria 5587
559 Ga0316576_10028532 3300031727 Bacteria 3934
560 Ga0316576_10108327 3300031727 Bacteria 2081
561 Ga0316578_10014810 3300031728 Bacteria 4178
562 Ga0316577_10011476 3300031733 Bacteria 4800
563 Ga0316577_10033831 3300031733 Bacteria 2856
564 Ga0307413_10000272 3300031824 Bacteria 15774
565 Ga0307410_10002547 3300031852 Bacteria 8826
566 Ga0307406_10014287 3300031901 Bacteria 4565
567 Ga0307407_10001800 3300031903 Bacteria 8022
568 Ga0307412_10017513 3300031911 Bacteria 4289
569 Ga0307409_100011608 3300031995 Bacteria 5565
570 Ga0307416_100139478 3300032002 Bacteria 2201
571 Ga0307414_10003567 3300032004 Bacteria 8329
572 Ga0307411_10000003 3300032005 Bacteria 477556
573 Ga0307411_10047461 3300032005 Bacteria 2776
574 Ga0307415_100009645 3300032126 Bacteria 5427
575 Ga0316585_10003725 3300032137 Bacteria 4205
576 Ga0316585_10005770 3300032137 Bacteria 3505
577 Ga0316580_10001868 3300032139 Bacteria 5650
578 Ga0373926_0000085 3300035083 Bacteria 17960
579 Ga0373934_0004651 3300035086 Bacteria 5075
580 Ga0373940_0038524 3300035088 Bacteria 1305
581 Ga0373944_0000201 3300035089 Bacteria 12777
582 Ga0373951_0012974 3300035091 Bacteria 1874
583 Ga0373923_0000654 3300035111 Bacteria 8765
584 Ga0373932_0022750 3300035112 Bacteria 1668
585 Ga0373936_0001199 3300035113 Bacteria 9336
586 Ga0373936_0019069 3300035113 Bacteria 2656
587 Ga0373941_0011532 3300035115 Bacteria 2286
588 Ga0373945_0000115 3300035116 Bacteria 19575
589 Ga0373945_0000374 3300035116 Bacteria 12870
590 Ga0373953_0000290 3300035117 Bacteria 13750
591 Ga0373953_0001319 3300035117 Bacteria 7116
592 Ga0373954_0000277 3300035118 Bacteria 18681
593 Ga0373954_0006958 3300035118 Bacteria 4938
594 Ga0373956_0000733 3300035119 Bacteria 13479
595 Ga0373956_0012653 3300035119 Bacteria 3501
596 Ga0373957_0000032 3300035120 Bacteria 36214
597 Ga0373957_0009644 3300035120 Bacteria 3164
598 Ga0373943_0000129 3300035170 Bacteria 28679
599 Ga0373943_0003042 3300035170 Bacteria 7618
600 Ga0373943_0023348 3300035170 Bacteria 2875
601 Ga0373943_0076020 3300035170 Bacteria 1712
602 Ga0373946_0000428 3300035171 Bacteria 13745
603 Ga0373946_0000709 3300035171 Bacteria 11299
604 Ga0373955_0000092 3300035172 Bacteria 36115
605 Ga0373955_0026927 3300035172 Bacteria 2967
606 Ga0373955_0030615 3300035172 Bacteria 2811
607 Ga0316574_0000052 3300035398 Bacteria 29685
608 Ga0316574_0036378 3300035398 Bacteria 3013
609 Ga0316574_0074281 3300035398 Bacteria 2151
610 Ga0373924_0000555 3300035410 Bacteria 11493
611 Ga0373924_0009457 3300035410 Bacteria 3571
612 Ga0373931_0018769 3300035691 Bacteria 3443
613 Ga0373935_0000628 3300035692 Bacteria 18518
614 Ga0373935_0003273 3300035692 Bacteria 9366
615 Ga0373935_0168636 3300035692 Bacteria 1496
616 Ga0373927_0002848 3300035695 Bacteria 12621
617 Ga0373927_0004146 3300035695 Bacteria 10196
618 Ga0373927_0074168 3300035695 Bacteria 2203
619 Ga0373933_0000121 3300035724 Bacteria 50773
620 Ga0373947_0000901 3300035725 Bacteria 17992
621 Ga0373947_0003331 3300035725 Bacteria 9516
622 Ga0373947_0038902 3300035725 Bacteria 2829
623 Ga0373947_0057317 3300035725 Bacteria 2357
624 Ga0373947_0058616 3300035725 Bacteria 2333
625 Ga0373947_0120244 3300035725 Bacteria 1668
626 Ga0373947_0142491 3300035725 Bacteria 1538
627 Ga0373937_0000169 3300036401 Bacteria 63595
628 Ga0373937_0018127 3300036401 Bacteria 6280
629 Ga0373937_0018778 3300036401 Bacteria 6179
630 Ga0373937_0021306 3300036401 Bacteria 5817
631 Ga0373937_0048404 3300036401 Bacteria 3892
632 Ga0373937_0057773 3300036401 Bacteria 3564
633 Ga0373937_0116738 3300036401 Bacteria 2485
634 Ga0316582_0000166 3300036647 Bacteria 20311
635 Ga0316584_0005054 3300036712 Bacteria 8789
636 Ga0316584_0007826 3300036712 Bacteria 7331
637 Ga0316584_0026524 3300036712 Bacteria 4259
638 Ga0316584_0029469 3300036712 Bacteria 4051
639 Ga0316584_0051911 3300036712 Bacteria 3067
640 Ga0316584_0091485 3300036712 Bacteria 2278
641 Ga0316584_0139184 3300036712 Bacteria 1811
642 Ga0373925_0002434 3300037068 Bacteria 14935
643 Ga0373925_0003472 3300037068 Bacteria 12194
644 Ga0373925_0034931 3300037068 Bacteria 3707
645 Ga0373925_0037510 3300037068 Bacteria 3578
646 Ga0373925_0140157 3300037068 Bacteria 1892
647 Ga0395900_0111834 3300037418 Bacteria 2805
648 Ga0395900_0233340 3300037418 Bacteria 1849
649 Ga0395898_0028626 3300037466 Bacteria 5583
650 Ga0395898_0190730 3300037466 Bacteria 1958
651 Ga0316581_0001663 3300037588 Bacteria 5103
652 Ga0395901_0018262 3300038443 Bacteria 7161
653 Ga0395901_0161922 3300038443 Bacteria 2350
654 Ga0395901_0193477 3300038443 Bacteria 2133
655 Ga0242420_000347 3300038996 Bacteria 5142
656 Ga0436360_0633769 3300039438 Bacteria 11634
657 Ga0436361_0002000 3300039447 Bacteria 1855
658 Ga0436361_0035073 3300039447 Bacteria 7878
659 Ga0436361_0336407 3300039447 Bacteria 16691
660 Ga0436361_0510461 3300039447 Bacteria 4197
661 Ga0436361_0735490 3300039447 Bacteria 23457
662 Ga0436363_0472667 3300039450 Bacteria 1777
663 Ga0436362_0003157 3300039453 Bacteria 13284
664 Ga0439447_000024 3300041407 Bacteria 53601
665 Ga0451853_1257484 3300041512 Bacteria 3450
666 Ga0466963_0000281 3300044694 Bacteria 22762
667 Ga0466963_0004575 3300044694 Bacteria 8052
668 Ga0466958_0007766 3300045836 Bacteria 5919
669 Ga0466967_0003703 3300045976 Bacteria 10067
670 Ga0466967_0015423 3300045976 Bacteria 5989
671 Ga0466967_0052298 3300045976 Bacteria 3584
672 Ga0466967_0077622 3300045976 Bacteria 2990
673 Ga0495592_0000070 3300046454 Bacteria 93255
674 Ga0495592_0000220 3300046454 Bacteria 49173
675 Ga0495592_0003048 3300046454 Bacteria 11941
676 Ga0495603_0023570 3300046455 Bacteria 3722
677 Ga0495603_0033679 3300046455 Bacteria 3082
678 Ga0495629_0009244 3300046459 Bacteria 7212
679 Ga0495629_0041398 3300046459 Bacteria 3242
680 Ga0495629_0088760 3300046459 Bacteria 2157
681 Ga0495629_0177689 3300046459 Bacteria 1476
682 Ga0495641_0000044 3300046461 Bacteria 77415
683 Ga0495641_0000742 3300046461 Bacteria 27572
684 Ga0495641_0004675 3300046461 Bacteria 9554
685 Ga0495641_0018240 3300046461 Bacteria 3626
686 Ga0495641_0038696 3300046461 Bacteria 2227
687 Ga0495651_0000034 3300046462 Bacteria 99213
688 Ga0495651_0000042 3300046462 Bacteria 93255
689 Ga0495651_0002437 3300046462 Bacteria 14361
690 Ga0495651_0009283 3300046462 Bacteria 7548
691 Ga0495651_0012581 3300046462 Bacteria 6530
692 Ga0495651_0066441 3300046462 Bacteria 2752
693 Ga0495651_0126539 3300046462 Bacteria 1871
694 Ga0495653_0000416 3300046463 Bacteria 34136
695 Ga0495653_0000669 3300046463 Bacteria 26191
696 Ga0495653_0013842 3300046463 Bacteria 6574
697 Ga0495653_0039619 3300046463 Bacteria 3690
698 Ga0495653_0089525 3300046463 Bacteria 2254
699 Ga0495582_0007328 3300046473 Bacteria 6112
700 Ga0495582_0019734 3300046473 Bacteria 3686
701 Ga0495582_0025352 3300046473 Bacteria 3248
702 Ga0495662_0001224 3300046476 Bacteria 12633
703 Ga0495662_0035185 3300046476 Bacteria 2417
704 Ga0495664_0001885 3300046477 Bacteria 11153
705 Ga0495664_0006030 3300046477 Bacteria 6681
706 Ga0495664_0018691 3300046477 Bacteria 3976
707 Ga0495664_0095018 3300046477 Bacteria 1794
708 Ga0495584_0050343 3300046491 Bacteria 2098
709 Ga0495594_0000001 3300046499 Bacteria 293051
710 Ga0495594_0037340 3300046499 Bacteria 2650
711 Ga0495608_0000054 3300046511 Bacteria 93255
712 Ga0495608_0000584 3300046511 Bacteria 25040
713 Ga0495608_0005192 3300046511 Bacteria 9304
714 Ga0495608_0018319 3300046511 Bacteria 4832
715 Ga0495608_0027634 3300046511 Bacteria 3859
716 Ga0495608_0050745 3300046511 Bacteria 2752
717 Ga0495608_0093071 3300046511 Bacteria 1947
718 Ga0495618_0002174 3300046514 Bacteria 12819
719 Ga0495620_0000144 3300046515 Bacteria 58204
720 Ga0495628_0000040 3300046516 Bacteria 104506
721 Ga0495628_0000106 3300046516 Bacteria 67965
722 Ga0495628_0000548 3300046516 Bacteria 34470
723 Ga0495628_0008134 3300046516 Bacteria 9024
724 Ga0495628_0026747 3300046516 Bacteria 4699
725 Ga0495628_0076419 3300046516 Bacteria 2606
726 Ga0495628_0077467 3300046516 Bacteria 2586
727 Ga0495628_0089313 3300046516 Bacteria 2387
728 Ga0495628_0095682 3300046516 Bacteria 2294
729 Ga0495628_0143245 3300046516 Bacteria 1823
730 Ga0495630_0007970 3300046517 Bacteria 7602
731 Ga0495630_0027711 3300046517 Bacteria 4207
732 Ga0495630_0218180 3300046517 Bacteria 1456
733 Ga0495666_0001713 3300046526 Bacteria 10830
734 Ga0495652_0000119 3300046529 Bacteria 85582
735 Ga0495652_0002645 3300046529 Bacteria 18255
736 Ga0495652_0006599 3300046529 Bacteria 10780
737 Ga0495652_0012958 3300046529 Bacteria 7515
738 Ga0495652_0024428 3300046529 Bacteria 5349
739 Ga0495652_0036500 3300046529 Bacteria 4273
740 Ga0495652_0057114 3300046529 Bacteria 3311
741 Ga0495652_0079778 3300046529 Bacteria 2705
742 Ga0495665_0001874 3300046531 Bacteria 11363
743 Ga0495665_0025665 3300046531 Bacteria 3165
744 Ga0495640_0002238 3300046533 Bacteria 15493
745 Ga0495640_0012252 3300046533 Bacteria 6561
746 Ga0495640_0069624 3300046533 Bacteria 2366
747 Ga0495586_0011461 3300046535 Bacteria 4713
748 Ga0495586_0028610 3300046535 Bacteria 2982
749 Ga0495587_0000055 3300046536 Bacteria 97024
750 Ga0495587_0000119 3300046536 Bacteria 60244
751 Ga0495587_0000208 3300046536 Bacteria 43565
752 Ga0495587_0021986 3300046536 Bacteria 3931
753 Ga0495587_0076226 3300046536 Bacteria 1947
754 Ga0495645_0000073 3300046543 Bacteria 70164
755 Ga0495645_0004517 3300046543 Bacteria 9499
756 Ga0495645_0009728 3300046543 Bacteria 6724
757 Ga0495645_0014243 3300046543 Bacteria 5639
758 Ga0495645_0025818 3300046543 Bacteria 4265
759 Ga0495645_0027180 3300046543 Bacteria 4155
760 Ga0495645_0050054 3300046543 Bacteria 3042
761 Ga0495645_0087386 3300046543 Bacteria 2230
762 Ga0495645_0150754 3300046543 Bacteria 1615
763 Ga0495622_0000033 3300046557 Bacteria 124162
764 Ga0495667_0000019 3300046559 Bacteria 181645
765 Ga0495667_0000253 3300046559 Bacteria 34719
766 Ga0495667_0000786 3300046559 Bacteria 20379
767 Ga0495667_0004224 3300046559 Bacteria 9683
768 Ga0495667_0004526 3300046559 Bacteria 9380
769 Ga0495667_0024978 3300046559 Bacteria 4026
770 Ga0495634_0000018 3300046642 Bacteria 121323
771 Ga0495634_0001902 3300046642 Bacteria 17893
772 Ga0495634_0003663 3300046642 Bacteria 12250
773 Ga0495625_0000109 3300046660 Bacteria 125064
774 Ga0495635_0006237 3300046663 Bacteria 8305
775 Ga0495635_0007795 3300046663 Bacteria 7476
776 Ga0495635_0104834 3300046663 Bacteria 1932
777 Ga0495657_0000067 3300046675 Bacteria 93255
778 Ga0495657_0027438 3300046675 Bacteria 4018
779 Ga0495657_0032893 3300046675 Bacteria 3615
780 Ga0495657_0109621 3300046675 Bacteria 1750
781 Ga0495599_0000042 3300046678 Bacteria 94912
782 Ga0495599_0000173 3300046678 Bacteria 42460
783 Ga0495599_0003417 3300046678 Bacteria 9292
784 Ga0495599_0023499 3300046678 Bacteria 3855
785 Ga0495599_0031788 3300046678 Bacteria 3313
786 Ga0495599_0054268 3300046678 Bacteria 2511
787 Ga0495623_0000101 3300046679 Bacteria 52470
788 Ga0495623_0035821 3300046679 Bacteria 3181
789 Ga0495623_0047400 3300046679 Bacteria 2727
790 Ga0495623_0054890 3300046679 Bacteria 2513
791 Ga0495623_0074173 3300046679 Bacteria 2114
792 Ga0495623_0097522 3300046679 Bacteria 1795
793 Ga0495646_0005486 3300046680 Bacteria 8017
794 Ga0495646_0009050 3300046680 Bacteria 6313
795 Ga0495646_0010006 3300046680 Bacteria 6029
796 Ga0495646_0014587 3300046680 Bacteria 4993
797 Ga0495646_0026385 3300046680 Bacteria 3649
798 Ga0495646_0028953 3300046680 Bacteria 3466
799 Ga0495647_0013226 3300046681 Bacteria 2857
800 Ga0495647_0044345 3300046681 Bacteria 1705
801 Ga0495658_0001583 3300046683 Bacteria 11873
802 Ga0495658_0002011 3300046683 Bacteria 10362
803 Ga0495613_0007629 3300046689 Bacteria 8046
804 Ga0495613_0107403 3300046689 Bacteria 2013
805 Ga0495613_0201242 3300046689 Bacteria 1404
806 Ga0495624_0002113 3300046690 Bacteria 15159
807 Ga0495624_0018620 3300046690 Bacteria 4643
808 Ga0495624_0032751 3300046690 Bacteria 3368
809 Ga0495600_0003523 3300046809 Bacteria 9203
810 Ga0495600_0005898 3300046809 Bacteria 7411
811 Ga0495600_0012266 3300046809 Bacteria 5355
812 Ga0495600_0057945 3300046809 Bacteria 2530
