F490269

General Info

Members Datasets Scaffolds Average Seq Length
1113 833 541 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221582|2643918320
Length 308
Sequence VESGSFMAALNFSDQRQSPDDVLASGEYPLTRRDLSEIAAMIYADAGIYLNDTKASLVYSRLSKHIRNLGLSGFREYCTLVSSTEGATARREMLSHLTTNFTRFFRENHHFEHLRDEVLPGLIARAKSGGRVRIWSAACSDGQEPYSIALTVLAMFPNAADYDFKILATDIDPKILAQARAGVYDDNALETVSPAMRKQWFTEVDAGGRRKFRIDDKVKRLITFNELNLMTQWPFKGNFDVIFCRNVVIYFDEPTQTRIWSRFAGLLPEGGHLYIGHSERVAGDAKNLFDNTGITTYRYIGHASGRKA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
55 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
56 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
57 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
58 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
59 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
60 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
61 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
62 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
63 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
64 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
65 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
66 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
67 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
68 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
69 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
70 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
71 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
72 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
75 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
76 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
77 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
78 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
79 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
80 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
81 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
82 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
83 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
86 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
87 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
88 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
89 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
90 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
91 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
92 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
93 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
94 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
95 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
96 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
97 2643221557 Ensifer sp. Root558 Isolate Unclassified
98 2643221558 Rhizobium sp. Root149 Isolate Unclassified
99 2643221568 Rhizobium sp. Root564 Isolate Unclassified
100 2643221582 Rhizobium sp. Root651 Isolate Unclassified
101 2643221599 Rhizobium sp. Root708 Isolate Unclassified
102 2643221607 Rhizobium sp. Root73 Isolate Unclassified
103 2643221610 Ensifer sp. Root74 Isolate Unclassified
104 2643221618 Ensifer sp. Root231 Isolate Unclassified
105 2643221626 Ensifer sp. Root31 Isolate Unclassified
106 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
107 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
108 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
109 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
110 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
111 2643221655 Ensifer sp. Root1252 Isolate Unclassified
112 2643221659 Ensifer sp. Root127 Isolate Unclassified
113 2643221668 Ensifer sp. Root423 Isolate Unclassified
114 2643221675 Ensifer sp. Root1298 Isolate Unclassified
115 2643221680 Ensifer sp. Root1312 Isolate Unclassified
116 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
117 2643221688 Rhizobium sp. Root482 Isolate Unclassified
118 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
119 2643221693 Rhizobium sp. Root491 Isolate Unclassified
120 2643221698 Ensifer sp. Root142 Isolate Unclassified
121 2643221712 Ensifer sp. Root258 Isolate Unclassified
122 2643221718 Rhizobium sp. Root268 Isolate Unclassified
123 2643221719 Rhizobium sp. Root274 Isolate Unclassified
124 2643221723 Ensifer sp. Root278 Isolate Unclassified
125 2643221726 Ensifer sp. Root954 Isolate Unclassified
126 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
127 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
128 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2718217882 Rhizobium sp. N741 Isolate Nodule
130 2718217927 Rhizobium sp. N324 Isolate Nodule
131 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
132 2718218009 Rhizobium sp. N561 Isolate Nodule
133 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
134 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
135 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
136 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
137 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
138 2718218363 Rhizobium sp. N113 Isolate Nodule
139 2718218365 Rhizobium sp. N731 Isolate Nodule
140 2718218366 Rhizobium sp. N621 Isolate Nodule
141 2718218423 Rhizobium sp. N941 Isolate Nodule
142 2721755514 Rhizobium sp. N6212 Isolate Nodule
143 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
144 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
145 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
146 2721755809 Rhizobium sp. N541 Isolate Nodule
147 2721755810 Rhizobium sp. N871 Isolate Nodule
148 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
149 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
150 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
151 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
152 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
153 2728369365 Rhizobium sp. N1341 Isolate Nodule
154 2728369397 Rhizobium sp. N1314 Isolate Nodule
155 2738541293 Rhizobium sp. GV031 Isolate Unclassified
156 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
157 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
158 2738543024 Aminobacter sp. AP02 Isolate Unclassified
159 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
160 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
161 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
162 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
163 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
164 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
165 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
166 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
167 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
168 2791355256 Rhizobium sp. M10 Isolate Nodule
169 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
170 2791355260 Rhizobium sp. L9 Isolate Nodule
171 2791355261 Rhizobium sp. J15 Isolate Nodule
172 2791355262 Rhizobium sp. M1 Isolate Nodule
173 2791355263 Rhizobium chutanense C5 Isolate Nodule
174 2791355264 Rhizobium sp. S9 Isolate Nodule
175 2791355265 Rhizobium sp. H4 Isolate Nodule
176 2791355266 Rhizobium sp. L43 Isolate Nodule
177 2791355267 Rhizobium sp. L18 Isolate Nodule
178 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
179 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
180 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
181 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
182 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
183 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
184 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
185 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
186 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
187 2802429633 Rhizobium anhuiense J3 Isolate Nodule
188 2802429634 Rhizobium anhuiense S10 Isolate Nodule
189 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
190 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
191 2802429637 Rhizobium anhuiense C15 Isolate Nodule
192 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
193 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
194 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
195 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
196 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
197 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
198 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
199 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
200 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
201 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
202 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
203 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
204 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
205 2838048938 Rhizobium pisi 27/80 Isolate Nodule
206 2838061910 Rhizobium phaseoli L15 Isolate Nodule
207 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
208 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
209 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
210 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
211 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
212 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
213 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
214 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
215 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
216 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
217 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
218 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
219 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
220 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
221 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
222 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
223 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
224 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
225 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
226 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
227 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
228 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
229 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
230 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
231 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
232 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
233 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
234 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
235 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
236 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
237 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
238 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
239 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
240 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
241 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
242 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
243 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
244 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
245 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
246 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
247 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
248 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
249 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
250 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
251 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
252 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
253 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
254 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
255 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
256 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
257 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
258 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
259 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
260 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
261 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
262 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
263 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
264 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
265 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
266 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
267 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
268 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
269 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
270 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
271 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
272 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
273 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
274 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
275 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
276 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
277 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
278 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
279 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
280 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
281 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
282 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
283 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
284 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
285 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
286 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
287 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
288 2844163670 Ensifer sp. 1H6 Isolate Unclassified
289 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
290 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
291 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
292 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
293 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
294 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
295 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
296 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
297 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
298 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
299 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
300 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
301 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
302 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
303 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
304 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
305 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
306 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
307 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
308 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
309 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
310 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
311 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
312 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
313 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
314 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
315 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
316 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
317 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
318 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
319 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
320 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
321 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
322 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
323 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
324 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
325 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
326 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
327 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
328 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
329 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
330 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
331 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
332 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
333 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
334 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
335 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
336 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
337 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
338 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
339 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
340 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
341 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
342 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
343 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
344 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
345 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
346 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
347 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
348 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
349 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
350 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
351 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
352 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
353 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
354 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
355 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
356 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
357 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
358 2932401849 Devosia sp. 2618 Isolate Rhizosphere
359 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
360 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
361 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
362 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
363 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
364 2933599457 Rhizobium phaseoli M3 Isolate Nodule
365 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
366 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
367 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
368 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
369 2936381700 Rhizobium chutanense C16 Isolate Unclassified
370 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
371 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
372 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
373 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
374 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
375 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
376 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
377 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
378 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
379 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
380 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
381 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
382 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
383 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
384 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
385 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
386 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
387 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
388 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
389 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
390 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
391 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
392 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
393 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
394 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
395 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
396 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
397 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
398 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
399 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
400 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
401 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
402 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
403 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
404 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
405 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
406 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
407 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
408 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
409 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
410 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
411 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
412 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
413 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
414 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
415 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
416 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
417 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
418 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
419 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
420 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
421 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
422 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
423 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
424 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
425 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
426 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
427 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
428 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
429 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
430 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
431 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
432 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
433 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
434 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
435 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
436 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
437 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
438 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
439 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
440 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
441 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
442 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
443 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
444 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
445 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
446 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
447 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
448 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
449 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
450 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
451 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
452 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
453 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
454 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
455 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
456 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
457 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
458 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
459 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
460 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
461 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
462 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
463 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
464 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
465 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
466 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
467 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
468 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
469 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
470 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
471 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
472 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
473 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
474 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
475 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
476 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
477 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
478 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
479 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
480 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
481 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
482 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
483 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
484 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
485 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
486 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
487 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
488 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
489 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
490 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
491 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
492 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
493 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
494 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
495 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
496 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
497 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
498 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
499 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
500 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
501 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
502 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
503 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
504 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
505 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
506 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
507 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
508 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
509 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
510 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
511 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
512 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
513 2996887358 Rhizobium sp. R711 Isolate Nodule
514 2996893221 Rhizobium sp. R635 Isolate Nodule
515 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
516 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
517 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
518 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
519 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
520 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
521 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
522 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
523 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
524 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
525 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
526 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
527 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
528 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
529 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
530 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
531 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
532 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
533 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
534 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
535 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
536 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
537 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
538 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
539 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
540 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
541 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
542 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
543 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
544 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
545 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
546 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
547 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
548 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
549 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
550 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
551 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
552 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
553 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
554 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
555 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
556 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
557 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
558 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
559 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
560 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
561 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
562 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
563 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
564 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
565 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
566 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
567 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
568 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
569 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
570 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
571 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
572 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
573 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
574 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
575 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
576 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
577 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
578 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
579 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
580 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
581 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
582 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
583 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
584 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
585 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
586 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
587 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
588 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
589 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
590 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
591 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
592 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
593 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
594 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
595 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
596 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
597 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
598 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
599 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
600 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
601 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
602 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
603 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
604 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
605 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
606 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
607 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
608 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
609 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
611 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
612 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
613 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
614 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
615 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
616 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
617 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
618 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
619 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
620 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
621 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