813 Ga0495581_0000642 3300047315 Bacteria 18306
814 Ga0495581_0001959 3300047315 Bacteria 11531
815 Ga0495581_0010170 3300047315 Bacteria 5442
816 Ga0495604_0000120 3300047317 Bacteria 66462
817 Ga0495604_0000121 3300047317 Bacteria 65991
818 Ga0495604_0006362 3300047317 Bacteria 9364
819 Ga0495604_0011115 3300047317 Bacteria 7146
820 Ga0495674_0005612 3300047319 Bacteria 12032
821 Ga0495674_0011270 3300047319 Bacteria 8440
822 Ga0495674_0019676 3300047319 Bacteria 6263
823 Ga0495674_0059367 3300047319 Bacteria 3340
824 Ga0495674_0123969 3300047319 Unclassified 2181
825 Ga0495676_0000928 3300047321 Bacteria 24577
826 Ga0495676_0003693 3300047321 Bacteria 13893
827 Ga0495676_0004043 3300047321 Bacteria 13354
828 Ga0495676_0006190 3300047321 Bacteria 11004
829 Ga0495676_0066007 3300047321 Bacteria 2806
830 Ga0495676_0147446 3300047321 Bacteria 1679
831 Ga0495680_0000054 3300047322 Bacteria 93244
832 Ga0495680_0001641 3300047322 Bacteria 23765
833 Ga0495680_0001765 3300047322 Bacteria 22914
834 Ga0495680_0002289 3300047322 Bacteria 19707
835 Ga0495680_0005698 3300047322 Bacteria 11659
836 Ga0495680_0009533 3300047322 Bacteria 8725
837 Ga0495680_0018763 3300047322 Bacteria 5862
838 Ga0495680_0020072 3300047322 Bacteria 5630
839 Ga0495680_0037660 3300047322 Bacteria 3873
840 Ga0495680_0084308 3300047322 Bacteria 2395
841 Ga0495675_0000029 3300047444 Bacteria 105305
842 Ga0495675_0000176 3300047444 Bacteria 46587
843 Ga0495675_0071560 3300047444 Bacteria 2188
844 Ga0495675_0077140 3300047444 Bacteria 2099
845 Ga0495684_0000562 3300047471 Bacteria 30116
846 Ga0495684_0001716 3300047471 Bacteria 17633
847 Ga0495684_0001870 3300047471 Bacteria 16849
848 Ga0495684_0008951 3300047471 Bacteria 7732
849 Ga0495684_0010104 3300047471 Bacteria 7299
850 Ga0495684_0010681 3300047471 Bacteria 7099
851 Ga0495684_0052690 3300047471 Bacteria 3105
852 Ga0495686_0000020 3300047472 Bacteria 429191
853 Ga0495686_0104501 3300047472 Bacteria 1705
854 Ga0495593_0004833 3300047673 Bacteria 7990
855 Ga0495602_0000083 3300048088 Bacteria 93242
856 Ga0495602_0001081 3300048088 Bacteria 26704
857 Ga0495602_0004291 3300048088 Bacteria 14846
858 Ga0495602_0004572 3300048088 Bacteria 14436
859 Ga0495602_0034960 3300048088 Bacteria 4692
860 Ga0495602_0038087 3300048088 Bacteria 4452
861 Ga0495602_0050130 3300048088 Bacteria 3733
862 Ga0496100_0000019 3300048903 Bacteria 149995
863 Ga0496100_0003734 3300048903 Bacteria 7970
864 Ga0496100_0005515 3300048903 Bacteria 6827
865 Ga0496100_0006389 3300048903 Bacteria 6425
866 Ga0496100_0011308 3300048903 Bacteria 5079
867 Ga0496100_0023604 3300048903 Bacteria 3739
868 Ga0496100_0050281 3300048903 Bacteria 2700
869 Ga0496101_0000005 3300048904 Bacteria 331455
870 Ga0496101_0025969 3300048904 Bacteria 4068
871 Ga0496101_0057627 3300048904 Bacteria 2810
872 Ga0496101_0089632 3300048904 Bacteria 2286
873 Ga0496101_0284127 3300048904 Bacteria 1294
874 Ga0496102_0000021 3300048905 Bacteria 246920
875 Ga0496102_0024895 3300048905 Bacteria 5323
876 Ga0496102_0029102 3300048905 Bacteria 4939
877 Ga0496102_0031693 3300048905 Bacteria 4744
878 Ga0496102_0037880 3300048905 Bacteria 4349
879 Ga0496102_0066504 3300048905 Bacteria 3303
880 Ga0496102_0128068 3300048905 Bacteria 2374
881 Ga0496102_0167077 3300048905 Bacteria 2071
882 Ga0496102_0285040 3300048905 Bacteria 1557
883 Ga0496103_0000001 3300048906 Bacteria 643471
884 Ga0496103_0007179 3300048906 Bacteria 6643
885 Ga0496103_0053282 3300048906 Bacteria 2507
886 Ga0496103_0064679 3300048906 Bacteria 2280
887 Ga0496103_0074041 3300048906 Bacteria 2134
888 Ga0496104_0000029 3300048907 Bacteria 202968
889 Ga0496104_0000551 3300048907 Bacteria 31933
890 Ga0496104_0008695 3300048907 Bacteria 9030
891 Ga0496104_0018535 3300048907 Bacteria 6351
892 Ga0496104_0029165 3300048907 Bacteria 5117
893 Ga0496104_0153399 3300048907 Bacteria 2211
894 Ga0496104_0154114 3300048907 Bacteria 2205
895 Ga0496104_0181132 3300048907 Bacteria 2017
896 Ga0496104_0219752 3300048907 Bacteria 1812
897 Ga0496105_0000002 3300048908 Bacteria 753215
898 Ga0496105_0007317 3300048908 Bacteria 8527
899 Ga0496105_0007781 3300048908 Bacteria 8318
900 Ga0496105_0011873 3300048908 Bacteria 6898
901 Ga0496105_0013858 3300048908 Bacteria 6404
902 Ga0496105_0037207 3300048908 Bacteria 4008
903 Ga0496105_0106059 3300048908 Bacteria 2320
904 Ga0496105_0123184 3300048908 Bacteria 2137
905 Ga0496105_0132247 3300048908 Bacteria 2057
906 Ga0496106_0000033 3300048909 Bacteria 131412
907 Ga0496106_0001620 3300048909 Bacteria 16924
908 Ga0496106_0002498 3300048909 Bacteria 13685
909 Ga0496106_0005382 3300048909 Bacteria 9471
910 Ga0496106_0011536 3300048909 Bacteria 6534
911 Ga0496106_0032180 3300048909 Bacteria 3910
912 Ga0496106_0087764 3300048909 Bacteria 2397
913 Ga0496106_0215607 3300048909 Bacteria 1530
914 Ga0496106_0231732 3300048909 Bacteria 1474
915 Ga0496107_0000004 3300048910 Bacteria 297680
916 Ga0496107_0001120 3300048910 Bacteria 16167
917 Ga0496107_0009391 3300048910 Bacteria 6783
918 Ga0496107_0010207 3300048910 Bacteria 6516
919 Ga0496107_0074309 3300048910 Bacteria 2473
920 Ga0496107_0108244 3300048910 Bacteria 2041
921 Ga0496107_0195020 3300048910 Bacteria 1505
922 Ga0496108_0000187 3300048911 Bacteria 57568
923 Ga0496108_0006174 3300048911 Bacteria 9692
924 Ga0496108_0012519 3300048911 Bacteria 6908
925 Ga0496108_0015305 3300048911 Bacteria 6258
926 Ga0496108_0029554 3300048911 Bacteria 4540
927 Ga0496108_0045410 3300048911 Bacteria 3670
928 Ga0496108_0045656 3300048911 Bacteria 3659
929 Ga0496108_0050063 3300048911 Bacteria 3496
930 Ga0496108_0065269 3300048911 Bacteria 3068
931 Ga0496108_0097162 3300048911 Bacteria 2510
932 Ga0496108_0107050 3300048911 Bacteria 2387
933 Ga0496109_0000636 3300048912 Bacteria 29254
934 Ga0496109_0011911 3300048912 Bacteria 7488
935 Ga0496109_0015902 3300048912 Bacteria 6571
936 Ga0496109_0057804 3300048912 Bacteria 3542
937 Ga0496109_0060773 3300048912 Bacteria 3453
938 Ga0496109_0066426 3300048912 Bacteria 3302
939 Ga0496109_0085910 3300048912 Bacteria 2905
940 Ga0496109_0128724 3300048912 Bacteria 2362
941 Ga0496110_0009948 3300048913 Bacteria 7711
942 Ga0496110_0010762 3300048913 Bacteria 7455
943 Ga0496110_0013223 3300048913 Bacteria 6815
944 Ga0496110_0014802 3300048913 Bacteria 6481
945 Ga0496110_0026382 3300048913 Bacteria 4971
946 Ga0496110_0035902 3300048913 Bacteria 4304
947 Ga0496110_0048112 3300048913 Bacteria 3737
948 Ga0496110_0068392 3300048913 Bacteria 3143
949 Ga0496110_0182004 3300048913 Bacteria 1908
950 Ga0496110_0187494 3300048913 Bacteria 1878
951 Ga0496110_0231352 3300048913 Bacteria 1681
952 Ga0496111_0004675 3300048914 Bacteria 8678
953 Ga0496111_0014526 3300048914 Bacteria 5383
954 Ga0496111_0014676 3300048914 Bacteria 5358
955 Ga0496111_0041217 3300048914 Bacteria 3313
956 Ga0496111_0047847 3300048914 Bacteria 3080
957 Ga0496111_0057454 3300048914 Bacteria 2817
958 Ga0496111_0101851 3300048914 Bacteria 2110
959 Ga0496111_0160691 3300048914 Bacteria 1668
960 Ga0496111_0192486 3300048914 Bacteria 1516
961 Ga0496112_0001147 3300048915 Bacteria 19779
962 Ga0496112_0009893 3300048915 Bacteria 8621
963 Ga0496112_0026382 3300048915 Bacteria 5589
964 Ga0496112_0062499 3300048915 Bacteria 3673
965 Ga0496112_0068233 3300048915 Bacteria 3511
966 Ga0496112_0078518 3300048915 Bacteria 3264
967 Ga0496112_0098819 3300048915 Bacteria 2888
968 Ga0496112_0108236 3300048915 Bacteria 2750
969 Ga0496112_0157518 3300048915 Bacteria 2238
970 Ga0496113_0002968 3300048916 Bacteria 10034
971 Ga0496113_0010955 3300048916 Bacteria 6022
972 Ga0496113_0094109 3300048916 Bacteria 2314
973 Ga0496113_0096997 3300048916 Bacteria 2280
974 Ga0496113_0162980 3300048916 Bacteria 1763
975 Ga0496113_0175229 3300048916 Bacteria 1699
976 Ga0496114_0000003 3300048917 Bacteria 630981
977 Ga0496114_0001583 3300048917 Bacteria 17261
978 Ga0496114_0003903 3300048917 Bacteria 11499
979 Ga0496114_0006313 3300048917 Bacteria 9328
980 Ga0496114_0008959 3300048917 Bacteria 7934
981 Ga0496114_0013045 3300048917 Bacteria 6659
982 Ga0496114_0046563 3300048917 Unclassified 3604
983 Ga0496114_0132957 3300048917 Bacteria 2150
984 Ga0496115_0001724 3300048918 Bacteria 15676
985 Ga0496115_0016518 3300048918 Bacteria 5622
986 Ga0496115_0022266 3300048918 Bacteria 4908
987 Ga0496115_0032311 3300048918 Bacteria 4128
988 Ga0496115_0037757 3300048918 Bacteria 3829
989 Ga0496115_0134780 3300048918 Bacteria 2036
990 Ga0496115_0215009 3300048918 Bacteria 1587
991 Ga0496116_0000138 3300048919 Bacteria 151606
992 Ga0496117_0002715 3300048920 Bacteria 21760
993 Ga0496118_0000424 3300048921 Bacteria 70137
994 Ga0496119_0005703 3300048922 Bacteria 11807
995 Ga0496119_0007790 3300048922 Bacteria 9553
996 Ga0496119_0014904 3300048922 Bacteria 6043
997 Ga0496119_0021422 3300048922 Bacteria 4674
998 Ga0496119_0059615 3300048922 Bacteria 2291
999 Ga0496120_0002506 3300048923 Bacteria 18404
1000 Ga0496121_0008090 3300048924 Bacteria 12514
1001 Ga0496121_0111864 3300048924 Bacteria 2081
1002 Ga0496121_0161553 3300048924 Bacteria 1637
1003 Ga0496125_0022767 3300048928 Bacteria 5808
1004 Ga0501032_0004690 3300049569 Bacteria 10261
1005 Ga0501033_0099214 3300049570 Bacteria 2126
1006 Ga0501034_0009420 3300049571 Bacteria 10222
1007 Ga0501034_0128786 3300049571 Bacteria 2515
1008 Ga0501036_0046408 3300049572 Bacteria 3679
1009 Ga0501038_0016446 3300049574 Bacteria 6704
1010 Ga0501039_0030969 3300049575 Bacteria 4124
1011 Ga0501039_0190209 3300049575 Bacteria 1614
1012 Ga0501042_0007340 3300049578 Bacteria 7215
1013 Ga0501042_0194806 3300049578 Bacteria 1461
1014 Ga0501046_0045753 3300049580 Bacteria 3475
1015 Ga0501047_0053952 3300049581 Bacteria 3889
1016 Ga0501047_0182365 3300049581 Bacteria 1965
1017 Ga0501069_0000387 3300049585 Bacteria 19897
1018 Ga0501070_0006896 3300049586 Bacteria 9665
1019 Ga0501070_0017234 3300049586 Bacteria 6065
1020 Ga0501249_003280 3300049679 Bacteria 3255
1021 Ga0501079_0071732 3300049741 Bacteria 2676
1022 nmdc:mga06z11_55717_c1 3300050494 Bacteria 2042
1023 nmdc:mga05p37_10540_c1 3300050507 Bacteria 10961
1024 nmdc:mga05p37_27122_c1 3300050507 Bacteria 6972
1025 nmdc:mga05p37_29021_c1 3300050507 Bacteria 6751
1026 nmdc:mga05p37_38141_c1 3300050507 Bacteria 5893
1027 nmdc:mga09592_111263_c1 3300050508 Bacteria 2350
1028 nmdc:mga09592_31516_c1 3300050508 Bacteria 4418
1029 nmdc:mga0qj67_100862_c1 3300050509 Bacteria 2327
1030 nmdc:mga0qj67_105601_c1 3300050509 Bacteria 2272
1031 nmdc:mga0qj67_126806_c1 3300050509 Bacteria 2065
1032 nmdc:mga0qj67_18732_c1 3300050509 Bacteria 5278
1033 nmdc:mga0qj67_21097_c1 3300050509 Bacteria 4995
1034 nmdc:mga0qj67_241184_c1 3300050509 Bacteria 1467
1035 nmdc:mga0qj67_70731_c1 3300050509 Bacteria 2784
1036 nmdc:mga06r32_11724_c1 3300050510 Bacteria 7890
1037 nmdc:mga06r32_217756_c1 3300050510 Bacteria 1897
1038 nmdc:mga06r32_26545_c1 3300050510 Bacteria 5401
1039 nmdc:mga08y16_1438_c1 3300050511 Bacteria 23849
1040 nmdc:mga08y16_27181_c1 3300050511 Bacteria 6029
1041 nmdc:mga08y16_51543_c1 3300050511 Bacteria 4305
1042 nmdc:mga08y16_62383_c1 3300050511 Bacteria 3893
1043 nmdc:mga0n895_103767_c1 3300050512 Bacteria 2855
1044 nmdc:mga0n895_147475_c1 3300050512 Bacteria 2383
1045 nmdc:mga0n895_191761_c1 3300050512 Bacteria 2075
1046 nmdc:mga0n895_38576_c1 3300050512 Bacteria 4630
1047 nmdc:mga0n895_4006_c1 3300050512 Bacteria 11980
1048 nmdc:mga0n895_51772_c1 3300050512 Bacteria 4029
1049 nmdc:mga0n895_52902_c1 3300050512 Bacteria 3988
1050 nmdc:mga0n895_6500_c1 3300050512 Bacteria 9938
1051 nmdc:mga0rr50_10917_c1 3300050513 Bacteria 5792
1052 nmdc:mga0rr50_13008_c1 3300050513 Bacteria 5401
1053 nmdc:mga0rr50_24764_c1 3300050513 Bacteria 4162
1054 nmdc:mga0rr50_26236_c1 3300050513 Bacteria 4062
1055 nmdc:mga0rr50_5422_c1 3300050513 Bacteria 7606
1056 nmdc:mga0rr50_60781_c1 3300050513 Bacteria 2844
1057 nmdc:mga0rr50_69963_c1 3300050513 Bacteria 2673
1058 nmdc:mga08x19_38054_c1 3300050514 Bacteria 3055
1059 nmdc:mga0a205_18213_c1 3300050515 Bacteria 6598
1060 nmdc:mga0a205_185303_c1 3300050515 Bacteria 1974
1061 nmdc:mga0a205_21593_c1 3300050515 Bacteria 6089
1062 nmdc:mga0a205_25548_c1 3300050515 Bacteria 5627