622 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
623 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
637 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
638 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
639 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
640 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
642 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
643 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
644 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
645 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
646 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
647 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
648 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
649 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
650 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
651 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
652 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
653 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
654 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
655 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
656 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
657 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
658 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
659 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
660 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
661 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
662 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
663 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
664 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
665 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
666 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
667 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
668 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
669 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
670 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
671 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
672 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
673 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
674 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
675 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
676 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
677 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
678 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
679 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
680 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
681 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
682 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
683 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
684 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
685 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
686 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
687 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
688 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
689 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
690 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
691 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
692 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
693 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
694 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
695 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
696 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
697 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
698 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
699 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
700 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
701 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
702 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
703 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
704 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
705 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
706 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
707 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
708 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
709 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
710 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
711 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
712 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
713 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
714 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
715 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
716 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
717 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
718 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
719 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
720 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
721 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
722 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
723 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
724 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
725 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
726 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
727 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
728 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
729 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
730 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
731 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
732 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
733 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
734 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
735 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
736 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
737 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
738 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
739 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
740 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
741 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
742 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
744 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
745 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
746 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
747 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
748 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
749 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
750 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
751 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
752 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
753 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
754 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
755 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
756 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
757 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
758 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
759 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
760 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
761 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
762 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
763 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
764 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
765 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
766 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
767 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
768 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
769 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
770 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
771 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
772 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
773 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
774 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
775 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
776 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
777 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
778 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
779 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
780 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
781 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
782 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
783 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
784 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
785 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
786 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
787 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
788 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
789 8005258706 Rhizobium sp. R693 Isolate Nodule
790 8005275841 Rhizobium sp. N4311 Isolate Nodule
791 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
792 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
793 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
794 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
795 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
796 8005321885 Rhizobium sp. R72 Isolate Nodule
797 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
798 8005382845 Rhizobium sp. R634 Isolate Nodule
799 8005395548 Rhizobium sp. R339 Isolate Nodule
800 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
801 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
802 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
803 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
804 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
805 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
806 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
807 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
808 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
809 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
810 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
811 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
812 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
813 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
814 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
815 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
816 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
817 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
818 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
819 8018176218 Rhizobium sp. N122 Isolate Nodule
820 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
821 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
822 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
823 8024501048 Rhizobium sp. H4 Isolate Nodule
824 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
825 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
826 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
827 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
828 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
829 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
830 8056382006 Rhizobium croatiense 13T Isolate Nodule
831 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
832 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
833 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.61
Metatranscriptomes 0
Isolates 51.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 18.42
Nodule 38.63
Rhizoplane 1.62
Rhizosphere 23.18
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000016 3300001979 Bacteria 58332
2 JGI25155J39150_1000157 3300002704 Bacteria 30370
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1000508 3300002737 Bacteria 29158
6 JGI25154J39366_1000286 3300002738 Bacteria 30355
7 JGI25158J39367_1000022 3300002739 Bacteria 38866
8 JGI25157J39369_1000247 3300002741 Bacteria 41079
9 JGI25152J39213_1000754 3300002773 Bacteria 16448
10 JGI25152J39213_1006226 3300002773 Bacteria 3304
11 JGI25152J39213_1006373 3300002773 Bacteria 3236
12 JGI25152J39213_1007385 3300002773 Bacteria 2851
13 JGI25152J39213_1011673 3300002773 Bacteria 1930
14 JGI25150J39212_1000012 3300002774 Bacteria 182468
15 JGI25150J39212_1011391 3300002774 Bacteria 1614
16 JGI25159J45721_1000137 3300002987 Bacteria 34522
17 JGI25159J45721_1000730 3300002987 Bacteria 14342
18 JGI25159J45721_1003596 3300002987 Bacteria 5419
19 JGI25151J46595_10000025 3300003187 Bacteria 213302
20 JGI25151J46595_10008949 3300003187 Bacteria 4775
21 JGI25151J46595_10014484 3300003187 Bacteria 3510
22 JGI25151J46595_10019714 3300003187 Bacteria 2858
23 JGI25151J46595_10020686 3300003187 Bacteria 2769
24 JGI25165J46597_1000355 3300003214 Bacteria 51475
25 JGI25165J46597_1000491 3300003214 Bacteria 38149
26 JGI25165J46597_1002805 3300003214 Bacteria 5045
27 JGI25165J46597_1002982 3300003214 Bacteria 4680
28 JGI25153J46596_10001788 3300003215 Bacteria 12753
29 JGI25153J46596_10005320 3300003215 Bacteria 6767
30 JGI25153J46596_10011406 3300003215 Bacteria 3930
31 JGI25153J46596_10014934 3300003215 Bacteria 3195
32 rootH2_10020588 3300003320 Bacteria 2532
33 rootL2_10000316 3300003322 Bacteria 7315
34 JGI25160J50197_1000003 3300003354 Bacteria 482719
35 JGI25160J50197_1000041 3300003354 Bacteria 152843
36 JGI25160J50197_1004302 3300003354 Bacteria 6173
37 JGI25160J50197_1004984 3300003354 Bacteria 5632
38 JGI25160J50197_1008638 3300003354 Bacteria 3863
39 JGI25161J50226_1000002 3300003374 Bacteria 420324
40 JGI25161J50226_1000143 3300003374 Bacteria 49711
41 JGI25161J50226_1000493 3300003374 Bacteria 17725
42 JGI25161J50226_1005407 3300003374 Bacteria 2484
43 Ga0055539_1007704 3300003752 Bacteria 1357
44 Ga0055526_1011121 3300003771 Bacteria 4099
45 Ga0055526_1015428 3300003771 Bacteria 3066
46 Ga0055526_1019108 3300003771 Bacteria 2513
47 Ga0055526_1030826 3300003771 Bacteria 1555
48 Ga0055524_1000776 3300003775 Bacteria 21442
49 Ga0055524_1013963 3300003775 Bacteria 3001
50 Ga0055524_1018649 3300003775 Bacteria 2401
51 Ga0055524_1021942 3300003775 Bacteria 2101
52 Ga0055524_1023588 3300003775 Bacteria 1977
53 Ga0055536_1003218 3300003781 Bacteria 8850
54 Ga0055536_1010563 3300003781 Bacteria 3644
55 Ga0055528_1000604 3300003790 Bacteria 26951
56 Ga0055528_1001318 3300003790 Bacteria 15525
57 Ga0055528_1007277 3300003790 Bacteria 4911
58 Ga0055528_1007971 3300003790 Bacteria 4610
59 Ga0055528_1020008 3300003790 Bacteria 2189
60 Ga0055528_1032103 3300003790 Bacteria 1350
61 Ga0055530_10023535 3300003791 Bacteria 1766
62 Ga0055540_1000249 3300003792 Bacteria 49180
63 Ga0055540_1001900 3300003792 Bacteria 11701
64 Ga0055540_1009280 3300003792 Bacteria 3415
65 Ga0055540_1011060 3300003792 Bacteria 2946
66 Ga0055531_10002859 3300003794 Bacteria 11257
67 Ga0058692_1000651 3300003856 Bacteria 14332
68 Ga0058692_1006563 3300003856 Bacteria 3174
69 Ga0058692_1013059 3300003856 Bacteria 1947
70 Ga0055543_1000008 3300004625 Bacteria 202062
71 Ga0055543_1000158 3300004625 Bacteria 56811
72 Ga0055543_1000263 3300004625 Bacteria 39326
73 Ga0055543_1002397 3300004625 Bacteria 6237
74 Ga0065165_1000031 3300005262 Bacteria 216330
75 Ga0065165_1000084 3300005262 Bacteria 154822
76 Ga0065165_1032974 3300005262 Bacteria 1617
77 Ga0070670_100000160 3300005331 Bacteria 61135
78 Ga0070689_100150898 3300005340 Bacteria 1874
79 Ga0070669_100312902 3300005353 Bacteria 1266
80 Ga0070671_100071497 3300005355 Bacteria 2895
81 Ga0068853_100005585 3300005539 Bacteria 9878
82 Ga0068853_100716037 3300005539 Bacteria 955
83 Ga0070665_100006971 3300005548 Bacteria 11488
84 Ga0070665_100030724 3300005548 Bacteria 5405
85 Ga0070665_100068975 3300005548 Bacteria 3544
86 Ga0070665_100183379 3300005548 Bacteria 2094
87 Ga0068855_100030372 3300005563 Bacteria 6464
88 Ga0068855_100356221 3300005563 Bacteria 1611
89 Ga0068855_100694160 3300005563 Bacteria 1090
90 Ga0068854_100010614 3300005578 Bacteria 5977
91 Ga0068856_100023203 3300005614 Bacteria 6035
92 Ga0068852_100067238 3300005616 Bacteria 3133
93 Ga0068851_10057716 3300005834 Bacteria 1982
94 Ga0081455_10120275 3300005937 Bacteria 2070
95 Ga0075365_10002780 3300006038 Bacteria 8748
96 Ga0075365_10073691 3300006038 Bacteria 2302
97 Ga0075368_10033956 3300006042 Bacteria 1986
98 Ga0075364_10001052 3300006051 Bacteria 14687
99 Ga0075362_10049289 3300006177 Bacteria 1881
100 Ga0075367_10020506 3300006178 Bacteria 3683
101 Ga0075367_10078712 3300006178 Bacteria 1991
102 Ga0075369_10008794 3300006186 Bacteria 3902
103 Ga0075369_10026093 3300006186 Bacteria 2434
104 Ga0075366_10007690 3300006195 Bacteria 5968
105 Ga0075370_10046246 3300006353 Bacteria 2463
106 Ga0075370_10081184 3300006353 Bacteria 1864
107 Ga0068871_100241737 3300006358 Bacteria 1570
108 Ga0068865_100056815 3300006881 Bacteria 2728
109 Ga0079104_1000452 3300006946 Bacteria 46570
110 Ga0099826_10000109 3300006948 Bacteria 38139
111 Ga0099826_10052386 3300006948 Bacteria 2726
112 Ga0105251_10049597 3300009011 Bacteria 2009
113 Ga0105240_10000460 3300009093 Bacteria 74956
114 Ga0105240_10033018 3300009093 Bacteria 6691
115 Ga0105240_10147525 3300009093 Bacteria 2805
116 Ga0105240_10406539 3300009093 Unclassified 1532
117 Ga0105245_10297941 3300009098 Unclassified 1581
118 Ga0105243_10189748 3300009148 Bacteria 1794
119 Ga0105241_10082735 3300009174 Bacteria 2517
120 Ga0105241_10111945 3300009174 Bacteria 2186
121 Ga0105241_10551437 3300009174 Bacteria 1035
122 Ga0105237_10000203 3300009545 Bacteria 84732
123 Ga0105237_10000814 3300009545 Bacteria 42652
124 Ga0105237_10003204 3300009545 Bacteria 19611
125 Ga0105237_10039891 3300009545 Bacteria 4737
126 Ga0105237_10277405 3300009545 Bacteria 1679
127 Ga0105238_10004247 3300009551 Bacteria 14240
128 Ga0105238_10232263 3300009551 Unclassified 1821
129 Ga0123341_1000040 3300009765 Bacteria 59249
130 Ga0123342_1014285 3300009766 Bacteria 7630
131 Ga0123342_1024557 3300009766 Bacteria 3757
132 Ga0105239_10000961 3300010375 Bacteria 40476
133 Ga0105239_10048550 3300010375 Bacteria 4655
134 Ga0105239_10065740 3300010375 Bacteria 3984
135 Ga0105239_10095969 3300010375 Bacteria 3275
136 Ga0105239_10218730 3300010375 Bacteria 2136
137 Ga0157322_1000175 3300012490 Bacteria 1823
138 Ga0157373_10000975 3300013100 Bacteria 22157
139 Ga0157373_10003509 3300013100 Bacteria 11857
140 Ga0157371_10000004 3300013102 Bacteria 512593
141 Ga0157371_10003340 3300013102 Bacteria 14639
142 Ga0157370_10000185 3300013104 Bacteria 78153
143 Ga0157370_10000952 3300013104 Bacteria 36741
144 Ga0157370_10075698 3300013104 Bacteria 3172
145 Ga0157369_10116422 3300013105 Bacteria 2838
146 Ga0157369_10284036 3300013105 Bacteria 1723
147 Ga0157369_10371908 3300013105 Bacteria 1484
148 Ga0171463_1001 3300013249 Bacteria 1406070
149 Ga0157374_10015143 3300013296 Bacteria 6762
150 Ga0163163_10254834 3300014325 Unclassified 1806
151 Ga0182008_10027245 3300014497 Bacteria 2897
152 Ga0182007_10000689 3300015262 Bacteria 19247
153 Ga0182005_1006222 3300015265 Bacteria 3665
154 Ga0183363_1003 3300015690 Bacteria 421263
155 Ga0183363_1032 3300015690 Bacteria 48614
156 Ga0163161_10142209 3300017792 Bacteria 1817
157 Ga0214544_1000012 3300021320 Bacteria 229808
158 Ga0214542_1000011 3300021321 Bacteria 238260
159 Ga0214542_1015274 3300021321 Bacteria 8100
160 Ga0214543_1000004 3300021327 Bacteria 527190
161 Ga0214543_1000259 3300021327 Bacteria 81880
162 Ga0228711_1000019 3300022739 Bacteria 111795
163 Ga0228710_1000022 3300022740 Bacteria 111795
164 Ga0209435_100011 3300025206 Bacteria 413027
165 Ga0209436_100461 3300025208 Bacteria 18099
166 Ga0209672_104444 3300025228 Bacteria 2602
167 Ga0209563_101710 3300025230 Bacteria 5551
168 Ga0207427_102165 3300025231 Bacteria 5603
169 Ga0209437_100056 3300025233 Bacteria 363071
170 Ga0209437_100196 3300025233 Bacteria 121199
171 Ga0207425_1000012 3300025245 Bacteria 528324
172 Ga0207425_1002334 3300025245 Bacteria 6782
173 Ga0207425_1010306 3300025245 Bacteria 2280
174 Ga0209646_1000024 3300025246 Bacteria 413027
175 Ga0209026_1000030 3300025250 Bacteria 329811
176 Ga0209677_100765 3300025253 Bacteria 16298
177 Ga0209148_1005457 3300025254 Bacteria 2914
178 Ga0209759_1000011 3300025256 Bacteria 413027
179 Ga0209129_1000081 3300025258 Bacteria 183694
180 Ga0209129_1000105 3300025258 Bacteria 159104
181 Ga0209129_1001073 3300025258 Bacteria 16132
182 Ga0209129_1001589 3300025258 Bacteria 12421
183 Ga0209129_1001943 3300025258 Bacteria 10827
184 Ga0209129_1005767 3300025258 Bacteria 4244
185 Ga0209129_1008820 3300025258 Bacteria 2748
186 Ga0209233_1000037 3300025261 Bacteria 554620
187 Ga0209233_1000071 3300025261 Bacteria 363290
188 Ga0209233_1000243 3300025261 Bacteria 90170
189 Ga0209233_1001636 3300025261 Bacteria 8722
190 Ga0209673_1000015 3300025273 Bacteria 530618
191 Ga0209673_1000709 3300025273 Bacteria 46936
192 Ga0209673_1002913 3300025273 Bacteria 10793
193 Ga0209673_1003862 3300025273 Bacteria 8457
194 Ga0209673_1005381 3300025273 Bacteria 6460
195 Ga0209673_1006637 3300025273 Bacteria 5529
196 Ga0209673_1018802 3300025273 Bacteria 2500
197 Ga0209130_1000002 3300025284 Bacteria 722648
198 Ga0209130_1000005 3300025284 Bacteria 599620
199 Ga0209130_1000088 3300025284 Bacteria 152927
200 Ga0209130_1011228 3300025284 Bacteria 2409
201 Ga0209130_1019596 3300025284 Bacteria 1565
202 Ga0209675_1005664 3300025291 Bacteria 5163
203 Ga0209676_1004283 3300025292 Bacteria 8044
204 Ga0209025_1000024 3300025294 Bacteria 528324
205 Ga0209025_1000037 3300025294 Bacteria 383429
206 Ga0209025_1000060 3300025294 Bacteria 305017
207 Ga0209025_1000295 3300025294 Bacteria 111489
208 Ga0209025_1000574 3300025294 Bacteria 66723
209 Ga0209025_1004420 3300025294 Bacteria 12226
210 Ga0209025_1006666 3300025294 Bacteria 8872
211 Ga0209025_1021284 3300025294 Bacteria 3499
212 Ga0209025_1062770 3300025294 Bacteria 1375
213 Ga0209564_1000093 3300025295 Bacteria 245793
214 Ga0209564_1000576 3300025295 Bacteria 58256
215 Ga0209564_1000744 3300025295 Bacteria 46190
216 Ga0209564_1003315 3300025295 Bacteria 11185
217 Ga0209564_1005971 3300025295 Bacteria 6737
218 Ga0209564_1022275 3300025295 Bacteria 2245
219 Ga0209564_1022639 3300025295 Bacteria 2212
220 Ga0209564_1030561 3300025295 Bacteria 1666
221 Ga0209758_1000046 3300025297 Bacteria 364931
222 Ga0209758_1000441 3300025297 Bacteria 69800
223 Ga0209758_1000575 3300025297 Bacteria 57471
224 Ga0209758_1000810 3300025297 Bacteria 44076
225 Ga0209758_1001120 3300025297 Bacteria 34521
226 Ga0209758_1013969 3300025297 Bacteria 4320
227 Ga0209758_1015725 3300025297 Bacteria 3897
228 Ga0209758_1038113 3300025297 Bacteria 1848
229 Ga0209050_1005438 3300025298 Bacteria 8002
230 Ga0209256_1000027 3300025299 Bacteria 423283
231 Ga0209256_1000646 3300025299 Bacteria 47375
232 Ga0209256_1003123 3300025299 Bacteria 12093
233 Ga0209256_1004089 3300025299 Bacteria 9460
234 Ga0209256_1004576 3300025299 Bacteria 8570
235 Ga0209256_1005525 3300025299 Bacteria 7225
236 Ga0209256_1006239 3300025299 Bacteria 6417
237 Ga0209256_1011971 3300025299 Bacteria 3392
238 Ga0209256_1018733 3300025299 Bacteria 2234
239 Ga0209256_1029324 3300025299 Bacteria 1536
240 Ga0207426_1000012 3300025302 Bacteria 730942
241 Ga0207426_1000013 3300025302 Bacteria 721897
242 Ga0207426_1000015 3300025302 Bacteria 599316
243 Ga0207426_1000063 3300025302 Bacteria 358920
244 Ga0207426_1000172 3300025302 Bacteria 163690
245 Ga0207426_1001042 3300025302 Bacteria 26389
246 Ga0209051_1000435 3300025303 Bacteria 56550
247 Ga0209051_1001495 3300025303 Bacteria 19567
248 Ga0209051_1002059 3300025303 Bacteria 15247
249 Ga0209051_1013785 3300025303 Bacteria 3817
250 Ga0209051_1033792 3300025303 Bacteria 1927
251 Ga0209051_1033794 3300025303 Bacteria 1927
252 Ga0209051_1035257 3300025303 Bacteria 1864
253 Ga0209257_1000598 3300025304 Bacteria 59869
254 Ga0209257_1001343 3300025304 Bacteria 29827
255 Ga0209257_1015925 3300025304 Bacteria 3082
256 Ga0207705_10101849 3300025909 Unclassified 2113
257 Ga0207695_10000036 3300025913 Bacteria 477897
258 Ga0207695_10002526 3300025913 Bacteria 26879
259 Ga0207695_10014432 3300025913 Bacteria 9359
260 Ga0207695_10033067 3300025913 Bacteria 5649
261 Ga0207671_10000177 3300025914 Bacteria 97072
262 Ga0207671_10000517 3300025914 Bacteria 52359
263 Ga0207694_10014209 3300025924 Bacteria 6004
264 Ga0207650_10000391 3300025925 Bacteria 40030
265 Ga0207644_10054057 3300025931 Bacteria 2891
266 Ga0207704_10004867 3300025938 Bacteria 6170
267 Ga0207667_10025939 3300025949 Bacteria 6410
268 Ga0207667_10055436 3300025949 Bacteria 4167
269 Ga0207667_10213721 3300025949 Bacteria 1977
270 Ga0207640_10009208 3300025981 Bacteria 5521
271 Ga0207702_10009604 3300026078 Bacteria 8121
272 Ga0207702_10433469 3300026078 Bacteria 1273
273 Ga0207698_10033932 3300026142 Bacteria 3714
274 Ga0209281_1000200 3300027111 Bacteria 135685
275 Ga0209281_1000227 3300027111 Bacteria 119329
276 Ga0209281_1000488 3300027111 Bacteria 54963
277 Ga0209371_1000009 3300027312 Bacteria 963030
278 Ga0209371_1000315 3300027312 Bacteria 53030
279 Ga0209371_1000424 3300027312 Bacteria 43444
280 Ga0209371_1001877 3300027312 Bacteria 12897
281 Ga0209282_1000042 3300027666 Bacteria 119329
282 Ga0209282_1002131 3300027666 Bacteria 11280
283 Ga0209813_10019163 3300027866 Bacteria 1898
284 Ga0209813_10020410 3300027866 Bacteria 1854
285 Ga0268266_10000343 3300028379 Bacteria 72589
286 Ga0268266_10027728 3300028379 Bacteria 4815
287 Ga0268266_10043210 3300028379 Bacteria 3850
288 Ga0268266_10075692 3300028379 Bacteria 2924
289 Ga0307515_10000121 3300028794 Bacteria 188657
290 Ga0307515_10001309 3300028794 Bacteria 56564
291 Ga0307515_10001439 3300028794 Bacteria 53690
292 Ga0307515_10048980 3300028794 Bacteria 6375
293 Ga0307515_10314605 3300028794 Bacteria 1237
294 Ga0268256_1000010 3300030500 Bacteria 963034
295 Ga0268256_1001516 3300030500 Bacteria 13723
296 Ga0268256_1003952 3300030500 Bacteria 6393
297 Ga0316182_1324402 3300030745 Bacteria 2051
298 Ga0307513_10002360 3300031456 Bacteria 26237
299 Ga0307513_10013648 3300031456 Bacteria 9964
300 Ga0307513_10195090 3300031456 Bacteria 1872
301 Ga0307408_100031751 3300031548 Bacteria 3679
302 Ga0316579_10096290 3300031691 Bacteria 1415
303 Ga0307516_10032356 3300031730 Bacteria 5268
304 Ga0307405_10002866 3300031731 Bacteria 7749
305 Ga0307405_10018812 3300031731 Bacteria 3820
306 Ga0307406_10004188 3300031901 Bacteria 7848
307 Ga0307406_10043976 3300031901 Bacteria 2797
308 Ga0307412_10000394 3300031911 Bacteria 26964
309 Ga0307412_10082914 3300031911 Bacteria 2221
310 Ga0307412_10220245 3300031911 Bacteria 1454
311 Ga0315914_1000009 3300031967 Bacteria 182444
312 Ga0307409_100066807 3300031995 Bacteria 2837
313 Ga0307414_10000147 3300032004 Bacteria 47511
314 Ga0307414_10036914 3300032004 Bacteria 3267
315 Ga0307414_10176721 3300032004 Bacteria 1713
316 Ga0307510_10144528 3300033180 Bacteria 2014
317 Ga0307510_10237844 3300033180 Bacteria 1318
318 Ga0315913_1000015 3300033430 Bacteria 119325
319 Ga0315915_1000013 3300033464 Bacteria 182438
320 Ga0373927_0000086 3300035695 Bacteria 69853
321 Ga0373925_0008735 3300037068 Bacteria 7380
322 Ga0395899_0098510 3300037312 Bacteria 2112
323 Ga0395900_0098655 3300037418 Bacteria 3001
324 Ga0395898_0129690 3300037466 Bacteria 2415
325 Ga0395905_0000775 3300037471 Bacteria 42024
326 Ga0395905_0002869 3300037471 Bacteria 18822
327 Ga0395901_0241671 3300038443 Bacteria 1883
328 Ga0400488_40386 3300038741 Bacteria 2199
329 Ga0400483_210922 3300039062 Bacteria 3277
330 Ga0439436_0019510 3300041404 Bacteria 2023
331 Ga0439465_0005470 3300041413 Bacteria 4055
332 Ga0451795_1599653 3300041456 Bacteria 1073
333 Ga0451839_0284469 3300041496 Bacteria 1211
334 Ga0451841_0185773 3300041498 Bacteria 1663
335 Ga0451845_0485343 3300041501 Bacteria 991
336 Ga0451855_0148620 3300041511 Bacteria 1233
337 Ga0439445_0017452 3300042004 Bacteria 1774
338 Ga0439445_0021883 3300042004 Bacteria 1609
339 Ga0439449_0010782 3300042007 Bacteria 3449
340 Ga0439462_0011190 3300042015 Bacteria 2281
341 Ga0450906_006429 3300042145 Bacteria 2373
342 Ga0450918_003188 3300042531 Bacteria 3058
343 Ga0466963_0082292 3300044694 Bacteria 2182
344 Ga0466968_0106166 3300044735 Bacteria 1259
345 Ga0451576_0012411 3300045051 Bacteria 9569
346 Ga0495638_0000788 3300046460 Bacteria 33436
347 Ga0495650_0039550 3300046471 Bacteria 2034
348 Ga0495605_0007669 3300046474 Bacteria 6118
349 Ga0495605_0024665 3300046474 Bacteria 3143
350 Ga0495662_0031958 3300046476 Bacteria 2542
351 Ga0495607_0023280 3300046501 Bacteria 3878
352 Ga0495607_0077205 3300046501 Bacteria 1840
353 Ga0495583_0034401 3300046506 Bacteria 2427
354 Ga0495606_0002833 3300046507 Bacteria 19241
355 Ga0495610_0005023 3300046512 Bacteria 9571
356 Ga0495610_0106832 3300046512 Bacteria 1245
357 Ga0495620_0026059 3300046515 Bacteria 2754
358 Ga0495631_0015169 3300046518 Bacteria 3701
359 Ga0495631_0076091 3300046518 Bacteria 1448
360 Ga0495632_0015112 3300046519 Bacteria 4340
361 Ga0495632_0043000 3300046519 Bacteria 2261
362 Ga0495648_0078617 3300046524 Bacteria 1886
363 Ga0495654_0000321 3300046530 Bacteria 42082
364 Ga0495640_0098569 3300046533 Bacteria 1921
365 Ga0495609_0025818 3300046538 Bacteria 2691
366 Ga0495597_0005914 3300046542 Bacteria 6389
367 Ga0495622_0043836 3300046557 Bacteria 2079
368 Ga0495633_0016323 3300046558 Bacteria 3832
369 Ga0495668_0003954 3300046616 Bacteria 10812
370 Ga0495611_0010307 3300046648 Bacteria 3953
371 Ga0495625_0005054 3300046660 Bacteria 12222
372 Ga0495625_0064844 3300046660 Bacteria 2576
373 Ga0495635_0043983 3300046663 Bacteria 3081
374 Ga0495661_0107348 3300046665 Bacteria 1561
375 Ga0495588_0000622 3300046674 Bacteria 16604
376 Ga0495588_0024360 3300046674 Bacteria 3006
377 Ga0495657_0087658 3300046675 Bacteria 2002
378 Ga0495658_0125100 3300046683 Bacteria 1559
379 Ga0495670_0033964 3300046691 Bacteria 2539
380 Ga0495670_0110482 3300046691 Bacteria 1422
381 Ga0495671_0052781 3300046692 Bacteria 2020
382 Ga0495671_0122081 3300046692 Bacteria 1271
383 Ga0495604_0113830 3300047317 Bacteria 1968
384 Ga0495672_0107347 3300047320 Bacteria 1504
385 Ga0495683_0144195 3300047323 Bacteria 1114
386 Ga0495687_009034 3300047443 Bacteria 5619
387 Ga0495681_0002829 3300047470 Bacteria 12267
388 Ga0495686_0000458 3300047472 Bacteria 61256
389 Ga0495686_0039525 3300047472 Bacteria 3012
390 Ga0495686_0054506 3300047472 Bacteria 2503
391 Ga0495686_0194815 3300047472 Bacteria 1166
392 Ga0496100_0066239 3300048903 Bacteria 2395
393 Ga0496102_0007240 3300048905 Bacteria 9470
394 Ga0496103_0011291 3300048906 Bacteria 5288
395 Ga0496104_0064887 3300048907 Bacteria 3464
396 Ga0496106_0017682 3300048909 Bacteria 5273
397 Ga0496110_0119904 3300048913 Bacteria 2369
398 Ga0496111_0004636 3300048914 Bacteria 8699
399 Ga0496113_0120442 3300048916 Bacteria 2051
400 Ga0496116_0000100 3300048919 Bacteria 194740
401 Ga0496116_0010591 3300048919 Bacteria 7712
402 Ga0496116_0034978 3300048919 Bacteria 3534
403 Ga0496116_0040518 3300048919 Bacteria 3207
404 Ga0496116_0049931 3300048919 Bacteria 2791
405 Ga0496116_0056547 3300048919 Bacteria 2570
406 Ga0496116_0164571 3300048919 Bacteria 1211
407 Ga0496117_0000002 3300048920 Bacteria 2483758
408 Ga0496117_0001791 3300048920 Bacteria 29241
409 Ga0496117_0003238 3300048920 Bacteria 19173
410 Ga0496117_0027534 3300048920 Bacteria 4426
411 Ga0496117_0047858 3300048920 Bacteria 3061
412 Ga0496117_0048598 3300048920 Bacteria 3028
413 Ga0496117_0060042 3300048920 Bacteria 2623
414 Ga0496118_0001493 3300048921 Bacteria 34920
415 Ga0496118_0006723 3300048921 Bacteria 12529
416 Ga0496118_0007119 3300048921 Bacteria 12000
417 Ga0496118_0030242 3300048921 Bacteria 4523
418 Ga0496118_0101278 3300048921 Bacteria 1946
419 Ga0496119_0021672 3300048922 Bacteria 4632
420 Ga0496120_0000021 3300048923 Bacteria 250966
421 Ga0496120_0018092 3300048923 Bacteria 4550
422 Ga0496121_0000001 3300048924 Bacteria 1830318
423 Ga0496121_0001709 3300048924 Bacteria 35918
424 Ga0496121_0002141 3300048924 Bacteria 31012
425 Ga0496121_0012257 3300048924 Bacteria 9386
426 Ga0496121_0012986 3300048924 Bacteria 9001
427 Ga0496121_0026205 3300048924 Bacteria 5503
428 Ga0496121_0078597 3300048924 Bacteria 2622
429 Ga0496121_0081281 3300048924 Bacteria 2565
430 Ga0496121_0103836 3300048924 Bacteria 2185
431 Ga0496121_0190280 3300048924 Bacteria 1472
432 Ga0496122_0000001 3300048925 Bacteria 1827766
433 Ga0496122_0000147 3300048925 Bacteria 165589
434 Ga0496122_0001112 3300048925 Bacteria 46455
435 Ga0496122_0004207 3300048925 Bacteria 18095
436 Ga0496122_0013026 3300048925 Bacteria 8191
437 Ga0496122_0047680 3300048925 Bacteria 3305
438 Ga0496122_0053134 3300048925 Bacteria 3057
439 Ga0496122_0063563 3300048925 Bacteria 2692
440 Ga0496122_0064956 3300048925 Bacteria 2650
441 Ga0496122_0166022 3300048925 Bacteria 1338
442 Ga0496123_0000001 3300048926 Bacteria 1831497
443 Ga0496123_0000158 3300048926 Bacteria 136078