1063 nmdc:mga0a205_271288_c1 3300050515 Bacteria 1573
1064 nmdc:mga0a205_3610_c1 3300050515 Bacteria 13853
1065 nmdc:mga0a205_62187_c1 3300050515 Bacteria 3607
1066 nmdc:mga0a205_679_c1 3300050515 Bacteria 27196
1067 nmdc:mga0a205_69143_c1 3300050515 Bacteria 3411
1068 nmdc:mga0sz30_56499_c2 3300050516 Bacteria 1381
1069 Ga0495601_0000110 3300053077 Bacteria 44959
1070 Ga0495601_0000124 3300053077 Bacteria 43205
1071 Ga0495601_0003438 3300053077 Bacteria 9074
1072 Ga0495601_0013142 3300053077 Bacteria 4977
1073 Ga0495601_0020740 3300053077 Bacteria 4017
1074 Ga0495601_0048222 3300053077 Bacteria 2683
1075 Ga0495612_0003172 3300053078 Bacteria 6811
1076 Ga0495612_0010699 3300053078 Bacteria 3707
1077 Ga0495612_0010857 3300053078 Bacteria 3680
1078 Ga0495612_0023356 3300053078 Bacteria 2481
1079 Ga0495655_0000008 3300053083 Bacteria 153535
1080 Ga0495595_0001178 3300053084 Bacteria 10157
1081 Ga0495595_0016809 3300053084 Bacteria 3136
1082 Ga0495595_0038686 3300053084 Bacteria 2174
1083 Ga0495619_0000025 3300053085 Bacteria 167905
1084 Ga0495619_0001863 3300053085 Bacteria 14045
1085 Ga0495619_0009701 3300053085 Bacteria 6070
1086 Ga0495619_0021921 3300053085 Bacteria 4084
1087 Ga0495619_0025437 3300053085 Bacteria 3802
1088 Ga0495619_0042642 3300053085 Bacteria 2972
1089 Ga0495619_0107445 3300053085 Bacteria 1904
1090 Ga0500566_0002923 3300053094 Bacteria 10195
1091 Ga0500556_0001512 3300053104 Bacteria 9592
1092 Ga0500572_001267 3300053111 Bacteria 7103
1093 Ga0500614_000117 3300053123 Bacteria 19001
1094 Ga0500628_000023 3300053129 Bacteria 77818
1095 Ga0500658_0000015 3300053134 Bacteria 151134
1096 Ga0500559_0010654 3300053136 Bacteria 3941
1097 Ga0500616_0011561 3300053153 Bacteria 5203
1098 Ga0501082_0056838 3300060353 Bacteria 3371

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100139241 Ga0070674_1001392413 355
2 3300049578 Ga0501042_0194806 Ga0501042_0194806_281_1438 366
3 3300035088 Ga0373940_0038524 Ga0373940_0038524_32_1189 368
4 3300048911 Ga0496108_0107050 Ga0496108_0107050_29_1186 368
5 3300048913 Ga0496110_0182004 Ga0496110_0182004_742_1893 373
6 3300048919 Ga0496116_0000138 Ga0496116_0000138_34635_35915 373
7 3300048922 Ga0496119_0021422 Ga0496119_0021422_3148_4428 373
8 3300046543 Ga0495645_0150754 Ga0495645_0150754_453_1586 374
9 3300048905 Ga0496102_0167077 Ga0496102_0167077_749_2032 381
10 3300048921 Ga0496118_0000424 Ga0496118_0000424_3126_4409 381
11 3300006844 Ga0075428_100081909 Ga0075428_1000819093 384
12 3300006163 Ga0070715_10001599 Ga0070715_100015995 389
13 3300025905 Ga0207685_10010684 Ga0207685_100106843 389
14 3300048903 Ga0496100_0023604 Ga0496100_0023604_44_1426 389
15 3300048905 Ga0496102_0024895 Ga0496102_0024895_3172_4554 389
16 3300048906 Ga0496103_0064679 Ga0496103_0064679_734_2116 389
17 3300050508 nmdc:mga09592_31516_c1 nmdc:mga09592_31516_c1_223_1434 397
18 3300050509 nmdc:mga0qj67_70731_c1 nmdc:mga0qj67_70731_c1_578_1789 397
19 3300035691 Ga0373931_0018769 Ga0373931_0018769_1669_3048 398
20 3300005718 Ga0068866_10016127 Ga0068866_100161273 399
21 3300009176 Ga0105242_10194217 Ga0105242_101942172 399
22 3300048905 Ga0496102_0066504 Ga0496102_0066504_541_1920 399
23 3300048910 Ga0496107_0074309 Ga0496107_0074309_885_2282 399
24 3300050494 nmdc:mga06z11_55717_c1 nmdc:mga06z11_55717_c1_455_1852 399
25 3300050513 nmdc:mga0rr50_24764_c1 nmdc:mga0rr50_24764_c1_2041_3438 399
26 3300005347 Ga0070668_100015399 Ga0070668_1000153992 400
27 3300009553 Ga0105249_10000916 Ga0105249_100009163 400
28 3300013297 Ga0157378_10217413 Ga0157378_102174132 400
29 3300013306 Ga0163162_10339249 Ga0163162_103392491 400
30 3300025942 Ga0207689_10150840 Ga0207689_101508402 400
31 3300041512 Ga0451853_1257484 Ga0451853_1257484_598_1812 400
32 3300046459 Ga0495629_0177689 Ga0495629_0177689_186_1400 400
33 3300046462 Ga0495651_0009283 Ga0495651_0009283_3968_5182 400
34 3300046511 Ga0495608_0018319 Ga0495608_0018319_960_2174 400
35 3300046516 Ga0495628_0076419 Ga0495628_0076419_296_1510 400
36 3300046517 Ga0495630_0218180 Ga0495630_0218180_125_1339 400
37 3300046529 Ga0495652_0006599 Ga0495652_0006599_1998_3212 400
38 3300046533 Ga0495640_0069624 Ga0495640_0069624_868_2082 400
39 3300046536 Ga0495587_0021986 Ga0495587_0021986_371_1585 400
40 3300046559 Ga0495667_0004526 Ga0495667_0004526_5405_6619 400
41 3300046663 Ga0495635_0104834 Ga0495635_0104834_288_1502 400
42 3300046675 Ga0495657_0109621 Ga0495657_0109621_132_1346 400
43 3300046678 Ga0495599_0031788 Ga0495599_0031788_1714_2928 400
44 3300046680 Ga0495646_0028953 Ga0495646_0028953_2052_3266 400
45 3300046809 Ga0495600_0012266 Ga0495600_0012266_389_1603 400
46 3300047317 Ga0495604_0006362 Ga0495604_0006362_2369_3583 400
47 3300047319 Ga0495674_0011270 Ga0495674_0011270_1773_2987 400
48 3300047322 Ga0495680_0002289 Ga0495680_0002289_17938_19152 400
49 3300047471 Ga0495684_0010681 Ga0495684_0010681_68_1282 400
50 3300048088 Ga0495602_0050130 Ga0495602_0050130_674_1888 400
51 3300048928 Ga0496125_0022767 Ga0496125_0022767_49_1383 400
52 3300050509 nmdc:mga0qj67_241184_c1 nmdc:mga0qj67_241184_c1_18_1223 400
53 3300053077 Ga0495601_0048222 Ga0495601_0048222_145_1359 400
54 3300053084 Ga0495595_0016809 Ga0495595_0016809_275_1489 400
55 3300053085 Ga0495619_0042642 Ga0495619_0042642_1701_2915 400
56 3300005338 Ga0068868_100132802 Ga0068868_1001328022 401
57 3300025912 Ga0207707_10017087 Ga0207707_100170874 401
58 3300035695 Ga0373927_0002848 Ga0373927_0002848_11353_12579 401
59 3300005356 Ga0070674_100150710 Ga0070674_1001507101 402
60 3300046689 Ga0495613_0201242 Ga0495613_0201242_27_1238 402
61 3300048904 Ga0496101_0284127 Ga0496101_0284127_22_1233 402
62 3300048910 Ga0496107_0195020 Ga0496107_0195020_24_1238 403
63 3300005337 Ga0070682_100143366 Ga0070682_1001433662 404
64 3300005366 Ga0070659_100065148 Ga0070659_1000651482 404
65 3300005438 Ga0070701_10073309 Ga0070701_100733091 404
66 3300005439 Ga0070711_100003451 Ga0070711_1000034516 404
67 3300005455 Ga0070663_100132944 Ga0070663_1001329441 404
68 3300005456 Ga0070678_100040934 Ga0070678_1000409343 404
69 3300005457 Ga0070662_100049611 Ga0070662_1000496112 404
70 3300005539 Ga0068853_100074408 Ga0068853_1000744081 404
71 3300005545 Ga0070695_100139300 Ga0070695_1001393001 404
72 3300005578 Ga0068854_100024072 Ga0068854_1000240723 404
73 3300006173 Ga0070716_100003719 Ga0070716_1000037194 404
74 3300006175 Ga0070712_100024148 Ga0070712_1000241482 404
75 3300006358 Ga0068871_100032952 Ga0068871_1000329523 404
76 3300013306 Ga0163162_10236293 Ga0163162_102362933 404
77 3300025915 Ga0207693_10002493 Ga0207693_1000249312 404
78 3300025916 Ga0207663_10005313 Ga0207663_100053133 404
79 3300025932 Ga0207690_10071111 Ga0207690_100711112 404
80 3300025939 Ga0207665_10043840 Ga0207665_100438402 404
81 3300026067 Ga0207678_10098105 Ga0207678_100981052 404
82 3300026121 Ga0207683_10102639 Ga0207683_101026392 404
83 3300028381 Ga0268264_10110101 Ga0268264_101101013 404
84 3300048903 Ga0496100_0050281 Ga0496100_0050281_22_1401 404
85 3300048909 Ga0496106_0011536 Ga0496106_0011536_4210_5589 404
86 3300048910 Ga0496107_0010207 Ga0496107_0010207_2613_3992 404
87 3300048920 Ga0496117_0002715 Ga0496117_0002715_20136_21518 407
88 3300014326 Ga0157380_10136826 Ga0157380_101368262 409
89 3300048922 Ga0496119_0005703 Ga0496119_0005703_6632_7942 410
90 3300048923 Ga0496120_0002506 Ga0496120_0002506_9028_10338 410
91 3300013308 Ga0157375_10427895 Ga0157375_104278952 411
92 3300048922 Ga0496119_0059615 Ga0496119_0059615_696_2078 411
93 3300048924 Ga0496121_0111864 Ga0496121_0111864_57_1439 411
94 3300037418 Ga0395900_0233340 Ga0395900_0233340_23_1318 412
95 3300048914 Ga0496111_0014526 Ga0496111_0014526_1925_3307 414
96 3300048917 Ga0496114_0008959 Ga0496114_0008959_4259_5641 414
97 3300025940 Ga0207691_10178554 Ga0207691_101785542 415
98 3300006844 Ga0075428_100079512 Ga0075428_1000795122 416
99 3300006847 Ga0075431_100082299 Ga0075431_1000822995 416
100 3300047472 Ga0495686_0000020 Ga0495686_0000020_260234_261511 416
101 3300048909 Ga0496106_0032180 Ga0496106_0032180_2470_3792 416
102 3300048914 Ga0496111_0192486 Ga0496111_0192486_168_1490 416
103 3300048915 Ga0496112_0068233 Ga0496112_0068233_369_1691 416
104 3300050507 nmdc:mga05p37_27122_c1 nmdc:mga05p37_27122_c1_5100_6398 416
105 3300050510 nmdc:mga06r32_217756_c1 nmdc:mga06r32_217756_c1_23_1321 416
106 3300050515 nmdc:mga0a205_271288_c1 nmdc:mga0a205_271288_c1_154_1452 416
107 3300050516 nmdc:mga0sz30_56499_c2 nmdc:mga0sz30_56499_c2_59_1330 416
108 3300014326 Ga0157380_10032636 Ga0157380_100326365 417
109 3300048913 Ga0496110_0048112 Ga0496110_0048112_377_1759 417
110 3300006847 Ga0075431_100065005 Ga0075431_1000650052 418
111 3300009098 Ga0105245_10108511 Ga0105245_101085112 418
112 3300009148 Ga0105243_10071064 Ga0105243_100710641 418
113 3300009176 Ga0105242_10091633 Ga0105242_100916332 418
114 3300013296 Ga0157374_10322458 Ga0157374_103224581 418
115 3300014326 Ga0157380_10177339 Ga0157380_101773392 418
116 3300025941 Ga0207711_10162875 Ga0207711_101628752 418
117 3300048905 Ga0496102_0031693 Ga0496102_0031693_2782_4095 418
118 3300048907 Ga0496104_0219752 Ga0496104_0219752_215_1546 418
119 3300048911 Ga0496108_0097162 Ga0496108_0097162_495_1877 418
120 3300048913 Ga0496110_0231352 Ga0496110_0231352_18_1400 418
121 3300053085 Ga0495619_0107445 Ga0495619_0107445_21_1352 418
122 3300035692 Ga0373935_0168636 Ga0373935_0168636_131_1414 419
123 3300035725 Ga0373947_0142491 Ga0373947_0142491_124_1407 419
124 3300037068 Ga0373925_0140157 Ga0373925_0140157_44_1498 419
125 3300046517 Ga0495630_0027711 Ga0495630_0027711_19_1302 419
126 3300047321 Ga0495676_0147446 Ga0495676_0147446_290_1573 419
127 3300004799 Ga0058863_11944294 Ga0058863_119442942 420
128 3300004800 Ga0058861_10082651 Ga0058861_100826511 420
129 3300005440 Ga0070705_100009341 Ga0070705_1000093412 420
130 3300005458 Ga0070681_10014198 Ga0070681_100141982 420
131 3300005615 Ga0070702_100005715 Ga0070702_1000057152 420
132 3300006852 Ga0075433_10004165 Ga0075433_100041658 420
133 3300009176 Ga0105242_10060082 Ga0105242_100600823 420
134 3300009553 Ga0105249_10150221 Ga0105249_101502212 420
135 3300014326 Ga0157380_10080362 Ga0157380_100803622 420
136 3300025912 Ga0207707_10017437 Ga0207707_100174377 420
137 3300025921 Ga0207652_10051270 Ga0207652_100512702 420
138 3300025934 Ga0207686_10053260 Ga0207686_100532602 420
139 3300010375 Ga0105239_10112707 Ga0105239_101127072 421
140 3300050515 nmdc:mga0a205_185303_c1 nmdc:mga0a205_185303_c1_20_1366 421
141 3300050515 nmdc:mga0a205_3610_c1 nmdc:mga0a205_3610_c1_7239_8645 422
142 3300005337 Ga0070682_100000013 Ga0070682_10000001365 423
143 3300005439 Ga0070711_100049324 Ga0070711_1000493242 423
144 3300005614 Ga0068856_100066493 Ga0068856_1000664936 423
145 3300025916 Ga0207663_10023197 Ga0207663_100231972 423
146 3300048903 Ga0496100_0005515 Ga0496100_0005515_1377_2834 423
147 3300048904 Ga0496101_0057627 Ga0496101_0057627_351_1808 423
148 3300048907 Ga0496104_0000551 Ga0496104_0000551_2291_3748 423
149 3300048908 Ga0496105_0007317 Ga0496105_0007317_608_2065 423
150 3300048909 Ga0496106_0001620 Ga0496106_0001620_867_2324 423
151 3300048910 Ga0496107_0001120 Ga0496107_0001120_1808_3265 423
152 3300048911 Ga0496108_0006174 Ga0496108_0006174_5517_6974 423
153 3300048912 Ga0496109_0060773 Ga0496109_0060773_271_1728 423
154 3300048913 Ga0496110_0009948 Ga0496110_0009948_4944_6401 423
155 3300048915 Ga0496112_0062499 Ga0496112_0062499_1797_3254 423
156 3300048917 Ga0496114_0001583 Ga0496114_0001583_8631_10088 423
157 3300048918 Ga0496115_0016518 Ga0496115_0016518_2258_3715 423
158 3300005614 Ga0068856_100009718 Ga0068856_1000097184 424
159 3300009176 Ga0105242_10008877 Ga0105242_100088771 424
160 3300013297 Ga0157378_10271297 Ga0157378_102712971 424
161 3300026078 Ga0207702_10028773 Ga0207702_100287735 424
162 3300046477 Ga0495664_0095018 Ga0495664_0095018_375_1670 424
163 3300048915 Ga0496112_0157518 Ga0496112_0157518_712_1989 424
164 3300048916 Ga0496113_0094109 Ga0496113_0094109_957_2234 424
165 3300053077 Ga0495601_0020740 Ga0495601_0020740_2262_3557 424
166 iso_pu_bacteria 2757320536 2758225509 424
167 3300005530 Ga0070679_100122463 Ga0070679_1001224632 425
168 3300020076 Ga0206355_1195442 Ga0206355_11954422 425
169 3300020077 Ga0206351_10855698 Ga0206351_108556982 425
170 3300020078 Ga0206352_10111744 Ga0206352_101117443 425
171 3300020082 Ga0206353_11863956 Ga0206353_118639562 425
172 3300020610 Ga0154015_1332211 Ga0154015_13322112 425
173 3300046690 Ga0495624_0032751 Ga0495624_0032751_112_1401 425
174 3300035725 Ga0373947_0057317 Ga0373947_0057317_663_2057 426
175 3300046455 Ga0495603_0033679 Ga0495603_0033679_1391_2785 426
176 3300025941 Ga0207711_10018257 Ga0207711_100182573 427
177 3300036712 Ga0316584_0005054 Ga0316584_0005054_5019_6350 427
178 3300037588 Ga0316581_0001663 Ga0316581_0001663_1271_2602 427
179 3300048903 Ga0496100_0003734 Ga0496100_0003734_815_2107 427
180 3300048904 Ga0496101_0025969 Ga0496101_0025969_662_1954 427
181 3300048907 Ga0496104_0153399 Ga0496104_0153399_836_2134 427
182 3300048910 Ga0496107_0009391 Ga0496107_0009391_4805_6097 427
183 3300048915 Ga0496112_0078518 Ga0496112_0078518_233_1531 427
184 3300048916 Ga0496113_0010955 Ga0496113_0010955_3904_5202 427
185 3300048918 Ga0496115_0215009 Ga0496115_0215009_84_1376 427
186 3300050509 nmdc:mga0qj67_126806_c1 nmdc:mga0qj67_126806_c1_404_1762 427
187 3300005436 Ga0070713_100001413 Ga0070713_1000014135 428
188 3300006175 Ga0070712_100069626 Ga0070712_1000696262 428
189 3300025915 Ga0207693_10083758 Ga0207693_100837584 428
190 3300025928 Ga0207700_10112071 Ga0207700_101120712 428
191 3300037466 Ga0395898_0190730 Ga0395898_0190730_142_1542 428
192 3300038443 Ga0395901_0018262 Ga0395901_0018262_3430_4830 428
193 3300046515 Ga0495620_0000144 Ga0495620_0000144_9405_10811 428
194 3300048914 Ga0496111_0101851 Ga0496111_0101851_452_1885 428
195 iso_pu_bacteria 2870628048 2870628812 428
196 3300005937 Ga0081455_10013896 Ga0081455_100138962 429
197 3300048906 Ga0496103_0007179 Ga0496103_0007179_4856_6187 429
198 3300050509 nmdc:mga0qj67_18732_c1 nmdc:mga0qj67_18732_c1_551_1981 429
199 3300009177 Ga0105248_10009406 Ga0105248_100094065 430
200 3300013306 Ga0163162_10030239 Ga0163162_100302392 430
201 3300014325 Ga0163163_10007110 Ga0163163_100071105 430
202 3300021361 Ga0213872_10023559 Ga0213872_100235592 430
203 3300032002 Ga0307416_100139478 Ga0307416_1001394782 430
204 3300039447 Ga0436361_0336407 Ga0436361_0336407_12604_13920 430
205 3300039453 Ga0436362_0003157 Ga0436362_0003157_9985_11301 430
206 3300048915 Ga0496112_0009893 Ga0496112_0009893_6177_7556 430
207 3300025933 Ga0207706_10040269 Ga0207706_100402691 431
208 3300039447 Ga0436361_0510461 Ga0436361_0510461_1018_2388 431
209 3300053085 Ga0495619_0025437 Ga0495619_0025437_87_1439 431
210 3300035119 Ga0373956_0012653 Ga0373956_0012653_1261_2583 432
211 3300037466 Ga0395898_0028626 Ga0395898_0028626_1490_2908 432
212 3300046675 Ga0495657_0027438 Ga0495657_0027438_1338_2660 432
213 3300047317 Ga0495604_0011115 Ga0495604_0011115_5399_6721 432
214 3300047322 Ga0495680_0009533 Ga0495680_0009533_6131_7453 432
215 iso_pu_bacteria 2523231044 2523385192 432
216 3300005435 Ga0070714_100006732 Ga0070714_1000067321 433
217 3300005439 Ga0070711_100077818 Ga0070711_1000778182 433
218 3300006028 Ga0070717_10002252 Ga0070717_100022529 433
219 3300006028 Ga0070717_10053450 Ga0070717_100534503 433
220 3300009098 Ga0105245_10013722 Ga0105245_100137223 433
221 3300009177 Ga0105248_10296632 Ga0105248_102966322 433
222 3300013308 Ga0157375_10247796 Ga0157375_102477962 433
223 3300014325 Ga0163163_10043622 Ga0163163_100436223 433
224 3300025929 Ga0207664_10070425 Ga0207664_100704252 433
225 3300026118 Ga0207675_100213549 Ga0207675_1002135492 433
226 3300030521 Ga0307511_10020634 Ga0307511_100206345 433
227 3300005983 Ga0081540_1000757 Ga0081540_100075715 434
228 3300031727 Ga0316576_10108327 Ga0316576_101083272 434
229 3300031733 Ga0316577_10033831 Ga0316577_100338314 434
230 3300035398 Ga0316574_0036378 Ga0316574_0036378_453_1820 434
231 3300036401 Ga0373937_0018127 Ga0373937_0018127_1327_2775 434
232 3300036712 Ga0316584_0026524 Ga0316584_0026524_1684_3051 434
233 3300039447 Ga0436361_0035073 Ga0436361_0035073_3303_4658 434
234 3300039447 Ga0436361_0735490 Ga0436361_0735490_3078_4433 434
235 3300046454 Ga0495592_0000220 Ga0495592_0000220_8677_10125 434
236 3300046462 Ga0495651_0000034 Ga0495651_0000034_95670_97118 434
237 3300046463 Ga0495653_0000669 Ga0495653_0000669_15081_16529 434
238 3300046511 Ga0495608_0000584 Ga0495608_0000584_10239_11687 434
239 3300046516 Ga0495628_0000040 Ga0495628_0000040_83042_84490 434
240 3300046529 Ga0495652_0002645 Ga0495652_0002645_4705_6153 434
241 3300046536 Ga0495587_0000055 Ga0495587_0000055_56422_57870 434
242 3300046543 Ga0495645_0000073 Ga0495645_0000073_44972_46420 434
243 3300046678 Ga0495599_0000173 Ga0495599_0000173_1964_3412 434
244 3300046679 Ga0495623_0000101 Ga0495623_0000101_30244_31692 434
245 3300046680 Ga0495646_0010006 Ga0495646_0010006_98_1546 434
246 3300047317 Ga0495604_0000120 Ga0495604_0000120_59204_60652 434
247 3300047322 Ga0495680_0018763 Ga0495680_0018763_378_1826 434
248 3300047444 Ga0495675_0000029 Ga0495675_0000029_54978_56426 434
249 3300048088 Ga0495602_0001081 Ga0495602_0001081_15082_16530 434
250 3300048917 Ga0496114_0006313 Ga0496114_0006313_4777_6180 434
251 3300050515 nmdc:mga0a205_62187_c1 nmdc:mga0a205_62187_c1_851_2248 434
252 3300053077 Ga0495601_0000110 Ga0495601_0000110_15902_17350 434
253 3300053078 Ga0495612_0023356 Ga0495612_0023356_53_1501 434
254 3300053084 Ga0495595_0038686 Ga0495595_0038686_271_1719 434
255 iso_pu_bacteria 2738541308 2738886880 434
256 3300005471 Ga0070698_100259376 Ga0070698_1002593761 435
257 3300006871 Ga0075434_100030794 Ga0075434_1000307942 435
258 3300036712 Ga0316584_0029469 Ga0316584_0029469_2712_4034 435
259 3300039438 Ga0436360_0633769 Ga0436360_0633769_10157_11488 435
260 3300049741 Ga0501079_0071732 Ga0501079_0071732_274_1716 435
261 3300050512 nmdc:mga0n895_51772_c1 nmdc:mga0n895_51772_c1_2478_3875 435
262 3300060353 Ga0501082_0056838 Ga0501082_0056838_285_1727 435
263 3300005983 Ga0081540_1037492 Ga0081540_10374922 436
264 3300009148 Ga0105243_10085160 Ga0105243_100851603 436
265 3300031251 Ga0265327_10000018 Ga0265327_10000018145 436
266 3300046477 Ga0495664_0018691 Ga0495664_0018691_401_1723 436
267 3300046675 Ga0495657_0032893 Ga0495657_0032893_130_1452 436
268 3300046679 Ga0495623_0035821 Ga0495623_0035821_13_1335 436
269 3300049575 Ga0501039_0190209 Ga0501039_0190209_83_1450 436
270 3300053078 Ga0495612_0010857 Ga0495612_0010857_90_1412 436
271 3300005345 Ga0070692_10011129 Ga0070692_100111291 437
272 3300005347 Ga0070668_100037245 Ga0070668_1000372453 437
273 3300005366 Ga0070659_100183191 Ga0070659_1001831911 437
274 3300005435 Ga0070714_100001300 Ga0070714_10000130018 437
275 3300005436 Ga0070713_100044804 Ga0070713_1000448042 437
276 3300005444 Ga0070694_100004651 Ga0070694_1000046514 437
277 3300005457 Ga0070662_100137455 Ga0070662_1001374552 437
278 3300005548 Ga0070665_100144277 Ga0070665_1001442772 437
279 3300005563 Ga0068855_100045286 Ga0068855_1000452862 437
280 3300005719 Ga0068861_100014414 Ga0068861_1000144142 437
281 3300005840 Ga0068870_10062911 Ga0068870_100629112 437
282 3300005842 Ga0068858_100031114 Ga0068858_1000311145 437
283 3300005844 Ga0068862_100062940 Ga0068862_1000629403 437
284 3300006028 Ga0070717_10026014 Ga0070717_100260143 437
285 3300006048 Ga0075363_100021934 Ga0075363_1000219342 437
286 3300006358 Ga0068871_100075188 Ga0068871_1000751884 437
287 3300006852 Ga0075433_10031502 Ga0075433_100315021 437
288 3300006871 Ga0075434_100225994 Ga0075434_1002259941 437
289 3300006914 Ga0075436_100006626 Ga0075436_1000066267 437
290 3300007076 Ga0075435_100014025 Ga0075435_1000140256 437
291 3300009093 Ga0105240_10094357 Ga0105240_100943573 437
292 3300009094 Ga0111539_10002534 Ga0111539_100025349 437
293 3300009148 Ga0105243_10041665 Ga0105243_100416651 437
294 3300009551 Ga0105238_10262486 Ga0105238_102624861 437
295 3300013100 Ga0157373_10075674 Ga0157373_100756742 437
296 3300013104 Ga0157370_10151057 Ga0157370_101510571 437
297 3300014326 Ga0157380_10039774 Ga0157380_100397744 437
298 3300014745 Ga0157377_10126072 Ga0157377_101260721 437
299 3300025904 Ga0207647_10008001 Ga0207647_100080015 437
300 3300025905 Ga0207685_10031309 Ga0207685_100313092 437
301 3300025915 Ga0207693_10002186 Ga0207693_100021868 437
302 3300025929 Ga0207664_10053517 Ga0207664_100535172 437
303 3300025933 Ga0207706_10015246 Ga0207706_100152465 437
304 3300025939 Ga0207665_10004626 Ga0207665_100046262 437
305 3300025942 Ga0207689_10036645 Ga0207689_100366454 437
306 3300025972 Ga0207668_10007005 Ga0207668_100070055 437
307 3300026023 Ga0207677_10087065 Ga0207677_100870651 437
308 3300026067 Ga0207678_10016969 Ga0207678_100169694 437
309 3300026075 Ga0207708_10058018 Ga0207708_100580183 437
310 3300026078 Ga0207702_10044134 Ga0207702_100441344 437
311 3300026095 Ga0207676_10056628 Ga0207676_100566284 437
312 3300026121 Ga0207683_10020763 Ga0207683_100207634 437
313 3300027907 Ga0207428_10080458 Ga0207428_100804582 437
314 3300035091 Ga0373951_0012974 Ga0373951_0012974_364_1761 437
315 3300035112 Ga0373932_0022750 Ga0373932_0022750_82_1479 437
316 3300035115 Ga0373941_0011532 Ga0373941_0011532_659_2056 437
317 3300038443 Ga0395901_0193477 Ga0395901_0193477_244_1656 437
318 3300048904 Ga0496101_0089632 Ga0496101_0089632_387_1784 437
319 3300048905 Ga0496102_0128068 Ga0496102_0128068_604_2001 437
320 3300048907 Ga0496104_0018535 Ga0496104_0018535_1423_2820 437
321 3300048908 Ga0496105_0132247 Ga0496105_0132247_494_1819 437
322 3300048909 Ga0496106_0231732 Ga0496106_0231732_37_1434 437
323 3300048910 Ga0496107_0108244 Ga0496107_0108244_400_1797 437
324 3300048912 Ga0496109_0015902 Ga0496109_0015902_2436_3833 437
325 3300048913 Ga0496110_0026382 Ga0496110_0026382_1895_3292 437
326 3300048914 Ga0496111_0041217 Ga0496111_0041217_1193_2590 437
327 3300048915 Ga0496112_0108236 Ga0496112_0108236_335_1690 437
328 3300048916 Ga0496113_0175229 Ga0496113_0175229_73_1470 437
329 3300048917 Ga0496114_0046563 Ga0496114_0046563_1175_2572 437
330 3300048918 Ga0496115_0134780 Ga0496115_0134780_110_1507 437
331 3300050509 nmdc:mga0qj67_105601_c1 nmdc:mga0qj67_105601_c1_493_1872 437
332 3300050511 nmdc:mga08y16_1438_c1 nmdc:mga08y16_1438_c1_4704_6200 437
333 3300050512 nmdc:mga0n895_103767_c1 nmdc:mga0n895_103767_c1_1399_2796 437
334 3300050512 nmdc:mga0n895_6500_c1 nmdc:mga0n895_6500_c1_6282_7778 437
335 3300050513 nmdc:mga0rr50_13008_c1 nmdc:mga0rr50_13008_c1_115_1512 437
336 3300050514 nmdc:mga08x19_38054_c1 nmdc:mga08x19_38054_c1_468_1964 437
337 3300050515 nmdc:mga0a205_25548_c1 nmdc:mga0a205_25548_c1_2798_4195 437
338 3300050515 nmdc:mga0a205_679_c1 nmdc:mga0a205_679_c1_19275_20771 437
339 3300003187 JGI25151J46595_10000166 JGI25151J46595_1000016668 438
340 3300017792 Ga0163161_10078165 Ga0163161_100781652 438
341 3300031665 Ga0316575_10002167 Ga0316575_100021675 438
342 3300031733 Ga0316577_10011476 Ga0316577_100114762 438
343 3300032137 Ga0316585_10005770 Ga0316585_100057705 438
344 3300035398 Ga0316574_0000052 Ga0316574_0000052_11211_12680 438
345 3300035398 Ga0316574_0074281 Ga0316574_0074281_581_1939 438
346 3300036647 Ga0316582_0000166 Ga0316582_0000166_1682_3151 438
347 3300036712 Ga0316584_0007826 Ga0316584_0007826_2317_3786 438
348 3300005338 Ga0068868_100180700 Ga0068868_1001807001 439
349 3300005366 Ga0070659_100132928 Ga0070659_1001329281 439
350 3300005539 Ga0068853_100093895 Ga0068853_1000938953 439
351 3300005841 Ga0068863_100079728 Ga0068863_1000797282 439
352 3300005843 Ga0068860_100128723 Ga0068860_1001287232 439
353 3300006844 Ga0075428_100028236 Ga0075428_1000282362 439
354 3300006852 Ga0075433_10063711 Ga0075433_100637112 439
355 3300006871 Ga0075434_100077166 Ga0075434_1000771662 439
356 3300007076 Ga0075435_100082894 Ga0075435_1000828942 439
357 3300009148 Ga0105243_10048351 Ga0105243_100483515 439
358 3300009553 Ga0105249_10107528 Ga0105249_101075281 439
359 3300013306 Ga0163162_10026336 Ga0163162_100263364 439
360 3300017792 Ga0163161_10017674 Ga0163161_100176743 439