444 Ga0496123_0000910 3300048926 Bacteria 46499
445 Ga0496123_0060370 3300048926 Bacteria 2445
446 Ga0496123_0069336 3300048926 Bacteria 2214
447 Ga0496123_0089386 3300048926 Bacteria 1835
448 Ga0496123_0124760 3300048926 Bacteria 1439
449 Ga0496124_0000063 3300048927 Bacteria 229705
450 Ga0496124_0000551 3300048927 Bacteria 63371
451 Ga0496124_0008733 3300048927 Bacteria 10526
452 Ga0496124_0021178 3300048927 Bacteria 5994
453 Ga0496124_0037083 3300048927 Bacteria 4243
454 Ga0496124_0049047 3300048927 Bacteria 3603
455 Ga0496124_0050127 3300048927 Bacteria 3559
456 Ga0496124_0060239 3300048927 Bacteria 3185
457 Ga0496124_0168106 3300048927 Bacteria 1702
458 Ga0496124_0186404 3300048927 Bacteria 1592
459 Ga0496124_0260101 3300048927 Bacteria 1278
460 Ga0496125_0000001 3300048928 Bacteria 1766138
461 Ga0496125_0000981 3300048928 Bacteria 44598
462 Ga0496125_0025057 3300048928 Bacteria 5473
463 Ga0496125_0029800 3300048928 Bacteria 4896
464 Ga0496125_0032809 3300048928 Bacteria 4607
465 Ga0496125_0055609 3300048928 Bacteria 3222
466 Ga0496126_0000094 3300048929 Bacteria 208184
467 Ga0496126_0000195 3300048929 Bacteria 135582
468 Ga0496126_0015337 3300048929 Bacteria 7710
469 Ga0496126_0052315 3300048929 Bacteria 3712
470 Ga0496126_0054690 3300048929 Bacteria 3613
471 Ga0496126_0096523 3300048929 Bacteria 2591
472 Ga0495682_0020262 3300049460 Bacteria 2497
473 Ga0501031_0019562 3300049568 Bacteria 4410
474 Ga0501032_0035214 3300049569 Bacteria 3424
475 Ga0501033_0000396 3300049570 Bacteria 41913
476 Ga0501033_0008788 3300049570 Bacteria 7807
477 Ga0501034_0012395 3300049571 Bacteria 8806
478 Ga0501034_0116860 3300049571 Bacteria 2655
479 Ga0501034_0169425 3300049571 Bacteria 2151
480 Ga0501034_0230224 3300049571 Bacteria 1802
481 Ga0501034_0252080 3300049571 Bacteria 1709
482 Ga0501037_0148425 3300049573 Bacteria 1677
483 Ga0501043_0016875 3300049579 Bacteria 5723
484 Ga0501046_0052880 3300049580 Bacteria 3200
485 Ga0501047_0195815 3300049581 Bacteria 1883
486 Ga0501047_0210632 3300049581 Bacteria 1802
487 Ga0501047_0249795 3300049581 Bacteria 1622
488 Ga0501068_0100704 3300049584 Bacteria 1791
489 Ga0501070_0079005 3300049586 Bacteria 2722
490 Ga0501074_0324806 3300049590 Bacteria 1093
491 Ga0501223_000256 3300049663 Bacteria 13526
492 Ga0501224_000034 3300049664 Bacteria 37769
493 Ga0501233_002460 3300049668 Bacteria 3267
494 Ga0501225_0000865 3300049705 Bacteria 9405
495 Ga0501083_0082272 3300049744 Bacteria 2133
496 Ga0501280_004240 3300049776 Bacteria 2121
497 Ga0501035_0000647 3300049822 Bacteria 38388
498 Ga0501035_0007015 3300049822 Bacteria 10525
499 Ga0501035_0118102 3300049822 Bacteria 2320
500 Ga0501044_0020415 3300049823 Bacteria 7074
501 Ga0501044_0089814 3300049823 Bacteria 3100
502 Ga0501044_0138692 3300049823 Bacteria 2421
503 Ga0501226_000038 3300049853 Bacteria 64184
504 nmdc:mga03n38_99294_c1 3300050490 Bacteria 1402
505 nmdc:mga00v17_140754_c1 3300050491 Bacteria 1547
506 nmdc:mga00v17_39_c1 3300050491 Bacteria 82050
507 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
508 nmdc:mga0yw44_35102_c1 3300050492 Bacteria 2945
509 nmdc:mga0yw44_439_c1 3300050492 Bacteria 9518
510 nmdc:mga04h51_1693_c1 3300050495 Bacteria 5148
511 nmdc:mga0sz30_287_c1 3300050516 Bacteria 19364
512 nmdc:mga0sz30_69478_c1 3300050516 Bacteria 1514
513 Ga0500610_0029107 3300053079 Bacteria 2788
514 Ga0500578_0085656 3300053086 Bacteria 2001
515 Ga0500644_0003697 3300053088 Bacteria 3798
516 Ga0500557_019472 3300053105 Bacteria 1913
517 Ga0500560_000754 3300053107 Bacteria 4912
518 Ga0500560_073441 3300053107 Bacteria 1130
519 Ga0500569_014925 3300053109 Bacteria 1934
520 Ga0500572_003242 3300053111 Bacteria 3750
521 Ga0500593_068618 3300053117 Bacteria 1543
522 Ga0500607_099280 3300053121 Bacteria 1449
523 Ga0500608_030758 3300053122 Bacteria 2545
524 Ga0500618_000119 3300053125 Bacteria 64330
525 Ga0500618_000359 3300053125 Bacteria 31723
526 Ga0500559_0006632 3300053136 Bacteria 5209
527 Ga0500559_0007875 3300053136 Bacteria 4703
528 Ga0500561_0000213 3300053137 Bacteria 10547
529 Ga0500568_0008632 3300053139 Bacteria 4894
530 Ga0500568_0020058 3300053139 Bacteria 2898
531 Ga0500616_0002453 3300053153 Bacteria 15395
532 Ga0500616_0002986 3300053153 Bacteria 13387
533 Ga0500622_0002012 3300053156 Bacteria 15189
534 Ga0500622_0013526 3300053156 Bacteria 4403
535 Ga0500622_0019253 3300053156 Bacteria 3626
536 Ga0500627_0019420 3300053158 Bacteria 2708
537 Ga0500634_0000017 3300053161 Bacteria 111983
538 Ga0500634_0049992 3300053161 Bacteria 2253
539 Ga0500636_0000006 3300053177 Bacteria 183899
540 Ga0500636_0075104 3300053177 Bacteria 1955
541 Ga0501082_0072834 3300060353 Bacteria 2959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0324806 Ga0501074_0324806_42_803 250
2 3300042007 Ga0439449_0010782 Ga0439449_0010782_2630_3436 268
3 3300053105 Ga0500557_019472 Ga0500557_019472_1092_1898 268
4 iso_pu_bacteria 2837651117 2837651880 269
5 3300039062 Ga0400483_210922 Ga0400483_210922_633_1463 274
6 iso_pu_bacteria 2932401849 2932405988 276
7 3300049580 Ga0501046_0052880 Ga0501046_0052880_2213_3061 277
8 3300049586 Ga0501070_0079005 Ga0501070_0079005_1685_2533 277
9 3300049822 Ga0501035_0007015 Ga0501035_0007015_1708_2556 277
10 3300049823 Ga0501044_0020415 Ga0501044_0020415_4638_5486 277
11 iso_pu_bacteria 2928027323 2928029504 277
12 iso_pu_bacteria 2984555340 2984557020 277
13 iso_pu_bacteria 2984564862 2984568670 277
14 iso_pu_bacteria 2993356040 2993359664 277
15 3300005563 Ga0068855_100356221 Ga0068855_1003562212 279
16 3300025291 Ga0209675_1005664 Ga0209675_10056644 279
17 3300025299 Ga0209256_1029324 Ga0209256_10293242 279
18 3300025949 Ga0207667_10213721 Ga0207667_102137212 279
19 3300037312 Ga0395899_0098510 Ga0395899_0098510_374_1228 279
20 3300037418 Ga0395900_0098655 Ga0395900_0098655_237_1091 279
21 3300005340 Ga0070689_100150898 Ga0070689_1001508982 280
22 3300031730 Ga0307516_10032356 Ga0307516_100323564 280
23 3300048929 Ga0496126_0096523 Ga0496126_0096523_1173_2018 280
24 3300049571 Ga0501034_0169425 Ga0501034_0169425_239_1084 280
25 3300053117 Ga0500593_068618 Ga0500593_068618_645_1490 280
26 3300053161 Ga0500634_0000017 Ga0500634_0000017_22157_23002 280
27 3300003214 JGI25165J46597_1002982 JGI25165J46597_10029824 281
28 3300003320 rootH2_10020588 rootH2_100205882 281
29 3300005539 Ga0068853_100005585 Ga0068853_1000055859 281
30 3300005563 Ga0068855_100694160 Ga0068855_1006941602 281
31 3300009545 Ga0105237_10000203 Ga0105237_1000020366 281
32 3300010375 Ga0105239_10048550 Ga0105239_100485503 281
33 3300013296 Ga0157374_10015143 Ga0157374_100151432 281
34 3300025231 Ga0207427_102165 Ga0207427_1021653 281
35 3300025261 Ga0209233_1001636 Ga0209233_10016365 281
36 3300025914 Ga0207671_10000177 Ga0207671_100001775 281
37 3300028379 Ga0268266_10000343 Ga0268266_1000034358 281
38 3300042004 Ga0439445_0017452 Ga0439445_0017452_85_945 281
39 3300048924 Ga0496121_0026205 Ga0496121_0026205_1901_2761 281
40 3300049573 Ga0501037_0148425 Ga0501037_0148425_342_1202 281
41 3300049581 Ga0501047_0249795 Ga0501047_0249795_685_1545 281
42 3300049822 Ga0501035_0118102 Ga0501035_0118102_926_1786 281
43 3300009174 Ga0105241_10551437 Ga0105241_105514372 282
44 3300009545 Ga0105237_10039891 Ga0105237_100398915 282
45 3300010375 Ga0105239_10095969 Ga0105239_100959694 282
46 3300025913 Ga0207695_10014432 Ga0207695_100144329 282
47 iso_pu_bacteria 2838680041 2838680503 282
48 iso_pu_bacteria 2838694306 2838695464 282
49 iso_pu_bacteria 2838707686 2838708841 282
50 iso_pu_bacteria 2842077413 2842079924 282
51 iso_pu_bacteria 2842118031 2842120542 282
52 iso_pu_bacteria 2842237096 2842238252 282
53 iso_pu_bacteria 2842291075 2842293585 282
54 iso_pu_bacteria 2842370503 2842370966 282
55 iso_pu_bacteria 2842377471 2842379982 282
56 iso_pu_bacteria 2842384541 2842387053 282
57 3300015690 Ga0183363_1003 Ga0183363_1003370 283
58 iso_pu_bacteria 2937063883 2937068340 283
59 3300031731 Ga0307405_10018812 Ga0307405_100188122 284
60 3300031911 Ga0307412_10000394 Ga0307412_1000039425 284
61 3300032004 Ga0307414_10000147 Ga0307414_1000014718 284
62 3300049571 Ga0501034_0012395 Ga0501034_0012395_5988_6857 284
63 3300049663 Ga0501223_000256 Ga0501223_000256_4379_5248 284
64 3300049664 Ga0501224_000034 Ga0501224_000034_9026_9895 284
65 3300049668 Ga0501233_002460 Ga0501233_002460_734_1603 284
66 3300049705 Ga0501225_0000865 Ga0501225_0000865_1025_1894 284
67 3300049853 Ga0501226_000038 Ga0501226_000038_9026_9895 284
68 3300045051 Ga0451576_0012411 Ga0451576_0012411_1960_2826 285
69 3300053136 Ga0500559_0007875 Ga0500559_0007875_3190_4107 286
70 3300049823 Ga0501044_0138692 Ga0501044_0138692_624_1511 289
71 iso_pu_bacteria 2551306086 2551696047 289
72 3300005539 Ga0068853_100716037 Ga0068853_1007160371 290
73 3300005548 Ga0070665_100006971 Ga0070665_1000069719 290
74 3300005548 Ga0070665_100030724 Ga0070665_1000307244 290
75 3300005548 Ga0070665_100183379 Ga0070665_1001833792 290
76 3300006358 Ga0068871_100241737 Ga0068871_1002417372 290
77 3300006881 Ga0068865_100056815 Ga0068865_1000568153 290
78 3300009093 Ga0105240_10033018 Ga0105240_100330187 290
79 3300009093 Ga0105240_10147525 Ga0105240_101475253 290
80 3300009093 Ga0105240_10406539 Ga0105240_104065392 290
81 3300009098 Ga0105245_10297941 Ga0105245_102979412 290
82 3300009174 Ga0105241_10082735 Ga0105241_100827352 290
83 3300009174 Ga0105241_10111945 Ga0105241_101119452 290
84 3300009545 Ga0105237_10003204 Ga0105237_100032047 290
85 3300009545 Ga0105237_10277405 Ga0105237_102774052 290
86 3300009551 Ga0105238_10004247 Ga0105238_100042478 290
87 3300009551 Ga0105238_10232263 Ga0105238_102322632 290
88 3300010375 Ga0105239_10065740 Ga0105239_100657403 290
89 3300010375 Ga0105239_10218730 Ga0105239_102187303 290
90 3300013102 Ga0157371_10003340 Ga0157371_100033408 290
91 3300013105 Ga0157369_10116422 Ga0157369_101164223 290
92 3300013105 Ga0157369_10371908 Ga0157369_103719082 290
93 3300014325 Ga0163163_10254834 Ga0163163_102548343 290
94 3300025909 Ga0207705_10101849 Ga0207705_101018492 290
95 3300025913 Ga0207695_10002526 Ga0207695_1000252618 290
96 3300025913 Ga0207695_10033067 Ga0207695_100330675 290
97 3300025924 Ga0207694_10014209 Ga0207694_100142091 290
98 3300025938 Ga0207704_10004867 Ga0207704_100048675 290
99 3300025949 Ga0207667_10025939 Ga0207667_100259393 290
100 3300028379 Ga0268266_10027728 Ga0268266_100277285 290
101 3300028379 Ga0268266_10043210 Ga0268266_100432102 290
102 3300031691 Ga0316579_10096290 Ga0316579_100962902 290
103 3300037466 Ga0395898_0129690 Ga0395898_0129690_131_1021 290
104 3300038443 Ga0395901_0241671 Ga0395901_0241671_240_1130 290
105 3300048919 Ga0496116_0000100 Ga0496116_0000100_104558_105466 290
106 3300048925 Ga0496122_0063563 Ga0496122_0063563_924_1832 290
107 3300048929 Ga0496126_0000094 Ga0496126_0000094_190194_191102 290
108 3300048924 Ga0496121_0190280 Ga0496121_0190280_256_1134 291
109 3300050492 nmdc:mga0yw44_439_c1 nmdc:mga0yw44_439_c1_2596_3504 291
110 3300026078 Ga0207702_10433469 Ga0207702_104334692 292
111 3300033180 Ga0307510_10144528 Ga0307510_101445282 292
112 3300033180 Ga0307510_10237844 Ga0307510_102378442 292
113 3300038741 Ga0400488_40386 Ga0400488_40386_815_1693 292
114 3300053156 Ga0500622_0013526 Ga0500622_0013526_3033_3914 292
115 3300049581 Ga0501047_0195815 Ga0501047_0195815_937_1818 293
116 3300022739 Ga0228711_1000019 Ga0228711_100001981 294
117 3300022740 Ga0228710_1000022 Ga0228710_100002281 294
118 3300027111 Ga0209281_1000227 Ga0209281_100022787 294
119 3300027666 Ga0209282_1000042 Ga0209282_100004287 294
120 3300031967 Ga0315914_1000009 Ga0315914_100000940 294
121 3300033430 Ga0315913_1000015 Ga0315913_100001587 294
122 3300033464 Ga0315915_1000013 Ga0315915_1000013148 294
123 iso_pu_bacteria 8002285264 8002287269 294
124 iso_pu_bacteria 2738543024 2739306123 295
125 iso_pu_bacteria 2838022645 2838025723 295
126 iso_pu_bacteria 2842163707 2842169611 295
127 iso_pu_bacteria 2842192696 2842192805 295
128 iso_pu_bacteria 2842198810 2842202874 295
129 iso_pu_bacteria 2842217011 2842218875 295
130 iso_pu_bacteria 2842495871 2842500121 295
131 iso_pu_bacteria 2842521101 2842521617 295
132 iso_pu_bacteria 2929138655 2929138729 295
133 3300046501 Ga0495607_0023280 Ga0495607_0023280_1168_2058 296
134 3300049776 Ga0501280_004240 Ga0501280_004240_670_1560 296
135 iso_pu_bacteria 2510461069 2510841138 296
136 iso_pu_bacteria 2582581866 2585391985 296
137 iso_pu_bacteria 2643221637 2644206785 296
138 iso_pu_bacteria 2643221653 2644297714 296
139 iso_pu_bacteria 2643221718 2644650433 296
140 iso_pu_bacteria 2643221719 2644655967 296
141 iso_pu_bacteria 2667528174 2671113742 296
142 iso_pu_bacteria 2818991272 2819245244 296
143 iso_pu_bacteria 2989771324 2989772712 296
144 iso_pu_bacteria 2989776772 2989777344 296
145 iso_pu_bacteria 8005246636 8005247468 296
146 3300025284 Ga0209130_1011228 Ga0209130_10112282 297
147 3300025284 Ga0209130_1019596 Ga0209130_10195962 297
148 3300028794 Ga0307515_10000121 Ga0307515_1000012186 297
149 3300031456 Ga0307513_10195090 Ga0307513_101950903 297
150 3300048920 Ga0496117_0047858 Ga0496117_0047858_2005_2904 297
151 3300048922 Ga0496119_0021672 Ga0496119_0021672_1322_2221 297
152 3300048923 Ga0496120_0018092 Ga0496120_0018092_2188_3087 297
153 3300048924 Ga0496121_0000001 Ga0496121_0000001_164169_165068 297
154 3300048925 Ga0496122_0166022 Ga0496122_0166022_47_946 297
155 3300048926 Ga0496123_0069336 Ga0496123_0069336_790_1689 297
156 3300048928 Ga0496125_0000001 Ga0496125_0000001_277611_278510 297
157 3300050491 nmdc:mga00v17_140754_c1 nmdc:mga00v17_140754_c1_346_1245 297
158 3300053158 Ga0500627_0019420 Ga0500627_0019420_606_1505 297
159 iso_pu_bacteria 2513237159 2513996687 297
160 iso_pu_bacteria 2738541317 2738948327 297
161 iso_pu_bacteria 2775507049 2776911992 297
162 iso_pu_bacteria 2899803654 2899805382 297
163 iso_pu_bacteria 2913308742 2913313331 297
164 iso_pu_bacteria 2989349275 2989351490 297
165 3300028794 Ga0307515_10314605 Ga0307515_103146052 298
166 3300031901 Ga0307406_10043976 Ga0307406_100439762 298
167 3300031911 Ga0307412_10082914 Ga0307412_100829142 298
168 3300031995 Ga0307409_100066807 Ga0307409_1000668074 298
169 3300035695 Ga0373927_0000086 Ga0373927_0000086_42651_43553 298
170 3300037068 Ga0373925_0008735 Ga0373925_0008735_6337_7239 298
171 3300037471 Ga0395905_0000775 Ga0395905_0000775_12947_13849 298
172 3300037471 Ga0395905_0002869 Ga0395905_0002869_713_1615 298
173 3300046460 Ga0495638_0000788 Ga0495638_0000788_21529_22425 298
174 3300046471 Ga0495650_0039550 Ga0495650_0039550_981_1877 298
175 3300046474 Ga0495605_0007669 Ga0495605_0007669_4814_5710 298
176 3300046501 Ga0495607_0077205 Ga0495607_0077205_321_1217 298
177 3300046506 Ga0495583_0034401 Ga0495583_0034401_705_1601 298
178 3300046518 Ga0495631_0076091 Ga0495631_0076091_80_976 298
179 3300046538 Ga0495609_0025818 Ga0495609_0025818_803_1699 298
180 3300046616 Ga0495668_0003954 Ga0495668_0003954_8314_9210 298
181 3300046648 Ga0495611_0010307 Ga0495611_0010307_1844_2740 298
182 3300046660 Ga0495625_0005054 Ga0495625_0005054_11309_12205 298
183 3300046691 Ga0495670_0033964 Ga0495670_0033964_1278_2174 298
184 3300046692 Ga0495671_0122081 Ga0495671_0122081_298_1194 298
185 3300047320 Ga0495672_0107347 Ga0495672_0107347_287_1183 298
186 3300049460 Ga0495682_0020262 Ga0495682_0020262_720_1616 298
187 3300053079 Ga0500610_0029107 Ga0500610_0029107_1154_2050 298
188 3300053088 Ga0500644_0003697 Ga0500644_0003697_1500_2402 298
189 3300053122 Ga0500608_030758 Ga0500608_030758_647_1549 298
190 3300053136 Ga0500559_0006632 Ga0500559_0006632_3464_4366 298
191 3300053139 Ga0500568_0020058 Ga0500568_0020058_677_1573 298
192 3300053153 Ga0500616_0002453 Ga0500616_0002453_13604_14500 298
193 3300053156 Ga0500622_0019253 Ga0500622_0019253_2571_3473 298
194 iso_pu_bacteria 2508501122 2509106965 298
195 iso_pu_bacteria 2509276019 2509375079 298
196 iso_pu_bacteria 2509276021 2509388517 298
197 iso_pu_bacteria 2509276033 2509444067 298
198 iso_pu_bacteria 2510065019 2510131336 298
199 iso_pu_bacteria 2510065057 2510303575 298
200 iso_pu_bacteria 2510461076 2510897690 298
201 iso_pu_bacteria 2510917022 2511134793 298
202 iso_pu_bacteria 2510917026 2511171242 298
203 iso_pu_bacteria 2510917028 2511184711 298
204 iso_pu_bacteria 2510917030 2511195324 298
205 iso_pu_bacteria 2511231052 2511500447 298
206 iso_pu_bacteria 2512047086 2512531907 298
207 iso_pu_bacteria 2512875026 2512972763 298