361 3300025933 Ga0207706_10099242 Ga0207706_100992421 439
362 3300025938 Ga0207704_10016620 Ga0207704_100166202 439
363 3300025961 Ga0207712_10111032 Ga0207712_101110322 439
364 3300025981 Ga0207640_10109174 Ga0207640_101091742 439
365 3300026041 Ga0207639_10075794 Ga0207639_100757942 439
366 3300026088 Ga0207641_10084193 Ga0207641_100841932 439
367 3300027907 Ga0207428_10014005 Ga0207428_100140052 439
368 3300048912 Ga0496109_0057804 Ga0496109_0057804_76_1479 439
369 3300048916 Ga0496113_0162980 Ga0496113_0162980_53_1456 439
370 3300050507 nmdc:mga05p37_38141_c1 nmdc:mga05p37_38141_c1_4298_5809 439
371 3300050510 nmdc:mga06r32_26545_c1 nmdc:mga06r32_26545_c1_1189_2688 439
372 3300050511 nmdc:mga08y16_62383_c1 nmdc:mga08y16_62383_c1_1621_3120 439
373 3300050512 nmdc:mga0n895_52902_c1 nmdc:mga0n895_52902_c1_218_1717 439
374 3300050513 nmdc:mga0rr50_69963_c1 nmdc:mga0rr50_69963_c1_639_2138 439
375 3300050515 nmdc:mga0a205_21593_c1 nmdc:mga0a205_21593_c1_622_2121 439
376 3300039447 Ga0436361_0002000 Ga0436361_0002000_127_1536 440
377 3300039450 Ga0436363_0472667 Ga0436363_0472667_288_1697 440
378 3300045976 Ga0466967_0052298 Ga0466967_0052298_948_2333 440
379 iso_pu_bacteria 2919034639 2919036786 440
380 3300005548 Ga0070665_100131441 Ga0070665_1001314412 441
381 3300028379 Ga0268266_10167727 Ga0268266_101677272 441
382 3300006175 Ga0070712_100000003 Ga0070712_100000003221 442
383 3300025915 Ga0207693_10000009 Ga0207693_10000009128 442
384 3300026023 Ga0207677_10140050 Ga0207677_101400502 442
385 3300045976 Ga0466967_0015423 Ga0466967_0015423_1357_2721 442
386 3300048915 Ga0496112_0001147 Ga0496112_0001147_9712_11046 442
387 3300049581 Ga0501047_0053952 Ga0501047_0053952_1571_2947 442
388 3300049586 Ga0501070_0017234 Ga0501070_0017234_300_1682 442
389 iso_pu_bacteria 2684623219 2687238119 442
390 3300009094 Ga0111539_10343497 Ga0111539_103434971 443
391 3300031456 Ga0307513_10006242 Ga0307513_100062424 443
392 3300048905 Ga0496102_0285040 Ga0496102_0285040_11_1456 443
393 3300050511 nmdc:mga08y16_51543_c1 nmdc:mga08y16_51543_c1_1891_3306 443
394 3300053136 Ga0500559_0010654 Ga0500559_0010654_407_1804 443
395 iso_pu_bacteria 2739367857 2740000265 443
396 iso_pu_bacteria 2739367858 2740005081 443
397 3300005347 Ga0070668_100065222 Ga0070668_1000652222 444
398 3300005353 Ga0070669_100104806 Ga0070669_1001048061 444
399 3300005841 Ga0068863_100055706 Ga0068863_1000557063 444
400 3300005843 Ga0068860_100234091 Ga0068860_1002340912 444
401 3300005844 Ga0068862_100087848 Ga0068862_1000878482 444
402 3300005937 Ga0081455_10016343 Ga0081455_100163432 444
403 3300006844 Ga0075428_100134561 Ga0075428_1001345611 444
404 3300006852 Ga0075433_10042932 Ga0075433_100429321 444
405 3300006871 Ga0075434_100144366 Ga0075434_1001443663 444
406 3300006914 Ga0075436_100009259 Ga0075436_1000092596 444
407 3300006942 Ga0099824_1000332 Ga0099824_100033226 444
408 3300007076 Ga0075435_100010366 Ga0075435_1000103669 444
409 3300009094 Ga0111539_10108769 Ga0111539_101087692 444
410 3300009147 Ga0114129_10036368 Ga0114129_100363685 444
411 3300009176 Ga0105242_10238791 Ga0105242_102387911 444
412 3300013100 Ga0157373_10000003 Ga0157373_1000000323 444
413 3300015261 Ga0182006_1041690 Ga0182006_10416901 444
414 3300025294 Ga0209025_1000053 Ga0209025_1000053133 444
415 3300025297 Ga0209758_1001127 Ga0209758_100112712 444
416 3300025923 Ga0207681_10086256 Ga0207681_100862561 444
417 3300025972 Ga0207668_10142092 Ga0207668_101420922 444
418 3300026088 Ga0207641_10042529 Ga0207641_100425293 444
419 3300028381 Ga0268264_10175727 Ga0268264_101757271 444
420 3300028381 Ga0268264_10212271 Ga0268264_102122711 444
421 3300031595 Ga0265313_10006987 Ga0265313_100069875 444
422 3300031711 Ga0265314_10064755 Ga0265314_100647552 444
423 3300031824 Ga0307413_10000272 Ga0307413_1000027212 444
424 3300032005 Ga0307411_10000003 Ga0307411_10000003184 444
425 3300036401 Ga0373937_0048404 Ga0373937_0048404_415_1827 444
426 3300041407 Ga0439447_000024 Ga0439447_000024_8629_10029 444
427 3300046511 Ga0495608_0050745 Ga0495608_0050745_171_1583 444
428 3300046516 Ga0495628_0026747 Ga0495628_0026747_2943_4355 444
429 3300046559 Ga0495667_0024978 Ga0495667_0024978_395_1807 444
430 3300047319 Ga0495674_0123969 Ga0495674_0123969_31_1443 444
431 3300047322 Ga0495680_0084308 Ga0495680_0084308_57_1469 444
432 3300047444 Ga0495675_0071560 Ga0495675_0071560_399_1811 444
433 3300048088 Ga0495602_0004291 Ga0495602_0004291_9778_11190 444
434 3300048924 Ga0496121_0008090 Ga0496121_0008090_8793_10193 444
435 3300049679 Ga0501249_003280 Ga0501249_003280_685_2085 444
436 3300050507 nmdc:mga05p37_29021_c1 nmdc:mga05p37_29021_c1_1890_3380 444
437 3300050512 nmdc:mga0n895_147475_c1 nmdc:mga0n895_147475_c1_763_2253 444
438 3300050513 nmdc:mga0rr50_5422_c1 nmdc:mga0rr50_5422_c1_5203_6693 444
439 3300050515 nmdc:mga0a205_69143_c1 nmdc:mga0a205_69143_c1_451_1941 444
440 3300053077 Ga0495601_0003438 Ga0495601_0003438_5052_6464 444
441 3300053111 Ga0500572_001267 Ga0500572_001267_1308_2702 444
442 3300053134 Ga0500658_0000015 Ga0500658_0000015_8215_9615 444
443 iso_pu_bacteria 2857618242 2857621489 444
444 iso_pu_bacteria 2919191525 2919192496 444
445 iso_pu_bacteria 8054307821 8054309405 444
446 3300005439 Ga0070711_100107448 Ga0070711_1001074482 445
447 3300005618 Ga0068864_100047627 Ga0068864_1000476272 445
448 3300035695 Ga0373927_0074168 Ga0373927_0074168_119_1576 445
449 3300049571 Ga0501034_0128786 Ga0501034_0128786_21_1412 445
450 3300031548 Ga0307408_100020500 Ga0307408_1000205004 446
451 3300031616 Ga0307508_10150367 Ga0307508_101503671 446
452 3300031852 Ga0307410_10002547 Ga0307410_100025472 446
453 3300031901 Ga0307406_10014287 Ga0307406_100142874 446
454 3300031903 Ga0307407_10001800 Ga0307407_100018008 446
455 3300031911 Ga0307412_10017513 Ga0307412_100175134 446
456 3300031995 Ga0307409_100011608 Ga0307409_1000116085 446
457 3300032004 Ga0307414_10003567 Ga0307414_100035675 446
458 3300032005 Ga0307411_10047461 Ga0307411_100474612 446
459 3300046559 Ga0495667_0000019 Ga0495667_0000019_46869_48251 446
460 3300046660 Ga0495625_0000109 Ga0495625_0000109_6990_8366 446
461 3300047321 Ga0495676_0006190 Ga0495676_0006190_3241_4641 446
462 3300047322 Ga0495680_0001765 Ga0495680_0001765_3607_4989 446
463 3300005618 Ga0068864_100000024 Ga0068864_100000024211 447
464 3300026095 Ga0207676_10000048 Ga0207676_1000004842 447
465 3300031727 Ga0316576_10028532 Ga0316576_100285324 447
466 3300035170 Ga0373943_0076020 Ga0373943_0076020_157_1584 447
467 3300035725 Ga0373947_0038902 Ga0373947_0038902_673_2100 447
468 3300036712 Ga0316584_0091485 Ga0316584_0091485_680_2119 447
469 3300005329 Ga0070683_100149948 Ga0070683_1001499481 448
470 3300005435 Ga0070714_100042155 Ga0070714_1000421553 448
471 3300006846 Ga0075430_100041844 Ga0075430_1000418443 448
472 3300025929 Ga0207664_10051885 Ga0207664_100518852 448
473 3300031665 Ga0316575_10001075 Ga0316575_100010754 448
474 3300031691 Ga0316579_10005583 Ga0316579_100055831 448
475 3300031727 Ga0316576_10012627 Ga0316576_100126274 448
476 3300031728 Ga0316578_10014810 Ga0316578_100148103 448
477 3300032137 Ga0316585_10003725 Ga0316585_100037253 448
478 3300032139 Ga0316580_10001868 Ga0316580_100018683 448
479 3300048911 Ga0496108_0045656 Ga0496108_0045656_191_1618 448
480 3300048914 Ga0496111_0160691 Ga0496111_0160691_162_1589 448
481 3300003373 JGI25407J50210_10006261 JGI25407J50210_100062613 449
482 3300005471 Ga0070698_100031035 Ga0070698_1000310354 449
483 3300005981 Ga0081538_10000023 Ga0081538_100000239 449
484 3300009098 Ga0105245_10236092 Ga0105245_102360921 449
485 3300026089 Ga0207648_10005519 Ga0207648_1000551920 449
486 3300038443 Ga0395901_0161922 Ga0395901_0161922_684_2078 449
487 3300044694 Ga0466963_0004575 Ga0466963_0004575_3994_5379 449
488 3300048914 Ga0496111_0057454 Ga0496111_0057454_1093_2478 449
489 iso_pu_bacteria 2818991458 2819667620 449
490 3300005337 Ga0070682_100020489 Ga0070682_1000204894 450
491 3300005719 Ga0068861_100055131 Ga0068861_1000551315 450
492 3300005983 Ga0081540_1007808 Ga0081540_10078087 450
493 3300013306 Ga0163162_10014212 Ga0163162_100142123 450
494 3300017792 Ga0163161_10047150 Ga0163161_100471505 450
495 3300025899 Ga0207642_10021960 Ga0207642_100219602 450
496 3300025924 Ga0207694_10076077 Ga0207694_100760772 450
497 3300025961 Ga0207712_10018506 Ga0207712_100185063 450
498 3300026067 Ga0207678_10145917 Ga0207678_101459172 450
499 3300037418 Ga0395900_0111834 Ga0395900_0111834_79_1506 450
500 3300048903 Ga0496100_0006389 Ga0496100_0006389_2400_3851 450
501 3300048905 Ga0496102_0029102 Ga0496102_0029102_2329_3780 450
502 3300048906 Ga0496103_0074041 Ga0496103_0074041_114_1565 450
503 3300048917 Ga0496114_0013045 Ga0496114_0013045_4432_5883 450
504 3300048918 Ga0496115_0022266 Ga0496115_0022266_1573_3024 450
505 iso_pu_bacteria 2939657138 2939658176 450
506 3300005842 Ga0068858_100081825 Ga0068858_1000818254 451
507 3300014968 Ga0157379_10140789 Ga0157379_101407893 451
508 3300035725 Ga0373947_0120244 Ga0373947_0120244_70_1557 451
509 3300038996 Ga0242420_000347 Ga0242420_000347_1996_3375 451
510 3300048907 Ga0496104_0029165 Ga0496104_0029165_98_1585 451
511 3300048907 Ga0496104_0181132 Ga0496104_0181132_192_1589 451
512 3300048908 Ga0496105_0123184 Ga0496105_0123184_618_2015 451
513 3300048911 Ga0496108_0050063 Ga0496108_0050063_485_1972 451
514 3300048912 Ga0496109_0128724 Ga0496109_0128724_475_1962 451
515 3300048922 Ga0496119_0007790 Ga0496119_0007790_7964_9361 451
516 3300048924 Ga0496121_0161553 Ga0496121_0161553_181_1578 451
517 iso_pu_bacteria 2818991462 2819690921 451
518 iso_pu_bacteria 2818991469 2819727738 451
519 3300005367 Ga0070667_100000597 Ga0070667_10000059728 452
520 3300005439 Ga0070711_100054959 Ga0070711_1000549592 452
521 3300005468 Ga0070707_100138905 Ga0070707_1001389053 452
522 3300005530 Ga0070679_100041121 Ga0070679_1000411212 452
523 3300005546 Ga0070696_100107322 Ga0070696_1001073222 452
524 3300005548 Ga0070665_100018108 Ga0070665_1000181086 452
525 3300005563 Ga0068855_100016708 Ga0068855_1000167086 452
526 3300005844 Ga0068862_100000366 Ga0068862_10000036633 452
527 3300006028 Ga0070717_10003906 Ga0070717_100039064 452
528 3300006175 Ga0070712_100158695 Ga0070712_1001586951 452
529 3300009093 Ga0105240_10032970 Ga0105240_100329705 452
530 3300009098 Ga0105245_10069086 Ga0105245_100690861 452
531 3300009551 Ga0105238_10152433 Ga0105238_101524332 452
532 3300010375 Ga0105239_10103632 Ga0105239_101036322 452
533 3300013105 Ga0157369_10033435 Ga0157369_100334352 452
534 3300013307 Ga0157372_10309031 Ga0157372_103090312 452
535 3300025913 Ga0207695_10003637 Ga0207695_1000363718 452
536 3300025917 Ga0207660_10085054 Ga0207660_100850542 452
537 3300025944 Ga0207661_10023477 Ga0207661_100234775 452
538 3300025986 Ga0207658_10000465 Ga0207658_1000046527 452
539 3300026035 Ga0207703_10121530 Ga0207703_101215303 452
540 3300026078 Ga0207702_10063186 Ga0207702_100631863 452
541 3300028379 Ga0268266_10161541 Ga0268266_101615413 452
542 3300028380 Ga0268265_10001048 Ga0268265_100010485 452
543 3300045976 Ga0466967_0077622 Ga0466967_0077622_1411_2820 452
544 3300048907 Ga0496104_0154114 Ga0496104_0154114_429_1850 452
545 3300048908 Ga0496105_0007781 Ga0496105_0007781_1344_2765 452
546 3300048908 Ga0496105_0011873 Ga0496105_0011873_5181_6638 452
547 3300048911 Ga0496108_0029554 Ga0496108_0029554_1563_2972 452
548 3300048912 Ga0496109_0066426 Ga0496109_0066426_1543_2982 452
549 3300048914 Ga0496111_0014676 Ga0496111_0014676_2556_3995 452
550 3300053085 Ga0495619_0021921 Ga0495619_0021921_1752_3158 452
551 3300053104 Ga0500556_0001512 Ga0500556_0001512_1735_3162 452
552 3300053153 Ga0500616_0011561 Ga0500616_0011561_1706_3133 452
553 iso_pu_bacteria 2811994882 2812372081 452
554 3300005844 Ga0068862_100200344 Ga0068862_1002003442 453
555 3300048906 Ga0496103_0053282 Ga0496103_0053282_846_2327 453
556 3300005435 Ga0070714_100046135 Ga0070714_1000461352 454
557 3300005436 Ga0070713_100005405 Ga0070713_1000054052 454
558 3300005459 Ga0068867_100008485 Ga0068867_1000084852 454
559 3300005518 Ga0070699_100000043 Ga0070699_100000043111 454
560 3300005535 Ga0070684_100010636 Ga0070684_1000106366 454
561 3300005535 Ga0070684_100062282 Ga0070684_1000622823 454
562 3300005546 Ga0070696_100088208 Ga0070696_1000882082 454
563 3300005577 Ga0068857_100017156 Ga0068857_1000171562 454
564 3300005614 Ga0068856_100003506 Ga0068856_10000350616 454
565 3300005615 Ga0070702_100123530 Ga0070702_1001235301 454
566 3300006880 Ga0075429_100116021 Ga0075429_1001160212 454
567 3300009094 Ga0111539_10030024 Ga0111539_100300242 454
568 3300009147 Ga0114129_10079769 Ga0114129_100797694 454
569 3300009148 Ga0105243_10003685 Ga0105243_100036859 454
570 3300009174 Ga0105241_10068171 Ga0105241_100681711 454
571 3300009176 Ga0105242_10018440 Ga0105242_100184404 454
572 3300009177 Ga0105248_10066247 Ga0105248_100662472 454
573 3300009545 Ga0105237_10028453 Ga0105237_100284532 454
574 3300009551 Ga0105238_10019629 Ga0105238_100196294 454
575 3300009553 Ga0105249_10002508 Ga0105249_1000250812 454
576 3300011119 Ga0105246_10033619 Ga0105246_100336192 454
577 3300013105 Ga0157369_10009457 Ga0157369_100094576 454
578 3300013105 Ga0157369_10069460 Ga0157369_100694604 454
579 3300013306 Ga0163162_10014551 Ga0163162_100145515 454
580 3300013308 Ga0157375_10103526 Ga0157375_101035261 454
581 3300014326 Ga0157380_10018093 Ga0157380_100180935 454
582 3300017792 Ga0163161_10055314 Ga0163161_100553143 454
583 3300020069 Ga0197907_10292294 Ga0197907_102922941 454
584 3300020077 Ga0206351_10206386 Ga0206351_102063861 454
585 3300020078 Ga0206352_11357117 Ga0206352_113571171 454
586 3300025929 Ga0207664_10022821 Ga0207664_100228215 454
587 3300025944 Ga0207661_10060629 Ga0207661_100606291 454
588 3300026078 Ga0207702_10050195 Ga0207702_100501952 454
589 3300026089 Ga0207648_10003682 Ga0207648_1000368212 454
590 3300026116 Ga0207674_10001090 Ga0207674_1000109027 454
591 3300035170 Ga0373943_0023348 Ga0373943_0023348_398_1855 454
592 3300035725 Ga0373947_0058616 Ga0373947_0058616_445_1902 454
593 3300036712 Ga0316584_0051911 Ga0316584_0051911_267_1676 454
594 3300037068 Ga0373925_0037510 Ga0373925_0037510_1151_2548 454
595 3300046459 Ga0495629_0088760 Ga0495629_0088760_631_2055 454
596 3300046461 Ga0495641_0000742 Ga0495641_0000742_21016_22440 454
597 3300046461 Ga0495641_0018240 Ga0495641_0018240_1647_3038 454
598 3300046473 Ga0495582_0025352 Ga0495582_0025352_41_1498 454
599 3300046476 Ga0495662_0035185 Ga0495662_0035185_850_2274 454
600 3300046516 Ga0495628_0077467 Ga0495628_0077467_28_1485 454
601 3300046543 Ga0495645_0025818 Ga0495645_0025818_618_2015 454
602 3300046680 Ga0495646_0026385 Ga0495646_0026385_1392_2789 454
603 3300046681 Ga0495647_0044345 Ga0495647_0044345_253_1644 454
604 3300046683 Ga0495658_0002011 Ga0495658_0002011_2851_4275 454
605 3300046809 Ga0495600_0057945 Ga0495600_0057945_353_1750 454
606 3300047315 Ga0495581_0000642 Ga0495581_0000642_6415_7806 454
607 3300047315 Ga0495581_0010170 Ga0495581_0010170_3577_4980 454
608 3300047319 Ga0495674_0005612 Ga0495674_0005612_3077_4468 454
609 3300047321 Ga0495676_0066007 Ga0495676_0066007_1132_2523 454
610 3300047472 Ga0495686_0104501 Ga0495686_0104501_101_1516 454
611 3300048903 Ga0496100_0011308 Ga0496100_0011308_2657_4060 454
612 3300048905 Ga0496102_0037880 Ga0496102_0037880_2532_3935 454
613 3300048908 Ga0496105_0037207 Ga0496105_0037207_1759_3156 454
614 3300048908 Ga0496105_0106059 Ga0496105_0106059_718_2121 454
615 3300048909 Ga0496106_0002498 Ga0496106_0002498_11705_13108 454
616 3300048909 Ga0496106_0215607 Ga0496106_0215607_88_1485 454
617 3300048911 Ga0496108_0065269 Ga0496108_0065269_1474_2871 454
618 3300048912 Ga0496109_0011911 Ga0496109_0011911_710_2107 454
619 3300048912 Ga0496109_0085910 Ga0496109_0085910_219_1622 454
620 3300048913 Ga0496110_0010762 Ga0496110_0010762_648_2045 454
621 3300048913 Ga0496110_0187494 Ga0496110_0187494_298_1701 454
622 3300048915 Ga0496112_0098819 Ga0496112_0098819_1465_2862 454
623 3300048917 Ga0496114_0003903 Ga0496114_0003903_422_1813 454
624 3300048917 Ga0496114_0132957 Ga0496114_0132957_434_1837 454
625 3300048918 Ga0496115_0001724 Ga0496115_0001724_412_1803 454
626 3300048918 Ga0496115_0037757 Ga0496115_0037757_1190_2587 454
627 3300049569 Ga0501032_0004690 Ga0501032_0004690_1792_3264 454
628 3300049570 Ga0501033_0099214 Ga0501033_0099214_415_1887 454
629 3300049571 Ga0501034_0009420 Ga0501034_0009420_7018_8490 454
630 3300049572 Ga0501036_0046408 Ga0501036_0046408_1964_3436 454
631 3300049574 Ga0501038_0016446 Ga0501038_0016446_1701_3173 454
632 3300049575 Ga0501039_0030969 Ga0501039_0030969_129_1601 454
633 3300049580 Ga0501046_0045753 Ga0501046_0045753_1952_3424 454
634 3300049581 Ga0501047_0182365 Ga0501047_0182365_454_1926 454
635 3300050507 nmdc:mga05p37_10540_c1 nmdc:mga05p37_10540_c1_2508_3905 454
636 3300050508 nmdc:mga09592_111263_c1 nmdc:mga09592_111263_c1_457_1854 454
637 3300050509 nmdc:mga0qj67_100862_c1 nmdc:mga0qj67_100862_c1_779_2176 454
638 3300050510 nmdc:mga06r32_11724_c1 nmdc:mga06r32_11724_c1_5725_7122 454
639 3300050511 nmdc:mga08y16_27181_c1 nmdc:mga08y16_27181_c1_2316_3713 454
640 3300050512 nmdc:mga0n895_191761_c1 nmdc:mga0n895_191761_c1_56_1477 454
641 3300050512 nmdc:mga0n895_38576_c1 nmdc:mga0n895_38576_c1_805_2202 454
642 3300050512 nmdc:mga0n895_4006_c1 nmdc:mga0n895_4006_c1_3216_4673 454
643 3300050513 nmdc:mga0rr50_10917_c1 nmdc:mga0rr50_10917_c1_511_1968 454
644 3300050513 nmdc:mga0rr50_26236_c1 nmdc:mga0rr50_26236_c1_1538_2959 454
645 3300050513 nmdc:mga0rr50_60781_c1 nmdc:mga0rr50_60781_c1_323_1720 454
646 3300050515 nmdc:mga0a205_18213_c1 nmdc:mga0a205_18213_c1_812_2209 454
647 3300005341 Ga0070691_10012578 Ga0070691_100125784 455
648 3300005435 Ga0070714_100133144 Ga0070714_1001331441 455
649 3300005439 Ga0070711_100025477 Ga0070711_1000254772 455
650 3300005439 Ga0070711_100050791 Ga0070711_1000507912 455
651 3300005441 Ga0070700_100018773 Ga0070700_1000187733 455
652 3300005457 Ga0070662_100047016 Ga0070662_1000470162 455
653 3300005539 Ga0068853_100063625 Ga0068853_1000636252 455
654 3300005544 Ga0070686_100076181 Ga0070686_1000761812 455
655 3300005719 Ga0068861_100176098 Ga0068861_1001760982 455
656 3300006175 Ga0070712_100027943 Ga0070712_1000279433 455
657 3300006846 Ga0075430_100041483 Ga0075430_1000414832 455
658 3300009177 Ga0105248_10127493 Ga0105248_101274933 455
659 3300009545 Ga0105237_10226999 Ga0105237_102269992 455
660 3300013308 Ga0157375_10086370 Ga0157375_100863703 455
661 3300022467 Ga0224712_10004327 Ga0224712_100043273 455
662 3300025915 Ga0207693_10131025 Ga0207693_101310251 455
663 3300025916 Ga0207663_10128601 Ga0207663_101286011 455
664 3300025918 Ga0207662_10056488 Ga0207662_100564882 455
665 3300025933 Ga0207706_10018736 Ga0207706_100187365 455
666 3300026035 Ga0207703_10246477 Ga0207703_102464771 455
667 3300026075 Ga0207708_10020425 Ga0207708_100204253 455
668 3300026118 Ga0207675_100088285 Ga0207675_1000882852 455
669 3300031727 Ga0316576_10001067 Ga0316576_1000106710 455
670 3300036712 Ga0316584_0139184 Ga0316584_0139184_191_1591 455
671 3300046678 Ga0495599_0023499 Ga0495599_0023499_396_1856 455
672 3300046678 Ga0495599_0054268 Ga0495599_0054268_169_1575 455
673 3300047471 Ga0495684_0001716 Ga0495684_0001716_2308_3819 455
674 3300049585 Ga0501069_0000387 Ga0501069_0000387_10458_11873 455
675 3300049586 Ga0501070_0006896 Ga0501070_0006896_7659_9074 455
676 3300050509 nmdc:mga0qj67_21097_c1 nmdc:mga0qj67_21097_c1_2304_3725 455
677 3300005329 Ga0070683_100000558 Ga0070683_10000055814 456
678 3300005439 Ga0070711_100031448 Ga0070711_1000314482 456
679 3300005535 Ga0070684_100011666 Ga0070684_1000116663 456
680 3300005548 Ga0070665_100000106 Ga0070665_100000106102 456
681 3300005564 Ga0070664_100163711 Ga0070664_1001637112 456
682 3300025904 Ga0207647_10055729 Ga0207647_100557291 456
683 3300025916 Ga0207663_10005201 Ga0207663_100052017 456
684 3300025944 Ga0207661_10000896 Ga0207661_100008968 456
685 3300028556 Ga0265337_1000060 Ga0265337_100006012 456
686 3300028558 Ga0265326_10000056 Ga0265326_1000005625 456
687 3300028654 Ga0265322_10000017 Ga0265322_1000001771 456
688 3300029957 Ga0265324_10000196 Ga0265324_100001964 456
689 3300031238 Ga0265332_10022481 Ga0265332_100224812 456
690 3300031239 Ga0265328_10000258 Ga0265328_100002581 456
691 3300031240 Ga0265320_10000068 Ga0265320_1000006853 456
692 3300031242 Ga0265329_10001686 Ga0265329_100016867 456
693 3300031250 Ga0265331_10000606 Ga0265331_1000060611 456
694 3300031251 Ga0265327_10000317 Ga0265327_1000031753 456
695 3300031344 Ga0265316_10034806 Ga0265316_100348062 456
696 3300031456 Ga0307513_10201135 Ga0307513_102011352 456
697 3300031711 Ga0265314_10000973 Ga0265314_100009739 456
698 3300035089 Ga0373944_0000201 Ga0373944_0000201_6325_7818 456
699 3300035113 Ga0373936_0001199 Ga0373936_0001199_7420_8913 456
700 3300035116 Ga0373945_0000115 Ga0373945_0000115_6738_8231 456
701 3300035170 Ga0373943_0000129 Ga0373943_0000129_23244_24737 456
702 3300035171 Ga0373946_0000428 Ga0373946_0000428_3702_5195 456
703 3300035692 Ga0373935_0000628 Ga0373935_0000628_8322_9815 456
704 3300035725 Ga0373947_0000901 Ga0373947_0000901_9861_11354 456
705 3300037068 Ga0373925_0003472 Ga0373925_0003472_1597_3090 456
706 3300046461 Ga0495641_0000044 Ga0495641_0000044_66279_67682 456
707 3300046461 Ga0495641_0038696 Ga0495641_0038696_596_2089 456
708 3300046463 Ga0495653_0013842 Ga0495653_0013842_3866_5359 456
709 3300046477 Ga0495664_0001885 Ga0495664_0001885_5220_6713 456
710 3300046511 Ga0495608_0093071 Ga0495608_0093071_336_1739 456
711 3300046531 Ga0495665_0025665 Ga0495665_0025665_481_1974 456
712 3300046543 Ga0495645_0087386 Ga0495645_0087386_346_1746 456
713 3300046559 Ga0495667_0000786 Ga0495667_0000786_16839_18332 456
714 3300046663 Ga0495635_0007795 Ga0495635_0007795_3943_5436 456
715 3300046690 Ga0495624_0018620 Ga0495624_0018620_1213_2706 456
716 3300047321 Ga0495676_0000928 Ga0495676_0000928_14541_15914 456
717 3300047321 Ga0495676_0004043 Ga0495676_0004043_7899_9392 456
718 3300047322 Ga0495680_0001641 Ga0495680_0001641_15225_16625 456
719 3300047322 Ga0495680_0005698 Ga0495680_0005698_1672_3165 456
720 3300047471 Ga0495684_0001870 Ga0495684_0001870_9042_10535 456
721 3300048903 Ga0496100_0000019 Ga0496100_0000019_119576_120949 456
722 3300048904 Ga0496101_0000005 Ga0496101_0000005_119576_120949 456
723 3300048909 Ga0496106_0000033 Ga0496106_0000033_69565_70938 456
724 3300048910 Ga0496107_0000004 Ga0496107_0000004_119793_121166 456
725 3300048913 Ga0496110_0013223 Ga0496110_0013223_3931_5331 456
726 3300048916 Ga0496113_0096997 Ga0496113_0096997_488_1891 456
727 3300048917 Ga0496114_0000003 Ga0496114_0000003_270290_271663 456
728 3300048918 Ga0496115_0032311 Ga0496115_0032311_2154_3527 456
729 3300053077 Ga0495601_0000124 Ga0495601_0000124_28298_29701 456
730 3300053123 Ga0500614_000117 Ga0500614_000117_12545_13948 456
731 3300005329 Ga0070683_100028383 Ga0070683_1000283833 457
732 3300005337 Ga0070682_100134408 Ga0070682_1001344081 457
733 3300005341 Ga0070691_10000100 Ga0070691_1000010015 457
734 3300005347 Ga0070668_100027645 Ga0070668_1000276453 457
735 3300005354 Ga0070675_100086774 Ga0070675_1000867742 457
736 3300005366 Ga0070659_100012095 Ga0070659_1000120952 457
737 3300005435 Ga0070714_100003174 Ga0070714_1000031744 457
738 3300005435 Ga0070714_100004997 Ga0070714_1000049977 457
739 3300005435 Ga0070714_100019304 Ga0070714_1000193046 457
740 3300005435 Ga0070714_100019464 Ga0070714_1000194642 457
741 3300005436 Ga0070713_100032866 Ga0070713_1000328662 457
742 3300005437 Ga0070710_10000267 Ga0070710_1000026713 457
743 3300005437 Ga0070710_10022888 Ga0070710_100228885 457
744 3300005437 Ga0070710_10028899 Ga0070710_100288992 457
745 3300005438 Ga0070701_10010033 Ga0070701_100100332 457
746 3300005439 Ga0070711_100000788 Ga0070711_1000007888 457
747 3300005439 Ga0070711_100011244 Ga0070711_1000112441 457
748 3300005441 Ga0070700_100010097 Ga0070700_1000100972 457
749 3300005441 Ga0070700_100052626 Ga0070700_1000526262 457
750 3300005444 Ga0070694_100076615 Ga0070694_1000766152 457
751 3300005445 Ga0070708_100184572 Ga0070708_1001845721 457