208 iso_pu_bacteria 2513237084 2513570554 298
209 iso_pu_bacteria 2513237085 2513580293 298
210 iso_pu_bacteria 2513237086 2513585423 298
211 iso_pu_bacteria 2513237088 2513596656 298
212 iso_pu_bacteria 2513237089 2513602848 298
213 iso_pu_bacteria 2513237091 2513616672 298
214 iso_pu_bacteria 2513237093 2513634173 298
215 iso_pu_bacteria 2513237103 2513707039 298
216 iso_pu_bacteria 2513237138 2513864931 298
217 iso_pu_bacteria 2513237140 2513885639 298
218 iso_pu_bacteria 2513237143 2513904010 298
219 iso_pu_bacteria 2513237144 2513910275 298
220 iso_pu_bacteria 2513237146 2513929785 298
221 iso_pu_bacteria 2513237160 2514005100 298
222 iso_pu_bacteria 2513237162 2514020324 298
223 iso_pu_bacteria 2515075009 2515110289 298
224 iso_pu_bacteria 2515154107 2515607649 298
225 iso_pu_bacteria 2515154113 2515634497 298
226 iso_pu_bacteria 2515154114 2515643722 298
227 iso_pu_bacteria 2515154116 2515657120 298
228 iso_pu_bacteria 2515154134 2515743380 298
229 iso_pu_bacteria 2516653046 2516891780 298
230 iso_pu_bacteria 2516653077 2517038974 298
231 iso_pu_bacteria 2516653085 2517079240 298
232 iso_pu_bacteria 2517093000 2517093168 298
233 iso_pu_bacteria 2517287029 2517409438 298
234 iso_pu_bacteria 2517487022 2517568578 298
235 iso_pu_bacteria 2519899620 2520375570 298
236 iso_pu_bacteria 2524023207 2524450606 298
237 iso_pu_bacteria 2524023209 2524458283 298
238 iso_pu_bacteria 2529292951 2530647899 298
239 iso_pu_bacteria 2534681796 2535515018 298
240 iso_pu_bacteria 2537561587 2537876002 298
241 iso_pu_bacteria 2551306084 2551677069 298
242 iso_pu_bacteria 2551306085 2551684035 298
243 iso_pu_bacteria 2554235003 2554246550 298
244 iso_pu_bacteria 2558860100 2558866183 298
245 iso_pu_bacteria 2558860242 2559293725 298
246 iso_pu_bacteria 2558860983 2561467007 298
247 iso_pu_bacteria 2582581283 2585164921 298
248 iso_pu_bacteria 2582581294 2585203595 298
249 iso_pu_bacteria 2582581298 2585223683 298
250 iso_pu_bacteria 2582581299 2585229741 298
251 iso_pu_bacteria 2582581304 2585255993 298
252 iso_pu_bacteria 2582581306 2585265297 298
253 iso_pu_bacteria 2582581307 2585273859 298
254 iso_pu_bacteria 2582581308 2585280160 298
255 iso_pu_bacteria 2582581315 2585326059 298
256 iso_pu_bacteria 2582581316 2585330228 298
257 iso_pu_bacteria 2582581865 2585385569 298
258 iso_pu_bacteria 2582581867 2585398628 298
259 iso_pu_bacteria 2585427526 2585529344 298
260 iso_pu_bacteria 2585427527 2585533589 298
261 iso_pu_bacteria 2585427528 2585539605 298
262 iso_pu_bacteria 2585427529 2585545721 298
263 iso_pu_bacteria 2585427530 2585553178 298
264 iso_pu_bacteria 2585427531 2585560035 298
265 iso_pu_bacteria 2585427590 2585819222 298
266 iso_pu_bacteria 2585427593 2585837562 298
267 iso_pu_bacteria 2585427594 2585844128 298
268 iso_pu_bacteria 2585427608 2585900710 298
269 iso_pu_bacteria 2585427609 2585905785 298
270 iso_pu_bacteria 2585427633 2585994314 298
271 iso_pu_bacteria 2585427634 2585998772 298
272 iso_pu_bacteria 2585428125 2587979099 298
273 iso_pu_bacteria 2599185156 2599332934 298
274 iso_pu_bacteria 2599185170 2599419267 298
275 iso_pu_bacteria 2599185210 2599606033 298
276 iso_pu_bacteria 2599185236 2599719629 298
277 iso_pu_bacteria 2599185352 2600191373 298
278 iso_pu_bacteria 2600254933 2600374625 298
279 iso_pu_bacteria 2600255279 2601609250 298
280 iso_pu_bacteria 2600255308 2601746025 298
281 iso_pu_bacteria 2615840624 2616297037 298
282 iso_pu_bacteria 2615840626 2616310293 298
283 iso_pu_bacteria 2615840698 2616553326 298
284 iso_pu_bacteria 2617270742 2617380341 298
285 iso_pu_bacteria 2643221557 2643806208 298
286 iso_pu_bacteria 2643221558 2643812838 298
287 iso_pu_bacteria 2643221568 2643855224 298
288 iso_pu_bacteria 2643221599 2644004820 298
289 iso_pu_bacteria 2643221607 2644047232 298
290 iso_pu_bacteria 2643221610 2644070188 298
291 iso_pu_bacteria 2643221618 2644103324 298
292 iso_pu_bacteria 2643221626 2644144263 298
293 iso_pu_bacteria 2643221634 2644190497 298
294 iso_pu_bacteria 2643221636 2644199603 298
295 iso_pu_bacteria 2643221643 2644241624 298
296 iso_pu_bacteria 2643221655 2644306254 298
297 iso_pu_bacteria 2643221659 2644330503 298
298 iso_pu_bacteria 2643221668 2644377470 298
299 iso_pu_bacteria 2643221675 2644420950 298
300 iso_pu_bacteria 2643221680 2644454473 298
301 iso_pu_bacteria 2643221686 2644480021 298
302 iso_pu_bacteria 2643221688 2644492323 298
303 iso_pu_bacteria 2643221689 2644496834 298
304 iso_pu_bacteria 2643221693 2644519308 298
305 iso_pu_bacteria 2643221698 2644542750 298
306 iso_pu_bacteria 2643221712 2644611865 298
307 iso_pu_bacteria 2643221723 2644671886 298
308 iso_pu_bacteria 2643221726 2644692411 298
309 iso_pu_bacteria 2657244999 2657681821 298
310 iso_pu_bacteria 2690316117 2692317332 298
311 iso_pu_bacteria 2718217882 2719179489 298
312 iso_pu_bacteria 2718217927 2719384045 298
313 iso_pu_bacteria 2718217997 2719663836 298
314 iso_pu_bacteria 2718218009 2719730159 298
315 iso_pu_bacteria 2718218199 2720490255 298
316 iso_pu_bacteria 2718218232 2720611632 298
317 iso_pu_bacteria 2718218233 2720618481 298
318 iso_pu_bacteria 2718218235 2720629889 298
319 iso_pu_bacteria 2718218269 2720773584 298
320 iso_pu_bacteria 2718218363 2721145582 298
321 iso_pu_bacteria 2718218365 2721157099 298
322 iso_pu_bacteria 2718218366 2721162461 298
323 iso_pu_bacteria 2718218423 2721397815 298
324 iso_pu_bacteria 2721755514 2722838631 298
325 iso_pu_bacteria 2721755556 2723025255 298
326 iso_pu_bacteria 2721755684 2723558840 298
327 iso_pu_bacteria 2721755685 2723565410 298
328 iso_pu_bacteria 2721755809 2724036625 298
329 iso_pu_bacteria 2721755810 2724042915 298
330 iso_pu_bacteria 2721755819 2724088191 298
331 iso_pu_bacteria 2721755822 2724102675 298
332 iso_pu_bacteria 2721755823 2724108571 298
333 iso_pu_bacteria 2724679232 2725948914 298
334 iso_pu_bacteria 2728369352 2730106191 298
335 iso_pu_bacteria 2728369365 2730162726 298
336 iso_pu_bacteria 2728369397 2730296731 298
337 iso_pu_bacteria 2738541293 2738801319 298
338 iso_pu_bacteria 2738541333 2739036995 298
339 iso_pu_bacteria 2751185821 2753461269 298
340 iso_pu_bacteria 2765235942 2766062836 298
341 iso_pu_bacteria 2775507266 2778179636 298
342 iso_pu_bacteria 2791355082 2792582997 298
343 iso_pu_bacteria 2791355091 2792623884 298
344 iso_pu_bacteria 2791355092 2792629736 298
345 iso_pu_bacteria 2791355094 2792638069 298
346 iso_pu_bacteria 2791355253 2793282068 298
347 iso_pu_bacteria 2791355256 2793295288 298
348 iso_pu_bacteria 2791355259 2793316410 298
349 iso_pu_bacteria 2791355260 2793323360 298
350 iso_pu_bacteria 2791355261 2793326246 298
351 iso_pu_bacteria 2791355262 2793334307 298
352 iso_pu_bacteria 2791355263 2793341886 298
353 iso_pu_bacteria 2791355264 2793348223 298
354 iso_pu_bacteria 2791355265 2793355711 298
355 iso_pu_bacteria 2791355266 2793361592 298
356 iso_pu_bacteria 2791355267 2793364596 298
357 iso_pu_bacteria 2802428858 2802720389 298
358 iso_pu_bacteria 2802428859 2802726209 298
359 iso_pu_bacteria 2802428860 2802731627 298
360 iso_pu_bacteria 2802428861 2802739378 298
361 iso_pu_bacteria 2802428862 2802742520 298
362 iso_pu_bacteria 2802428863 2802749225 298
363 iso_pu_bacteria 2802429268 2804750841 298
364 iso_pu_bacteria 2802429605 2805929291 298
365 iso_pu_bacteria 2802429606 2805932450 298
366 iso_pu_bacteria 2802429633 2806047623 298
367 iso_pu_bacteria 2802429634 2806055042 298
368 iso_pu_bacteria 2802429635 2806062056 298
369 iso_pu_bacteria 2802429636 2806067218 298
370 iso_pu_bacteria 2802429637 2806076539 298
371 iso_pu_bacteria 2808606387 2808986447 298
372 iso_pu_bacteria 2818991439 2819556577 298
373 iso_pu_bacteria 2818991448 2819608489 298
374 iso_pu_bacteria 2818991453 2819640594 298
375 iso_pu_bacteria 2818991461 2819686239 298
376 iso_pu_bacteria 2821123053 2821123558 298
377 iso_pu_bacteria 2838016132 2838020204 298
378 iso_pu_bacteria 2838029111 2838029372 298
379 iso_pu_bacteria 2838035591 2838037049 298
380 iso_pu_bacteria 2838042994 2838044518 298
381 iso_pu_bacteria 2838048938 2838051580 298
382 iso_pu_bacteria 2838061910 2838064055 298
383 iso_pu_bacteria 2838068647 2838071030 298
384 iso_pu_bacteria 2838074704 2838075294 298
385 iso_pu_bacteria 2838661181 2838663774 298
386 iso_pu_bacteria 2838668709 2838672475 298
387 iso_pu_bacteria 2838675328 2838677305 298
388 iso_pu_bacteria 2838686498 2838691663 298
389 iso_pu_bacteria 2838701080 2838703783 298
390 iso_pu_bacteria 2838714209 2838716193 298
391 iso_pu_bacteria 2838719591 2838720007 298
392 iso_pu_bacteria 2838724970 2838726945 298
393 iso_pu_bacteria 2838729681 2838733853 298
394 iso_pu_bacteria 2838736955 2838739408 298
395 iso_pu_bacteria 2838742623 2838747083 298
396 iso_pu_bacteria 2841840854 2841843306 298
397 iso_pu_bacteria 2841846520 2841846939 298
398 iso_pu_bacteria 2841851746 2841856224 298
399 iso_pu_bacteria 2841859092 2841860533 298
400 iso_pu_bacteria 2841864319 2841866893 298
401 iso_pu_bacteria 2842110456 2842112129 298
402 iso_pu_bacteria 2842124991 2842127032 298
403 iso_pu_bacteria 2842130223 2842132198 298
404 iso_pu_bacteria 2842140634 2842145973 298
405 iso_pu_bacteria 2842146304 2842148425 298
406 iso_pu_bacteria 2842152218 2842152633 298
407 iso_pu_bacteria 2842156927 2842162012 298
408 iso_pu_bacteria 2842170452 2842172438 298
409 iso_pu_bacteria 2842175837 2842176252 298
410 iso_pu_bacteria 2842180545 2842185854 298
411 iso_pu_bacteria 2842187318 2842189300 298
412 iso_pu_bacteria 2842205361 2842207032 298
413 iso_pu_bacteria 2842211629 2842213614 298
414 iso_pu_bacteria 2842224351 2842224768 298
415 iso_pu_bacteria 2842229732 2842235382 298
416 iso_pu_bacteria 2842243621 2842248163 298
417 iso_pu_bacteria 2842250916 2842253491 298
418 iso_pu_bacteria 2842257432 2842262243 298
419 iso_pu_bacteria 2842264693 2842268842 298
420 iso_pu_bacteria 2842271015 2842276636 298
421 iso_pu_bacteria 2842278818 2842280275 298
422 iso_pu_bacteria 2842285085 2842286757 298
423 iso_pu_bacteria 2842298080 2842299531 298
424 iso_pu_bacteria 2842304105 2842306582 298
425 iso_pu_bacteria 2842311132 2842312702 298
426 iso_pu_bacteria 2842317721 2842322433 298
427 iso_pu_bacteria 2842341865 2842343155 298
428 iso_pu_bacteria 2842357229 2842360958 298
429 iso_pu_bacteria 2842363717 2842367120 298
430 iso_pu_bacteria 2842395702 2842399167 298
431 iso_pu_bacteria 2842402390 2842403690 298
432 iso_pu_bacteria 2842409023 2842410608 298
433 iso_pu_bacteria 2842415677 2842417254 298
434 iso_pu_bacteria 2842422224 2842424645 298
435 iso_pu_bacteria 2842428310 2842432958 298
436 iso_pu_bacteria 2842434925 2842439263 298
437 iso_pu_bacteria 2842441272 2842445892 298
438 iso_pu_bacteria 2842447887 2842451927 298
439 iso_pu_bacteria 2842462802 2842467078 298
440 iso_pu_bacteria 2842469257 2842473894 298
441 iso_pu_bacteria 2842475841 2842476198 298
442 iso_pu_bacteria 2842482326 2842487663 298
443 iso_pu_bacteria 2842489311 2842492541 298
444 iso_pu_bacteria 2842502639 2842502900 298
445 iso_pu_bacteria 2842509118 2842509124 298
446 iso_pu_bacteria 2842515876 2842517318 298
447 iso_pu_bacteria 2842922631 2842923242 298
448 iso_pu_bacteria 2844163670 2844165169 298
449 iso_pu_bacteria 2844454524 2844456072 298
450 iso_pu_bacteria 2847417321 2847417599 298
451 iso_pu_bacteria 2848992105 2848992405 298
452 iso_pu_bacteria 2850079185 2850079901 298
453 iso_pu_bacteria 2852387548 2852388397 298
454 iso_pu_bacteria 2854896431 2854898181 298
455 iso_pu_bacteria 2854916844 2854919863 298
456 iso_pu_bacteria 2855825444 2855828148 298
457 iso_pu_bacteria 2855839649 2855839920 298
458 iso_pu_bacteria 2855872281 2855873456 298
459 iso_pu_bacteria 2857516855 2857521725 298
460 iso_pu_bacteria 2857531043 2857531121 298
461 iso_pu_bacteria 2858800743 2858803893 298
462 iso_pu_bacteria 2891373044 2891375014 298
463 iso_pu_bacteria 2896384573 2896391632 298
464 iso_pu_bacteria 2899792073 2899792615 298
465 iso_pu_bacteria 2899845264 2899846015 298
466 iso_pu_bacteria 2913295892 2913298068 298
467 iso_pu_bacteria 2915980308 2915980708 298
468 iso_pu_bacteria 2915986958 2915990582 298
469 iso_pu_bacteria 2915993759 2915998225 298
470 iso_pu_bacteria 2916000859 2916001029 298
471 iso_pu_bacteria 2916007675 2916011080 298
472 iso_pu_bacteria 2916014648 2916015500 298
473 iso_pu_bacteria 2916021584 2916025423 298
474 iso_pu_bacteria 2916028427 2916031109 298
475 iso_pu_bacteria 2916035215 2916036436 298
476 iso_pu_bacteria 2916041962 2916045647 298
477 iso_pu_bacteria 2916048683 2916053748 298
478 iso_pu_bacteria 2916055098 2916057327 298
479 iso_pu_bacteria 2916061851 2916063725 298
480 iso_pu_bacteria 2916068649 2916069640 298
481 iso_pu_bacteria 2919100787 2919101431 298
482 iso_pu_bacteria 2919114240 2919116396 298
483 iso_pu_bacteria 2919166419 2919166795 298
484 iso_pu_bacteria 2919171160 2919172177 298
485 iso_pu_bacteria 2919408235 2919408719 298
486 iso_pu_bacteria 2920760137 2920763472 298
487 iso_pu_bacteria 2920822456 2920823292 298
488 iso_pu_bacteria 2921201388 2921207017 298
489 iso_pu_bacteria 2921208531 2921212213 298
490 iso_pu_bacteria 2921237296 2921242029 298
491 iso_pu_bacteria 2921244191 2921248895 298
492 iso_pu_bacteria 2921250672 2921257234 298
493 iso_pu_bacteria 2921257292 2921260943 298
494 iso_pu_bacteria 2921263974 2921266402 298
495 iso_pu_bacteria 2921282425 2921288489 298
496 iso_pu_bacteria 2921289301 2921294458 298
497 iso_pu_bacteria 2921296804 2921300176 298
498 iso_pu_bacteria 2923556063 2923557065 298
499 iso_pu_bacteria 2924144063 2924149833 298
500 iso_pu_bacteria 2924150972 2924156580 298
501 iso_pu_bacteria 2924158325 2924163418 298
502 iso_pu_bacteria 2924165586 2924170408 298
503 iso_pu_bacteria 2924172951 2924177691 298
504 iso_pu_bacteria 2924179722 2924183545 298
505 iso_pu_bacteria 2924186466 2924190781 298
506 iso_pu_bacteria 2924193448 2924199082 298
507 iso_pu_bacteria 2924200457 2924205614 298
508 iso_pu_bacteria 2924207177 2924209126 298
509 iso_pu_bacteria 2924214083 2924215226 298
510 iso_pu_bacteria 2924221636 2924228354 298
511 iso_pu_bacteria 2924228884 2924232842 298
512 iso_pu_bacteria 2926754445 2926757350 298
513 iso_pu_bacteria 2926760298 2926761566 298
514 iso_pu_bacteria 2933006813 2933007278 298
515 iso_pu_bacteria 2933011516 2933015131 298
516 iso_pu_bacteria 2933570622 2933573651 298
517 iso_pu_bacteria 2933586486 2933587457 298
518 iso_pu_bacteria 2933594066 2933594483 298
519 iso_pu_bacteria 2933599457 2933601829 298
520 iso_pu_bacteria 2935894831 2935895988 298
521 iso_pu_bacteria 2935901341 2935907246 298
522 iso_pu_bacteria 2936367885 2936369010 298
523 iso_pu_bacteria 2936375103 2936378374 298
524 iso_pu_bacteria 2936381700 2936383661 298
525 iso_pu_bacteria 2936996657 2936997855 298
526 iso_pu_bacteria 2937002841 2937007614 298
527 iso_pu_bacteria 2937009748 2937014862 298
528 iso_pu_bacteria 2937016420 2937022394 298
529 iso_pu_bacteria 2937023124 2937023282 298
530 iso_pu_bacteria 2937029754 2937034604 298
531 iso_pu_bacteria 2937036028 2937041235 298
532 iso_pu_bacteria 2937042894 2937045988 298
533 iso_pu_bacteria 2937049772 2937051829 298
534 iso_pu_bacteria 2937056579 2937062640 298
535 iso_pu_bacteria 2937071275 2937074843 298
536 iso_pu_bacteria 2937078374 2937078816 298
537 iso_pu_bacteria 2937084907 2937089102 298
538 iso_pu_bacteria 2937091812 2937095206 298
539 iso_pu_bacteria 2937098957 2937104396 298
540 iso_pu_bacteria 2937106411 2937112408 298
541 iso_pu_bacteria 2937113482 2937119566 298
542 iso_pu_bacteria 2937119839 2937126096 298
543 iso_pu_bacteria 2937126314 2937131519 298
544 iso_pu_bacteria 2941499720 2941500796 298
545 iso_pu_bacteria 2957375807 2957382132 298
546 iso_pu_bacteria 2957382221 2957388582 298
547 iso_pu_bacteria 2957388812 2957393991 298
548 iso_pu_bacteria 2957395598 2957399079 298
549 iso_pu_bacteria 2957402308 2957403340 298
550 iso_pu_bacteria 2957408893 2957412038 298
551 iso_pu_bacteria 2957415311 2957418140 298
552 iso_pu_bacteria 2957422303 2957423935 298
553 iso_pu_bacteria 2957430029 2957434067 298
554 iso_pu_bacteria 2957437181 2957442563 298
555 iso_pu_bacteria 2957443900 2957447203 298
556 iso_pu_bacteria 2957450854 2957455236 298
557 iso_pu_bacteria 2957457609 2957462747 298
558 iso_pu_bacteria 2957464669 2957466239 298
559 iso_pu_bacteria 2957471148 2957473703 298
560 iso_pu_bacteria 2957478035 2957479708 298
561 iso_pu_bacteria 2957484790 2957484925 298
562 iso_pu_bacteria 2957491536 2957496110 298
563 iso_pu_bacteria 2957498199 2957500572 298
564 iso_pu_bacteria 2957505466 2957508219 298