752 3300005455 Ga0070663_100036784 Ga0070663_1000367842 457
753 3300005457 Ga0070662_100154358 Ga0070662_1001543581 457
754 3300005459 Ga0068867_100002154 Ga0068867_1000021542 457
755 3300005466 Ga0070685_10007229 Ga0070685_100072292 457
756 3300005467 Ga0070706_100025104 Ga0070706_1000251042 457
757 3300005471 Ga0070698_100037283 Ga0070698_1000372832 457
758 3300005536 Ga0070697_100021855 Ga0070697_1000218554 457
759 3300005544 Ga0070686_100029552 Ga0070686_1000295522 457
760 3300005548 Ga0070665_100006680 Ga0070665_1000066809 457
761 3300005577 Ga0068857_100115106 Ga0068857_1001151062 457
762 3300005614 Ga0068856_100014872 Ga0068856_1000148725 457
763 3300005614 Ga0068856_100109819 Ga0068856_1001098193 457
764 3300005616 Ga0068852_100008106 Ga0068852_1000081063 457
765 3300005841 Ga0068863_100016249 Ga0068863_1000162492 457
766 3300005843 Ga0068860_100078060 Ga0068860_1000780602 457
767 3300005983 Ga0081540_1000181 Ga0081540_100018122 457
768 3300005985 Ga0081539_10001052 Ga0081539_1000105249 457
769 3300006028 Ga0070717_10000006 Ga0070717_1000000698 457
770 3300006028 Ga0070717_10008176 Ga0070717_100081766 457
771 3300006173 Ga0070716_100001363 Ga0070716_1000013635 457
772 3300006175 Ga0070712_100003227 Ga0070712_1000032275 457
773 3300006175 Ga0070712_100019601 Ga0070712_1000196014 457
774 3300006237 Ga0097621_100011114 Ga0097621_1000111148 457
775 3300006237 Ga0097621_100140573 Ga0097621_1001405731 457
776 3300006358 Ga0068871_100034036 Ga0068871_1000340362 457
777 3300006358 Ga0068871_100040731 Ga0068871_1000407314 457
778 3300006358 Ga0068871_100041886 Ga0068871_1000418863 457
779 3300006844 Ga0075428_100022812 Ga0075428_1000228127 457
780 3300006846 Ga0075430_100011868 Ga0075430_10001186810 457
781 3300006846 Ga0075430_100113457 Ga0075430_1001134571 457
782 3300006847 Ga0075431_100000685 Ga0075431_1000006853 457
783 3300006852 Ga0075433_10016860 Ga0075433_100168605 457
784 3300006871 Ga0075434_100004695 Ga0075434_10000469511 457
785 3300006871 Ga0075434_100228529 Ga0075434_1002285291 457
786 3300006881 Ga0068865_100003061 Ga0068865_10000306111 457
787 3300006881 Ga0068865_100094754 Ga0068865_1000947541 457
788 3300007076 Ga0075435_100010048 Ga0075435_1000100487 457
789 3300007076 Ga0075435_100122502 Ga0075435_1001225021 457
790 3300009093 Ga0105240_10192408 Ga0105240_101924082 457
791 3300009098 Ga0105245_10073817 Ga0105245_100738173 457
792 3300009176 Ga0105242_10001159 Ga0105242_1000115918 457
793 3300009176 Ga0105242_10016636 Ga0105242_100166363 457
794 3300009553 Ga0105249_10009694 Ga0105249_100096947 457
795 3300010375 Ga0105239_10033703 Ga0105239_100337034 457
796 3300013102 Ga0157371_10049289 Ga0157371_100492892 457
797 3300013104 Ga0157370_10033202 Ga0157370_100332022 457
798 3300013306 Ga0163162_10025640 Ga0163162_100256402 457
799 3300013306 Ga0163162_10205614 Ga0163162_102056141 457
800 3300013307 Ga0157372_10008824 Ga0157372_100088243 457
801 3300013308 Ga0157375_10004006 Ga0157375_100040064 457
802 3300014968 Ga0157379_10018892 Ga0157379_100188924 457
803 3300014969 Ga0157376_10004119 Ga0157376_100041194 457
804 3300025898 Ga0207692_10004714 Ga0207692_100047143 457
805 3300025898 Ga0207692_10006213 Ga0207692_100062134 457
806 3300025901 Ga0207688_10069458 Ga0207688_100694581 457
807 3300025904 Ga0207647_10051955 Ga0207647_100519552 457
808 3300025906 Ga0207699_10003875 Ga0207699_100038755 457
809 3300025910 Ga0207684_10208636 Ga0207684_102086361 457
810 3300025915 Ga0207693_10001273 Ga0207693_1000127310 457
811 3300025915 Ga0207693_10003950 Ga0207693_100039508 457
812 3300025915 Ga0207693_10015101 Ga0207693_100151012 457
813 3300025916 Ga0207663_10016114 Ga0207663_100161144 457
814 3300025916 Ga0207663_10066960 Ga0207663_100669602 457
815 3300025916 Ga0207663_10080764 Ga0207663_100807642 457
816 3300025919 Ga0207657_10012567 Ga0207657_100125673 457
817 3300025922 Ga0207646_10082643 Ga0207646_100826432 457
818 3300025922 Ga0207646_10104150 Ga0207646_101041502 457
819 3300025927 Ga0207687_10176006 Ga0207687_101760062 457
820 3300025928 Ga0207700_10005015 Ga0207700_100050155 457
821 3300025928 Ga0207700_10012605 Ga0207700_100126053 457
822 3300025929 Ga0207664_10003838 Ga0207664_100038384 457
823 3300025929 Ga0207664_10005028 Ga0207664_100050284 457
824 3300025929 Ga0207664_10007360 Ga0207664_100073606 457
825 3300025929 Ga0207664_10008030 Ga0207664_100080307 457
826 3300025929 Ga0207664_10012014 Ga0207664_100120143 457
827 3300025929 Ga0207664_10097511 Ga0207664_100975112 457
828 3300025933 Ga0207706_10005339 Ga0207706_100053392 457
829 3300025934 Ga0207686_10000035 Ga0207686_1000003520 457
830 3300025934 Ga0207686_10001551 Ga0207686_100015517 457
831 3300025935 Ga0207709_10001318 Ga0207709_100013184 457
832 3300025935 Ga0207709_10068835 Ga0207709_100688351 457
833 3300025935 Ga0207709_10117364 Ga0207709_101173642 457
834 3300025938 Ga0207704_10006123 Ga0207704_100061233 457
835 3300025938 Ga0207704_10102160 Ga0207704_101021601 457
836 3300025939 Ga0207665_10001498 Ga0207665_1000149811 457
837 3300025939 Ga0207665_10039692 Ga0207665_100396922 457
838 3300025961 Ga0207712_10064710 Ga0207712_100647101 457
839 3300026075 Ga0207708_10002772 Ga0207708_100027723 457
840 3300026075 Ga0207708_10017990 Ga0207708_100179904 457
841 3300026078 Ga0207702_10085384 Ga0207702_100853842 457
842 3300026088 Ga0207641_10011889 Ga0207641_100118896 457
843 3300026089 Ga0207648_10003623 Ga0207648_1000362313 457
844 3300026118 Ga0207675_100234454 Ga0207675_1002344542 457
845 3300026121 Ga0207683_10000941 Ga0207683_1000094121 457
846 3300026142 Ga0207698_10008521 Ga0207698_100085214 457
847 3300026142 Ga0207698_10099693 Ga0207698_100996931 457
848 3300027907 Ga0207428_10001212 Ga0207428_100012127 457
849 3300035083 Ga0373926_0000085 Ga0373926_0000085_7661_9139 457
850 3300035086 Ga0373934_0004651 Ga0373934_0004651_1784_3295 457
851 3300035111 Ga0373923_0000654 Ga0373923_0000654_6915_8393 457
852 3300035113 Ga0373936_0019069 Ga0373936_0019069_1006_2511 457
853 3300035116 Ga0373945_0000374 Ga0373945_0000374_3278_4756 457
854 3300035117 Ga0373953_0000290 Ga0373953_0000290_7615_9168 457
855 3300035117 Ga0373953_0001319 Ga0373953_0001319_2531_4009 457
856 3300035118 Ga0373954_0000277 Ga0373954_0000277_10388_11941 457
857 3300035118 Ga0373954_0006958 Ga0373954_0006958_334_1812 457
858 3300035119 Ga0373956_0000733 Ga0373956_0000733_11252_12805 457
859 3300035120 Ga0373957_0000032 Ga0373957_0000032_24400_25953 457
860 3300035120 Ga0373957_0009644 Ga0373957_0009644_1615_3093 457
861 3300035170 Ga0373943_0003042 Ga0373943_0003042_767_2245 457
862 3300035171 Ga0373946_0000709 Ga0373946_0000709_603_2081 457
863 3300035172 Ga0373955_0000092 Ga0373955_0000092_2894_4447 457
864 3300035172 Ga0373955_0026927 Ga0373955_0026927_1396_2901 457
865 3300035172 Ga0373955_0030615 Ga0373955_0030615_373_1851 457
866 3300035410 Ga0373924_0000555 Ga0373924_0000555_3741_5219 457
867 3300035410 Ga0373924_0009457 Ga0373924_0009457_194_1699 457
868 3300035692 Ga0373935_0003273 Ga0373935_0003273_7516_8994 457
869 3300035695 Ga0373927_0004146 Ga0373927_0004146_8347_9825 457
870 3300035724 Ga0373933_0000121 Ga0373933_0000121_32531_34084 457
871 3300035725 Ga0373947_0003331 Ga0373947_0003331_7719_9197 457
872 3300036401 Ga0373937_0000169 Ga0373937_0000169_2894_4447 457
873 3300036401 Ga0373937_0018778 Ga0373937_0018778_1866_3371 457
874 3300036401 Ga0373937_0021306 Ga0373937_0021306_2676_4187 457
875 3300036401 Ga0373937_0057773 Ga0373937_0057773_607_2085 457
876 3300036401 Ga0373937_0116738 Ga0373937_0116738_373_1851 457
877 3300037068 Ga0373925_0002434 Ga0373925_0002434_7531_9009 457
878 3300037068 Ga0373925_0034931 Ga0373925_0034931_1299_2789 457
879 3300044694 Ga0466963_0000281 Ga0466963_0000281_10819_12276 457
880 3300045836 Ga0466958_0007766 Ga0466958_0007766_3211_4668 457
881 3300045976 Ga0466967_0003703 Ga0466967_0003703_4755_6212 457
882 3300046454 Ga0495592_0000070 Ga0495592_0000070_59149_60702 457
883 3300046454 Ga0495592_0003048 Ga0495592_0003048_4349_5854 457
884 3300046455 Ga0495603_0023570 Ga0495603_0023570_442_1920 457
885 3300046459 Ga0495629_0009244 Ga0495629_0009244_294_1670 457
886 3300046459 Ga0495629_0041398 Ga0495629_0041398_1317_2693 457
887 3300046461 Ga0495641_0004675 Ga0495641_0004675_7704_9182 457
888 3300046462 Ga0495651_0000042 Ga0495651_0000042_32554_34107 457
889 3300046462 Ga0495651_0002437 Ga0495651_0002437_6138_7643 457
890 3300046462 Ga0495651_0012581 Ga0495651_0012581_1670_3148 457
891 3300046462 Ga0495651_0066441 Ga0495651_0066441_458_1954 457
892 3300046462 Ga0495651_0126539 Ga0495651_0126539_169_1548 457
893 3300046463 Ga0495653_0000416 Ga0495653_0000416_18026_19579 457
894 3300046463 Ga0495653_0089525 Ga0495653_0089525_302_1780 457
895 3300046473 Ga0495582_0007328 Ga0495582_0007328_84_1562 457
896 3300046476 Ga0495662_0001224 Ga0495662_0001224_4048_5526 457
897 3300046477 Ga0495664_0006030 Ga0495664_0006030_984_2462 457
898 3300046499 Ga0495594_0000001 Ga0495594_0000001_156847_158226 457
899 3300046499 Ga0495594_0037340 Ga0495594_0037340_536_2014 457
900 3300046511 Ga0495608_0000054 Ga0495608_0000054_32554_34107 457
901 3300046511 Ga0495608_0027634 Ga0495608_0027634_2009_3487 457
902 3300046514 Ga0495618_0002174 Ga0495618_0002174_4529_6007 457
903 3300046516 Ga0495628_0000106 Ga0495628_0000106_29800_31353 457
904 3300046516 Ga0495628_0000548 Ga0495628_0000548_11650_13026 457
905 3300046516 Ga0495628_0008134 Ga0495628_0008134_2988_4493 457
906 3300046516 Ga0495628_0089313 Ga0495628_0089313_658_2037 457
907 3300046516 Ga0495628_0095682 Ga0495628_0095682_373_1851 457
908 3300046517 Ga0495630_0007970 Ga0495630_0007970_4551_6029 457
909 3300046526 Ga0495666_0001713 Ga0495666_0001713_7265_8743 457
910 3300046529 Ga0495652_0000119 Ga0495652_0000119_59134_60687 457
911 3300046529 Ga0495652_0012958 Ga0495652_0012958_1414_2919 457
912 3300046529 Ga0495652_0024428 Ga0495652_0024428_2704_4215 457
913 3300046529 Ga0495652_0036500 Ga0495652_0036500_461_1948 457
914 3300046529 Ga0495652_0057114 Ga0495652_0057114_1380_2858 457
915 3300046529 Ga0495652_0079778 Ga0495652_0079778_856_2235 457
916 3300046531 Ga0495665_0001874 Ga0495665_0001874_7076_8554 457
917 3300046533 Ga0495640_0002238 Ga0495640_0002238_6940_8418 457
918 3300046533 Ga0495640_0012252 Ga0495640_0012252_3995_5500 457
919 3300046535 Ga0495586_0011461 Ga0495586_0011461_1595_3073 457
920 3300046535 Ga0495586_0028610 Ga0495586_0028610_389_1894 457
921 3300046536 Ga0495587_0000119 Ga0495587_0000119_32554_34107 457
922 3300046536 Ga0495587_0000208 Ga0495587_0000208_31278_32783 457
923 3300046536 Ga0495587_0076226 Ga0495587_0076226_379_1755 457
924 3300046543 Ga0495645_0004517 Ga0495645_0004517_4697_6076 457
925 3300046543 Ga0495645_0009728 Ga0495645_0009728_444_1922 457
926 3300046543 Ga0495645_0014243 Ga0495645_0014243_3754_5151 457
927 3300046543 Ga0495645_0027180 Ga0495645_0027180_1745_3124 457
928 3300046543 Ga0495645_0050054 Ga0495645_0050054_392_1879 457
929 3300046557 Ga0495622_0000033 Ga0495622_0000033_69070_70449 457
930 3300046559 Ga0495667_0000253 Ga0495667_0000253_32554_34107 457
931 3300046559 Ga0495667_0004224 Ga0495667_0004224_6623_8101 457
932 3300046642 Ga0495634_0001902 Ga0495634_0001902_7591_9069 457
933 3300046642 Ga0495634_0003663 Ga0495634_0003663_10552_12057 457
934 3300046663 Ga0495635_0006237 Ga0495635_0006237_6384_7862 457
935 3300046675 Ga0495657_0000067 Ga0495657_0000067_32554_34107 457
936 3300046678 Ga0495599_0000042 Ga0495599_0000042_60806_62359 457
937 3300046678 Ga0495599_0003417 Ga0495599_0003417_5100_6578 457
938 3300046679 Ga0495623_0047400 Ga0495623_0047400_424_1935 457
939 3300046679 Ga0495623_0054890 Ga0495623_0054890_851_2404 457
940 3300046679 Ga0495623_0074173 Ga0495623_0074173_480_1958 457
941 3300046679 Ga0495623_0097522 Ga0495623_0097522_53_1531 457
942 3300046680 Ga0495646_0005486 Ga0495646_0005486_6289_7794 457
943 3300046680 Ga0495646_0009050 Ga0495646_0009050_444_1922 457
944 3300046680 Ga0495646_0014587 Ga0495646_0014587_1623_3176 457
945 3300046681 Ga0495647_0013226 Ga0495647_0013226_97_1575 457