565 iso_pu_bacteria 2960584000 2960589379 298
566 iso_pu_bacteria 2960591022 2960594691 298
567 iso_pu_bacteria 2960597568 2960603486 298
568 iso_pu_bacteria 2960603979 2960608765 298
569 iso_pu_bacteria 2960610863 2960614410 298
570 iso_pu_bacteria 2960617483 2960621621 298
571 iso_pu_bacteria 2960624210 2960628915 298
572 iso_pu_bacteria 2960631154 2960637532 298
573 iso_pu_bacteria 2960637947 2960645045 298
574 iso_pu_bacteria 2960645483 2960647991 298
575 iso_pu_bacteria 2960652885 2960658368 298
576 iso_pu_bacteria 2960660292 2960660487 298
577 iso_pu_bacteria 2960667422 2960672278 298
578 iso_pu_bacteria 2960674078 2960677196 298
579 iso_pu_bacteria 2960680706 2960686536 298
580 iso_pu_bacteria 2960687367 2960690391 298
581 iso_pu_bacteria 2960693952 2960698899 298
582 iso_pu_bacteria 2964607997 2964613080 298
583 iso_pu_bacteria 2964615318 2964618942 298
584 iso_pu_bacteria 2964621998 2964627997 298
585 iso_pu_bacteria 2964628898 2964632729 298
586 iso_pu_bacteria 2964636051 2964639021 298
587 iso_pu_bacteria 2964643177 2964649289 298
588 iso_pu_bacteria 2964649959 2964650256 298
589 iso_pu_bacteria 2964656573 2964661142 298
590 iso_pu_bacteria 2964663802 2964668187 298
591 iso_pu_bacteria 2964670856 2964675531 298
592 iso_pu_bacteria 2964678106 2964683367 298
593 iso_pu_bacteria 2964685014 2964690626 298
594 iso_pu_bacteria 2964691889 2964694685 298
595 iso_pu_bacteria 2964698721 2964700585 298
596 iso_pu_bacteria 2964705432 2964709900 298
597 iso_pu_bacteria 2964712639 2964717322 298
598 iso_pu_bacteria 2964719344 2964722984 298
599 iso_pu_bacteria 2967664464 2967667807 298
600 iso_pu_bacteria 2967671571 2967675342 298
601 iso_pu_bacteria 2967678726 2967684779 298
602 iso_pu_bacteria 2967686174 2967691450 298
603 iso_pu_bacteria 2967693043 2967694994 298
604 iso_pu_bacteria 2967699805 2967705139 298
605 iso_pu_bacteria 2967706974 2967712175 298
606 iso_pu_bacteria 2967714385 2967714588 298
607 iso_pu_bacteria 2967721400 2967722537 298
608 iso_pu_bacteria 2967728569 2967730483 298
609 iso_pu_bacteria 2967735183 2967739338 298
610 iso_pu_bacteria 2967742019 2967748257 298
611 iso_pu_bacteria 2967748971 2967754977 298
612 iso_pu_bacteria 2967755722 2967759313 298
613 iso_pu_bacteria 2967762386 2967766465 298
614 iso_pu_bacteria 2967769361 2967774657 298
615 iso_pu_bacteria 2967775926 2967782539 298
616 iso_pu_bacteria 2970019648 2970022851 298
617 iso_pu_bacteria 2970026789 2970030504 298
618 iso_pu_bacteria 2970033650 2970037020 298
619 iso_pu_bacteria 2970040964 2970041205 298
620 iso_pu_bacteria 2970047711 2970052795 298
621 iso_pu_bacteria 2970054988 2970056752 298
622 iso_pu_bacteria 2970061556 2970067911 298
623 iso_pu_bacteria 2970068827 2970073946 298
624 iso_pu_bacteria 2970076120 2970081683 298
625 iso_pu_bacteria 2970082768 2970088475 298
626 iso_pu_bacteria 2970088815 2970091362 298
627 iso_pu_bacteria 2970095765 2970102010 298
628 iso_pu_bacteria 2970102677 2970105893 298
629 iso_pu_bacteria 2970109326 2970115666 298
630 iso_pu_bacteria 2970116247 2970117532 298
631 iso_pu_bacteria 2970122695 2970124316 298
632 iso_pu_bacteria 2970129317 2970131492 298
633 iso_pu_bacteria 2970136068 2970136699 298
634 iso_pu_bacteria 2970143518 2970147691 298
635 iso_pu_bacteria 2970149975 2970151780 298
636 iso_pu_bacteria 2970156795 2970163334 298
637 iso_pu_bacteria 2970164137 2970170012 298
638 iso_pu_bacteria 2970170962 2970175734 298
639 iso_pu_bacteria 2970177841 2970181974 298
640 iso_pu_bacteria 2970184632 2970191768 298
641 iso_pu_bacteria 2970191845 2970196650 298
642 iso_pu_bacteria 2977516862 2977519983 298
643 iso_pu_bacteria 2977523885 2977528388 298
644 iso_pu_bacteria 2977530762 2977535786 298
645 iso_pu_bacteria 2977537788 2977543891 298
646 iso_pu_bacteria 2977544691 2977549540 298
647 iso_pu_bacteria 2977551784 2977553602 298
648 iso_pu_bacteria 2977558990 2977564820 298
649 iso_pu_bacteria 2977565890 2977571826 298
650 iso_pu_bacteria 2977572785 2977574587 298
651 iso_pu_bacteria 2977579622 2977584529 298
652 iso_pu_bacteria 2978969890 2978973211 298
653 iso_pu_bacteria 2979089926 2979093144 298
654 iso_pu_bacteria 2979095461 2979099469 298
655 iso_pu_bacteria 2979100975 2979105112 298
656 iso_pu_bacteria 2984509177 2984513047 298
657 iso_pu_bacteria 2984518228 2984520589 298
658 iso_pu_bacteria 2984537506 2984539883 298
659 iso_pu_bacteria 2984587000 2984591460 298
660 iso_pu_bacteria 2984601300 2984602090 298
661 iso_pu_bacteria 2996887358 2996888434 298
662 iso_pu_bacteria 2996893221 2996893353 298
663 iso_pu_bacteria 3003930520 3003931871 298
664 iso_pu_bacteria 3005409236 3005411151 298
665 iso_pu_bacteria 3005416602 3005422889 298
666 iso_pu_bacteria 3005445848 3005446102 298
667 iso_pu_bacteria 639633055 639646568 298
668 iso_pu_bacteria 643692032 643824464 298
669 iso_pu_bacteria 648276728 648741578 298
670 iso_pu_bacteria 650716007 650738967 298
671 iso_pu_bacteria 8003570095 8003572599 298
672 iso_pu_bacteria 8003992118 8003992372 298
673 iso_pu_bacteria 8003999396 8003999701 298
674 iso_pu_bacteria 8005258706 8005261006 298
675 iso_pu_bacteria 8005275841 8005278756 298
676 iso_pu_bacteria 8005282627 8005289090 298
677 iso_pu_bacteria 8005289223 8005291164 298
678 iso_pu_bacteria 8005301065 8005301469 298
679 iso_pu_bacteria 8005307578 8005309276 298
680 iso_pu_bacteria 8005314921 8005321575 298
681 iso_pu_bacteria 8005321885 8005322961 298
682 iso_pu_bacteria 8005376324 8005377516 298
683 iso_pu_bacteria 8005382845 8005387378 298
684 iso_pu_bacteria 8005395548 8005400044 298
685 iso_pu_bacteria 8005430974 8005432850 298
686 iso_pu_bacteria 8005460587 8005460928 298
687 iso_pu_bacteria 8005484373 8005484867 298
688 iso_pu_bacteria 8005497431 8005498580 298
689 iso_pu_bacteria 8005542996 8005543690 298
690 iso_pu_bacteria 8005556819 8005560541 298
691 iso_pu_bacteria 8005563573 8005564001 298
692 iso_pu_bacteria 8005570704 8005576840 298
693 iso_pu_bacteria 8005619151 8005619772 298
694 iso_pu_bacteria 8005626139 8005628344 298
695 iso_pu_bacteria 8005645114 8005649561 298
696 iso_pu_bacteria 8005658619 8005660701 298
697 iso_pu_bacteria 8005668836 8005669991 298
698 iso_pu_bacteria 8005682033 8005685196 298
699 iso_pu_bacteria 8005688590 8005690185 298
700 iso_pu_bacteria 8005695170 8005699335 298
701 iso_pu_bacteria 8018127388 8018133040 298
702 iso_pu_bacteria 8018150411 8018153007 298
703 iso_pu_bacteria 8018163183 8018168942 298
704 iso_pu_bacteria 8018176218 8018178882 298
705 iso_pu_bacteria 8023680758 8023684322 298
706 iso_pu_bacteria 8024479707 8024480194 298
707 iso_pu_bacteria 8024486573 8024491492 298
708 iso_pu_bacteria 8024501048 8024501684 298
709 iso_pu_bacteria 8046767195 8046770783 298
710 iso_pu_bacteria 8049293176 8049293398 298
711 iso_pu_bacteria 8054460903 8054461241 298
712 iso_pu_bacteria 8054558443 8054562309 298
713 iso_pu_bacteria 8055431914 8055435669 298
714 iso_pu_bacteria 8056375014 8056375553 298
715 iso_pu_bacteria 8056382006 8056385867 298
716 iso_pu_bacteria 8056875544 8056878964 298
717 iso_pu_bacteria 8057575449 8057577755 298
718 iso_pu_bacteria 8057874678 8057875967 298
719 3300005331 Ga0070670_100000160 Ga0070670_10000016017 299
720 3300012490 Ga0157322_1000175 Ga0157322_10001752 299
721 3300025294 Ga0209025_1062770 Ga0209025_10627702 299
722 3300025304 Ga0209257_1015925 Ga0209257_10159252 299
723 3300028794 Ga0307515_10001309 Ga0307515_1000130914 299
724 3300031456 Ga0307513_10002360 Ga0307513_1000236012 299
725 3300031911 Ga0307412_10220245 Ga0307412_102202452 299
726 3300041404 Ga0439436_0019510 Ga0439436_0019510_859_1764 299
727 3300041413 Ga0439465_0005470 Ga0439465_0005470_2016_2921 299
728 3300041496 Ga0451839_0284469 Ga0451839_0284469_251_1150 299
729 3300041498 Ga0451841_0185773 Ga0451841_0185773_62_961 299
730 3300041501 Ga0451845_0485343 Ga0451845_0485343_31_930 299
731 3300041511 Ga0451855_0148620 Ga0451855_0148620_273_1172 299
732 3300042015 Ga0439462_0011190 Ga0439462_0011190_758_1663 299
733 3300042145 Ga0450906_006429 Ga0450906_006429_996_1901 299
734 3300042531 Ga0450918_003188 Ga0450918_003188_158_1063 299
735 3300046474 Ga0495605_0024665 Ga0495605_0024665_1260_2159 299
736 3300046476 Ga0495662_0031958 Ga0495662_0031958_921_1820 299
737 3300046507 Ga0495606_0002833 Ga0495606_0002833_6549_7454 299
738 3300046512 Ga0495610_0106832 Ga0495610_0106832_297_1196 299
739 3300046518 Ga0495631_0015169 Ga0495631_0015169_978_1877 299
740 3300046519 Ga0495632_0043000 Ga0495632_0043000_547_1446 299
741 3300046524 Ga0495648_0078617 Ga0495648_0078617_660_1559 299
742 3300046533 Ga0495640_0098569 Ga0495640_0098569_509_1408 299
743 3300046542 Ga0495597_0005914 Ga0495597_0005914_4658_5557 299
744 3300046557 Ga0495622_0043836 Ga0495622_0043836_76_975 299
745 3300046558 Ga0495633_0016323 Ga0495633_0016323_148_1047 299
746 3300046663 Ga0495635_0043983 Ga0495635_0043983_927_1826 299
747 3300046665 Ga0495661_0107348 Ga0495661_0107348_147_1046 299
748 3300046674 Ga0495588_0024360 Ga0495588_0024360_1124_2023 299
749 3300046675 Ga0495657_0087658 Ga0495657_0087658_732_1631 299
750 3300046683 Ga0495658_0125100 Ga0495658_0125100_421_1320 299
751 3300046691 Ga0495670_0110482 Ga0495670_0110482_319_1218 299
752 3300047317 Ga0495604_0113830 Ga0495604_0113830_724_1623 299
753 3300047323 Ga0495683_0144195 Ga0495683_0144195_154_1053 299
754 3300047443 Ga0495687_009034 Ga0495687_009034_3612_4511 299
755 3300047472 Ga0495686_0000458 Ga0495686_0000458_665_1564 299
756 3300047472 Ga0495686_0054506 Ga0495686_0054506_1096_1995 299
757 3300047472 Ga0495686_0194815 Ga0495686_0194815_111_1016 299
758 3300048924 Ga0496121_0012257 Ga0496121_0012257_1060_1965 299
759 3300049568 Ga0501031_0019562 Ga0501031_0019562_510_1415 299
760 3300049569 Ga0501032_0035214 Ga0501032_0035214_1906_2811 299
761 3300049570 Ga0501033_0008788 Ga0501033_0008788_783_1688 299
762 3300049571 Ga0501034_0116860 Ga0501034_0116860_1572_2477 299
763 3300049571 Ga0501034_0230224 Ga0501034_0230224_200_1105 299
764 3300049579 Ga0501043_0016875 Ga0501043_0016875_1429_2334 299
765 3300049823 Ga0501044_0089814 Ga0501044_0089814_1543_2448 299
766 3300053086 Ga0500578_0085656 Ga0500578_0085656_159_1058 299
767 3300053109 Ga0500569_014925 Ga0500569_014925_120_1019 299
768 3300053121 Ga0500607_099280 Ga0500607_099280_343_1248 299
769 3300053161 Ga0500634_0049992 Ga0500634_0049992_1218_2123 299
770 iso_pu_bacteria 2516143018 2516204414 299
771 3300001979 JGI24740J21852_10000016 JGI24740J21852_1000001620 300
772 3300002704 JGI25155J39150_1000157 JGI25155J39150_10001578 300
773 3300002705 JGI25156J39149_1000029 JGI25156J39149_10000298 300
774 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016916 300
775 3300002737 JGI25162J39368_1000508 JGI25162J39368_100050812 300
776 3300002738 JGI25154J39366_1000286 JGI25154J39366_10002868 300
777 3300002739 JGI25158J39367_1000022 JGI25158J39367_100002225 300
778 3300002741 JGI25157J39369_1000247 JGI25157J39369_10002478 300
779 3300002773 JGI25152J39213_1000754 JGI25152J39213_100075411 300
780 3300002773 JGI25152J39213_1006226 JGI25152J39213_10062263 300
781 3300002773 JGI25152J39213_1006373 JGI25152J39213_10063732 300
782 3300002773 JGI25152J39213_1007385 JGI25152J39213_10073853 300
783 3300002773 JGI25152J39213_1011673 JGI25152J39213_10116732 300
784 3300002774 JGI25150J39212_1000012 JGI25150J39212_10000129 300
785 3300002774 JGI25150J39212_1011391 JGI25150J39212_10113911 300
786 3300002987 JGI25159J45721_1000137 JGI25159J45721_100013711 300
787 3300002987 JGI25159J45721_1000730 JGI25159J45721_10007309 300
788 3300002987 JGI25159J45721_1003596 JGI25159J45721_10035966 300
789 3300003187 JGI25151J46595_10000025 JGI25151J46595_1000002549 300
790 3300003187 JGI25151J46595_10008949 JGI25151J46595_100089492 300
791 3300003187 JGI25151J46595_10014484 JGI25151J46595_100144845 300
792 3300003187 JGI25151J46595_10019714 JGI25151J46595_100197143 300
793 3300003187 JGI25151J46595_10020686 JGI25151J46595_100206862 300
794 3300003214 JGI25165J46597_1000355 JGI25165J46597_100035536 300
795 3300003214 JGI25165J46597_1000491 JGI25165J46597_100049111 300
796 3300003214 JGI25165J46597_1002805 JGI25165J46597_10028052 300
797 3300003215 JGI25153J46596_10001788 JGI25153J46596_1000178811 300
798 3300003215 JGI25153J46596_10005320 JGI25153J46596_100053202 300
799 3300003215 JGI25153J46596_10011406 JGI25153J46596_100114065 300
800 3300003215 JGI25153J46596_10014934 JGI25153J46596_100149342 300
801 3300003322 rootL2_10000316 rootL2_100003168 300
802 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003448 300
803 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004156 300
804 3300003354 JGI25160J50197_1004302 JGI25160J50197_10043023 300
805 3300003354 JGI25160J50197_1004984 JGI25160J50197_10049843 300
806 3300003354 JGI25160J50197_1008638 JGI25160J50197_10086384 300
807 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000256 300
808 3300003374 JGI25161J50226_1000143 JGI25161J50226_100014330 300
809 3300003374 JGI25161J50226_1000493 JGI25161J50226_100049311 300
810 3300003374 JGI25161J50226_1005407 JGI25161J50226_10054073 300
811 3300003752 Ga0055539_1007704 Ga0055539_10077041 300
812 3300003771 Ga0055526_1011121 Ga0055526_10111213 300
813 3300003771 Ga0055526_1015428 Ga0055526_10154283 300
814 3300003771 Ga0055526_1019108 Ga0055526_10191084 300
815 3300003771 Ga0055526_1030826 Ga0055526_10308262 300
816 3300003775 Ga0055524_1000776 Ga0055524_10007766 300
817 3300003775 Ga0055524_1013963 Ga0055524_10139632 300
818 3300003775 Ga0055524_1018649 Ga0055524_10186492 300
819 3300003775 Ga0055524_1021942 Ga0055524_10219422 300
820 3300003775 Ga0055524_1023588 Ga0055524_10235882 300
821 3300003781 Ga0055536_1003218 Ga0055536_100321810 300
822 3300003781 Ga0055536_1010563 Ga0055536_10105632 300
823 3300003790 Ga0055528_1000604 Ga0055528_100060429 300
824 3300003790 Ga0055528_1001318 Ga0055528_10013183 300
825 3300003790 Ga0055528_1007277 Ga0055528_10072773 300
826 3300003790 Ga0055528_1007971 Ga0055528_10079715 300
827 3300003790 Ga0055528_1020008 Ga0055528_10200082 300
828 3300003790 Ga0055528_1032103 Ga0055528_10321032 300
829 3300003791 Ga0055530_10023535 Ga0055530_100235352 300
830 3300003792 Ga0055540_1000249 Ga0055540_100024911 300
831 3300003792 Ga0055540_1001900 Ga0055540_10019006 300
832 3300003792 Ga0055540_1009280 Ga0055540_10092802 300
833 3300003792 Ga0055540_1011060 Ga0055540_10110602 300
834 3300003794 Ga0055531_10002859 Ga0055531_100028596 300
835 3300003856 Ga0058692_1000651 Ga0058692_100065113 300
836 3300003856 Ga0058692_1006563 Ga0058692_10065632 300
837 3300003856 Ga0058692_1013059 Ga0058692_10130592 300
838 3300004625 Ga0055543_1000008 Ga0055543_100000860 300
839 3300004625 Ga0055543_1000158 Ga0055543_100015838 300
840 3300004625 Ga0055543_1000263 Ga0055543_100026330 300
841 3300004625 Ga0055543_1002397 Ga0055543_10023974 300
842 3300005262 Ga0065165_1000031 Ga0065165_100003169 300
843 3300005262 Ga0065165_1000084 Ga0065165_1000084124 300
844 3300005262 Ga0065165_1032974 Ga0065165_10329742 300
845 3300005353 Ga0070669_100312902 Ga0070669_1003129022 300
846 3300005355 Ga0070671_100071497 Ga0070671_1000714971 300
847 3300005548 Ga0070665_100068975 Ga0070665_1000689752 300
848 3300005563 Ga0068855_100030372 Ga0068855_1000303726 300
849 3300005578 Ga0068854_100010614 Ga0068854_1000106142 300
850 3300005614 Ga0068856_100023203 Ga0068856_1000232036 300
851 3300005616 Ga0068852_100067238 Ga0068852_1000672383 300
852 3300005834 Ga0068851_10057716 Ga0068851_100577163 300
853 3300005937 Ga0081455_10120275 Ga0081455_101202751 300
854 3300006038 Ga0075365_10002780 Ga0075365_100027803 300
855 3300006038 Ga0075365_10073691 Ga0075365_100736913 300
856 3300006042 Ga0075368_10033956 Ga0075368_100339562 300
857 3300006051 Ga0075364_10001052 Ga0075364_1000105214 300
858 3300006177 Ga0075362_10049289 Ga0075362_100492893 300
859 3300006178 Ga0075367_10020506 Ga0075367_100205063 300
860 3300006178 Ga0075367_10078712 Ga0075367_100787122 300
861 3300006186 Ga0075369_10008794 Ga0075369_100087943 300
862 3300006186 Ga0075369_10026093 Ga0075369_100260933 300
863 3300006195 Ga0075366_10007690 Ga0075366_100076906 300
864 3300006353 Ga0075370_10046246 Ga0075370_100462462 300
865 3300006353 Ga0075370_10081184 Ga0075370_100811842 300
866 3300006946 Ga0079104_1000452 Ga0079104_100045223 300
867 3300006948 Ga0099826_10000109 Ga0099826_100001097 300
868 3300006948 Ga0099826_10052386 Ga0099826_100523862 300
869 3300009011 Ga0105251_10049597 Ga0105251_100495973 300
870 3300009093 Ga0105240_10000460 Ga0105240_1000046030 300
871 3300009148 Ga0105243_10189748 Ga0105243_101897482 300
872 3300009545 Ga0105237_10000814 Ga0105237_1000081430 300
873 3300009765 Ga0123341_1000040 Ga0123341_100004023 300
874 3300009766 Ga0123342_1014285 Ga0123342_10142852 300
875 3300009766 Ga0123342_1024557 Ga0123342_10245574 300
876 3300010375 Ga0105239_10000961 Ga0105239_1000096130 300
877 3300013100 Ga0157373_10000975 Ga0157373_100009753 300
878 3300013100 Ga0157373_10003509 Ga0157373_100035099 300
879 3300013102 Ga0157371_10000004 Ga0157371_10000004406 300
880 3300013104 Ga0157370_10000185 Ga0157370_1000018529 300
881 3300013104 Ga0157370_10000952 Ga0157370_1000095214 300
882 3300013104 Ga0157370_10075698 Ga0157370_100756982 300
883 3300013105 Ga0157369_10284036 Ga0157369_102840362 300
884 3300013249 Ga0171463_1001 Ga0171463_1001773 300
885 3300014497 Ga0182008_10027245 Ga0182008_100272453 300
886 3300015262 Ga0182007_10000689 Ga0182007_1000068921 300
887 3300015265 Ga0182005_1006222 Ga0182005_10062223 300
888 3300015690 Ga0183363_1032 Ga0183363_103231 300
889 3300017792 Ga0163161_10142209 Ga0163161_101422092 300
890 3300021320 Ga0214544_1000012 Ga0214544_100001271 300
891 3300021321 Ga0214542_1000011 Ga0214542_100001165 300
892 3300021321 Ga0214542_1015274 Ga0214542_10152743 300
893 3300021327 Ga0214543_1000004 Ga0214543_1000004435 300
894 3300021327 Ga0214543_1000259 Ga0214543_100025936 300
895 3300025206 Ga0209435_100011 Ga0209435_100011402 300
896 3300025208 Ga0209436_100461 Ga0209436_10046115 300
897 3300025228 Ga0209672_104444 Ga0209672_1044442 300
898 3300025230 Ga0209563_101710 Ga0209563_1017103 300
899 3300025233 Ga0209437_100056 Ga0209437_10005654 300
900 3300025233 Ga0209437_100196 Ga0209437_10019657 300
901 3300025245 Ga0207425_1000012 Ga0207425_1000012212 300
902 3300025245 Ga0207425_1002334 Ga0207425_10023346 300
903 3300025245 Ga0207425_1010306 Ga0207425_10103063 300
904 3300025246 Ga0209646_1000024 Ga0209646_10000248 300
905 3300025250 Ga0209026_1000030 Ga0209026_10000308 300
906 3300025253 Ga0209677_100765 Ga0209677_1007653 300
907 3300025254 Ga0209148_1005457 Ga0209148_10054572 300
908 3300025256 Ga0209759_1000011 Ga0209759_1000011402 300
909 3300025258 Ga0209129_1000081 Ga0209129_1000081149 300
910 3300025258 Ga0209129_1000105 Ga0209129_1000105166 300
911 3300025258 Ga0209129_1001073 Ga0209129_10010733 300
912 3300025258 Ga0209129_1001589 Ga0209129_100158912 300
913 3300025258 Ga0209129_1001943 Ga0209129_100194310 300
914 3300025258 Ga0209129_1005767 Ga0209129_10057673 300
915 3300025258 Ga0209129_1008820 Ga0209129_10088203 300
916 3300025261 Ga0209233_1000037 Ga0209233_1000037505 300
917 3300025261 Ga0209233_1000071 Ga0209233_100007154 300
918 3300025261 Ga0209233_1000243 Ga0209233_100024366 300
919 3300025273 Ga0209673_1000015 Ga0209673_1000015441 300
920 3300025273 Ga0209673_1000709 Ga0209673_100070913 300
921 3300025273 Ga0209673_1002913 Ga0209673_10029136 300
922 3300025273 Ga0209673_1003862 Ga0209673_10038626 300
923 3300025273 Ga0209673_1005381 Ga0209673_10053816 300
924 3300025273 Ga0209673_1006637 Ga0209673_10066376 300
925 3300025273 Ga0209673_1018802 Ga0209673_10188022 300
926 3300025284 Ga0209130_1000002 Ga0209130_1000002137 300
927 3300025284 Ga0209130_1000005 Ga0209130_100000528 300
928 3300025284 Ga0209130_1000088 Ga0209130_1000088134 300
929 3300025292 Ga0209676_1004283 Ga0209676_10042831 300
930 3300025294 Ga0209025_1000024 Ga0209025_1000024212 300
931 3300025294 Ga0209025_1000037 Ga0209025_1000037351 300
932 3300025294 Ga0209025_1000060 Ga0209025_1000060273 300
933 3300025294 Ga0209025_1000295 Ga0209025_100029582 300
934 3300025294 Ga0209025_1000574 Ga0209025_10005742 300
935 3300025294 Ga0209025_1004420 Ga0209025_100442014 300
936 3300025294 Ga0209025_1006666 Ga0209025_10066666 300
937 3300025294 Ga0209025_1021284 Ga0209025_10212844 300
938 3300025295 Ga0209564_1000093 Ga0209564_100009330 300
939 3300025295 Ga0209564_1000576 Ga0209564_100057612 300
940 3300025295 Ga0209564_1000744 Ga0209564_100074411 300
941 3300025295 Ga0209564_1003315 Ga0209564_10033156 300
942 3300025295 Ga0209564_1005971 Ga0209564_10059716 300
943 3300025295 Ga0209564_1022275 Ga0209564_10222752 300
944 3300025295 Ga0209564_1022639 Ga0209564_10226392 300
945 3300025295 Ga0209564_1030561 Ga0209564_10305613 300
946 3300025297 Ga0209758_1000046 Ga0209758_1000046330 300
947 3300025297 Ga0209758_1000441 Ga0209758_100044124 300
948 3300025297 Ga0209758_1000575 Ga0209758_100057510 300
949 3300025297 Ga0209758_1000810 Ga0209758_100081038 300
950 3300025297 Ga0209758_1001120 Ga0209758_100112031 300
951 3300025297 Ga0209758_1013969 Ga0209758_10139695 300
952 3300025297 Ga0209758_1015725 Ga0209758_10157253 300
953 3300025297 Ga0209758_1038113 Ga0209758_10381132 300
954 3300025298 Ga0209050_1005438 Ga0209050_10054385 300
955 3300025299 Ga0209256_1000027 Ga0209256_1000027392 300
956 3300025299 Ga0209256_1000646 Ga0209256_100064618 300
957 3300025299 Ga0209256_1003123 Ga0209256_10031237 300
958 3300025299 Ga0209256_1004089 Ga0209256_10040893 300
959 3300025299 Ga0209256_1004576 Ga0209256_10045768 300
960 3300025299 Ga0209256_1005525 Ga0209256_10055252 300
961 3300025299 Ga0209256_1006239 Ga0209256_10062392 300
962 3300025299 Ga0209256_1011971 Ga0209256_10119712 300
963 3300025299 Ga0209256_1018733 Ga0209256_10187332 300
964 3300025302 Ga0207426_1000012 Ga0207426_1000012189 300
965 3300025302 Ga0207426_1000013 Ga0207426_1000013137 300
966 3300025302 Ga0207426_1000015 Ga0207426_1000015571 300
967 3300025302 Ga0207426_1000063 Ga0207426_1000063305 300
968 3300025302 Ga0207426_1000172 Ga0207426_100017231 300
969 3300025302 Ga0207426_1001042 Ga0207426_10010429 300
970 3300025303 Ga0209051_1000435 Ga0209051_100043534 300
971 3300025303 Ga0209051_1001495 Ga0209051_100149516 300
972 3300025303 Ga0209051_1002059 Ga0209051_10020593 300
973 3300025303 Ga0209051_1013785 Ga0209051_10137853 300
974 3300025303 Ga0209051_1033792 Ga0209051_10337922 300
975 3300025303 Ga0209051_1033794 Ga0209051_10337942 300
976 3300025303 Ga0209051_1035257 Ga0209051_10352572 300
977 3300025304 Ga0209257_1000598 Ga0209257_100059838 300
978 3300025304 Ga0209257_1001343 Ga0209257_100134326 300
979 3300025913 Ga0207695_10000036 Ga0207695_1000003630 300
980 3300025914 Ga0207671_10000517 Ga0207671_1000051713 300
981 3300025925 Ga0207650_10000391 Ga0207650_1000039130 300
982 3300025931 Ga0207644_10054057 Ga0207644_100540572 300
983 3300025949 Ga0207667_10055436 Ga0207667_100554363 300
984 3300025981 Ga0207640_10009208 Ga0207640_100092082 300
985 3300026078 Ga0207702_10009604 Ga0207702_100096046 300
986 3300026142 Ga0207698_10033932 Ga0207698_100339323 300
987 3300027111 Ga0209281_1000200 Ga0209281_100020061 300
988 3300027111 Ga0209281_1000488 Ga0209281_100048838 300
989 3300027312 Ga0209371_1000009 Ga0209371_1000009521 300
990 3300027312 Ga0209371_1000315 Ga0209371_10003158 300
991 3300027312 Ga0209371_1000424 Ga0209371_10004246 300
992 3300027312 Ga0209371_1001877 Ga0209371_10018777 300
993 3300027666 Ga0209282_1002131 Ga0209282_10021319 300
994 3300027866 Ga0209813_10019163 Ga0209813_100191633 300
995 3300027866 Ga0209813_10020410 Ga0209813_100204102 300
996 3300028379 Ga0268266_10075692 Ga0268266_100756922 300
997 3300028794 Ga0307515_10001439 Ga0307515_1000143912 300
998 3300028794 Ga0307515_10048980 Ga0307515_100489806 300
999 3300030500 Ga0268256_1000010 Ga0268256_1000010520 300
1000 3300030500 Ga0268256_1001516 Ga0268256_10015168 300
1001 3300030500 Ga0268256_1003952 Ga0268256_10039524 300
1002 3300030745 Ga0316182_1324402 Ga0316182_13244022 300
1003 3300031456 Ga0307513_10013648 Ga0307513_100136488 300
1004 3300031548 Ga0307408_100031751 Ga0307408_1000317515 300
1005 3300031731 Ga0307405_10002866 Ga0307405_100028665 300
1006 3300031901 Ga0307406_10004188 Ga0307406_100041886 300
1007 3300032004 Ga0307414_10036914 Ga0307414_100369143 300
1008 3300032004 Ga0307414_10176721 Ga0307414_101767212 300
1009 3300041456 Ga0451795_1599653 Ga0451795_1599653_55_963 300
1010 3300042004 Ga0439445_0021883 Ga0439445_0021883_140_1048 300
1011 3300044694 Ga0466963_0082292 Ga0466963_0082292_1074_1982 300
1012 3300044735 Ga0466968_0106166 Ga0466968_0106166_199_1107 300
1013 3300046512 Ga0495610_0005023 Ga0495610_0005023_8035_8946 300
1014 3300046515 Ga0495620_0026059 Ga0495620_0026059_1086_1997 300
1015 3300046519 Ga0495632_0015112 Ga0495632_0015112_2721_3632 300
1016 3300046530 Ga0495654_0000321 Ga0495654_0000321_14466_15374 300
1017 3300046660 Ga0495625_0064844 Ga0495625_0064844_268_1176 300
1018 3300046674 Ga0495588_0000622 Ga0495588_0000622_15265_16173 300
1019 3300046692 Ga0495671_0052781 Ga0495671_0052781_16_924 300
1020 3300047470 Ga0495681_0002829 Ga0495681_0002829_7232_8140 300
1021 3300047472 Ga0495686_0039525 Ga0495686_0039525_672_1580 300
1022 3300048903 Ga0496100_0066239 Ga0496100_0066239_917_1825 300
1023 3300048905 Ga0496102_0007240 Ga0496102_0007240_627_1535 300
1024 3300048906 Ga0496103_0011291 Ga0496103_0011291_1739_2647 300
1025 3300048907 Ga0496104_0064887 Ga0496104_0064887_1181_2089 300
1026 3300048909 Ga0496106_0017682 Ga0496106_0017682_3533_4441 300
1027 3300048913 Ga0496110_0119904 Ga0496110_0119904_1345_2253 300
1028 3300048914 Ga0496111_0004636 Ga0496111_0004636_2648_3556 300
1029 3300048916 Ga0496113_0120442 Ga0496113_0120442_734_1642 300
1030 3300048919 Ga0496116_0010591 Ga0496116_0010591_4207_5115 300
1031 3300048919 Ga0496116_0034978 Ga0496116_0034978_633_1541 300
1032 3300048919 Ga0496116_0040518 Ga0496116_0040518_556_1467 300
1033 3300048919 Ga0496116_0049931 Ga0496116_0049931_1690_2601 300
1034 3300048919 Ga0496116_0056547 Ga0496116_0056547_1056_1967 300
1035 3300048919 Ga0496116_0164571 Ga0496116_0164571_110_1021 300
1036 3300048920 Ga0496117_0000002 Ga0496117_0000002_2048108_2049016 300
1037 3300048920 Ga0496117_0001791 Ga0496117_0001791_17489_18397 300
1038 3300048920 Ga0496117_0003238 Ga0496117_0003238_15452_16360 300
1039 3300048920 Ga0496117_0027534 Ga0496117_0027534_849_1760 300
1040 3300048920 Ga0496117_0048598 Ga0496117_0048598_1385_2293 300
1041 3300048920 Ga0496117_0060042 Ga0496117_0060042_1042_1953 300
1042 3300048921 Ga0496118_0001493 Ga0496118_0001493_16271_17179 300
1043 3300048921 Ga0496118_0006723 Ga0496118_0006723_11186_12094 300
1044 3300048921 Ga0496118_0007119 Ga0496118_0007119_658_1569 300
1045 3300048921 Ga0496118_0030242 Ga0496118_0030242_2520_3428 300
1046 3300048921 Ga0496118_0101278 Ga0496118_0101278_195_1103 300
1047 3300048923 Ga0496120_0000021 Ga0496120_0000021_17559_18467 300
1048 3300048924 Ga0496121_0001709 Ga0496121_0001709_2725_3633 300
1049 3300048924 Ga0496121_0002141 Ga0496121_0002141_10921_11829 300
1050 3300048924 Ga0496121_0012986 Ga0496121_0012986_996_1904 300
1051 3300048924 Ga0496121_0078597 Ga0496121_0078597_617_1525 300
1052 3300048924 Ga0496121_0081281 Ga0496121_0081281_1084_1995 300
1053 3300048924 Ga0496121_0103836 Ga0496121_0103836_1084_1995 300
1054 3300048925 Ga0496122_0000001 Ga0496122_0000001_1418898_1419806 300
1055 3300048925 Ga0496122_0000147 Ga0496122_0000147_105348_106256 300
1056 3300048925 Ga0496122_0001112 Ga0496122_0001112_22436_23344 300
1057 3300048925 Ga0496122_0004207 Ga0496122_0004207_11963_12874 300
1058 3300048925 Ga0496122_0013026 Ga0496122_0013026_4716_5624 300
1059 3300048925 Ga0496122_0047680 Ga0496122_0047680_1374_2282 300
1060 3300048925 Ga0496122_0053134 Ga0496122_0053134_1094_2002 300
1061 3300048925 Ga0496122_0064956 Ga0496122_0064956_1022_1933 300
1062 3300048926 Ga0496123_0000001 Ga0496123_0000001_1422629_1423537 300
1063 3300048926 Ga0496123_0000158 Ga0496123_0000158_107548_108456 300
1064 3300048926 Ga0496123_0000910 Ga0496123_0000910_23112_24020 300
1065 3300048926 Ga0496123_0060370 Ga0496123_0060370_804_1712 300
1066 3300048926 Ga0496123_0089386 Ga0496123_0089386_735_1646 300
1067 3300048926 Ga0496123_0124760 Ga0496123_0124760_62_973 300
1068 3300048927 Ga0496124_0000063 Ga0496124_0000063_185154_186062 300
1069 3300048927 Ga0496124_0000551 Ga0496124_0000551_14823_15731 300
1070 3300048927 Ga0496124_0008733 Ga0496124_0008733_1326_2234 300
1071 3300048927 Ga0496124_0021178 Ga0496124_0021178_2364_3272 300
1072 3300048927 Ga0496124_0037083 Ga0496124_0037083_1084_1995 300
1073 3300048927 Ga0496124_0049047 Ga0496124_0049047_1799_2710 300
1074 3300048927 Ga0496124_0050127 Ga0496124_0050127_1568_2476 300
1075 3300048927 Ga0496124_0060239 Ga0496124_0060239_2267_3175 300
1076 3300048927 Ga0496124_0168106 Ga0496124_0168106_18_929 300
1077 3300048927 Ga0496124_0186404 Ga0496124_0186404_43_951 300
1078 3300048927 Ga0496124_0260101 Ga0496124_0260101_340_1248 300
1079 3300048928 Ga0496125_0000981 Ga0496125_0000981_36823_37731 300
1080 3300048928 Ga0496125_0025057 Ga0496125_0025057_191_1102 300
1081 3300048928 Ga0496125_0029800 Ga0496125_0029800_3949_4857 300
1082 3300048928 Ga0496125_0032809 Ga0496125_0032809_1017_1925 300
1083 3300048928 Ga0496125_0055609 Ga0496125_0055609_1341_2252 300
1084 3300048929 Ga0496126_0000195 Ga0496126_0000195_27230_28138 300
1085 3300048929 Ga0496126_0015337 Ga0496126_0015337_1555_2463 300
1086 3300048929 Ga0496126_0052315 Ga0496126_0052315_668_1579 300
1087 3300048929 Ga0496126_0054690 Ga0496126_0054690_865_1773 300
1088 3300049570 Ga0501033_0000396 Ga0501033_0000396_17870_18778 300
1089 3300049571 Ga0501034_0252080 Ga0501034_0252080_476_1384 300
1090 3300049581 Ga0501047_0210632 Ga0501047_0210632_664_1575 300
1091 3300049584 Ga0501068_0100704 Ga0501068_0100704_365_1276 300
1092 3300049744 Ga0501083_0082272 Ga0501083_0082272_274_1185 300
1093 3300049822 Ga0501035_0000647 Ga0501035_0000647_13974_14882 300
1094 3300050490 nmdc:mga03n38_99294_c1 nmdc:mga03n38_99294_c1_166_1074 300
1095 3300050491 nmdc:mga00v17_39_c1 nmdc:mga00v17_39_c1_78316_79224 300
1096 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_19615_20523 300
1097 3300050492 nmdc:mga0yw44_35102_c1 nmdc:mga0yw44_35102_c1_311_1219 300
1098 3300050495 nmdc:mga04h51_1693_c1 nmdc:mga04h51_1693_c1_2491_3399 300
1099 3300050516 nmdc:mga0sz30_287_c1 nmdc:mga0sz30_287_c1_9713_10621 300
1100 3300050516 nmdc:mga0sz30_69478_c1 nmdc:mga0sz30_69478_c1_96_1004 300
1101 3300053107 Ga0500560_000754 Ga0500560_000754_3846_4754 300
1102 3300053107 Ga0500560_073441 Ga0500560_073441_210_1118 300
1103 3300053111 Ga0500572_003242 Ga0500572_003242_663_1571 300
1104 3300053125 Ga0500618_000119 Ga0500618_000119_29487_30395 300
1105 3300053125 Ga0500618_000359 Ga0500618_000359_29286_30194 300
1106 3300053137 Ga0500561_0000213 Ga0500561_0000213_7999_8907 300
1107 3300053139 Ga0500568_0008632 Ga0500568_0008632_716_1624 300
1108 3300053153 Ga0500616_0002986 Ga0500616_0002986_1465_2373 300
1109 3300053156 Ga0500622_0002012 Ga0500622_0002012_1011_1922 300
1110 3300053177 Ga0500636_0000006 Ga0500636_0000006_128412_129320 300
1111 3300053177 Ga0500636_0075104 Ga0500636_0075104_397_1305 300
1112 3300060353 Ga0501082_0072834 Ga0501082_0072834_1219_2130 300
1113 iso_pu_bacteria 2643221582 2643918320 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01739

CheR

CheR methyltransferase, SAM binding domain

100

298

0.97

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

33

85

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.8812 16 291
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.875 16 291
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8685 94 291
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8522 94 291
7phf-assembly1.cif.gz_B chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8309 225 267
ID Description Score Start End Superfamily
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.9014 16 90 1.10.155.10
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9011 92 291 3.40.50.150
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8901 16 90 1.10.155.10
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8877 92 291 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8755 91 291 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W6J3H2-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9833 6 295 GO:0008983
GO:0032259
AF-A0A357RVJ2-F1-model_v4 deleted 0.9825 205 291
AF-A0A512HDE6-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9796 1 295 GO:0008983
GO:0032259
AF-A0A7W6Q8U9-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9768 2 300 GO:0008983
GO:0032259
AF-A0A7W5PJU2-F1-model_v4 deleted 0.9763 2 300

Feature Viewer

pLDDT pTM Quality
92.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map