946 3300046683 Ga0495658_0001583 Ga0495658_0001583_2597_4075 457
947 3300046689 Ga0495613_0007629 Ga0495613_0007629_961_2439 457
948 3300046689 Ga0495613_0107403 Ga0495613_0107403_237_1742 457
949 3300046690 Ga0495624_0002113 Ga0495624_0002113_10225_11703 457
950 3300046809 Ga0495600_0003523 Ga0495600_0003523_885_2438 457
951 3300046809 Ga0495600_0005898 Ga0495600_0005898_302_1780 457
952 3300047315 Ga0495581_0001959 Ga0495581_0001959_1357_2835 457
953 3300047317 Ga0495604_0000121 Ga0495604_0000121_59149_60702 457
954 3300047319 Ga0495674_0019676 Ga0495674_0019676_1632_3122 457
955 3300047319 Ga0495674_0059367 Ga0495674_0059367_879_2357 457
956 3300047321 Ga0495676_0003693 Ga0495676_0003693_8738_10216 457
957 3300047322 Ga0495680_0000054 Ga0495680_0000054_32543_34096 457
958 3300047322 Ga0495680_0020072 Ga0495680_0020072_3678_5156 457
959 3300047322 Ga0495680_0037660 Ga0495680_0037660_2469_3845 457
960 3300047444 Ga0495675_0000176 Ga0495675_0000176_25696_27249 457
961 3300047444 Ga0495675_0077140 Ga0495675_0077140_294_1772 457
962 3300047471 Ga0495684_0000562 Ga0495684_0000562_23564_25069 457
963 3300047471 Ga0495684_0008951 Ga0495684_0008951_5616_7094 457
964 3300047471 Ga0495684_0052690 Ga0495684_0052690_968_2479 457
965 3300047673 Ga0495593_0004833 Ga0495593_0004833_5986_7464 457
966 3300048088 Ga0495602_0000083 Ga0495602_0000083_32554_34107 457
967 3300048088 Ga0495602_0004572 Ga0495602_0004572_3530_4906 457
968 3300048088 Ga0495602_0034960 Ga0495602_0034960_984_2462 457
969 3300048088 Ga0495602_0038087 Ga0495602_0038087_2703_4214 457
970 3300048905 Ga0496102_0000021 Ga0496102_0000021_53645_55021 457
971 3300048906 Ga0496103_0000001 Ga0496103_0000001_540886_542262 457
972 3300048907 Ga0496104_0008695 Ga0496104_0008695_2381_3886 457
973 3300048908 Ga0496105_0013858 Ga0496105_0013858_3585_5090 457
974 3300048911 Ga0496108_0012519 Ga0496108_0012519_1211_2716 457
975 3300048911 Ga0496108_0045410 Ga0496108_0045410_80_1459 457
976 3300048913 Ga0496110_0035902 Ga0496110_0035902_1418_2797 457
977 3300048913 Ga0496110_0068392 Ga0496110_0068392_864_2369 457
978 3300048914 Ga0496111_0004675 Ga0496111_0004675_5803_7182 457
979 3300048914 Ga0496111_0047847 Ga0496111_0047847_963_2468 457
980 3300048915 Ga0496112_0026382 Ga0496112_0026382_119_1624 457
981 3300049578 Ga0501042_0007340 Ga0501042_0007340_1966_3342 457
982 3300053077 Ga0495601_0013142 Ga0495601_0013142_373_1851 457
983 3300053078 Ga0495612_0003172 Ga0495612_0003172_4235_5713 457
984 3300053078 Ga0495612_0010699 Ga0495612_0010699_2096_3472 457
985 3300053083 Ga0495655_0000008 Ga0495655_0000008_85522_86898 457
986 3300053084 Ga0495595_0001178 Ga0495595_0001178_8161_9714 457
987 3300053085 Ga0495619_0001863 Ga0495619_0001863_9060_10538 457
988 3300053085 Ga0495619_0009701 Ga0495619_0009701_2301_3806 457
989 3300053094 Ga0500566_0002923 Ga0500566_0002923_5180_6556 457
990 3300053129 Ga0500628_000023 Ga0500628_000023_40436_41812 457
991 3300001979 JGI24740J21852_10000802 JGI24740J21852_100008023 458
992 3300005329 Ga0070683_100002533 Ga0070683_1000025335 458
993 3300005329 Ga0070683_100039126 Ga0070683_1000391261 458
994 3300005334 Ga0068869_100021699 Ga0068869_1000216993 458
995 3300005336 Ga0070680_100059941 Ga0070680_1000599411 458
996 3300005337 Ga0070682_100062599 Ga0070682_1000625992 458
997 3300005339 Ga0070660_100011436 Ga0070660_1000114369 458
998 3300005340 Ga0070689_100033350 Ga0070689_1000333502 458
999 3300005341 Ga0070691_10014628 Ga0070691_100146282 458
1000 3300005345 Ga0070692_10018220 Ga0070692_100182201 458
1001 3300005345 Ga0070692_10107762 Ga0070692_101077621 458
1002 3300005353 Ga0070669_100014929 Ga0070669_1000149293 458
1003 3300005354 Ga0070675_100001463 Ga0070675_1000014639 458
1004 3300005354 Ga0070675_100013342 Ga0070675_1000133429 458
1005 3300005365 Ga0070688_100038237 Ga0070688_1000382373 458
1006 3300005366 Ga0070659_100000852 Ga0070659_1000008528 458
1007 3300005366 Ga0070659_100012543 Ga0070659_1000125437 458
1008 3300005367 Ga0070667_100183131 Ga0070667_1001831311 458
1009 3300005437 Ga0070710_10000002 Ga0070710_10000002158 458
1010 3300005441 Ga0070700_100005283 Ga0070700_1000052839 458
1011 3300005455 Ga0070663_100002472 Ga0070663_10000247215 458
1012 3300005455 Ga0070663_100134704 Ga0070663_1001347041 458
1013 3300005456 Ga0070678_100183952 Ga0070678_1001839521 458
1014 3300005457 Ga0070662_100013035 Ga0070662_1000130353 458
1015 3300005457 Ga0070662_100063899 Ga0070662_1000638994 458
1016 3300005535 Ga0070684_100006264 Ga0070684_1000062648 458
1017 3300005539 Ga0068853_100007231 Ga0068853_1000072313 458
1018 3300005543 Ga0070672_100013162 Ga0070672_1000131622 458
1019 3300005544 Ga0070686_100111680 Ga0070686_1001116801 458
1020 3300005547 Ga0070693_100009311 Ga0070693_1000093112 458
1021 3300005564 Ga0070664_100013358 Ga0070664_1000133588 458
1022 3300005564 Ga0070664_100017902 Ga0070664_1000179027 458
1023 3300005564 Ga0070664_100154820 Ga0070664_1001548201 458
1024 3300005578 Ga0068854_100004234 Ga0068854_10000423410 458
1025 3300005615 Ga0070702_100003799 Ga0070702_1000037995 458
1026 3300005616 Ga0068852_100080517 Ga0068852_1000805173 458
1027 3300005616 Ga0068852_100091270 Ga0068852_1000912702 458
1028 3300005616 Ga0068852_100119796 Ga0068852_1001197962 458
1029 3300005840 Ga0068870_10079616 Ga0068870_100796162 458
1030 3300005844 Ga0068862_100132971 Ga0068862_1001329712 458
1031 3300006051 Ga0075364_10017590 Ga0075364_100175903 458
1032 3300006881 Ga0068865_100005688 Ga0068865_10000568811 458
1033 3300009094 Ga0111539_10002876 Ga0111539_100028766 458
1034 3300009094 Ga0111539_10164550 Ga0111539_101645502 458
1035 3300009098 Ga0105245_10010376 Ga0105245_100103767 458
1036 3300009098 Ga0105245_10047423 Ga0105245_100474233 458
1037 3300009101 Ga0105247_10000369 Ga0105247_1000036930 458
1038 3300009148 Ga0105243_10005915 Ga0105243_100059156 458
1039 3300009148 Ga0105243_10017401 Ga0105243_100174013 458
1040 3300009176 Ga0105242_10176318 Ga0105242_101763182 458
1041 3300010375 Ga0105239_10009449 Ga0105239_100094498 458
1042 3300011119 Ga0105246_10018236 Ga0105246_100182361 458
1043 3300013308 Ga0157375_10003892 Ga0157375_100038926 458
1044 3300013308 Ga0157375_10016208 Ga0157375_100162086 458
1045 3300014745 Ga0157377_10001163 Ga0157377_100011638 458
1046 3300014745 Ga0157377_10005504 Ga0157377_100055045 458
1047 3300025898 Ga0207692_10000005 Ga0207692_1000000559 458
1048 3300025900 Ga0207710_10000227 Ga0207710_1000022712 458
1049 3300025901 Ga0207688_10006721 Ga0207688_100067212 458
1050 3300025907 Ga0207645_10039419 Ga0207645_100394192 458
1051 3300025909 Ga0207705_10013443 Ga0207705_100134437 458
1052 3300025911 Ga0207654_10091040 Ga0207654_100910401 458
1053 3300025919 Ga0207657_10005677 Ga0207657_1000567715 458
1054 3300025919 Ga0207657_10093682 Ga0207657_100936822 458
1055 3300025920 Ga0207649_10116054 Ga0207649_101160541 458
1056 3300025923 Ga0207681_10045347 Ga0207681_100453473 458
1057 3300025926 Ga0207659_10003884 Ga0207659_100038841 458
1058 3300025926 Ga0207659_10040587 Ga0207659_100405872 458
1059 3300025927 Ga0207687_10027279 Ga0207687_100272792 458
1060 3300025927 Ga0207687_10037166 Ga0207687_100371661 458
1061 3300025927 Ga0207687_10053621 Ga0207687_100536213 458
1062 3300025932 Ga0207690_10029423 Ga0207690_100294232 458
1063 3300025932 Ga0207690_10039765 Ga0207690_100397652 458
1064 3300025933 Ga0207706_10002554 Ga0207706_100025541 458
1065 3300025933 Ga0207706_10003441 Ga0207706_1000344115 458
1066 3300025935 Ga0207709_10035002 Ga0207709_100350021 458
1067 3300025936 Ga0207670_10021496 Ga0207670_100214962 458
1068 3300025937 Ga0207669_10020443 Ga0207669_100204435 458
1069 3300025940 Ga0207691_10003769 Ga0207691_1000376917 458
1070 3300025942 Ga0207689_10028298 Ga0207689_100282983 458
1071 3300025942 Ga0207689_10071506 Ga0207689_100715062 458
1072 3300025944 Ga0207661_10005047 Ga0207661_100050478 458
1073 3300025944 Ga0207661_10017682 Ga0207661_100176825 458
1074 3300025944 Ga0207661_10181926 Ga0207661_101819263 458
1075 3300025945 Ga0207679_10033544 Ga0207679_100335442 458
1076 3300025961 Ga0207712_10120762 Ga0207712_101207622 458
1077 3300025972 Ga0207668_10137382 Ga0207668_101373822 458
1078 3300026023 Ga0207677_10044985 Ga0207677_100449852 458
1079 3300026041 Ga0207639_10005344 Ga0207639_1000534411 458
1080 3300026067 Ga0207678_10003330 Ga0207678_100033302 458
1081 3300026067 Ga0207678_10013416 Ga0207678_100134169 458
1082 3300026075 Ga0207708_10013121 Ga0207708_100131213 458
1083 3300026089 Ga0207648_10074878 Ga0207648_100748781 458
1084 3300026116 Ga0207674_10025958 Ga0207674_100259584 458
1085 3300026118 Ga0207675_100036180 Ga0207675_1000361802 458
1086 3300026121 Ga0207683_10125432 Ga0207683_101254322 458
1087 3300026142 Ga0207698_10059113 Ga0207698_100591132 458
1088 3300026142 Ga0207698_10122177 Ga0207698_101221772 458
1089 3300028381 Ga0268264_10220509 Ga0268264_102205092 458
1090 3300028563 Ga0265319_1000037 Ga0265319_100003767 458
1091 3300028800 Ga0265338_10000051 Ga0265338_10000051168 458
1092 3300028800 Ga0265338_10175064 Ga0265338_101750641 458
1093 3300031250 Ga0265331_10004016 Ga0265331_100040165 458
1094 3300031251 Ga0265327_10063849 Ga0265327_100638491 458
1095 3300031712 Ga0265342_10094047 Ga0265342_100940471 458
1096 3300032126 Ga0307415_100009645 Ga0307415_1000096453 458
1097 3300046463 Ga0495653_0039619 Ga0495653_0039619_1683_3098 458
1098 3300046473 Ga0495582_0019734 Ga0495582_0019734_1234_2718 458
1099 3300046491 Ga0495584_0050343 Ga0495584_0050343_320_1762 458
1100 3300046511 Ga0495608_0005192 Ga0495608_0005192_4601_6013 458
1101 3300046516 Ga0495628_0143245 Ga0495628_0143245_99_1511 458
1102 3300046642 Ga0495634_0000018 Ga0495634_0000018_90428_91840 458
1103 3300047471 Ga0495684_0010104 Ga0495684_0010104_1103_2533 458
1104 3300048907 Ga0496104_0000029 Ga0496104_0000029_72377_73753 458
1105 3300048908 Ga0496105_0000002 Ga0496105_0000002_72377_73753 458
1106 3300048909 Ga0496106_0005382 Ga0496106_0005382_7734_9155 458
1107 3300048909 Ga0496106_0087764 Ga0496106_0087764_210_1658 458
1108 3300048911 Ga0496108_0000187 Ga0496108_0000187_47547_48959 458
1109 3300048911 Ga0496108_0015305 Ga0496108_0015305_3963_5384 458
1110 3300048912 Ga0496109_0000636 Ga0496109_0000636_17535_18947 458
1111 3300048913 Ga0496110_0014802 Ga0496110_0014802_1510_2931 458
1112 3300048916 Ga0496113_0002968 Ga0496113_0002968_8349_9770 458
1113 3300048922 Ga0496119_0014904 Ga0496119_0014904_1047_2423 458
1114 3300053085 Ga0495619_0000025 Ga0495619_0000025_32220_33632 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10009

DUF2252

Uncharacterized protein conserved in bacteria (DUF2252)

114

522

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dm8-assembly1.cif.gz_A-2 crystal structure of putative isomerase from rhodopseudomonas palustris 0.5083 269 314
3i4b-assembly1.cif.gz_A crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor 0.4662 277 370
3rcd-assembly1.cif.gz_A her2 kinase domain complexed with tak-285 0.4403 277 371
5jeb-assembly1.cif.gz_A crystal structure of egfr tyrosine kinase domain with novel inhibitor of active state of her2 0.4272 273 371
4cyi-assembly2.cif.gz_C chaetomium thermophilum pan3 0.4212 291 369
ID Description Score Start End Superfamily
af_Q9VIG3_1_153_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5294 274 316 3.30.200.20
3dm8A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5083 269 314 3.10.450.50
af_Q2FWK3_394_500_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.4762 275 326 3.30.160.270
3attA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4634 279 370 3.30.200.20
af_Q12222_39_128_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.446 275 370 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1P8YCJ8-F1-model_v4 DUF2252 domain-containing protein 0.9812 1 458 GO:0016020
AF-A0A359A5M1-F1-model_v4 deleted 0.9811 1 458
AF-A0A401WF67-F1-model_v4 DUF2252 domain-containing protein 0.979 1 458
AF-A0A359A5M1-F1-model_v4 deleted 0.979 1 458
AF-A0A6B2XTZ6-F1-model_v4 DUF2252 domain-containing protein 0.9788 26 146

Feature Viewer

pLDDT pTM Quality
90.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map